(data stored in SCRATCH3701 zone)

EMBL: CP002013

ID   CP002013; SV 1; circular; genomic DNA; STD; PRO; 3518940 BP.
XX
AC   CP002013; ADCC01000000-ADCC01000119;
XX
PR   Project:PRJNA37719;
XX
DT   03-MAY-2010 (Rel. 104, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Burkholderia sp. CCGE1002 chromosome 1, complete sequence.
XX
KW   .
XX
OS   Paraburkholderia sp. CCGE1002
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Paraburkholderia.
XX
RN   [1]
RP   1-3518940
RX   PUBMED; 23209196.
RA   Ormeno-Orrillo E., Rogel M.A., Chueire L.M., Tiedje J.M.,
RA   Martinez-Romero E., Hungria M.;
RT   "Genome Sequences of Burkholderia sp. Strains CCGE1002 and H160, Isolated
RT   from Legume Nodules in Mexico and Brazil";
RL   J. Bacteriol. 194(24):6927-6927(2012).
XX
RN   [2]
RP   1-3518940
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Kyrpides N., Ovchinnikova G., Martinez-Romero E., Hernandez M.A.R.,
RA   Tiedje J.M., Woyke T.;
RT   "Complete sequence of chromosome 1 of Burkholderia sp. CCGE1002";
RL   Unpublished.
XX
RN   [3]
RP   1-3518940
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Kyrpides N., Ovchinnikova G., Martinez-Romero E., Hernandez M.A.R.,
RA   Tiedje J.M., Woyke T.;
RT   ;
RL   Submitted (19-APR-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; e8b7f569bbb4bbf9e203ebd73331bb21.
DR   BioSample; SAMN02598517.
DR   EnsemblGenomes-Gn; BC1002_R0001.
DR   EnsemblGenomes-Gn; BC1002_R0002.
DR   EnsemblGenomes-Gn; BC1002_R0003.
DR   EnsemblGenomes-Gn; BC1002_R0004.
DR   EnsemblGenomes-Gn; BC1002_R0005.
DR   EnsemblGenomes-Gn; BC1002_R0006.
DR   EnsemblGenomes-Gn; BC1002_R0007.
DR   EnsemblGenomes-Gn; BC1002_R0008.
DR   EnsemblGenomes-Gn; BC1002_R0009.
DR   EnsemblGenomes-Gn; BC1002_R0010.
DR   EnsemblGenomes-Gn; BC1002_R0011.
DR   EnsemblGenomes-Gn; BC1002_R0012.
DR   EnsemblGenomes-Gn; BC1002_R0013.
DR   EnsemblGenomes-Gn; BC1002_R0014.
DR   EnsemblGenomes-Gn; BC1002_R0015.
DR   EnsemblGenomes-Gn; BC1002_R0016.
DR   EnsemblGenomes-Gn; BC1002_R0017.
DR   EnsemblGenomes-Gn; BC1002_R0018.
DR   EnsemblGenomes-Gn; BC1002_R0019.
DR   EnsemblGenomes-Gn; BC1002_R0020.
DR   EnsemblGenomes-Gn; BC1002_R0021.
DR   EnsemblGenomes-Gn; BC1002_R0022.
DR   EnsemblGenomes-Gn; BC1002_R0023.
DR   EnsemblGenomes-Gn; BC1002_R0024.
DR   EnsemblGenomes-Gn; BC1002_R0025.
DR   EnsemblGenomes-Gn; BC1002_R0026.
DR   EnsemblGenomes-Gn; BC1002_R0027.
DR   EnsemblGenomes-Gn; BC1002_R0028.
DR   EnsemblGenomes-Gn; BC1002_R0029.
DR   EnsemblGenomes-Gn; BC1002_R0030.
DR   EnsemblGenomes-Gn; BC1002_R0031.
DR   EnsemblGenomes-Gn; BC1002_R0032.
DR   EnsemblGenomes-Gn; BC1002_R0033.
DR   EnsemblGenomes-Gn; BC1002_R0034.
DR   EnsemblGenomes-Gn; BC1002_R0035.
DR   EnsemblGenomes-Gn; BC1002_R0036.
DR   EnsemblGenomes-Gn; BC1002_R0037.
DR   EnsemblGenomes-Gn; BC1002_R0038.
DR   EnsemblGenomes-Gn; BC1002_R0039.
DR   EnsemblGenomes-Gn; BC1002_R0040.
DR   EnsemblGenomes-Gn; BC1002_R0041.
DR   EnsemblGenomes-Gn; BC1002_R0042.
DR   EnsemblGenomes-Gn; BC1002_R0043.
DR   EnsemblGenomes-Gn; BC1002_R0044.
DR   EnsemblGenomes-Gn; BC1002_R0045.
DR   EnsemblGenomes-Gn; BC1002_R0046.
DR   EnsemblGenomes-Gn; BC1002_R0047.
DR   EnsemblGenomes-Gn; BC1002_R0048.
DR   EnsemblGenomes-Gn; BC1002_R0049.
DR   EnsemblGenomes-Gn; BC1002_R0050.
DR   EnsemblGenomes-Gn; BC1002_R0051.
DR   EnsemblGenomes-Gn; BC1002_R0052.
DR   EnsemblGenomes-Gn; BC1002_R0053.
DR   EnsemblGenomes-Gn; BC1002_R0054.
DR   EnsemblGenomes-Gn; BC1002_R0055.
DR   EnsemblGenomes-Gn; BC1002_R0056.
DR   EnsemblGenomes-Gn; BC1002_R0057.
DR   EnsemblGenomes-Gn; BC1002_R0058.
DR   EnsemblGenomes-Gn; BC1002_R0059.
DR   EnsemblGenomes-Gn; BC1002_R0060.
DR   EnsemblGenomes-Gn; BC1002_R0061.
DR   EnsemblGenomes-Gn; BC1002_R0062.
DR   EnsemblGenomes-Gn; BC1002_R0063.
DR   EnsemblGenomes-Gn; BC1002_R0064.
DR   EnsemblGenomes-Gn; BC1002_R0065.
DR   EnsemblGenomes-Gn; BC1002_R0066.
DR   EnsemblGenomes-Gn; BC1002_R0067.
DR   EnsemblGenomes-Gn; BC1002_R0068.
DR   EnsemblGenomes-Gn; BC1002_R0069.
DR   EnsemblGenomes-Gn; EBG00001135337.
DR   EnsemblGenomes-Gn; EBG00001135338.
DR   EnsemblGenomes-Gn; EBG00001135339.
DR   EnsemblGenomes-Gn; EBG00001135340.
DR   EnsemblGenomes-Gn; EBG00001135341.
DR   EnsemblGenomes-Gn; EBG00001135342.
DR   EnsemblGenomes-Gn; EBG00001135343.
DR   EnsemblGenomes-Gn; EBG00001135344.
DR   EnsemblGenomes-Gn; EBG00001135345.
DR   EnsemblGenomes-Gn; EBG00001135346.
DR   EnsemblGenomes-Gn; EBG00001135347.
DR   EnsemblGenomes-Gn; EBG00001135348.
DR   EnsemblGenomes-Gn; EBG00001135349.
DR   EnsemblGenomes-Gn; EBG00001135350.
DR   EnsemblGenomes-Gn; EBG00001135351.
DR   EnsemblGenomes-Gn; EBG00001135352.
DR   EnsemblGenomes-Gn; EBG00001135353.
DR   EnsemblGenomes-Gn; EBG00001135354.
DR   EnsemblGenomes-Gn; EBG00001135355.
DR   EnsemblGenomes-Gn; EBG00001135356.
DR   EnsemblGenomes-Gn; EBG00001135357.
DR   EnsemblGenomes-Gn; EBG00001135358.
DR   EnsemblGenomes-Gn; EBG00001135359.
DR   EnsemblGenomes-Gn; EBG00001135360.
DR   EnsemblGenomes-Gn; EBG00001135361.
DR   EnsemblGenomes-Gn; EBG00001135362.
DR   EnsemblGenomes-Gn; EBG00001135363.
DR   EnsemblGenomes-Gn; EBG00001135364.
DR   EnsemblGenomes-Gn; EBG00001135365.
DR   EnsemblGenomes-Gn; EBG00001135366.
DR   EnsemblGenomes-Gn; EBG00001135367.
DR   EnsemblGenomes-Gn; EBG00001135368.
DR   EnsemblGenomes-Gn; EBG00001135369.
DR   EnsemblGenomes-Gn; EBG00001135370.
DR   EnsemblGenomes-Gn; EBG00001135371.
DR   EnsemblGenomes-Gn; EBG00001135372.
DR   EnsemblGenomes-Gn; EBG00001135373.
DR   EnsemblGenomes-Gn; EBG00001135374.
DR   EnsemblGenomes-Gn; EBG00001135375.
DR   EnsemblGenomes-Gn; EBG00001135376.
DR   EnsemblGenomes-Gn; EBG00001135377.
DR   EnsemblGenomes-Gn; EBG00001135378.
DR   EnsemblGenomes-Gn; EBG00001135379.
DR   EnsemblGenomes-Gn; EBG00001135380.
DR   EnsemblGenomes-Gn; EBG00001135381.
DR   EnsemblGenomes-Gn; EBG00001135382.
DR   EnsemblGenomes-Gn; EBG00001135383.
DR   EnsemblGenomes-Gn; EBG00001135384.
DR   EnsemblGenomes-Gn; EBG00001135385.
DR   EnsemblGenomes-Gn; EBG00001135386.
DR   EnsemblGenomes-Gn; EBG00001135387.
DR   EnsemblGenomes-Gn; EBG00001135388.
DR   EnsemblGenomes-Gn; EBG00001135389.
DR   EnsemblGenomes-Gn; EBG00001135390.
DR   EnsemblGenomes-Gn; EBG00001135391.
DR   EnsemblGenomes-Gn; EBG00001135392.
DR   EnsemblGenomes-Gn; EBG00001135393.
DR   EnsemblGenomes-Gn; EBG00001135394.
DR   EnsemblGenomes-Gn; EBG00001135395.
DR   EnsemblGenomes-Gn; EBG00001135396.
DR   EnsemblGenomes-Gn; EBG00001135397.
DR   EnsemblGenomes-Gn; EBG00001135398.
DR   EnsemblGenomes-Gn; EBG00001135399.
DR   EnsemblGenomes-Gn; EBG00001135400.
DR   EnsemblGenomes-Gn; EBG00001135401.
DR   EnsemblGenomes-Gn; EBG00001135402.
DR   EnsemblGenomes-Gn; EBG00001135403.
DR   EnsemblGenomes-Gn; EBG00001135404.
DR   EnsemblGenomes-Gn; EBG00001135405.
DR   EnsemblGenomes-Gn; EBG00001135406.
DR   EnsemblGenomes-Gn; EBG00001135407.
DR   EnsemblGenomes-Gn; EBG00001135408.
DR   EnsemblGenomes-Gn; EBG00001135409.
DR   EnsemblGenomes-Gn; EBG00001135410.
DR   EnsemblGenomes-Gn; EBG00001135411.
DR   EnsemblGenomes-Gn; EBG00001135412.
DR   EnsemblGenomes-Gn; EBG00001135413.
DR   EnsemblGenomes-Gn; EBG00001135414.
DR   EnsemblGenomes-Gn; EBG00001135415.
DR   EnsemblGenomes-Gn; EBG00001135416.
DR   EnsemblGenomes-Gn; EBG00001135417.
DR   EnsemblGenomes-Gn; EBG00001135418.
DR   EnsemblGenomes-Gn; EBG00001135419.
DR   EnsemblGenomes-Gn; EBG00001135420.
DR   EnsemblGenomes-Gn; EBG00001135421.
DR   EnsemblGenomes-Tr; BC1002_R0001-1.
DR   EnsemblGenomes-Tr; BC1002_R0002-1.
DR   EnsemblGenomes-Tr; BC1002_R0003-1.
DR   EnsemblGenomes-Tr; BC1002_R0004-1.
DR   EnsemblGenomes-Tr; BC1002_R0005-1.
DR   EnsemblGenomes-Tr; BC1002_R0006-1.
DR   EnsemblGenomes-Tr; BC1002_R0007-1.
DR   EnsemblGenomes-Tr; BC1002_R0008-1.
DR   EnsemblGenomes-Tr; BC1002_R0009-1.
DR   EnsemblGenomes-Tr; BC1002_R0010-1.
DR   EnsemblGenomes-Tr; BC1002_R0011-1.
DR   EnsemblGenomes-Tr; BC1002_R0012-1.
DR   EnsemblGenomes-Tr; BC1002_R0013-1.
DR   EnsemblGenomes-Tr; BC1002_R0014-1.
DR   EnsemblGenomes-Tr; BC1002_R0015-1.
DR   EnsemblGenomes-Tr; BC1002_R0016-1.
DR   EnsemblGenomes-Tr; BC1002_R0017-1.
DR   EnsemblGenomes-Tr; BC1002_R0018-1.
DR   EnsemblGenomes-Tr; BC1002_R0019-1.
DR   EnsemblGenomes-Tr; BC1002_R0020-1.
DR   EnsemblGenomes-Tr; BC1002_R0021-1.
DR   EnsemblGenomes-Tr; BC1002_R0022-1.
DR   EnsemblGenomes-Tr; BC1002_R0023-1.
DR   EnsemblGenomes-Tr; BC1002_R0024-1.
DR   EnsemblGenomes-Tr; BC1002_R0025-1.
DR   EnsemblGenomes-Tr; BC1002_R0026-1.
DR   EnsemblGenomes-Tr; BC1002_R0027-1.
DR   EnsemblGenomes-Tr; BC1002_R0028-1.
DR   EnsemblGenomes-Tr; BC1002_R0029-1.
DR   EnsemblGenomes-Tr; BC1002_R0030-1.
DR   EnsemblGenomes-Tr; BC1002_R0031-1.
DR   EnsemblGenomes-Tr; BC1002_R0032-1.
DR   EnsemblGenomes-Tr; BC1002_R0033-1.
DR   EnsemblGenomes-Tr; BC1002_R0034-1.
DR   EnsemblGenomes-Tr; BC1002_R0035-1.
DR   EnsemblGenomes-Tr; BC1002_R0036-1.
DR   EnsemblGenomes-Tr; BC1002_R0037-1.
DR   EnsemblGenomes-Tr; BC1002_R0038-1.
DR   EnsemblGenomes-Tr; BC1002_R0039-1.
DR   EnsemblGenomes-Tr; BC1002_R0040-1.
DR   EnsemblGenomes-Tr; BC1002_R0041-1.
DR   EnsemblGenomes-Tr; BC1002_R0042-1.
DR   EnsemblGenomes-Tr; BC1002_R0043-1.
DR   EnsemblGenomes-Tr; BC1002_R0044-1.
DR   EnsemblGenomes-Tr; BC1002_R0045-1.
DR   EnsemblGenomes-Tr; BC1002_R0046-1.
DR   EnsemblGenomes-Tr; BC1002_R0047-1.
DR   EnsemblGenomes-Tr; BC1002_R0048-1.
DR   EnsemblGenomes-Tr; BC1002_R0049-1.
DR   EnsemblGenomes-Tr; BC1002_R0050-1.
DR   EnsemblGenomes-Tr; BC1002_R0051-1.
DR   EnsemblGenomes-Tr; BC1002_R0052-1.
DR   EnsemblGenomes-Tr; BC1002_R0053-1.
DR   EnsemblGenomes-Tr; BC1002_R0054-1.
DR   EnsemblGenomes-Tr; BC1002_R0055-1.
DR   EnsemblGenomes-Tr; BC1002_R0056-1.
DR   EnsemblGenomes-Tr; BC1002_R0057-1.
DR   EnsemblGenomes-Tr; BC1002_R0058-1.
DR   EnsemblGenomes-Tr; BC1002_R0059-1.
DR   EnsemblGenomes-Tr; BC1002_R0060-1.
DR   EnsemblGenomes-Tr; BC1002_R0061-1.
DR   EnsemblGenomes-Tr; BC1002_R0062-1.
DR   EnsemblGenomes-Tr; BC1002_R0063-1.
DR   EnsemblGenomes-Tr; BC1002_R0064-1.
DR   EnsemblGenomes-Tr; BC1002_R0065-1.
DR   EnsemblGenomes-Tr; BC1002_R0066-1.
DR   EnsemblGenomes-Tr; BC1002_R0067-1.
DR   EnsemblGenomes-Tr; BC1002_R0068-1.
DR   EnsemblGenomes-Tr; BC1002_R0069-1.
DR   EnsemblGenomes-Tr; EBT00001726648.
DR   EnsemblGenomes-Tr; EBT00001726649.
DR   EnsemblGenomes-Tr; EBT00001726650.
DR   EnsemblGenomes-Tr; EBT00001726651.
DR   EnsemblGenomes-Tr; EBT00001726652.
DR   EnsemblGenomes-Tr; EBT00001726653.
DR   EnsemblGenomes-Tr; EBT00001726654.
DR   EnsemblGenomes-Tr; EBT00001726655.
DR   EnsemblGenomes-Tr; EBT00001726656.
DR   EnsemblGenomes-Tr; EBT00001726657.
DR   EnsemblGenomes-Tr; EBT00001726658.
DR   EnsemblGenomes-Tr; EBT00001726659.
DR   EnsemblGenomes-Tr; EBT00001726660.
DR   EnsemblGenomes-Tr; EBT00001726661.
DR   EnsemblGenomes-Tr; EBT00001726662.
DR   EnsemblGenomes-Tr; EBT00001726663.
DR   EnsemblGenomes-Tr; EBT00001726664.
DR   EnsemblGenomes-Tr; EBT00001726665.
DR   EnsemblGenomes-Tr; EBT00001726666.
DR   EnsemblGenomes-Tr; EBT00001726667.
DR   EnsemblGenomes-Tr; EBT00001726668.
DR   EnsemblGenomes-Tr; EBT00001726669.
DR   EnsemblGenomes-Tr; EBT00001726670.
DR   EnsemblGenomes-Tr; EBT00001726671.
DR   EnsemblGenomes-Tr; EBT00001726672.
DR   EnsemblGenomes-Tr; EBT00001726673.
DR   EnsemblGenomes-Tr; EBT00001726674.
DR   EnsemblGenomes-Tr; EBT00001726675.
DR   EnsemblGenomes-Tr; EBT00001726676.
DR   EnsemblGenomes-Tr; EBT00001726677.
DR   EnsemblGenomes-Tr; EBT00001726678.
DR   EnsemblGenomes-Tr; EBT00001726679.
DR   EnsemblGenomes-Tr; EBT00001726680.
DR   EnsemblGenomes-Tr; EBT00001726681.
DR   EnsemblGenomes-Tr; EBT00001726682.
DR   EnsemblGenomes-Tr; EBT00001726683.
DR   EnsemblGenomes-Tr; EBT00001726684.
DR   EnsemblGenomes-Tr; EBT00001726685.
DR   EnsemblGenomes-Tr; EBT00001726686.
DR   EnsemblGenomes-Tr; EBT00001726687.
DR   EnsemblGenomes-Tr; EBT00001726688.
DR   EnsemblGenomes-Tr; EBT00001726689.
DR   EnsemblGenomes-Tr; EBT00001726690.
DR   EnsemblGenomes-Tr; EBT00001726691.
DR   EnsemblGenomes-Tr; EBT00001726692.
DR   EnsemblGenomes-Tr; EBT00001726693.
DR   EnsemblGenomes-Tr; EBT00001726694.
DR   EnsemblGenomes-Tr; EBT00001726695.
DR   EnsemblGenomes-Tr; EBT00001726696.
DR   EnsemblGenomes-Tr; EBT00001726697.
DR   EnsemblGenomes-Tr; EBT00001726698.
DR   EnsemblGenomes-Tr; EBT00001726699.
DR   EnsemblGenomes-Tr; EBT00001726700.
DR   EnsemblGenomes-Tr; EBT00001726701.
DR   EnsemblGenomes-Tr; EBT00001726702.
DR   EnsemblGenomes-Tr; EBT00001726703.
DR   EnsemblGenomes-Tr; EBT00001726704.
DR   EnsemblGenomes-Tr; EBT00001726705.
DR   EnsemblGenomes-Tr; EBT00001726706.
DR   EnsemblGenomes-Tr; EBT00001726707.
DR   EnsemblGenomes-Tr; EBT00001726708.
DR   EnsemblGenomes-Tr; EBT00001726709.
DR   EnsemblGenomes-Tr; EBT00001726710.
DR   EnsemblGenomes-Tr; EBT00001726711.
DR   EnsemblGenomes-Tr; EBT00001726712.
DR   EnsemblGenomes-Tr; EBT00001726713.
DR   EnsemblGenomes-Tr; EBT00001726714.
DR   EnsemblGenomes-Tr; EBT00001726715.
DR   EnsemblGenomes-Tr; EBT00001726716.
DR   EnsemblGenomes-Tr; EBT00001726717.
DR   EnsemblGenomes-Tr; EBT00001726718.
DR   EnsemblGenomes-Tr; EBT00001726719.
DR   EnsemblGenomes-Tr; EBT00001726720.
DR   EnsemblGenomes-Tr; EBT00001726721.
DR   EnsemblGenomes-Tr; EBT00001726722.
DR   EnsemblGenomes-Tr; EBT00001726723.
DR   EnsemblGenomes-Tr; EBT00001726724.
DR   EnsemblGenomes-Tr; EBT00001726725.
DR   EnsemblGenomes-Tr; EBT00001726726.
DR   EnsemblGenomes-Tr; EBT00001726727.
DR   EnsemblGenomes-Tr; EBT00001726728.
DR   EnsemblGenomes-Tr; EBT00001726729.
DR   EnsemblGenomes-Tr; EBT00001726730.
DR   EnsemblGenomes-Tr; EBT00001726731.
DR   EnsemblGenomes-Tr; EBT00001726732.
DR   EuropePMC; PMC3510596; 23209196.
DR   EuropePMC; PMC5367793; 28373958.
DR   EuropePMC; PMC6315756; 30545132.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00624; P9.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP002013.
DR   SILVA-SSU; CP002013.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085555
CC   Source DNA and organism available from Esperanza Martinez-Romero
CC   (Centro de Ciencias Genomicas--http://ccg.unam.mx)
CC   Contacts: James M. Tiedje (tiedjej@msu.edu)
CC        Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Burkholderia sp. CCGE1002 is a mimosa occidentalis nodule isolate
CC   from Nayarit, Tepic, Mexico. Site of isolation is Latitude: 21.604,
CC   Longitude: -104.952. Additionally, it forms nodules in Phaseolus
CC   vulgaris beans. It contributes to Nitrogen fixation and CO2
CC   fixation in the tropics.
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Burkholderia sp. CCGE1002
CC   GOLD Stamp ID         :: Gi03922
CC   Oxygen Requirement    :: Facultative
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Habitat               :: Host, Rhizosphere, Rhizosphere-colonizing
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3518940
FT                   /organism="Paraburkholderia sp. CCGE1002"
FT                   /chromosome="1"
FT                   /strain="CCGE1002"
FT                   /mol_type="genomic DNA"
FT                   /country="Mexico:Nayarit, Tepic"
FT                   /lat_lon="21.6 N 104.95 W"
FT                   /db_xref="taxon:640511"
FT   gene            363..1961
FT                   /locus_tag="BC1002_0001"
FT   CDS_pept        363..1961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   bxe:Bxe_A4462 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14115"
FT                   /db_xref="GOA:D5W9C3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9C3"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADG14115.1"
FT                   /translation="MNEFWQHCSALLERELTPQQYVTWIKPLAPVAFDADANTLSIAAP
FT                   NRFKLDWVKSQFSGRIADMARDFWHAPVDVQFVLDPKAGMRGPAAAAPAPSSARPASTA
FT                   PQGGNAGGVAAVDAAVGAVQAAHAARANPAAAAAALAAQSANPRSAAEDAADLDLPSLD
FT                   ANEAAAGRRTWRPGQGAGAAATSESDSMYERSKLNPVLTFDNFVTGKANQLARAAAIQV
FT                   ADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLMDKPGARIRYIHAEQYVSDVVKAYQR
FT                   KAFDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEI
FT                   SGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEFVSLNEDVAFFVAKHLRSNVR
FT                   ELEGALRKILAYSKFHGREITIELTKEALKDLLTVQNRQISVENIQKTVADFYSIKVAD
FT                   MYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDA
FT                   QLNHELHVLEQTLKG"
FT   gene            2447..3550
FT                   /locus_tag="BC1002_0002"
FT   CDS_pept        2447..3550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: bpy:Bphyt_0002 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14116"
FT                   /db_xref="GOA:D5W9C4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9C4"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADG14116.1"
FT                   /translation="MQLVKTERDNLLRPLQTVSGIVERRHTLPILANLLITKNGPDVSF
FT                   LSTDLELQITTRADFGVGGDSVATTVAARKLLDILRAMPDGQVTLTLNDKRLTVQSGKS
FT                   RFALQTLAADEFPTVAQAKDYGASLVVPQKTFRQLLGMVHFSMAQQDIRYYLNGMLLVV
FT                   DGDQLMAVATDGHRLAFSSMKIEGSFARQEVIIPRKTILELQRLLEDIDDTLNIDIAQT
FT                   QVKFTFGQVELVSKLVEGKFPDFQRVIPKSHKNKFQIGREELQRSLQRAAILTSDKFKG
FT                   VRCIVEPGQLKIMSTNADQEEAQEELEIAYDGDSVDIGFNVTYLLDVLANLKVDMLQVS
FT                   LGDASSSALITIPENDEFKYVVMPMRI"
FT   gene            3665..6136
FT                   /locus_tag="BC1002_0003"
FT   CDS_pept        3665..6136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0003"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: bxe:Bxe_A4460 DNA gyrase subunit B; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM domain
FT                   protein; DNA gyrase subunit B domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14117"
FT                   /db_xref="GOA:D5W9C5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9C5"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADG14117.1"
FT                   /translation="MTDMNNTQPDNSYGASSIQILEGLEAVRKRPGMYIGDTSDGTGLH
FT                   HLVFEVLDNSIDEALAGHCNDIQVIIHADNSVSITDNGRGVPTGLKMDDKHDPKRSAAE
FT                   IVMTELHAGGKFDQNSYKVSGGLHGVGVSCVNALSAWLRLTVRRDGKKHFMEFHRGVPQ
FT                   NRVLEEIDGVVTSPMPVIGDTENRGTEVHFMADETIFGNVEYHYDILAKRIRELSFLNN
FT                   GVRIRLLDQRSGKEEDFAFVGGVKGFVEYINKNKSVLHPNIFHIMGEKDGVGVEVAMQW
FT                   NDSYNENVLCFTNNIPQRDGGTHLTGLRAAMTRVLNKYIADHEVAKKAKVETSGDDMRE
FT                   GLSCVLSVKVPEPKFSSQTKDKLVSSEVRAPVEEVVAKALEEFLLETPGDAKIICGKIV
FT                   DAARARDAARKAREMTRRKGVLDGVGLPGKLADCQEKDPAKSEIYIVEGDSAGGSAKQG
FT                   RDRKFQAILPLRGKVLNVEKARYDKLLSSEQIVTLITALGCGIGKEDYNLDKLRYHRII
FT                   IMTDADVDGAHIRTLLLTFFYRQMPEMIERGYIYIAQPPLYKIKAGKDERYLKDESEVN
FT                   AHILRLALQGSELVASEGATPITGDALGELARSYLLAQAVVDRLSRLYDAGALEAVMDG
FT                   VAVDLSSEQAAEASARALEAKLRDDALKPDVTVSTMYDPVRELRSLRVARTHHGNQKIS
FT                   VIDEEFQLTADYQQLVNTANTFKGLIGAGAVIKRGERSMAVTDFKSAMKWLLADAERNM
FT                   SKQRYKGLGEMNPEQLWETTMDPQVRRLLRVQIEDAIAADGIFTTLMGDDVEPRRAFIE
FT                   SNALRAGNIDV"
FT   gene            complement(6551..6865)
FT                   /pseudo
FT                   /locus_tag="BC1002_0004"
FT   gene            7194..8588
FT                   /locus_tag="BC1002_0005"
FT   CDS_pept        7194..8588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0005"
FT                   /product="Ethanolamine ammonia-lyase"
FT                   /EC_number="4.3.1.7"
FT                   /note="KEGG: bpy:Bphyt_0021 ethanolamine ammonia lyase
FT                   large subunit; PFAM: Ethanolamine ammonia lyase large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14118"
FT                   /db_xref="GOA:D5W9C6"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9C6"
FT                   /inference="protein motif:PRIAM:4.3.1.7"
FT                   /protein_id="ADG14118.1"
FT                   /translation="MSYTESIGSRTYRFADLKTLLAKSSPQRSGDQLAGIAAASEEERV
FT                   AAKMALAQVPLRTFLNDPLIPYESDEVTRLIIDDHSPQAFAEISHLTVGDFRNWLLSTA
FT                   TDTDALTRITQGLTAEMVAAVSKLMRNQDLIAASRKRPVITRFRNTVGLPGRMSVRLQP
FT                   NHPTDDVKGIAASMLDGLMYGCGDALIGINPASDNLAAITKLLLMIDDFRQRYQVPTQS
FT                   CVLTHVTSTIAAIEKGAPVDLVFQSIAGTEKANASFGISLAVLQEAYDAGLSLKRGTVG
FT                   SNLMYFETGQGSALSADAHFGVDQQTCEARAYAVARKFKPFLVNTVVGFIGPEYLYDGK
FT                   QITRAGLEDHFCGKLLGVPMGCDICYTNHAEADQDDMDNLLTLLGVAGINFIMGVPGAD
FT                   DVMLNYQSTSFHDALYVRDVLGLRRAPEFEEWLESMQIIDERGALIGASARQPLLEGAR
FT                   DWMGIA"
FT   gene            8585..9376
FT                   /locus_tag="BC1002_0006"
FT   CDS_pept        8585..9376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0006"
FT                   /product="Ethanolamine ammonia-lyase"
FT                   /EC_number="4.3.1.7"
FT                   /note="KEGG: bpy:Bphyt_0022 ethanolamine ammonia-lyase
FT                   small subunit; PFAM: Ethanolamine ammonia-lyase light
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14119"
FT                   /db_xref="GOA:D5W9C7"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9C7"
FT                   /inference="protein motif:PRIAM:4.3.1.7"
FT                   /protein_id="ADG14119.1"
FT                   /translation="MSENDALDKDPWNALRRFTQARIALGRAGNSLPTAPLLAFNLAHA
FT                   QARDAVHHPLDADALHAQLQEQGFNTLDVHSAAPDREHYLRRPDLGRRLSDESRATLAQ
FT                   LPTQSSDVLFVIGDGLSAFAASKHAVPLLQAIHPKLADWTIGPAVIARQARVALGDEIG
FT                   ELLDAKIVVMLIGERPGLSSPDSLGIYMTYAPKVGCSDAQRNCISNVRPEGLGYPQAAH
FT                   KLHYLLTQAKKLTLTGVGLKDDSEEQLASVPAHPAVSDGST"
FT   gene            complement(9408..11852)
FT                   /locus_tag="BC1002_0007"
FT   CDS_pept        complement(9408..11852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0007"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: bpy:Bphyt_0026 heavy metal translocating
FT                   P-type ATPase; TIGRFAM: heavy metal translocating P-type
FT                   ATPase; cadmium-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14120"
FT                   /db_xref="GOA:D5W9C8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9C8"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADG14120.1"
FT                   /translation="MPDTDRIATDRSELDEACTHGGCGDVEARHDHADGRGTGDGCGHA
FT                   HGGEHACGGDAVGGHRHEGHDHHDGHDHVHGHAHDHAAGACCGSSTGFAPASVRLPPSE
FT                   AVGGDLRTAMRILQMDCPTEEALIRKKLGRMPAVRSMHFNLMQRVLTVVHAPEALESVL
FT                   AALRSLDFTPELASDAGSGANANAAPQPITDATRKPWWPLIVAGIVAGAAEAAGWLGAP
FT                   TWVVAAMAIVAIVSCGLTTYRKGWLALRNGNMNINALMSIAVTGAALLGQWPEAAMVMV
FT                   LFTIAELIEARSLDRARNAIEGLMRLAPEEASAQQPDGAWQLVRVDAIVPGTLVRVKPG
FT                   ERIALDGEIVAGRSSVDQAPITGESLPVDKATGDAVFAGTINQAGSFEYRVTAAAGNTT
FT                   LARIIHAVEEAQGTKAPTQRFVDEFARVYTPIVFAIALAVALVPPLVFGGAWHAWVYKA
FT                   LVLLVIACPCALVISTPVTIVSGLAAAARKGILIKGGVYLEQGRKLTRLALDKTGTITH
FT                   GKPVQTEFAVVGDEADALRYRMLAASLAGRSDHPVSMAIAAAANDDRVEHLHVDAFEAI
FT                   AGRGVRGDIDGIGYWLGNHRLIEELGRCSPQLEARLDALELQGKTVVILADAQRVLALF
FT                   AVADTVKDTSRAAVAELRRLGVGTAMLTGDNRHTAEAIARQVGVDEARGDQLPEDKLDA
FT                   VAQWSSDGATVGMVGDGINDAPALARADIGFAMGAMGTDTAIETADVALMDDDLRKIPA
FT                   FIRLSKATYAVLVQNISLALGIKSVFLVLTLMGFGTMWMAVFADVGASLLVVGNGLRLL
FT                   RK"
FT   gene            11934..12365
FT                   /locus_tag="BC1002_0008"
FT   CDS_pept        11934..12365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0008"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional
FT                   regulator; PFAM: Transcription regulator MerR DNA binding;
FT                   regulatory protein MerR; KEGG: bpy:Bphyt_0028
FT                   transcriptional regulator, MerR family; SMART: regulatory
FT                   protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14121"
FT                   /db_xref="GOA:D5W9C9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9C9"
FT                   /inference="protein motif:TFAM:TIGR02047"
FT                   /protein_id="ADG14121.1"
FT                   /translation="MKIGELAKIAHCTTETIRFYEKERLLPEAERTEANYRSYTAKHVE
FT                   RLRFIRNCRALDMTHDEIRALLRLTDAPANGCGGMHALIDEHVAHVDTRIEELQQLKAQ
FT                   LTTLRDQCHGEHPVEDCGIVHGLTDMDVAVPRPRHTHLG"
FT   gene            12491..12691
FT                   /locus_tag="BC1002_0009"
FT   CDS_pept        12491..12691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14122"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9D0"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0029"
FT                   /protein_id="ADG14122.1"
FT                   /translation="MFTCRNQSCSAQWEQSDVVIKNEGQGLLFRCPLCGARNYVERFDG
FT                   DDGEVLYEQLPGRPDQGPMAE"
FT   gene            12715..14118
FT                   /locus_tag="BC1002_0010"
FT   CDS_pept        12715..14118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0010"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="KEGG: bxe:Bxe_A4436 ATP-dependent RNA helicase DbpA;
FT                   PFAM: DEAD/DEAH box helicase domain protein; helicase
FT                   domain protein; DbpA RNA-binding domain protein; SMART:
FT                   DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14123"
FT                   /db_xref="GOA:D5W9D1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9D1"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADG14123.1"
FT                   /translation="MNSPTHAGAAFSELPLPPAMLANLTQLGYVEMTPIQAASLPIALG
FT                   GHDLIAQAKTGSGKTAAFSLALLARLDARKFDTQAMVLCPTRELADQVTQEIRRLARAE
FT                   ENIKVLTLCGGTPMRPQTASLEHGAHVVVGTPGRIMDHLERGTLVLQALNTLVLDEADR
FT                   MLDMGFFDDIAKVARQCPKERQTLLFSATYPEGIAKLSQQFLRNPKEVKLAERHDDSKI
FT                   RQRFYEVTEDERLHAVGLLLNHYRPVSTIAFCNTKQQCRDLLDVLRAQGFHALALHGEL
FT                   DQRERDQVLIQFANRSCSVLVATDVAARGLDIAQLEAVINVDVTPDPEVHTHRIGRTGR
FT                   ADQEGWALSLASMDEMGRVGGIEQVHKRDVEWHKLAELKAASNDPLLPPMETLQILGGR
FT                   KDKIRPGDVLGALTGDAGFAGSQIGKINVTDMSTYVAVERSIAREAVRRLSAGKLKGRK
FT                   VKVRLMDEA"
FT   gene            14464..15618
FT                   /locus_tag="BC1002_0011"
FT   CDS_pept        14464..15618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0011"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   bpy:Bphyt_0031 putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14124"
FT                   /db_xref="GOA:D5W9D2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9D2"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADG14124.1"
FT                   /translation="MQSAMQARSKLPDVGTTIFTVIGQLAAKHDALNLSQGAPNFAPDP
FT                   QLVDGVAQAMRAGHNQYAPMAGIGALREALADKVETLYGVRYDPASEVTVLASASEGLY
FT                   STISALVHPGDEVIYFEPSFDSYAPIVRLQGAKPVAIKLSLDHFRVNWDEVAAAITPKT
FT                   RMIIVNTPHNPTATIFGDADIERLKALTRSTDIVILSDEVYEHVVFDGAKHQSMARHRE
FT                   LAERSVIVSSFGKSYHVTGWRVGYCLAPAALMEEIRKVHQFMVFSADTPMQHAFVDALA
FT                   NRDSYLGLSDFYQKKRDLLTRALRESRFELLPSEGSFFMLARFRGFSDESDSDFVLRLI
FT                   RDARVATIPLSAFYTDGTDSGLIRLSFSKDDATLLEGARRLCEI"
FT   gene            15683..16477
FT                   /locus_tag="BC1002_0012"
FT   CDS_pept        15683..16477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0012"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: bxe:Bxe_A4434 ABC amino acid transporter,
FT                   periplasmic ligand binding protein; PFAM: extracellular
FT                   solute-binding protein family 3; SMART: extracellular
FT                   solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14125"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9D3"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADG14125.1"
FT                   /translation="MKLLKCLLALACAGASLATWSAASAADTATLRFGLEAQYPPFESK
FT                   GPNGELQGLDIDVGNAVCAAAHMTCKWVETSFDGLIPALQGRKFDAINSAMNATEQRRQ
FT                   AIDFTTVVYRVPSQLIARSDSGLQPTPESLKGKRIGVLQGSIQETFAKVHWEPAGVTVL
FT                   PYQDQNQVYTDLTAGRLDGTLVLAPAGQTGFLSKPEGKGYGFVGHPVRDDKILGSGIAY
FT                   GIRKGDTALRDQLNAAIAKVQADGTVKTLAAKYLGNIDVSAK"
FT   sig_peptide     15683..15760
FT                   /locus_tag="BC1002_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.688 at
FT                   residue 26"
FT   gene            16619..17485
FT                   /locus_tag="BC1002_0013"
FT   CDS_pept        16619..17485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0013"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: bpy:Bphyt_0033 transcriptional regulator, AraC
FT                   family; PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14126"
FT                   /db_xref="GOA:D5W9D4"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9D4"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADG14126.1"
FT                   /translation="MSEKIEAAGAANTARAKGAETPRFWRSDALPFIEARSIDDGRKVC
FT                   YAKHSHETFSIGAVTGGRSVYLNRHAREWIGAGAVVMMNPDDVHACNPVAGERWSYRML
FT                   HVDVAWFTKLQHELGFNENHAFRAFSQIMTLDAALFDGLNRLCAILTSNDDDIDTLRKE
FT                   SAAITFFSNVQQTLNPAGLPERAASGQLARAAEYIAENCTSALKLDDVCSAAGLSASHL
FT                   IRAFKLRYGMTPHAYLINRRIQYSRAQLRRGALIAEVALDAGFADQAHLQRTFKRLVAA
FT                   TPGQYRS"
FT   gene            complement(17535..18122)
FT                   /locus_tag="BC1002_0014"
FT   CDS_pept        complement(17535..18122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0014"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bpy:Bphyt_0034 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14127"
FT                   /db_xref="GOA:D5W9D5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9D5"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADG14127.1"
FT                   /translation="MTALLSMAAFALASSISPGPVNVVALSAGAQHGLAASLRHVTGAT
FT                   VGFTLLLLLIGLGLHELLARFPDLVAIVKWAGVGFLLYLAYKLTIDNGQLGADKPARGP
FT                   SFAHGAAMQWLNPKAWLASLAGMGAYAAGGDGGLVWQFAALYFVICYLSIASWAYAGTF
FT                   LRRHLREAKRVRVFNRVMAALLALSAMYLLVE"
FT   sig_peptide     complement(18051..18122)
FT                   /locus_tag="BC1002_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.567 at
FT                   residue 24"
FT   gene            18509..18838
FT                   /locus_tag="BC1002_0015"
FT   CDS_pept        18509..18838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_6561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14128"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9D6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14128.1"
FT                   /translation="MERPVEWIKGVHVGPHVSRQKIADELNELCLALFDGWCERRCVIP
FT                   LAYLLHVWPIVDATQRSFKRLRDNLRDLECWHLNDLSDEDSGRIRYLLGVLSQQTGSVV
FT                   STSTN"
FT   gene            18865..20382
FT                   /locus_tag="BC1002_0016"
FT   CDS_pept        18865..20382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0016"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: bmj:BMULJ_03822 putative
FT                   diguanylate cyclase; SMART: GGDEF domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14129"
FT                   /db_xref="GOA:D5W9D7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9D7"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADG14129.1"
FT                   /translation="MIHRRKGRFRVLIARAHRWQVPRDGVIVAGCGVVLAMLALCGYTL
FT                   YQSREDAIERALDSTRDVATIIQRDIARNFELYSLSLQAVADGLGRPGVLDSPRLWREI
FT                   LFDRAATGQYVGAMVVLDGLGNVVIDSENDVPRRGNLSDRQYFRIHREDPNFGLYVSAP
FT                   YNSRLRPGSRSIALSRRLSRPDGSFAGIVALGIDQEYFASLFADLRIGQHGSVSIIRTD
FT                   GTIIVRRPDDRNLTGSDISKTEFFQRLLAKDERSFIASSPLDGVERVYSFRRIPQLPLI
FT                   VLVANSTADIYAGWWKRALTIGSLMLILGGGVIVLAAWLGAELRRRQRVEHELERLAGT
FT                   DGLTGLPNRRALCETLDREWLRARRTGSVLSLLFVDIDHFKAYNDTYGHQAGDVALTAV
FT                   ARCIRRVSQRPGDCVGRYGGEEFVVVLPDTDVTGAEVVAEKIRAAIDELDIAHVGCEFG
FT                   RVTVSIGATMSRPDRAMDVGAVVRAADEALYSAKAGGRNMVAQMRVG"
FT   gene            complement(20457..20532)
FT                   /locus_tag="BC1002_R0001"
FT                   /note="tRNA-Lys2"
FT   tRNA            complement(20457..20532)
FT                   /locus_tag="BC1002_R0001"
FT                   /product="tRNA-Lys"
FT   gene            20735..21139
FT                   /locus_tag="BC1002_0017"
FT   CDS_pept        20735..21139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0017"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   bxe:Bxe_A4425 phenylacetic acid degradation-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14130"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9D8"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADG14130.1"
FT                   /translation="MDNTEITQLLDRVLAPWVRALTLTPIKVDEESATLRLPFSGEWRH
FT                   SGGMISGQVFMAAADTAMVVAITAALGGFKPMSTVSLNISFMRAVRKGDVLIKARVLRM
FT                   GRNLVFGEVELFDEGGNMAVHATTTYALLE"
FT   gene            21214..22092
FT                   /locus_tag="BC1002_0018"
FT   CDS_pept        21214..22092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0018"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: bxe:Bxe_A4424 putative
FT                   patatin-like phospholipase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14131"
FT                   /db_xref="GOA:D5W9D9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9D9"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ADG14131.1"
FT                   /translation="MFDQVVFAGGGNRCWWQAGFWDVVQPRLDIRPRVITGISAGAATA
FT                   CMIYTRGDSDWVMRYYEDALRHNTRNAYWGNLLRGESVFPHYRIYRQALLDIYGDKFSR
FT                   LAQAPEIRIGVSHLPRWLGARSAVAAGLVAYNIEKYVRKTLHPTLGRTLGFHPEFVRAQ
FT                   DCVSVDELADLILQSSSTPPFTPVLRRNGRPVLDGGMVDNVPVGALDADTPGNVLVMVT
FT                   RLYPRPQMFVVPHGVQQRLYVQPSRKVPISSWDYTSPSQMVHAYNLGRADGEVFLERIP
FT                   ALMEAGAHEAR"
FT   gene            complement(22151..23164)
FT                   /locus_tag="BC1002_0019"
FT   CDS_pept        complement(22151..23164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0019"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: bxe:Bxe_A4423 putative
FT                   2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14132"
FT                   /db_xref="GOA:D5W9E0"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9E0"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADG14132.1"
FT                   /translation="MKIAILDDYQDAVRKLDCFQLLADQEVKVFNNTVRGLGQLASRLA
FT                   EVDALVLIRERTRITSQLLDKLPRLRMISQTGKVASHIDLAACTERGIAVLEGTGSPVA
FT                   PAELTWALIMAAQRRIPQYVANLKQGAWQQSGLKTSALPPNFGLGQVLRGQTLGIWGYG
FT                   KIGRLLAGYGKAFGMNVLIWGREHSREAASADGYGVAASREELFETSDVLSLHLRLHDD
FT                   TRGIVKQDDLMRMKPTALLVNTSRAELLEENALVNALSHNRPGMVAIDVYESEPILQGY
FT                   SLLRMENVICTPHIGYVERESYELYFSAAFKNILAFDAGDTASVANPEALQGGRRR"
FT   gene            23550..25406
FT                   /locus_tag="BC1002_0020"
FT   CDS_pept        23550..25406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0020"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="KEGG: bxe:Bxe_A4422 phosphoenolpyruvate
FT                   carboxykinase; PFAM: phosphoenolpyruvate carboxykinase
FT                   (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14133"
FT                   /db_xref="GOA:D5W9E1"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9E1"
FT                   /inference="protein motif:PRIAM:4.1.1.32"
FT                   /protein_id="ADG14133.1"
FT                   /translation="MNLPSFEGPPAIEAPTWVKHRKLIDWVQRIAALTKPEKVVWCDGS
FT                   QEEYDRLCEQMVEAGTLKKLNPAKRPNSYLAWSDPSDVARVEDRTFICSQRAEDAGPTN
FT                   NWIAPAEMRSTLDGLFDGAMRGRTMYVVPFSMGPLGSPIAHIGVELSDSPYVVTNMRIM
FT                   TRMGRKVYDVLGEDGQFVPCVHSVGAPLAAGEQDVSWPCNKTKYIVHFPESREIWSFGS
FT                   GYGGNALLGKKCFALRIASTMGRDEGWLAEHMLILGVTSPEGRKHHVAAAFPSACGKTN
FT                   FAMLIPPAGLNGWKISTIGDDIAWIKPGKDGRLYAINPEAGYFGVAPGTSEKTNFNALA
FT                   TLKENVIFTNVALTDDGDVWWEGMTDEPPAHLIDWQGKDWTPADAKETGRKAAHPNARF
FT                   TAPASQCPSIDADWENPAGVAIDAFIFGGRRSTTVPLVTEARNWVEGVYMAATMGSETT
FT                   AAAAGQQGVVRRDPFAMLPFCGYNMSDYFSHWLKTGERLQQLGAKLPKIFCVNWFRKGP
FT                   DGKFVWPGFGENMRVLSWMVGRIEGTAQGEEHAFGISPHYEDIDWSGLNFTREQFDQVI
FT                   SVDAAAWRDELVLHTKLFDTLQHGLPPALTEAKRGLEEKLTA"
FT   gene            25750..26853
FT                   /locus_tag="BC1002_0021"
FT   CDS_pept        25750..26853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0021"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bpy:Bphyt_0305 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14134"
FT                   /db_xref="GOA:D5W9E2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9E2"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADG14134.1"
FT                   /translation="MDHLQSMRVFVKVADLGSFARAASAMDISNAVATRHVADLEGRLG
FT                   TRLLNRTTRSLSLTESGQVYLERARQILDELEDVEQMVVARNHEPVGTLRIVAPVVFGL
FT                   HNLAPVLQTYAERYPKVIPDVTLVDRQVDLVEEGFDVGVVIARQMRSASIVTRRLTTGC
FT                   MTVCATPAYLEKHGMPTRPEHLLEHPCLSLPSEYWGDERVFTGPEGEVRVRPSNVIVAN
FT                   NTEMLRQFALLGMGIAILPSYLIGRDMTRGRLVRLLGDYRLPQVEINIAYPSRRHLPAK
FT                   VRTFIDHLVEHFSQTPNSVLGEQWIKDGLERPATSAAFETAESRAPEAFDGAEPLSRLL
FT                   DSELSPAVPKPMTKSSNRSRPTALSPL"
FT   gene            complement(27049..29766)
FT                   /locus_tag="BC1002_0022"
FT   CDS_pept        complement(27049..29766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0022"
FT                   /product="DNA topoisomerase III"
FT                   /note="TIGRFAM: DNA topoisomerase III; PFAM: DNA
FT                   topoisomerase type IA central domain protein; TOPRIM domain
FT                   protein; KEGG: bpy:Bphyt_0306 DNA topoisomerase III; SMART:
FT                   DNA topoisomerase I DNA-binding; DNA topoisomerase I
FT                   ATP-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14135"
FT                   /db_xref="GOA:D5W9E3"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9E3"
FT                   /inference="protein motif:TFAM:TIGR01056"
FT                   /protein_id="ADG14135.1"
FT                   /translation="MLALKATNPDLPTSHRVMSKALIIAEKPSVANDIARALGGFTKHD
FT                   EYYESDDYVLSSAVGHLLEIAAPDEYEVKRGKWSFANLPVIPPHFDLNPIAKSESRLKV
FT                   LTKLMKRKDIDRLINACDAGREGELIFRLIAQHAKAKQPVQRLWLQSMTAGSIREGFAR
FT                   LRSDEEMQPLADAARCRSEADWLVGINGTRAMTAFNSKGGGFFLTTVGRVQTPTLSIVV
FT                   EREEKIRRFVPRDYWEVKAEFVCAAGFYEGRWFDPKFKRDEFDPEKRDSRLWSLPAAET
FT                   IVAACRGQMGVVTEESKPSTQLSPALFDLTSLQREANGRFGFSAKNTLGLAQALYEKHK
FT                   VLTYPRTDARALPEDYLDTVKQTLGMLKESNNYLPFAKQVLDKGWVKPNKRIFDNSKIS
FT                   DHFAIIPTLQAPKNLSEPEQKLYDLVVKRFLSVFFPAAEYRVTTRITEVVGHHFKTEGK
FT                   VLVEPGWLQIYGRETSGDDANLVPVQKDEKVKTDKIAAQQLVTKPPARYNEATLLSAME
FT                   GAGKLVEDDELREAMAAKGLGTPATRAAIIEGLLTEKYLIREGRDLIPAAKAFQLMTLL
FT                   RGLGVKELTAPELTGEWEYKLSQMERGNLPRDAFMQEIARMTQTIVKRAKEYDSDTIPG
FT                   DYATLQTPCPNCGGQVKENYRRFACSKCEFSISKIPGGRQFEIAEVEELLQNKTIGPLS
FT                   GFRSKMGRPFSAILKLSLDDEIKNYKLEFDFGQDAAGEDGEPPDFSDQQPVGACPKCQG
FT                   RVFEHGMSYVCENSVANPKSCDFRSGKVILQQEIAREQMAKLLEEGRTDLLTNFKSSRT
FT                   GRNFKAFLVKQNDGKIGFEFEKKEPAAAKTAAAKTSGARSAAKAMPEADEGDTAVAVKA
FT                   EPAEKKVAAKKAPAAKTTAAKKAPAKKTAARKIG"
FT   gene            complement(30026..30403)
FT                   /locus_tag="BC1002_0023"
FT   CDS_pept        complement(30026..30403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0023"
FT                   /product="thioredoxin domain protein"
FT                   /note="KEGG: bpy:Bphyt_0307 thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14136"
FT                   /db_xref="GOA:D5W9E4"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9E4"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0307"
FT                   /protein_id="ADG14136.1"
FT                   /translation="MPALNLDTDQDRIAERVNEPDTLFVACLCAEWCGTCREYRDAFNQ
FT                   LAERHPEVCFAWIDIETHADRFDDLDVENFPTVLIEDSVTTRFFGTVLPQVSIVERMLS
FT                   DLTALPGVTGAPKLRPALAVA"
FT   gene            complement(30505..31734)
FT                   /locus_tag="BC1002_0024"
FT   CDS_pept        complement(30505..31734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0024"
FT                   /product="DNA protecting protein DprA"
FT                   /note="KEGG: bpy:Bphyt_0308 DNA protecting protein DprA;
FT                   TIGRFAM: DNA protecting protein DprA; PFAM: SMF family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14137"
FT                   /db_xref="GOA:D5W9E5"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9E5"
FT                   /inference="protein motif:TFAM:TIGR00732"
FT                   /protein_id="ADG14137.1"
FT                   /translation="MHTLPATRIELAAWLRLSLAPGLKPAALRLLLAAFGLPQALFAQS
FT                   PEALAEVAGDAAARAVLAPPGPAFDGQLDAVLAWREQAGNQIVTLDDPAYPPALLTMPD
FT                   PPPLLYIKGRLDLLHTRAVALVGSRSATPQGIEDARRFARELSAAGVTVVSGLALGIDG
FT                   AAHRGGLEGVGGTVAVVGTGADLIYPAAHQALARQIAVQGAILSEWPLGTPARAANFPQ
FT                   RNRLIAGLVSGVVIVEAAMRSGSLITARLANEMGRDVFALPGSIYAPLSRGCHRMIKQG
FT                   ARLVETPDEVLEELGFVRRPASNTGRAAKQVGPLDRAGLHGSSGGTALQAATAAFADAP
FT                   PSGSAPQPALAPDAQRLLAALGHSPTTLEILAARTEMEDAALHAALLRLELAGKITLLP
FT                   GGRFMRAHHD"
FT   gene            32012..32515
FT                   /locus_tag="BC1002_0025"
FT   CDS_pept        32012..32515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0025"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="TIGRFAM: peptide deformylase; KEGG: bph:Bphy_0035
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14138"
FT                   /db_xref="GOA:D5W9E6"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9E6"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ADG14138.1"
FT                   /translation="MALLNILNYPDKRLHKVAKPVEEVNDRIRRLVADMAETMYAAPGV
FT                   GLAATQVDVHERVIVIDVSETHDELLAFINPEIVWSSDQRKLSEEGCLSVPGIYDNVER
FT                   AEKVRVRALNQKGETFELDCEGLLAVCIQHEMDHLMGRVFVEYLSPLKQTRIKSKMKKL
FT                   AHAM"
FT   gene            32545..33540
FT                   /locus_tag="BC1002_0026"
FT   CDS_pept        32545..33540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0026"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="KEGG: bpy:Bphyt_0310 methionyl-tRNA
FT                   formyltransferase; TIGRFAM: methionyl-tRNA
FT                   formyltransferase; PFAM: formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14139"
FT                   /db_xref="GOA:D5W9E7"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9E7"
FT                   /inference="protein motif:TFAM:TIGR00460"
FT                   /protein_id="ADG14139.1"
FT                   /translation="MTHSLRVIFAGTPEFAAAALAAIHRAGFAVPLVLTQPDRPAGRGM
FT                   KLQASPVKRYAQEHGLAVAQPTSLRRAGKYPEEAAAGIEQLRATPHDVMVVAAYGLILP
FT                   QEVLDIPRFGCINIHASLLPRWRGAAPIHRAIEAGDAQTGITLMQMDAGLDTGAMISEV
FT                   RTPISADDTTATLHDRLAEAGAQLIVHALIELERSGKLASTPQPADGVTYAEKIAKHEA
FT                   ALDWRRPAEALARQVRAFDPFPGGAGTLDDGNTVKIWAATAVASPASGSSKTPGTITEV
FT                   SPDGVLVACDEGALRLTQLQKPGGKRLPVREFLAGSPLVAGQRFQLPEAQ"
FT   gene            33658..34299
FT                   /locus_tag="BC1002_0027"
FT   CDS_pept        33658..34299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0027"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bpy:Bphyt_0311 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14140"
FT                   /db_xref="GOA:D5W9E8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9E8"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADG14140.1"
FT                   /translation="MFGIVHFEFFIVAVFLLNITPGPDTAYIVGRSVAQGRGAGLMSAL
FT                   GISAGCCIHSLACAFGLTALLAASATAFTIVKFVGAIYLIYLGVRLIFAKPAADAPAGD
FT                   ARAPSTPKSLRQLFLQGFWTNVLNPKVVLFFVSFFPQFVATGSEHKTFAFLTLGAVFVL
FT                   MSMVWNSFVAWIAGSVTQRFSGKPTVKRWLDRGVGSAFVGLGIKLATASR"
FT   gene            34404..35261
FT                   /locus_tag="BC1002_0028"
FT   CDS_pept        34404..35261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0028"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: bxe:Bxe_A4413 M48
FT                   family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14141"
FT                   /db_xref="GOA:D5W9E9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9E9"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADG14141.1"
FT                   /translation="MFNWVKTAMLMAAITALFIVIGGMIGGSRGMMLALVIALGMNFFS
FT                   YWFSDKMVLRMYNAQEVDENSAPQFYRMVRDLATRANLPMPRVYLINEDAPNAFATGRN
FT                   PEHAAVAATTGILRVLSEREMRGVMAHELSHVKHRDILISTISATMAGAISALANFAMF
FT                   FGGRDENGRPANPIASIAVALLAPIAGALIQMAISRAREFEADRGGAQISGDPQALASA
FT                   LDKIHRYASGIPFPTAEAHPATAQMMIMNPLSGGGIANLFSTHPATEERIARLMEMART
FT                   GRFD"
FT   gene            35461..36900
FT                   /locus_tag="BC1002_0029"
FT   CDS_pept        35461..36900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0029"
FT                   /product="sun protein"
FT                   /note="KEGG: bxe:Bxe_A4412 Fmu, rRNA SAM-dependent
FT                   methyltransferase; TIGRFAM: sun protein; PFAM: Fmu (Sun)
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14142"
FT                   /db_xref="GOA:D5W9F0"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9F0"
FT                   /inference="protein motif:TFAM:TIGR00563"
FT                   /protein_id="ADG14142.1"
FT                   /translation="MTSKPSSRSASSSARSRESRLSALHLSPESLGFALDCAAQAVGAV
FT                   RLGAALPAALQSVFAAMPEGNAAAARGAVQDLAYRTMRRLASAEWLIAKLVKKAPPPHV
FT                   AHVLACALALLVDDETSAAYTPFTVVDQAVSAIGARREFAFAKGLVNAVLRNFLRERDT
FT                   LLAAVQADEVAHWNYPAWWIDAVKRTWPEAWQSVLAAGNTQGPLTLRVNARHSTVDAYL
FT                   QELQRQQITARKAGEHAVTLATPMPVERIPGFNEGVVSVQDAGAQLAAQLLGVRDGMRV
FT                   LDACAAPGGKTGHLLELANIQLVALESDASRARRIGENLRRLKLEAEVRIGDAGNPAQW
FT                   HDDLDQPFDRILADVPCSASGIVRRHPDIRWLRRQSDIAALVSEQRRILDALWPLVKPG
FT                   GELLYVTCSIFPEEGELQAQWFGNQHQDAVRLDAPGQLLPSVARAPADSSAGSHAGRPA
FT                   EFSTGTNSDHDGFFYARFQKR"
FT   gene            36897..37496
FT                   /locus_tag="BC1002_0030"
FT   CDS_pept        36897..37496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0030"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14143"
FT                   /db_xref="InterPro:IPR025500"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9F1"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0314"
FT                   /protein_id="ADG14143.1"
FT                   /translation="MTIKRFFPLRLAAVLWIALAVWLAAPGAAHADSIAVQRASLQADN
FT                   GGWSLDAHFEFELNSNLEDAVNKGIPLYFTTDFELSRPRWYWFDEQPVSVSQSLRLSFQ
FT                   PLTREYRVSSVQSGGLQLGFSTLKDALAVIKHVTSWHVIDRNQVRVGETYNASVRMQLD
FT                   IGLMPKPFQIDAVNNRDWNLASDWKRFTFTAADRAK"
FT   sig_peptide     36897..36992
FT                   /locus_tag="BC1002_0030"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 32"
FT   gene            37486..39912
FT                   /locus_tag="BC1002_0031"
FT   CDS_pept        37486..39912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0031"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: bxe:Bxe_A4410 multi-sensor signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase HAMP region domain protein; PAS
FT                   fold-4 domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; histidine kinase HAMP region
FT                   domain protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14144"
FT                   /db_xref="GOA:D5W9F2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9F2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG14144.1"
FT                   /translation="MLNKVRSSSTSVSSIVVRVLVSTVAVTAVLLLVLLAAASANTEFF
FT                   DRYYQWLYAANVAVAMIFLLVVATLVVIIVVRLRTGKFGTRLLAKLAFFMALVGVVPGG
FT                   IIYIVSYQFVSRSIESWFDVNVETALASGLNLGRGMLDASLSDLQTKARLMSEQIASAD
FT                   AAGTTLTLLRLRDQFGVQDATIIEPTRSMSGATPDMHVVAQASSNYAMLLPNDLPTPLM
FT                   IEQARGHGYAAIEGEVDGDAHAQGGKGALRLRVVQRIPDANASLLQPAERFLQLTQPVS
FT                   TTLARNADAVQRAYREYQEKALGRTGLRKMYIGTLTLSLFLATFIAMMLALALGNQLAR
FT                   PLFLLAQGTKEITEGDYTPKREIKSRDELGFLTQSFNAMTRQLAEARGAVEKNRIALEH
FT                   SKAYLESILANLTAGVFVFDRQFRLTTANRGAERIFRQPFQTVLGSSLDQIGVLGEFGA
FT                   MVRKAFADREAASEDGHDDNGHWQQQFSVPVPGETEPLTLLVRGARLVAANERDAEDIQ
FT                   TSGYVVVFDDISDVISAQRSIAWGEVARRLAHEIKNPLTPIQLSAERLQMKLADKLAPS
FT                   DADVLKRGATTIVNQVAAMKQMVDDFRDYARTPPAVLAHLQLNDLVSEVLTLYGIEEGK
FT                   GAIQVELAALPAIRGDATQLRQVIHNLLQNAQDAVAEVAHPRVLLETRTVEYGDPDAQG
FT                   KARVAVRLTVSDNGPGFPARILTRAFEPYVTTKAKGTGLGLAMVKKIVDEHGARIDIRN
FT                   RMKAGDVIEGAQISILFLQLADDPAQPGTPGSGAHPAHGGASQGTTKATVQTRAA"
FT   gene            39913..40602
FT                   /locus_tag="BC1002_0032"
FT   CDS_pept        39913..40602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0032"
FT                   /product="two component transcriptional regulator, Fis
FT                   family"
FT                   /note="KEGG: bpy:Bphyt_0316 two component transcriptional
FT                   regulator, fis family; PFAM: response regulator receiver;
FT                   helix-turn-helix Fis-type; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14145"
FT                   /db_xref="GOA:D5W9F3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9F3"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG14145.1"
FT                   /translation="MATILVVDDEMGIRELLSEILSDEGHVVEAAENAQEAREFRLRQA
FT                   PDLVLLDIWMPDTDGVTLLKEWAAQGQLTMPVIMMSGHATIDTAVEATKIGALNFLEKP
FT                   IALQKLLKAVEQGLARGNSTAVPGGVAAKPALPVSASSVASAAALPMLSADGVGGGALA
FT                   AQTASISFDIPLRDARDAFERAYFEYHLARENGSMTRVAEKTGLERTHLYRKLKQLGVD
FT                   LGKNKGE"
FT   gene            40697..40772
FT                   /locus_tag="BC1002_R0002"
FT                   /note="tRNA-Phe1"
FT   tRNA            40697..40772
FT                   /locus_tag="BC1002_R0002"
FT                   /product="tRNA-Phe"
FT   gene            41084..41896
FT                   /locus_tag="BC1002_0033"
FT   CDS_pept        41084..41896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0033"
FT                   /product="exsB protein"
FT                   /note="KEGG: bpy:Bphyt_0317 ExsB protein; TIGRFAM: exsB
FT                   protein; PFAM: Queuosine synthesis-like"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14146"
FT                   /db_xref="GOA:D5W9F4"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9F4"
FT                   /inference="protein motif:TFAM:TIGR00364"
FT                   /protein_id="ADG14146.1"
FT                   /translation="MPAHVAPLLAWRTWRSATWHPHSRSITVIRKDAKRSALVLFSGGQ
FT                   DSATCLAWALDRYDTVETIGFDYGQRHRVELECREGFRQAVVRAFPAWADRLGDDHTID
FT                   LSLLGAISDTAMTREIEIEATANGLPNTFVPGRNLMFMTIAAAIAYRRGLQVLVGGMCE
FT                   TDFSGYPDCRDDTMKALQVALNLGMDTRFALETPLMWLDKADTWRLAHELGGDALVELV
FT                   RVETHTCYLGERAELHSWGFGCGECPACRLRKRGYEAYLAGEKVTEPV"
FT   gene            41951..42583
FT                   /locus_tag="BC1002_0034"
FT   CDS_pept        41951..42583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0034"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   bxe:Bxe_A4406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14147"
FT                   /db_xref="GOA:D5W9F5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="InterPro:IPR030977"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9F5"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADG14147.1"
FT                   /translation="MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAEAV
FT                   CRFCDTDFVGTDGENGGKYRTPDELVAMIASQWPQGEGERFVVCTGGEPMLQIDQPLVD
FT                   ALHAAGFEIAIETNGSLPVLDTIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLADYA
FT                   KLDFEYFLVQPMDGPSRDINTKLAIDWCKRHPQWRLSMQTHKYLNIP"
FT   gene            42590..43036
FT                   /locus_tag="BC1002_0035"
FT   CDS_pept        42590..43036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0035"
FT                   /product="6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein"
FT                   /note="PFAM: 6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein; KEGG: bpy:Bphyt_0319 queuosine
FT                   biosynthesis protein QueD"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14148"
FT                   /db_xref="GOA:D5W9F6"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9F6"
FT                   /inference="protein motif:PFAM:PF01242"
FT                   /protein_id="ADG14148.1"
FT                   /translation="MLTITRKLEFDAGHRIPDHRSQCRNLHGHRYVLEITLQGDLVDTE
FT                   GAPDRGMVMDFADVKSLASEHLVDKWDHAFLVYEGDTQVRGFLDTMADHKTVVIDRIPT
FT                   VENLAAIAFDILANVYDAHYGVNLRLHRVRLYETPNCWADVVRD"
FT   gene            43240..44022
FT                   /locus_tag="BC1002_0036"
FT   CDS_pept        43240..44022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0036"
FT                   /product="2-dehydro-3-deoxyglucarate aldolase"
FT                   /EC_number="4.1.2.20"
FT                   /note="KEGG: bxe:Bxe_A4404 2-dehydro-3-deoxyglucarate
FT                   aldolase; PFAM: HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14149"
FT                   /db_xref="GOA:D5W9F7"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9F7"
FT                   /inference="protein motif:PRIAM:4.1.2.20"
FT                   /protein_id="ADG14149.1"
FT                   /translation="MSTFTNSLKQRLKDNAPLFGLWLSLGSEAGAEALAHAGFDWLLID
FT                   MEHAPNDSGGVESQLRAIAAAHLPSEPVVRVPASEPWLVKRVLDAGARTLMFPNIESAE
FT                   DAARAVRLTQYPTAEALDGLRGVAGVVRAAGYGMRRDYLQTANAQIATIVQIESARGLR
FT                   EVEQIAATPGVDCVFVGPADLAASLGHLGDAKHADVQAAMARIVSAADKAGIAAGIFAM
FT                   DVAGARQHRDAGFRFVALAADVIWMLRATRQALQEVRS"
FT   gene            44019..44753
FT                   /locus_tag="BC1002_0037"
FT   CDS_pept        44019..44753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0037"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="KEGG: bxe:Bxe_A4403 hypothetical protein; PFAM: Sel1
FT                   domain protein repeat-containing protein; SMART: Sel1
FT                   domain protein repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14150"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9F8"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ADG14150.1"
FT                   /translation="MNGRVQGGAGPRIARVTAQVTITAALLASAAWSAAYAQDHVARSN
FT                   DPQTQSAVADYNAGNLAAALTEFREAAERGSRLAQFNYAMMLLNGEGTPVNVDEGKKWL
FT                   RKAADANMSHAQYVYGKMYDDGEFVERDPAEAHRWFMKAAAQGHVQAELALANQFLDGR
FT                   GTERDNKQAFVWYKKAAQGGDMTAQYVTGSFYERGGDGVDRNLNVARAYYAAAAAQGDP
FT                   AARLKYQQLSAQLRDQKEVKPQ"
FT   gene            complement(44835..45983)
FT                   /locus_tag="BC1002_0038"
FT   CDS_pept        complement(44835..45983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0038"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="KEGG: bpy:Bphyt_0322 rod shape-determining protein
FT                   RodA; TIGRFAM: rod shape-determining protein RodA; PFAM:
FT                   cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14151"
FT                   /db_xref="GOA:D5W9F9"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9F9"
FT                   /inference="protein motif:TFAM:TIGR02210"
FT                   /protein_id="ADG14151.1"
FT                   /translation="MQFDKRAWLDRIKRMFAGFDRPLALIVFLLLCVGIVTLYSASLDM
FT                   PGRVEDQLRNILLTFVLMWGLANVPPNTLMRFAVPLYTFGIALLVAVAMFGLTRKGAKR
FT                   WINVGVVIQPSEILKIATPLMLAWYFQRREGVMRWYDYLVGFVILIVPVGLIAKQPDLG
FT                   TAVLVFAAGLFVIYFAGLSFKLIVPVLIAAVIAVVSIAAFQDKICQPEVQWPLMHDYQK
FT                   HRICTLLDPTSDPLGKGFHTIQAVIAIGSGGPLGKGWLKGTQAHLEFIPEKHTDFIFAV
FT                   FSEEFGLAGGIVLLTLYMLLIARGLYIAANGATLFGRLLAGSLTMAFFTYAFVNIGMVS
FT                   GILPVVGVPLPFMSYGGTALTTLGVATGLIMSVARQKRLMQS"
FT   gene            complement(45994..48369)
FT                   /locus_tag="BC1002_0039"
FT   CDS_pept        complement(45994..48369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0039"
FT                   /product="penicillin-binding protein 2"
FT                   /EC_number="2.4.1.129"
FT                   /note="TIGRFAM: penicillin-binding protein 2; KEGG:
FT                   bpy:Bphyt_0323 penicillin-binding protein 2; PFAM:
FT                   penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14152"
FT                   /db_xref="GOA:D5W9G0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9G0"
FT                   /inference="protein motif:TFAM:TIGR03423"
FT                   /protein_id="ADG14152.1"
FT                   /translation="MTEFKDTQQQLTKFRLRVAAAGLFVFVCFGLIGFRFLFLQVWHYS
FT                   KYSLQADENRISVAPIVPNRGIITDRNGVVLAKNYSAYTLEITPSKLNDTLENVVDNLA
FT                   TVVSIDARDRRRFKKLQEDSKNFESLPIRTRLTDDEVARFTAQRFRFPGVEVRARLFRQ
FT                   YPLGPTAAHVIGYIGRISQRDQDRIDDASDQNDSDPDHYDPRLDANNYKGTDYIGKIGV
FT                   EQSYETELHGQTGFEEVEVTAGGRPVRTLSRTQATPGNNLVLSLDIGLQQVAEQAFAGR
FT                   RGALVAIEPATGDVLAFVSAPSFDPNSFVDGIDQQTWDELNNSPDHPLLNRPLHGTYPP
FT                   GSTYKPFMALAALSLHKRTPSWGFQDPGYYTFGGHTFRNDVRSGQGWVDMNRAIVVSND
FT                   TYFYMLAHDLGVNNIANFMKPWGFGQITGIDIAGEAKGILPSTDWKRHAYRKPEQQKWY
FT                   EGETVSLGIGQGYNSFTILQLAHATATLANNGVVMKPHLVRDIENPITKDTRPVVRDPS
FT                   DKIAVKQQDIDFIKHAMEGVVTNGTAAKVFAGAAYQAAGKTGTAQVYSLQGANYKGHAI
FT                   AENLRDHALFIAFAPVEQPKIALALIVENGGWGAESAGPIARRVLDYYLVGKNKPGVVE
FT                   AAVAAAASNTAEASAPQVGETPAHHEGAQPLRIAAGFKALPVPGAAAAAAASGASAAVA
FT                   ASGANGASAPVAASAGATATVPASAPAAASAGAARAASAAKPASASAAAKKSASRTSGA
FT                   PHKPRPASEPAPSVTAPSRDDSVQGASPRQPATGGIDE"
FT   gene            complement(48449..48961)
FT                   /locus_tag="BC1002_0040"
FT   CDS_pept        complement(48449..48961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0040"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="KEGG: bpy:Bphyt_0324 rod shape-determining protein
FT                   MreD; TIGRFAM: rod shape-determining protein MreD; PFAM:
FT                   Rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14153"
FT                   /db_xref="GOA:D5W9G1"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9G1"
FT                   /inference="protein motif:TFAM:TIGR03426"
FT                   /protein_id="ADG14153.1"
FT                   /translation="MNRPQYILQPVNPYFIAFSLASAFLLNLMPWGRLAGVPDFVALVL
FT                   LFWNVHQPRKVGMGIAFLLGLLMDVHNASLLGEHALAYTLLSYGAITIHRRVLWMSLGV
FT                   QTFAVMPLLVVAQLVPFVIRLLTGAAFPGWSYLIDGFVEAALWPLTSILLLMPQRRPAD
FT                   PDDTRPI"
FT   gene            complement(48958..50094)
FT                   /locus_tag="BC1002_0041"
FT   CDS_pept        complement(48958..50094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0041"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="KEGG: bxe:Bxe_A4399 rod shape-determining protein
FT                   MreC; TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14154"
FT                   /db_xref="GOA:D5W9G2"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9G2"
FT                   /inference="protein motif:TFAM:TIGR00219"
FT                   /protein_id="ADG14154.1"
FT                   /translation="MEYSPPPLFKQGPSALARLVFFVVLALALLISDARFQTLEIVRGV
FT                   LGAGLYPLQRAALVPRDIFMGAADLAVTSATLRNENAKLREKDLQLSQQANTAASLAAE
FT                   NSHLRALMQLSQQLTTQSLPAEIQYDTRDPFTQKVVIGRGAQQGIQNGSPVVDEDGVIG
FT                   QVTRVFPLQAEVTLLTDKDQAVPVEILRTGLRSVIYGTPKGDTLDLRFVPISADVQTGD
FT                   ELVTSGLDGVYPPGLPVAKVVRVDKQADTAFARVVSLPVAAVRGARQVLVLHVQNTAPP
FT                   RPADEPDAATVAKEAKAKKGAKAADGKGAADKSAARSADKNAADKAPAEKPAAKSTEKA
FT                   PAKAPVDKKSDKPAADRKAEKPAAAKNAKPQAEPGAQP"
FT   gene            complement(50249..51292)
FT                   /locus_tag="BC1002_0042"
FT   CDS_pept        complement(50249..51292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0042"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="KEGG: bgl:bglu_1g33940 putative rod
FT                   shape-determining protein; TIGRFAM: cell shape determining
FT                   protein, MreB/Mrl family; PFAM: cell shape determining
FT                   protein MreB/Mrl"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14155"
FT                   /db_xref="GOA:D5W9T3"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9T3"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ADG14155.1"
FT                   /translation="MFGFLRSYFSNDLAIDLGTANTLIYMRGKGIVLDEPSVVSIRQEG
FT                   GPNGKKTIQAVGKEAKQMLGKVPGNIEAIRPMKDGVIADFTVTEQMIKQFIKTAHESRM
FT                   FSPSPRIIICVPCGSTQVERRAIKEAAHGAGASQVYLIEEPMAAAIGAGLPVSEATGSM
FT                   VVDIGGGTTEVGVISLGGIVYKGSVRVGGDKFDEAIVNYIRRNYGMLIGEQTAEAIKKE
FT                   IGSAFPGSEVKEMEVKGRNLSEGIPRSFTISSNEILEALTDPLNQIVSSVKIALEQTPP
FT                   ELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVVRGSGMALERMDKL
FT                   GSIFSYE"
FT   gene            51667..51966
FT                   /locus_tag="BC1002_0043"
FT   CDS_pept        51667..51966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0043"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="KEGG: bxe:Bxe_A4397 aspartyl/glutamyl-tRNA
FT                   amidotransferase subunit C; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, C subunit; PFAM: Glu-tRNAGln
FT                   amidotransferase C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14156"
FT                   /db_xref="GOA:D5W9T4"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9T4"
FT                   /inference="protein motif:TFAM:TIGR00135"
FT                   /protein_id="ADG14156.1"
FT                   /translation="MALTLTDVKRIAHLARLELADSDAEHTRAQLNDFFGLVEQMQAVD
FT                   TTGIAPLAHPIEQIEDVALRLRDDAVTETVEREAFQRPAPAVQDGLYLVPKVIE"
FT   gene            52125..53612
FT                   /locus_tag="BC1002_0044"
FT   CDS_pept        52125..53612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0044"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /note="KEGG: bpy:Bphyt_0328 aspartyl/glutamyl-tRNA
FT                   amidotransferase subunit A; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14157"
FT                   /db_xref="GOA:D5W9T5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9T5"
FT                   /inference="protein motif:TFAM:TIGR00132"
FT                   /protein_id="ADG14157.1"
FT                   /translation="MHEKSLTELRAALAAKECSAVELAQLYLKRIDAANSLNAFIQVDP
FT                   ELTLAQAKAADALLHTGHAGPLVGLPIAHKDVFVTKGWRSTAGSKMLANYESPFDATVV
FT                   ARLQNAGMVCVGKTNMDEFAMGSSNENSYFGAVQNPWDRKAVPGGSSGGSAAAVAARLA
FT                   PAATGTDTGGSIRQPASFSGITGIKPTYGRVSRYGMIAFASSLDQGGPMAQSAADCATL
FT                   LNAMAGFDERDSTSLSHEPEDYTRYLGKSWRDGGAEKPLAGLRIGLPKEYFGAGLADEV
FT                   RASIDAALKQYEALGATLVEVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRFGHRAAE
FT                   YRDLLDMYKKSRAEGFGPEVKRRILVGTYVLSHGYYDAYYLQAQKIRRIIAQDFQEAFK
FT                   QCDVIMGPVAPSVAWDIGAKGDDPVQMYLADIYTLSVSLAGLPGMSVPCGFGAGANAQR
FT                   PVGLQIIGNYFNEARMLQVADAFQRATDWHRQAPAGV"
FT   gene            53618..55093
FT                   /locus_tag="BC1002_0045"
FT   CDS_pept        53618..55093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0045"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="KEGG: bpy:Bphyt_0329 aspartyl/glutamyl-tRNA
FT                   amidotransferase subunit B; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, B subunit; PFAM: GatB region; GatB
FT                   central domain protein; Asn/Gln amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14158"
FT                   /db_xref="GOA:D5W9T6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9T6"
FT                   /inference="protein motif:TFAM:TIGR00133"
FT                   /protein_id="ADG14158.1"
FT                   /translation="MTKQWEVVIGLETHTQLSTHSKIFSGTATQFGAAPNTQASPVDLA
FT                   LPGTLPVMNRGAVERAIQFGLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQG
FT                   GQVTIQVPANEKAGKEAYEKTINLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEI
FT                   VTEPEMRSAAEAVAYAKSLHTLVVWLGICDGNMQEGSFRCDANVSVRPLGQKEFGTRAE
FT                   IKNLNSFRFLEEAIQYEVRRQIELIEDGGTVVQETRLYDPDKRETRSMRSKEDAHDYRY
FT                   FPDPDLMPLMIDAAWVERVRSEMPELPEAIQRRFVSQYGLTPYDANVLTSSKATAAYYE
FT                   AVVAKAGEANAKVAANWVMGEVSSQLNREGLDIAACPVSAAQLALVLQRIADGTISNKI
FT                   AKEIFLAIWEEKATDEAAADRIIEAKGLKQISDTGALEAIIDEVLAANQKSVDEYRAGK
FT                   EKAFNALIGQAMKATKGKANPAQVNELLKKKLS"
FT   gene            55203..56042
FT                   /locus_tag="BC1002_0046"
FT   CDS_pept        55203..56042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0046"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   bxe:Bxe_A4394 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14159"
FT                   /db_xref="GOA:D5W9T7"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9T7"
FT                   /inference="protein motif:PFAM:PF03976"
FT                   /protein_id="ADG14159.1"
FT                   /translation="MTKHPDLDDFRVPYFDDGKKRNHFSLDHFDPKAKPFSSGSKDADR
FT                   ARLSEVGLLLDNLQERLHAQRKRRVLLVLQGMDTSGKDGTIRAVFHEVDPLGLRIVPFK
FT                   APTPVELAHDFLWRVHSQAPAAGELTIFNRSHYEDLLVPTVQGELDADAFQQRCCHIRQ
FT                   FEQLLAYSGATILKCMLHISKDEQRVRLQERIDDPLKHWKFEVSDLEARKQWDAYQNAY
FT                   RDALAATSTEYAPWYVIPADSKTHRNVMVAELLLRTLNELKLEYPPAKESLKGVKVE"
FT   gene            56095..56874
FT                   /locus_tag="BC1002_0047"
FT   CDS_pept        56095..56874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0047"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="TIGRFAM: exodeoxyribonuclease III Xth;
FT                   exodeoxyribonuclease III; KEGG: bxe:Bxe_A4393
FT                   exodeoxyribonucleaseiii xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14160"
FT                   /db_xref="GOA:D5W9T8"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9T8"
FT                   /inference="protein motif:TFAM:TIGR00633"
FT                   /protein_id="ADG14160.1"
FT                   /translation="MLRVITANLNGIRSAAKKGFFEWFGEQGADVLCVQEIKCSQDDMT
FT                   PEFMAPHDFTGYFQHAVKKGYSGAGVYTRHEPDEVVIGFGSEEFDPEGRYVELRFGKLS
FT                   VVSVYVPSGSSGDERQQAKFRFMDEFMPHLAELAKEREVIVCGDVNIVHKEIDIKNWKS
FT                   NQKNSGCLPEERAWLDKLFDEVGYVDVFRTLDQRPEQYTWWSNRGQAYAKNVGWRIDYQ
FT                   IATPGIASKAKRTDVFRDIKFSDHAPLTVDYDHKVKK"
FT   gene            complement(56936..58219)
FT                   /locus_tag="BC1002_0048"
FT   CDS_pept        complement(56936..58219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0048"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: bpy:Bphyt_0332
FT                   peptidase M48 Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14161"
FT                   /db_xref="GOA:D5W9T9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9T9"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADG14161.1"
FT                   /translation="MKVPFPTRARRTALSAVGVLGCASVALAMPMGAHAAGTPATGASP
FT                   VSGAQAPAPAAAAATTSGATANPAPTPAAKTATSGASAENATSAAAGNSGTGGGNPGAN
FT                   NSIGANALSSPSASGSAPSAAASGSTPQSAQPPAAAKAPAGASAPAAVPPPYYVSPQLR
FT                   YGGYMVFRNLIPSSMLEAQAAEEFSQIVYGASHANRLYGDTDARVTRVRSIIDRMIPYS
FT                   LKWNERAKGWKWEVAVVRSNDIRMYCLPGGKIVVYSGILDRVRLNDNEVAMLIGHEIAH
FT                   ALREHARMRLGQLQASQLDSSGTIPQLFGLADLGMAPLGIGSRLLEMKYESTDETEADV
FT                   IGSDIASRAGFDPRSAVTLWDKLAQATRGNREQGFIYVHPFTAARRDDIIKRLPDMLSL
FT                   YAKAIGRSVDELPDYAGIGRPTRKTARD"
FT   sig_peptide     complement(58112..58219)
FT                   /locus_tag="BC1002_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 36"
FT   gene            complement(58216..59610)
FT                   /locus_tag="BC1002_0049"
FT   CDS_pept        complement(58216..59610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0049"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_A4390 major facilitator superfamily
FT                   (MFS)muropeptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14162"
FT                   /db_xref="GOA:D5W9U0"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9U0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG14162.1"
FT                   /translation="MSNPPHEAPALTAHEEHPGWRAFLNTRMLICVFLGFTSGLPLFTL
FT                   VYLVQAWLRSEGVNLKEIGLFALIQFPYTWKFVWAPLMDRYVPRVPGWRPGRRRGWMLV
FT                   TQLLVAGAMATLGFVSPRESIWSVAALTALVAFFGASSDIVIDAYRRELLSDTQQGLGN
FT                   AVHVNAYKIAALVPGSLALILSDHLPWSTVFIVTAAFMLPGVLMTLVVREPEVHGQPPK
FT                   NLREAIVEPFREFIQRDGWRGALFVLGFIFLYKLGDTMATTLSTSFFLDIGFSRTQIGV
FT                   IAKTTAFGASLAGGIIGGIWLMRIGIGRGLWIFGLLQMVSTLGFAWLAHLGPDSPGLAA
FT                   IYNIAVALSQGTTKLLSLVGIDWSVQLDPRSVALALVYGFETFATGLTMAAFTAYIAST
FT                   TDPRYTATQFALFTSLASVPRTLASAASGFVVARIGWFDYFILCTALAVPGMLLLVRIA
FT                   PWRDRS"
FT   gene            complement(59625..60233)
FT                   /locus_tag="BC1002_0050"
FT   CDS_pept        complement(59625..60233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0050"
FT                   /product="methionine biosynthesis protein MetW"
FT                   /note="KEGG: bpy:Bphyt_0334 methionine biosynthesis protein
FT                   MetW; TIGRFAM: methionine biosynthesis protein MetW; PFAM:
FT                   Methionine biosynthesis MetW protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14163"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9U1"
FT                   /inference="protein motif:TFAM:TIGR02081"
FT                   /protein_id="ADG14163.1"
FT                   /translation="MNQRALDYLASRPDFRAIARWVEPRATVLDLGCGDGSLLSLLNEE
FT                   LEVQGYGIEINDAGVLAATQNGVNVIQQNLEDGLRLFEDGSFDFAVLSQTLQTIHQTAA
FT                   ILRETVRVGKQCIVSFPNFGYWAHRLSVLQGRMPVSKSLPYQWHNTPNVRVLTIKDFEA
FT                   LAPEVGIEILDRVVLHDGQVVRWGVNWRGSLAVYRVKKS"
FT   gene            complement(60230..61375)
FT                   /locus_tag="BC1002_0051"
FT   CDS_pept        complement(60230..61375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0051"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="TIGRFAM: homoserine O-acetyltransferase; KEGG:
FT                   bpy:Bphyt_0335 homoserine O-acetyltransferase; PFAM:
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14164"
FT                   /db_xref="GOA:D5W9U2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9U2"
FT                   /inference="protein motif:TFAM:TIGR01392"
FT                   /protein_id="ADG14164.1"
FT                   /translation="MDSIGIVAPQKMHFTEPLRLRNGSSLAGYDLMVETYGTLNAAHSN
FT                   AVLVCHALNASHHVAGVYADNPKDIGWWDNMVGPGKPLDTDKFFVIGVNNLGSCFGSTG
FT                   PMSIDPATGKPYGATFPVVTVEDWVNAQARVADAFGITRFAAVMGGSLGGMQALAWSMM
FT                   YPERIAHCIVIASTPKLSAQNIAFNEVARSAILSDPDFHGGNYYAHGVKPKRGLRVARM
FT                   IGHITYLSDDDMAEKFGRSLRRAEGALDDYNFSFDVEFEVESYLRYQGDKFADYFDANT
FT                   YLLITRALDYFDPAKAFDGDLTAALEHTTAKYLIASFSTDWRFAPARSRELVKALLDHK
FT                   RTVTYAEIDAPHGHDAFLLDDARYHNLLRAYYERIANEVNA"
FT   gene            complement(61696..62406)
FT                   /locus_tag="BC1002_0052"
FT   CDS_pept        complement(61696..62406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0052"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bpy:Bphyt_0336
FT                   nucleoid occlusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14165"
FT                   /db_xref="GOA:D5W9U3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9U3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG14165.1"
FT                   /translation="MQPIDKPDEASAAASPAAPAATRATRPKPGERRVHILQALASMLE
FT                   APKSEKVTTAALAARLGVSEAALYRHFASKAQMFEGLIEFIEQTLFGLINQITGHENNG
FT                   VLQARSIALMLLNFPAKNPGMTRVLTCEALVGEHERLTERVNQMLERVEASLKQCLRLA
FT                   QTEALARADNHPTDTPDSQTAPQTTTLPAGYDPAIRASLLVSYVIGRWHRYVRSGFARS
FT                   PAEHADEQLLLILQ"
FT   gene            complement(62448..63215)
FT                   /locus_tag="BC1002_0053"
FT   CDS_pept        complement(62448..63215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0053"
FT                   /product="pyrimidine 5'-nucleotidase"
FT                   /note="KEGG: bxe:Bxe_A4386 HAD family hydrolase; TIGRFAM:
FT                   pyrimidine 5'-nucleotidase; HAD-superfamily hydrolase,
FT                   subfamily IA, variant 3; PFAM: Haloacid dehalogenase domain
FT                   protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14166"
FT                   /db_xref="GOA:D5W9U4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9U4"
FT                   /inference="protein motif:TFAM:TIGR01993"
FT                   /protein_id="ADG14166.1"
FT                   /translation="MRTPTSRRRRPDIASGKPVWLFDLDNTLHHASHAIFPAINRGMTQ
FT                   YIIDALQVDTDEANRLRTGYTLRYGAALLGLTRHHPLDAHDFLKVVHTFPDLGSMIRHE
FT                   RGVARLVAALPGRKIVLTNAPETYARAVLAELRIERLFERVIAIEHMRDRRQWRAKPDH
FT                   AMLRRAMRDAQVSLKDAILVEDTRSHLKNYRRLGIRTVWITGHLPRKPHADGVPTRLPG
FT                   TGRPHYVDRSIRSLKSLRLGTRSVRWKGRKPGP"
FT   gene            complement(63379..64278)
FT                   /locus_tag="BC1002_0054"
FT   CDS_pept        complement(63379..64278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0054"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="TIGRFAM: acetylglutamate kinase; KEGG:
FT                   bpy:Bphyt_0338 acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14167"
FT                   /db_xref="GOA:D5W9U5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9U5"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ADG14167.1"
FT                   /translation="MSELPDLSQIAPTLKAEILAEALPYIRQYHGKTVVIKYGGNAMTE
FT                   ERLKQGFARDVILLKLVGINPVIVHGGGPQIDQALKKIGKQGTFIQGMRVTDEETMEVV
FT                   EWVLGGEVQQDIVMLINHFGGHAVGLTGKDGGLIHARKMLMPDREKPGQYVDIGQVGEV
FT                   EAINPAVVKALQDDAFIPVISPIGFGEDGLSYNINADLVAGKLAVVLNAEKLVMMTNIP
FT                   GVMDKEGNLLTDLSAREIDGLFEDGTISGGMLPKISSALDAAKSGVRSVHIIDGRIEHS
FT                   VLLEILTEQPFGTMIRSH"
FT   gene            64503..64772
FT                   /pseudo
FT                   /locus_tag="BC1002_0055"
FT   gene            complement(64807..66181)
FT                   /pseudo
FT                   /locus_tag="BC1002_0056"
FT   gene            66566..67876
FT                   /locus_tag="BC1002_0057"
FT   CDS_pept        66566..67876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0057"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: bpy:Bphyt_0340 integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14168"
FT                   /db_xref="GOA:D5W9U6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9U6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG14168.1"
FT                   /translation="MQRITNTGRVNLGHLFWLRSLAIIGQLLTIAFVQIFIGANLPLPA
FT                   MLLVIGLEVLFNALTWFRVSQQRPESNIELFGQIWVDLGALSALLFLSGGTTNPFVSLY
FT                   LPSLAIAAAVLPWYLMAWLAAFAVACYAMLSFDSVPLNLENPANLFDYYRSGMWVNFMV
FT                   SVGLIAWFVARMSRALRLRDAALGEAQQRLLQDERAVALGVQAATVAHEIGTPLSTIAM
FT                   LSEELRDAARTDAGLAPYRADLELLEQQMTLCTSALARLRSRATTTTNRQPVDEWLESF
FT                   AEQWRLRHPHVKFERLGTPPADVSLNDTVAVSQILTILLDNAARASRDHVTLSCTLAPR
FT                   GDQIEFEVCDHGPGIPVALRGSLGTMPVESTQGGHGVGLYLAFSAAARLKGSIELTDAN
FT                   GGRPRGTRAVLRLPLGARKISGASPQGAAPSNTEKQA"
FT   gene            67873..68415
FT                   /locus_tag="BC1002_0058"
FT   CDS_pept        67873..68415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0058"
FT                   /product="two component transcriptional regulator, Fis
FT                   family"
FT                   /note="KEGG: bpy:Bphyt_0341 two component transcriptional
FT                   regulator, fis family; PFAM: response regulator receiver;
FT                   helix-turn-helix Fis-type; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14169"
FT                   /db_xref="GOA:D5W9U7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9U7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG14169.1"
FT                   /translation="MSEKNFLVIDDDEVFSGILARGLTRRGYTVSEAHNADEAIRLANQ
FT                   QKFSEITVDLHLGNDSGLTLVAPLRDLQPDARMLVLTGYASIATAVQAVKDGADNYLAK
FT                   PANVETILSALQSEASALQAEEAIEHPQPLSVARLEWEHIQRVLAEHNGNISATARALN
FT                   MHRRTLQRKLAKRPVRQ"
FT   gene            complement(68507..69853)
FT                   /locus_tag="BC1002_0059"
FT   CDS_pept        complement(68507..69853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0059"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="TIGRFAM: heat shock protein HslVU, ATPase subunit
FT                   HslU; PFAM: ATPase AAA-2 domain protein; KEGG:
FT                   bpy:Bphyt_0342 ATP-dependent protease ATP-binding subunit
FT                   HslU; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14170"
FT                   /db_xref="GOA:D5W9U8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9U8"
FT                   /inference="protein motif:TFAM:TIGR00390"
FT                   /protein_id="ADG14170.1"
FT                   /translation="MSTMTPAEIVSELDKHIIGQGRAKKAVAVALRNRWRRQQVDEPLR
FT                   QEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLI
FT                   EISVKQTRETEMRKVRTKAGDLAEDRILDILLPTARPVGFGSSTSSTDTADEGSTTRQT
FT                   FRKRLREGQLDDKEIELDVEQPQVGMDIMGPPGMEDMTEQIRSMFANIGGGKKTRRKMK
FT                   VKEALKVLTDEEAGKMLNDEEVKSKAVQNVEQNGIVFLDEIDKIASRNEAGGGEVSRQG
FT                   VQRDLLPLVEGTTINTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSL
FT                   SVNDFESILVSTDASLVKQYQALLATEDVHLEFADDGIRRLAEIAYSVNEKTENIGARR
FT                   LYTVIEKLLEEVSFSAGNHSGRTVQIDAAYVDRALNEVAEDEDLSRYVL"
FT   gene            complement(69863..70399)
FT                   /locus_tag="BC1002_0060"
FT   CDS_pept        complement(69863..70399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0060"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   bxe:Bxe_A4380 ATP-dependent protease peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14171"
FT                   /db_xref="GOA:D5W9U9"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9U9"
FT                   /inference="protein motif:PFAM:PF00227"
FT                   /protein_id="ADG14171.1"
FT                   /translation="MEQFHGTTIVSVRRGNKVALGGDGQVTLGNIVMKGGAKKVRRIYN
FT                   GKVLVGFAGGTADAFSLLDRFEAKLEKHQGNLTRAAVELAKDWRTDRMLRRLEAMLITA
FT                   DATTTLVITGNGDVLDPEGGICAIGSGGAYAQAAAKALADNTELSPRDIVEKSLEIAGD
FT                   MCIYTNHNRVIETIE"
FT   gene            complement(70739..71158)
FT                   /locus_tag="BC1002_0061"
FT   CDS_pept        complement(70739..71158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0061"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="KEGG: bph:Bphy_0071 TraR/DksA family transcriptional
FT                   regulator; TIGRFAM: RNA polymerase-binding protein DksA;
FT                   PFAM: zinc finger DksA/TraR C4-type"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14172"
FT                   /db_xref="GOA:D5W9V0"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9V0"
FT                   /inference="protein motif:TFAM:TIGR02420"
FT                   /protein_id="ADG14172.1"
FT                   /translation="MTTKRLLTEAEILKMSDKDYMNEDQLAFFKNRLEQLQADILRNAG
FT                   QTTENLRETVIVPDPADRATIEEEHALELRTRDRERKLLKKVQQSIARIEAGDYGWCEE
FT                   TGEPIGIPRLLARPTATLSLEAQERRELRQKLFGD"
FT   gene            complement(71840..73147)
FT                   /locus_tag="BC1002_0062"
FT   CDS_pept        complement(71840..73147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0062"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: bxe:Bxe_A4377
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14173"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9V1"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ADG14173.1"
FT                   /translation="MPAAAPASLRAAGHQQAARRPPLRSPGKYVSITGWIGPRHLAAAA
FT                   GLTLLASLALAFDHAPFHDLQATHMIPVTILTGFLGSGKTTLLKRILNEKHGMKIAVIE
FT                   NEFGEENIDNEILVQDTTEQIIQMSNGCICCTIRGDLSRVLNDLAAKKQAGEVDFDRVV
FT                   IETTGLANPGPVAQTFFMDDQIASDFLLDAIITLVDAKHADRQLDEHEVVQRQVGFADR
FT                   LFITKADLVDERHVGDLRHRLLHMNPKAAIRVVNFGEADIKEIFDLRGFNLNSKLEIDP
FT                   DFLAEDEHAHSHAHAHDEHGHAHGDHDHDHANCDHDHGHCDHEGHDHGHHHHAHHDDKI
FT                   KSFVYRSDRPFDPNKLEDFLGGILQIYGEHLLRYKGVLYMKGVDRKVVFQGVHQMMGSD
FT                   LAAKWQPAEKKTNKMVFIGIELPRDLITDGLDACLA"
FT   gene            complement(73175..74377)
FT                   /locus_tag="BC1002_0063"
FT   CDS_pept        complement(73175..74377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0063"
FT                   /product="PUA domain containing protein"
FT                   /note="SMART: PUA domain containing protein; KEGG:
FT                   bpy:Bphyt_0346 PUA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14174"
FT                   /db_xref="GOA:D5W9V2"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9V2"
FT                   /inference="protein motif:SMART:SM00359"
FT                   /protein_id="ADG14174.1"
FT                   /translation="MNTVTLKPSKEKSLLRRHPWVYANAIEHVDGRPAPGATVLVRAHD
FT                   GRFLARAAYSPHSQIRARVWSFDEAEPIDHAFFKRRVQRAFAHRQAMVRDTGAVRLIFG
FT                   EADGLPGLIVDYYVAEDAGQRSQIVCQFMAAGVEAWKDAIVAALVGATGCPNVYERSDV
FT                   SIRQKEGLEQVTGVLAGEPPSEKLIASENGVRYHVDVRNGHKTGFYVDQRDNRLLVQQF
FT                   AKDRDVLNCFCYTGGFSLAALKGGAKRVVSVDSSGEALALAQQNVAANGFDVDRASWLD
FT                   ADAFKTLRRLYDEGERFDLIVLDPPKFAPSREHVDRASRAYKDINLTGLKLLRPGGLLF
FT                   TYSCSGAIDPELFQKIVSGAAADARVDARILKRLGAGVDHPLLTAFPEGEYLKGLLLQI
FT                   A"
FT   gene            complement(74439..75362)
FT                   /locus_tag="BC1002_0064"
FT   CDS_pept        complement(74439..75362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0064"
FT                   /product="tyrosine recombinase XerC"
FT                   /note="KEGG: bxe:Bxe_A4375 site-specific tyrosine
FT                   recombinase XerC; TIGRFAM: tyrosine recombinase XerC; PFAM:
FT                   integrase family protein; integrase domain protein SAM
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14175"
FT                   /db_xref="GOA:D5W9V3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9V3"
FT                   /inference="protein motif:TFAM:TIGR02224"
FT                   /protein_id="ADG14175.1"
FT                   /translation="MTAADPIAAYLSHLEHERRLSEHTLRGYTHELAELKLLAKGRPLE
FT                   SLTAVDIRGAVARAHAGGLTARSIGHRLSAWRAFYRWLAGHVELPANPVAAVRAPKQAK
FT                   TLPKALSVDDTARLMDSPPADSPEGLRDHAMLELFYSSGLRLAELVGLDVRFADVDGYR
FT                   SAGWLKLDSGEVEVLGKGNRRRVVPVGSKAVAALNAWLAVRERMVRHDPHPLFLSARGN
FT                   RLSPNVVRERVKRAALAAGIPANVHPHVLRHSFATHVLQSSGDLRAVQELLGHASITAT
FT                   QVYTGLDFQHLAHVYDSAHPRAKKRN"
FT   gene            complement(75386..76144)
FT                   /locus_tag="BC1002_0065"
FT   CDS_pept        complement(75386..76144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0065"
FT                   /product="protein of unknown function DUF484"
FT                   /note="PFAM: protein of unknown function DUF484; KEGG:
FT                   bxe:Bxe_A4374 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14176"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9V4"
FT                   /inference="protein motif:PFAM:PF04340"
FT                   /protein_id="ADG14176.1"
FT                   /translation="MNDREVAEYLLANPEFFVEHAETLATIRLANPHGKAAVSLQERQM
FT                   EMLRDKNKHLERRLAELLRYGHENDSIASKFNRWTIRVMAERDPYALPRTIAGGLRDVF
FT                   DVPQAALRVWDVAEPYAQADFARHVSEEVRIFAGSLSTPYCGANTGFEAAQWLAQMAGA
FT                   SNGAGNPATNPATSATDDPSAASSETAQTTESIALLALRDPEGAEDAPTFGLLVMGSSD
FT                   PRRFHEGMATDFLTQIGALASAALSRLLPR"
FT   gene            complement(76202..77314)
FT                   /locus_tag="BC1002_0066"
FT   CDS_pept        complement(76202..77314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0066"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="TIGRFAM: diaminopimelate epimerase; KEGG:
FT                   bpy:Bphyt_0349 diaminopimelate epimerase; PFAM:
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14177"
FT                   /db_xref="GOA:D5W9V5"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9V5"
FT                   /inference="protein motif:TFAM:TIGR00652"
FT                   /protein_id="ADG14177.1"
FT                   /translation="MKRHPGRLSAIPFPMGQRVSSAIGPARLEWVIHPTAAEAPIFGSA
FT                   RTREALRSNGYTENVKLKFTKMHGAGNDFVVLDGYTQPLDLTTAQVRALANRHFGVGAD
FT                   QLLLVEKPTVEGVDFRYRIFNCDGGEVEHCGNGARCFVKFVRERGLTDQRSVRVQVQKG
FT                   TITLTMQDNGEVIVDMGTPVFDPELVPFATKGLQGRREGADTLWPLDVNGTTRWMSVVS
FT                   MGNPHAVQVVDDAEAFPVLVEGPAIERHTRFPQRVNAGFMQIVNRNEIRLRVYERGAGE
FT                   TLACGTGACAAVGAGIRRGLLDSPVLVHTHGGDLTITWDIAQPGAPLLMAGPAATVFEG
FT                   EIELAEEASGASPDSSQHHSSRAAPVAPSV"
FT   gene            complement(77367..78251)
FT                   /locus_tag="BC1002_0067"
FT   CDS_pept        complement(77367..78251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0067"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   bpy:Bphyt_0350 lipid A biosynthesis lauroyl
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14178"
FT                   /db_xref="GOA:D5W9V6"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9V6"
FT                   /inference="protein motif:PFAM:PF03279"
FT                   /protein_id="ADG14178.1"
FT                   /translation="MLSRYGAKLAIGLLKLFALLPYGFVARLGDGLGWLLYQIPSRRKR
FT                   IVHTNLKLCFPDWSAERREDVAQKHFRHAIRSYLERSVQWFGSAKKLEKLIQLDSAIDL
FT                   TDPNLPPTLFLGFHFVGIEAGSIFLNYSLKRQCGSLYQPMSNQELEEIAKAARARFGAD
FT                   MASRADSARVVLRWLRERKPVMLGADMDYGARNSTFVPFFGVPTCTLTAVGRLAKVGHA
FT                   QVVPFIGEVLPNYKGYRLKVFKPWANYPTGDDDADARRMNEFLEEQIPLMPEQYYWVHK
FT                   RFKTRPPGVPGVY"
FT   gene            78534..79721
FT                   /locus_tag="BC1002_0068"
FT   CDS_pept        78534..79721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0068"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="TIGRFAM: S-adenosylmethionine synthetase; KEGG:
FT                   bpy:Bphyt_0351 S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14179"
FT                   /db_xref="GOA:D5W9V7"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9V7"
FT                   /inference="protein motif:TFAM:TIGR01034"
FT                   /protein_id="ADG14179.1"
FT                   /translation="MANDYLFTSESVSEGHPDKVADQISDAILDAILAQDKYSRVAAET
FT                   LCNTGLVVLAGEITTTANVDYIQIARNTIKRIGYDNTDYGIDYRGCAVLVAYDKQSPDI
FT                   AQGVDRAHDNNLDQGAGDQGLMFGYACEETPELMPLPIHLSHRLVERQANLRRDGRLPW
FT                   LRPDAKSQVTVRYVDGKPHSIDTVVLSTQHAPDISLEALREAVIEEVIKPTLPAELIKG
FT                   DVKYLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYA
FT                   GRYVAKNIVAAGLASRCLIQVSYAIGVAQPTSVMVNTFGTGRVSDATITELVRQHFDLR
FT                   PKGIIQMLDLLRPVYEKSAAYGHFGREEPEFTWEATDKALALAEAAGTEPVAAIA"
FT   gene            complement(79929..80291)
FT                   /locus_tag="BC1002_0069"
FT   CDS_pept        complement(79929..80291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14180"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9V8"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4370"
FT                   /protein_id="ADG14180.1"
FT                   /translation="MHTLLSTRLTRAALKAARPARRHMMRALRHHAARTRALGEQWRDA
FT                   KAVDGFRTWFHTFFSALRQQSGTRRLSLRTLLRKPTPLRLAVAKRAPAAHTPASRRPRR
FT                   LSTSSSGWFAFAFASR"
FT   gene            80807..81568
FT                   /locus_tag="BC1002_0070"
FT   CDS_pept        80807..81568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0070"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase; KEGG:
FT                   bpy:Bphyt_0353 phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14181"
FT                   /db_xref="GOA:D5W9V9"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9V9"
FT                   /inference="protein motif:PFAM:PF05721"
FT                   /protein_id="ADG14181.1"
FT                   /translation="MSLHSKKEQIQTLREQGFVVVPGLVSPERCDELKRIAQRQLQEAA
FT                   APIEFEADLKYPGAPSSKDAPGGHTVRRLLDAYGRHPAFAQWATAPEIRGWMELYFGEE
FT                   PRLSRAHHNCMMTKHPAYGSLTGWHRDVRYWSFERDDLVSVWLAVGPETIDNGALWFVP
FT                   QSHGAAFTSDRFDEAKFFRTDLAENEAAIRTAVSPELKTGDVVFFHCNTLHSAGKNLSD
FT                   QVKFSLVFTYHGVSNVPLPGTRSAAKPEIAF"
FT   gene            complement(81600..81806)
FT                   /locus_tag="BC1002_0071"
FT   CDS_pept        complement(81600..81806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0071"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0354 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14182"
FT                   /db_xref="GOA:D5W9W0"
FT                   /db_xref="InterPro:IPR021521"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9W0"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0354"
FT                   /protein_id="ADG14182.1"
FT                   /translation="MTKAISIALIVGSIVLLYFGGQAFNSVSSDVSRFFTGSPSNKAIV
FT                   LIVAGVVATLAGLTGIAMSGRKR"
FT   sig_peptide     complement(81729..81806)
FT                   /locus_tag="BC1002_0071"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.494 at
FT                   residue 26"
FT   gene            82034..83077
FT                   /locus_tag="BC1002_0072"
FT   CDS_pept        82034..83077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0072"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bpy:Bphyt_0355
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14183"
FT                   /db_xref="InterPro:IPR005399"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9W1"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADG14183.1"
FT                   /translation="MAYEAASERYSDMQYRVCGKSGLKLPALSLGLWHNFGDTTPISTQ
FT                   RDILRTAFDLGITHFDLANNYGPPYGSAETNFGRLFKDDFKPYRDELLISSKAGWDMWP
FT                   GPYGQGGGSRKYVLASLDQSLKRMGLEYVDIFYSHRFDAHTPLEETAGALASAVQQGKA
FT                   LYIGISSYSSAKTREMTKLLAEYKVPLLIHQPSYNMLNRWIEQDLLDTLDEVGAGAIAF
FT                   TPLAQGLLTGKYLNGVPADARVNKPGGGSLKDEHLSPQNIEHVRKLNDIAQRRGQSLAQ
FT                   MALAWALRDQRVTSVLIGASRAEQVRENVGALKNLAFSADELAEIDRYATEGGINLWEK
FT                   PSTDQAI"
FT   gene            complement(83178..83360)
FT                   /locus_tag="BC1002_0073"
FT   CDS_pept        complement(83178..83360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14184"
FT                   /db_xref="GOA:D5W9W2"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9W2"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0356"
FT                   /protein_id="ADG14184.1"
FT                   /translation="MTYFTIGDFILVIPMALAGALFVGALPCKTELRHNALRVLGALIG
FT                   VMCAVALVEGLPALV"
FT   gene            83462..83773
FT                   /locus_tag="BC1002_0074"
FT   CDS_pept        83462..83773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0074"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GF24738 gene product from transcript
FT                   GF24738-RA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14185"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9W3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14185.1"
FT                   /translation="MERRDGASVRVGAYSQAAEPRRSGRATIGAAQQNPPESTKRSLTQ
FT                   AFRFSADPRGMGDCVRLFASAQVPRRDQADSEQRTDQPDDPVPAVTGPHVTAIRADQA"
FT   gene            complement(83645..84922)
FT                   /locus_tag="BC1002_0075"
FT   CDS_pept        complement(83645..84922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0075"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_0357 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14186"
FT                   /db_xref="GOA:D5W9W4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9W4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG14186.1"
FT                   /translation="MTLPPQSQRTASAVPSPLAASAASTRTTSVSDIPYLERGSRAYWR
FT                   ASLALLFAGYATFSLLYCVQPLLPSFSEAFNVTPAQSSLSLSLSTAALALAIFVAGFVS
FT                   EGWSRHKLMTLSLTVSSVLTIGVSVAPQWHQLLILRTLEGLALGGVPAVAMAYLAEEVH
FT                   PDGLGLAMGLYVGGTAIGGMAGRVITGVVADLFSWRVAIGTIGVLGLLSMLAFRALLPP
FT                   SRHFVPRRGLGFAHHRTLLLRQFTRPGLPLLFLLGFVLMGSFVTLYNYIGYRLLAPPYR
FT                   LNQTEIGAIFIVYLVGVVASPWSGRMADTFGRARVLIGSLLLMVFGLALTMLHPLPAIA
FT                   TGIACATFGFFAGHSVASGWVGRLAKDAKGQAAALYLLAYYIGSSLVGSYGGHVWASHG
FT                   WNGVVGLVGALLAIGLIAARHLRGRE"
FT   gene            complement(85057..86637)
FT                   /locus_tag="BC1002_0076"
FT   CDS_pept        complement(85057..86637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0076"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="KEGG: bpy:Bphyt_0358 RND efflux system, outer
FT                   membrane lipoprotein, NodT family; TIGRFAM: RND efflux
FT                   system, outer membrane lipoprotein, NodT family; PFAM:
FT                   outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14187"
FT                   /db_xref="GOA:D5W9W5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9W5"
FT                   /inference="protein motif:TFAM:TIGR01845"
FT                   /protein_id="ADG14187.1"
FT                   /translation="MIMKMSVMRRALASSAEFARGSASNSIRASAVALTLAGALGACTV
FT                   GPDYVKPAAVTPATWRELEGTGWKPAQPADTLTRGAWWRIYGDASLDALEPQVASANQD
FT                   VQAAEARFRAARASVAQYRSQFFPVVTAGVQYSRTRSSENVLHKSTAGLALNDYLVQVD
FT                   ASWEPDLWGRVSRSVEGAKAGAQASAADLDAALLSMQAELATDYFELRGLDQERRLLDD
FT                   TIKAYQEALELTQHRYAGGIATDADVAQAQTQLKTTQAQALDLGVQRAQLEHAVGILIG
FT                   QPPSTFTLPVAPLVAVPVIAAAGVPSGLLERRPDIAAAERHVAAMNAQIGVATAAFFPN
FT                   LVLAVTGGLEATNYSQWLLAPSRLWSLGPTLAGTLLDFGGRAAVKEQARAHYDESVAQY
FT                   RQTVLNAFGQVEDNLAALRVLEQEAAAQDDAVAAAQRALAVVSDRYRNGAITYLDVVVA
FT                   QTTTLTNERNAVSIARRRMAASVALVKALGGGWDTSVLPGDDALVHPSTATSGATQAPA
FT                   PASDAGAHS"
FT   gene            complement(86640..87950)
FT                   /locus_tag="BC1002_0077"
FT   CDS_pept        complement(86640..87950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0077"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: bxe:Bxe_A4363 RND efflux system membrane
FT                   fusion protein; TIGRFAM: efflux transporter, RND family,
FT                   MFP subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14188"
FT                   /db_xref="GOA:D5W9W6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9W6"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADG14188.1"
FT                   /translation="MEAQGPGGSGSGSGDGGHAAHDQAKARRTRLIMIAAAVAVLALAA
FT                   QGIWSRHDAHAALERDAEHTSQMSVEVVQPQKSSTGFDLTLPGNVQAFLDTPIYARTNG
FT                   YLKKWYADIGARVKSGQLLAEIDTPEIDDQLRAARADLANAEANYALAKSTADRWTDMF
FT                   RSKSVSKQETDEKVGDMLAKKATLDAARFNVARLEKTQSFQKVYAPFDGTVTARNVDVG
FT                   ALIDAGSSGGPAKELFHVAQADRLRVYVNVPQAYAQQVRAQQSAFLTLTETPSRHYPGT
FT                   VARTAGAVDPQQRTMLVEVDVDNRSGELLPGAYAQVHFALGAGTASFTLPGNALLFRPD
FT                   GVKVATVDPQHKVKLLPVSLGTDFGTRVAIVAGLQGNEQVILNPQDSIVDGAPVRIVPR
FT                   KAEDGAASEGAAGAAGATGAAASATAAQGGARPGART"
FT   gene            complement(88054..91236)
FT                   /locus_tag="BC1002_0078"
FT   CDS_pept        complement(88054..91236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0078"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   bxe:Bxe_A4362 AcrB/AcrD/AcrF family cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14189"
FT                   /db_xref="GOA:D5W9W7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9W7"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ADG14189.1"
FT                   /translation="MWIVRLALRRPYTFVVLALLLLIVGPLTILRTPTDIFPNIDIPVL
FT                   SVIWSYNGLPADEMERRIALNYERGLSVAVNDIEHTESTSLNGITVIKIFFQPGANIDE
FT                   ALAQVTALSQSQVRSLPPGITPPFILRYNASTVPILRLALSSASLTEQELFDFGNNFLK
FT                   TQLATVPGASAPLPYGGKQRQIMIDIDSRKLQERNLSPMDVVSAVSAQNLILPSGTAKI
FT                   GSTEYSVVMNGSPDSLAGLNNIPIRTTANGTIYIRDVAHVRDGYQPQTNIVRVNGQRAA
FT                   LLTINKSGNTSTLDIVDRIKTMMPTLRNLVPPSLNIDPVADQSLFVRASVEGVLREALI
FT                   AACLTGLMILLFLGNWRATLIIAVSIPLSMITSIIALSALGQTINIMTLGGLALAVGIL
FT                   VDDATVAIENISHQLEQGKTLEQAILDGAHQIAIPTLVSTLSICIVFVPMFLLTGVAHY
FT                   LFIPLAEAVVFAMLASYFFSRTLVPTLAKYLLRYHHKPADLHHAPAQTRNPFMRVHYAF
FT                   ERGFSRLRERYRVFLEARVARPGLFVTLFLMCCGASLLLLPFIGRDFFPAVDAGTIALH
FT                   MRAKTGMRVEETAVLTDRVDARIRQLIPAGELHSIIDNIGLPVSGINLSYSNTGTIGTS
FT                   DSDILITLNPEHHPSAGYVRTLRRTLTDEFPGVQFAFLPADIVSQTLNFGMPSAIDIQI
FT                   VGREVAANRAFAAKLLNRLRTVPGLVDARIQQPADLPRIFIDVDRTRAQQAGFSQRDIA
FT                   SNLLITLSGSQQTTPTFWLNPRNGVSYNVITEAPQYTIDSLQSLANIPLNANGHNNILG
FT                   SLATMRREASNAVLTHYNAQTTIDIYGTADGRDLGGVSDDIRKIIDESKAELPKSSTIE
FT                   LRGQVQTMNESFSGLLAGLLFAVLLVYLLIVVNFQSWLDPFIIITALPGALAGIVWMLF
FT                   LTHTTLSIPALTGAIMCIGIATANSILVISFAREQLLLHGDATRAAIEAGFTRFRPVLM
FT                   TALAMVIGMVPMAIGLGEGGEQNAPLGRAVIGGLAVGTLATLILVPVVFSMIYRRLAAR
FT                   HQRAAEHVVQKP"
FT   gene            91656..91868
FT                   /locus_tag="BC1002_0079"
FT   CDS_pept        91656..91868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bph:Bphy_0086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14190"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9W8"
FT                   /inference="similar to AA sequence:KEGG:Bphy_0086"
FT                   /protein_id="ADG14190.1"
FT                   /translation="MQVGSIVRSVHIAVPQGARGIVMRILGDMAMVAWYAGEPGASRQL
FT                   NTEPFFLEDLIDTGDLIRPAGAQTH"
FT   gene            92077..93123
FT                   /locus_tag="BC1002_0080"
FT   CDS_pept        92077..93123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0080"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   bxe:Bxe_A4360 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14191"
FT                   /db_xref="GOA:D5W9W9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9W9"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADG14191.1"
FT                   /translation="MRGMNDTIPDNSHPQAGADGAVPFARLTPETVLDAIDGVLATSGV
FT                   RTDGRLLPLNSYENRVYQVGVEDGPPVVAKFYRPERWSDAAILEEHAFVAELAAREIPA
FT                   VPARMLDGHTLHSFDGFRFSVFERRGGRAPDLDRRDTLEWLGRFIGRIHAIGQTQDYAE
FT                   RPALNIDTFGYEPRDFLLAHRFVPDDLRTAWETVVNLALEGVARAFERAGEIRTLRLHG
FT                   DCHPSNVLWTDAGPHFVDFDDSRMGPAIQDLWLLLPGERAEASRALSDLLAGYEDFCEF
FT                   EPRELYLIEALRTLRLIHYQAWLARRWNDPAFPAAFPWFNTQRYWEDRILEMREQIGAM
FT                   QEGPLWPV"
FT   gene            complement(93143..95041)
FT                   /locus_tag="BC1002_0081"
FT   CDS_pept        complement(93143..95041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0081"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   bpy:Bphyt_0363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14192"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9X0"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ADG14192.1"
FT                   /translation="MRLCLVVLASAGWLAGIHAASASVPVKLDDPYTNEGETQTFTINA
FT                   DGSYAKLDSMTLHVNNEAGVERVAQQYVWFNRNMADVQILEAYTVTTDGKRHDVAPEQI
FT                   RDVQEVRSFDAPMFQDIQEKVIVFPAVEPGARVHLTYRKTQRQPIVPGEFSDFTPPDLA
FT                   PTRNFRLIYDLPADKPLYADARGFSAVTPITRDGRTRYEFRYDKAHFDRLERGSVAYVS
FT                   YGDRLMVSTFPSYAAFAASYRGSAADPGTHDGAITQLAQQLTAHDHTAHDKAKTLYDWV
FT                   RRNIRYVAIYVGRGSVVPHSASAILANRYGDCKDHVALYGALLDAVSVRNEPALISSGT
FT                   IYTLPSVPGYGVINHAITWLPDLQMYADSTASNVEFGFLPSSDMDRPTVLIDDGVLAQT
FT                   PATAQMSRSTDLAIKIEPDGSASFTYRLQDAGPYAEQARARLRTQSPAQREESIQAELR
FT                   NVNLRGTATLTTSDLSAADGPLTLTMKGTLESLVVTGMTASIPALTSLGGGVEADTRYW
FT                   LGERKRTQPFVCHNLAIHERARIELPANFRVLDMPEAQRTQDRFVDYTSEYAFDPLSNV
FT                   VTMTRDGATHFDSDVCTPDDFTRMRPAIEAIGRDVRAQVIVRSTLVESSNVASQAP"
FT   sig_peptide     complement(94973..95041)
FT                   /locus_tag="BC1002_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.851) with cleavage site probability 0.804 at
FT                   residue 23"
FT   gene            95371..96084
FT                   /locus_tag="BC1002_0082"
FT   CDS_pept        95371..96084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0082"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: bxe:Bxe_A4358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14193"
FT                   /db_xref="GOA:D5W9X1"
FT                   /db_xref="InterPro:IPR032307"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9X1"
FT                   /inference="protein motif:PFAM:PF03929"
FT                   /protein_id="ADG14193.1"
FT                   /translation="MNAPESIDLKPTVAAPGVATPGAVAQQAPRRQRSRRATFIRWLRN
FT                   VHGWIGLWGAVLGLMFGVTGFLLNHRAGPLKISTGAPQVEEMQIAVPEKPLHSPGEMAK
FT                   WLQRELKIDGKPGRAKRDPAHPVAWGDHSTIQPEQWQVGIMGPGQSVQAEYWVGNGFVT
FT                   VKHTRNSFFATLSNLHKGVGLSVGWVLLIDTIAGSLILLSLTGVLLWTELNKRRVVGVV
FT                   LVSGSVIAAVVCGLM"
FT   gene            complement(96136..97158)
FT                   /locus_tag="BC1002_0083"
FT   CDS_pept        complement(96136..97158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0083"
FT                   /product="protein of unknown function DUF182"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   bxe:Bxe_A4357 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14194"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9X2"
FT                   /inference="protein motif:PFAM:PF02625"
FT                   /protein_id="ADG14194.1"
FT                   /translation="MDSVDLEVLKTSVRWLEDGHRALLVTVVKTWGSSPRPEGAMLAVR
FT                   DDGLVVGSVSGGCIEDDLIDRVRQRGIEQTNPEAVKYGITAEEAHRFGLPCGGTIQLVL
FT                   EPLTRQSGIAELCHAVENGRLVARELDMATGVVRLDNAQATDGVHFDDKRLLTIHGPRY
FT                   RMLVIGAGQLSRYLCHIAVGLDYQVTVCDPREEYTEEWDVPGTKIVRTMPDDTVTDMKL
FT                   DERCAVIALTHDPKLDDLALMEALKTPAFYVGALGSRRNNHARRERLKEFDLNEAELAR
FT                   LHGPVGIYIGSRTPPEIAVSILAEVTAAKNGVSLPTLLQVEGAKAAREIAASGGAACSV
FT                   "
FT   gene            complement(97131..97757)
FT                   /locus_tag="BC1002_0084"
FT   CDS_pept        complement(97131..97757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0084"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   bpy:Bphyt_0365 carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14195"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9X3"
FT                   /inference="protein motif:PFAM:PF06240"
FT                   /protein_id="ADG14195.1"
FT                   /translation="MELSETHTLPVAQQQTWDALNDTEILRACIPGCESIDPDGENAYL
FT                   VTLSAAVGPVKARFKGRMQLTDIDAPNAYTIVFEGQGGAAGFAKGNTQVTLEADGDAAT
FT                   KLSYTANAQVGGKLAQIGSRLVDGAARKIAGEFFKRLSAQLSGENSAEEAADGNASVDT
FT                   EAEAEAGSVSASASEQTESNEAADGESGGEAKKGKKSWTAWISKF"
FT   gene            complement(97748..99013)
FT                   /locus_tag="BC1002_0085"
FT   CDS_pept        complement(97748..99013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0085"
FT                   /product="VWA containing CoxE family protein"
FT                   /note="PFAM: VWA containing CoxE family protein; KEGG:
FT                   bpy:Bphyt_0366 VWA containing CoxE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14196"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9X4"
FT                   /inference="protein motif:PFAM:PF05762"
FT                   /protein_id="ADG14196.1"
FT                   /translation="MTNDIGIGRRDGANQQSAPMLARNVVHFVRVLRGAGLPMSPAHAV
FT                   DALAALQWIDLGRRDDVRAALAALLVTAPDERELFNAAFDLFWRDPDWEGKLRALLLPK
FT                   VRDGLPPPKRNNRLADALAVRMPPSPHPNAPQETEHHELHAQLTFSAEERLRHRDFDTL
FT                   SADEWRTLRHLIRGQRLPLATEPTRRLKAASHGTHADLRASARHAVRAGGDWTVWKYRA
FT                   RVERKPPLVLLLDISGSMSNYSRAVLYFCHALLQSRERLQVFLFGTRLTNATRALRERD
FT                   PDVAIATLSDQVVDWSGGTRIGAALAEFNRRWARRVLTGRATVLLVTDGLDHEAIDVLD
FT                   TEMARLARFAHRIVWLNPLLRFSGFTPKARGVQAILPYVDAHRPVHNLDSLAAFGRDLA
FT                   QLTRAPRHAVAATTLAGATSWN"
FT   gene            complement(99025..99906)
FT                   /locus_tag="BC1002_0086"
FT   CDS_pept        complement(99025..99906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0086"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="KEGG: bpy:Bphyt_0367 ATPase associated with various
FT                   cellular activities AAA_5; PFAM: ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14197"
FT                   /db_xref="GOA:D5W9X5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9X5"
FT                   /inference="protein motif:PFAM:PF07728"
FT                   /protein_id="ADG14197.1"
FT                   /translation="MQPASIDDTLAQLAAQCYFASRELATALYLALRMERPLFVEGEPG
FT                   VGKTELAKAAAGMLGTTLLRLQCYEGLDTASALYEWDYPRQIMALRLAEASGERPDNDT
FT                   LYRGEFLLKRPLLQALMPDENHPGARRVLLIDEIDRADEPFEAFLLELLSDFQVSIPEY
FT                   GTVRASQPPLVIMTSNRTREVHDALKRRCLYQWIGYPDRERELEIVAARAPQTSAQLQR
FT                   RAVDFVHRLRGMDLFKAPGIAETIDWCRALEALSVTELDPQSVQNTLGVLLKYQDDLAR
FT                   VDAEQIAQCLAG"
FT   gene            complement(100077..100874)
FT                   /locus_tag="BC1002_0087"
FT   CDS_pept        complement(100077..100874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0087"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; KEGG:
FT                   bpy:Bphyt_0368 molybdopterin dehydrogenase FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14198"
FT                   /db_xref="GOA:D5W9X6"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9X6"
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /protein_id="ADG14198.1"
FT                   /translation="MYSFEYQRATDPQAAAAALTADSDAKFLAGGQSLLPTMRLRLAQP
FT                   SQLIDVTRIPALKTISVDANKVTIGAAVCHADVAEHADVRRVLPALAELAANIGDRQVR
FT                   ALGTIGGSLANNDPAACYPAAAMGLDATIVTDRRRIASGDFFVGMYETALAPDELIVAV
FT                   EFPVPERAAYEKFRNPASHFALVGVFVAKSAGGVRVAVTGAASSVFRVPELESALSANF
FT                   TPEAARAVSVSPDELNEDMHASAAYRAHLIPLLAARAVTKATA"
FT   gene            complement(100903..103284)
FT                   /locus_tag="BC1002_0088"
FT   CDS_pept        complement(100903..103284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0088"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; aldehyde oxidase and xanthine
FT                   dehydrogenase a/b hammerhead; KEGG: bxe:Bxe_A4352 xanthine
FT                   dehydrogenase, molybdenum binding subunit apoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14199"
FT                   /db_xref="GOA:D5W9X7"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9X7"
FT                   /inference="protein motif:PFAM:PF02738"
FT                   /protein_id="ADG14199.1"
FT                   /translation="MNAPDTQSLIGAAVERKEDYRFLTGKGQYTDDIVLPQQSYAVFLR
FT                   SPHAHAKINSIDTSAAKQSPGVVAIFTGADLAAEKVGGLPCGWLIHSTDGKPMNEPPHP
FT                   VIAHTKARHVGDQIALVIAESIKAAKDAAELIDVDYEELPAVVDTAHAADPGQAAVHDE
FT                   VPDNVCYNWGHGDKAATDAAFAKAAHVTTLDIVNNRLVPNAIEPRAVNASYSAQDDSYT
FT                   LYVANQNPHVERLLMAAFVLSLPESKLRVIAPDVGGGFGSKIFLYAEDVALTWASKKIG
FT                   RPVKWTAERSEAFVSDAHGRDHVTKAELAMDADGKFLAMRVHTIANMGAYLSTFASSVP
FT                   TILYATLLAGQYATPAIYAEVKAVFTNTVPVDAYRGAGRPEATFVVERLVEAAAREMKL
FT                   DPAEIRRRNFITQFPYATPVGLTYDTGDYNAILSRALTLADVEGFAARRQESEQNGKRR
FT                   GLGYSCYIEACGLAPSNIAGALGARAGLFEVGQIRVHPTGSVTVFTGSHSHGQGHETTF
FT                   AQVVADRLGIPLESVEIVHGDTGRIAFGMGTYGSRSIAVGGSAISKALDKIEAKAKKIA
FT                   AHLLEASAEDIEFKNGVFRVAGTDRTKAFAEISLAAYVPHNYPLDVLEPGLEESAFYDP
FT                   TNFTYPSGAYICEIEVDPDTGESRIQKFTAVDDFGNVINPMIVEGQVHGGLGQGIGQAM
FT                   LERCVYDNDSGQLLSGSYMDYAMPHASDLPDFTVETSKGTPCTHNPLGVKGCGEAGAIG
FT                   SPPAVINAIIDALAPLGVTNLQMPATPHRVWSAIQAAKQA"
FT   gene            complement(103295..103819)
FT                   /locus_tag="BC1002_0089"
FT   CDS_pept        complement(103295..103819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0089"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: [2Fe-2S]-binding domain protein; ferredoxin;
FT                   KEGG: bxe:Bxe_A4351 putative carbon-monoxide dehydrogenase,
FT                   small subunit (CoxS)"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14200"
FT                   /db_xref="GOA:D5W9X8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9X8"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="ADG14200.1"
FT                   /translation="MAISISLTVNGAPVSASVDPGTLLVQFLRDQLRLTGTHVGCDTAQ
FT                   CGACTVHLNGRAIKSCNILAAQADGAEVTTIEGLAHNGALHPMQAAFKHCHGLQCGFCT
FT                   PGMVMSAVSLVQRQPDLTGDEVREQLDGNLCRCTGYHNIVKAVLEGAAGMKASAASSAT
FT                   AGANAAGATAA"
FT   gene            complement(104235..105626)
FT                   /locus_tag="BC1002_0090"
FT   CDS_pept        complement(104235..105626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0090"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bpy:Bphyt_0373 amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14201"
FT                   /db_xref="GOA:D5W9X9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9X9"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ADG14201.1"
FT                   /translation="MSLFRKKSVEHMLAASAQTAGLKKALGALDLTFLGVGAIIGTGIF
FT                   VLTGTGALQAGPALMISFVIAAIACGFAALAYAEFASTIPVAGSIYTYSYATLGELAAW
FT                   IIGWDLMLEYGLATSAVSVGWSGYLQSLLSGFGVSLPMALTAAPGAVPGHETLFNLPAF
FT                   LVMMAITTLLSVGVRESARINNIMVAIKVVVVLLVIGVGVFHVTPANWHPFMPHGWSGV
FT                   FGAAAVMFFAFIGFDSVSSAAEEVKNPKRDLPIGIIASLGVCAVLYVAVAAVVTGIVPS
FT                   GKFMGISHPVSYALQLAGQNWVAGFIDLGAVLGMLTVILVMAYGQTRVIFAMSRDGLLP
FT                   AKLSKVHPRFATPFFTTWLVGIFFGLIGALVPLNVLAELINIGTLAAFSMVSIAVLVLR
FT                   KTHPELPRAFRCPGVPVVPVLAVASCLFLMLNLQGITWGAFLIWLAIGMVVYFGYSRRH
FT                   SKLAK"
FT   gene            complement(105922..106578)
FT                   /locus_tag="BC1002_0091"
FT   CDS_pept        complement(105922..106578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0091"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: bxe:Bxe_A4347 two component LuxR family
FT                   transcriptional regulator; PFAM: response regulator
FT                   receiver; regulatory protein LuxR; SMART: response
FT                   regulator receiver; regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14202"
FT                   /db_xref="GOA:D5W9Y0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9Y0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG14202.1"
FT                   /translation="MSLRILIVEDHAVVRQGVRQLLLDRGVAREVAEAQSGSEALDSVV
FT                   HHGFDVVLLDISLPDMNGVEVLKRLKRKAPRVAVLMFSMYREDQYAVRALKAGASGYLS
FT                   KTVDAAQMIGAIQQVAAGRKYVSPEMAEALADYVSFDGEQLPHEKLSDREYQTLCMLAS
FT                   GKRLTDIAATLSLSVKTVSVYRTRLLDKMKLRNNAELTFYVMSNRLVDLNPAMAG"
FT   gene            complement(106589..107476)
FT                   /locus_tag="BC1002_0092"
FT   CDS_pept        complement(106589..107476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0092"
FT                   /product="histidine kinase"
FT                   /note="KEGG: bpy:Bphyt_0375 putative signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase dimerisation and phosphoacceptor
FT                   region; SMART: ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14203"
FT                   /db_xref="GOA:D5W9Y1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9Y1"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG14203.1"
FT                   /translation="MDTSTAVPFNAALASAAQRDGFDMPSHAAREIERLRARVRELSAE
FT                   LVEAQESVRRHVARELHDGVGAELTATRFALAGIETWLPTDAPPQCAAALAVANRSLDA
FT                   VHAASREAIAQLHAPSFETGVAGALMCWVRDFSTRTGLRATFTCPDDARLARLPADAAL
FT                   AVFRVAQEALNNVAKHARASCADVRIETGARHLKLLISDDGIGLRRGARERGGQKEPGG
FT                   HFGLAGMQARCAAFDGALRVGTRRASVGRGEDGGTGNNGAIASRGTLIQARFAWHALLA
FT                   TSPAPRAARRALQS"
FT   gene            complement(107877..108647)
FT                   /locus_tag="BC1002_0093"
FT   CDS_pept        complement(107877..108647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0093"
FT                   /product="Ferredoxin--NADP(+) reductase"
FT                   /EC_number="1.18.1.2"
FT                   /note="KEGG: bxe:Bxe_A4345 ferredoxin--NADP reductase;
FT                   PFAM: Oxidoreductase FAD-binding domain protein;
FT                   oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14204"
FT                   /db_xref="GOA:D5W9Y2"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9Y2"
FT                   /inference="protein motif:PRIAM:1.18.1.2"
FT                   /protein_id="ADG14204.1"
FT                   /translation="MSNLNSQTVLSVHHWTDTLFSFTCTRDPSFRFENGQFTMVGLQVD
FT                   GKPLLRAYSLASANYEEHLEFLSIKVQDGPLTSRLQHLKVGDEVLIGKKPVGTLVADNL
FT                   LPGKTLWLLSTGTGLAPFMSIIKDPEIYDRYERVVLTHTCRFVDELAYKEYITEHLPAH
FT                   EHLGELVQEKLLYYPTVTREAFQNRGRITELIETEKLFADLGVPGFSLENDRVMLCGSP
FT                   HMLRDTRKLLEDAGFKEGSNNEPGHYVVEKAFVG"
FT   gene            109173..109934
FT                   /locus_tag="BC1002_0094"
FT   CDS_pept        109173..109934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc2525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14205"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9Y3"
FT                   /inference="similar to AA sequence:KEGG:RSc2525"
FT                   /protein_id="ADG14205.1"
FT                   /translation="MRWLRGSFWRLRPPLRVVGVTDGKNVVPPGSLLVINPQGGLVTEL
FT                   KDQRLLDGHWDLTVIDGGRFARVFVSDVLNGKVARIDLSIGANGVQMLPGSTIIASGYL
FT                   HRTDPAALVVGPTGLAYDPTHDVLYVASTGDNAVFAIYGAASANHDGGVGRMIYHDNKH
FT                   LHGPLVLALAPNGHLVTANGDAVNPDPNQPSEIVEFTVDGQFVAQLQVDPAPRSAFGLA
FT                   FDLDSNRHLQFTAVDDAINTATVWTLRTNNR"
FT   gene            complement(110224..111032)
FT                   /pseudo
FT                   /locus_tag="BC1002_0095"
FT   gene            complement(111022..111132)
FT                   /pseudo
FT                   /locus_tag="BC1002_0096"
FT   gene            111137..111508
FT                   /pseudo
FT                   /locus_tag="BC1002_0097"
FT   gene            complement(111558..112355)
FT                   /locus_tag="BC1002_0098"
FT   CDS_pept        complement(111558..112355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0098"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   bxe:Bxe_A4337 putative metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14206"
FT                   /db_xref="GOA:D5W9Y4"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9Y4"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ADG14206.1"
FT                   /translation="MRNPEELIRESLAPNDFVAVSWNLHKGRTPLGFQAWQAMQRWVQS
FT                   THADAYFLQEAMARRMPSPVLASSFGAPMGDPLSDVWHCQATEIARALELEVALGPNVF
FT                   KPSWRHGNAILSPHPLDLGGRWDISAHRFEKRGLLVARATFGGRLVTLLCAHLALTRPA
FT                   RLRQMNWIAHWIAKEAPDGPLVLAGDFNDWRNDSVPLFREHGLQEVATLLGEPARTFPA
FT                   FSPALSLDKMFVRGMQPVEWIQPTQETAWLSDHLPYMAKLRLE"
FT   gene            complement(112410..112970)
FT                   /locus_tag="BC1002_0099"
FT   CDS_pept        complement(112410..112970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4336 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14207"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9Y5"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4336"
FT                   /protein_id="ADG14207.1"
FT                   /translation="MWKTGIVAMLLGASLLAHAQQRPAQQVVQWQLQVVKDGQQIDSFD
FT                   GTTTVGQARTDTHHQVVQHNVGCKDQPAGSIDLSRTITVSPLRVDPEGVMFSIDTQETL
FT                   EDTNAGRTDIGCKLPPQPRQVSASHPGLVVPPDQWASWTIVDRNPNLVYRVHASVVSNG
FT                   ANGTVTNGGMSGNGAATGGNNPN"
FT   sig_peptide     complement(112911..112970)
FT                   /locus_tag="BC1002_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            113262..114227
FT                   /locus_tag="BC1002_0100"
FT   CDS_pept        113262..114227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0100"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="KEGG: bpy:Bphyt_0386 AAA ATPase central domain
FT                   protein; PFAM: AAA ATPase central domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14208"
FT                   /db_xref="GOA:D5W9Y6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9Y6"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADG14208.1"
FT                   /translation="MVKQEIAVASFSRVYDLDEVESALNGLGEGANEALRATYEKMLKT
FT                   GNLRFCVKPNRMPSIDDLIDALPNFSAPLDDIRKQVALCLETEDRLELMPILLLGEPGI
FT                   GKTHFAKQLARLLGTAYQYVAMSSLTAGWILSGASSQWKNAKPGKVFDALVNGSYANPV
FT                   IAVDEIDKATGDSQYDPLGALYALLEHDTAQSFVDEFAEIAINAGNVIWIATANDERAI
FT                   PEPILNRMNVYEIPPPDHAGARRIAQSIYDEIRGAHNWGMRFPETLGDATLDALKRASP
FT                   REMRRAILNGFGAARIAGRDQVEPADIRLDYGNRRKPIGF"
FT   gene            114581..115687
FT                   /locus_tag="BC1002_0101"
FT   CDS_pept        114581..115687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0101"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bpy:Bphyt_0387 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14209"
FT                   /db_xref="GOA:D5W9Y7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9Y7"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADG14209.1"
FT                   /translation="MDQIECVVIGAGVIGLATARALAARGREVIVLEAADAIGVGTSSR
FT                   NSEVIHAGIYYSRGSLKATLCVRGREMLYDYCAERNVPHSRCGKLLVATSRNQIPQLES
FT                   IMAKGRDNGVLDLMRITGDQAQALEPALECVEAVFSPQTGIVDSHQYMLALQGDAERDG
FT                   AMCAFHAPVEAIEAHNGRFTIAVGGAAPTTISAACVINSAGLHANALARKIRGLDPRHV
FT                   PPLYFARGNYFSISGRAPFSRLIYPMPNEAGLGVHLTLDLGGQARFGPDVEWVDAINYD
FT                   VDPHRAESFYAAIRAYWPALPDDALQPAYAGIRPKLSGPGEPAADFVIQGPAAHGVRGL
FT                   VNLFGIESPGLTASLAIAQRVCELAGRA"
FT   gene            115820..116131
FT                   /locus_tag="BC1002_0102"
FT   CDS_pept        115820..116131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0102"
FT                   /product="High potential iron-sulfur protein"
FT                   /note="PFAM: High potential iron-sulfur protein; Ergtoxin;
FT                   KEGG: bxe:Bxe_A4333 putative high potential iron-sulfur
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14210"
FT                   /db_xref="GOA:D5W9Y8"
FT                   /db_xref="InterPro:IPR000170"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036369"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9Y8"
FT                   /inference="protein motif:PFAM:PF01355"
FT                   /protein_id="ADG14210.1"
FT                   /translation="MRSSRRTFLITSIGVASTLALSRQAFADAPKVSETDPTAQALGYK
FT                   ADASKVDKAKFAKFEPGQQCSNCSFFQGKAGDAYGGCPMFAGKQVAATGWCSAYNKKA"
FT   sig_peptide     115820..115903
FT                   /locus_tag="BC1002_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            complement(116303..117859)
FT                   /locus_tag="BC1002_0103"
FT   CDS_pept        complement(116303..117859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0103"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: bxe:Bxe_A4331 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14211"
FT                   /db_xref="GOA:D5W9Y9"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9Y9"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ADG14211.1"
FT                   /translation="MPTDREGSTDVLSDYLAHDAIGLAELVRTRQVSARELIDVAISRT
FT                   EAVNPAINAVVLKDYDAARQRASRDDANRANSVEGVNGIDDSTAHAALAGVPFLIKDLG
FT                   APVAGLRMAMGSRHYRHFIPTQDAPVVALAKAAGLNIFAKTSTSELGQMPYTEPELFGA
FT                   CRNPWNLDHTPGGSSGGAAAAVAAGVVPLAHASDGGGSIRIPASCCGLFGLKPSRGRVP
FT                   RAAQVSAGELGIDHAVSRSVRDSALLLDLLAGNAERPAGAPGTFLGATREPCKPLTIAY
FT                   VTEPMLAPSLSADARAALDDAAQLASSLGHRLEPVSLGVDFAAVRHAFLTLWSVTAEDL
FT                   VLNAERITGHKPTRGEFEISTWAMAHVGRKIGEQGLPAALDEQRRITARLTDLLNRYDV
FT                   LLCATLASAPIKIGEMRPSSVERMQMRAVTTMPLERLMKKLLFEASNKAFAWAGCTELF
FT                   NLSGQPAMSVPLYWNARGLPIGVQFAARVGGEATLFRLAAQLEAARPWFDRRPPLMKAR
FT                   R"
FT   gene            complement(118058..118756)
FT                   /locus_tag="BC1002_0104"
FT   CDS_pept        complement(118058..118756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0104"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="KEGG: bxe:Bxe_A4330 carboxymethylenebutenolidase;
FT                   PFAM: dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14212"
FT                   /db_xref="GOA:D5W9Z0"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9Z0"
FT                   /inference="protein motif:PRIAM:3.1.1.45"
FT                   /protein_id="ADG14212.1"
FT                   /translation="MSTTSRWIDIPAGNDTFGGYLALPKGGKGPAVIIIQEIFGVNSHI
FT                   RSVADQYAQDGYVALAPDVFWRVQPRVELTYEGKDREKGIELMQKTKVDDAVADIGAAA
FT                   AALRALPEVTGKVAAIGYCFGGRLAYLAAAAGSVDAAVAYYGGGIHNHLDKAANVKVPM
FT                   QFHYGELDAHILPSDIGQIQERFAGRADVQFNIYPNADHGFNCSDRASYNQHASALAHG
FT                   RTLTFLGERM"
FT   gene            119078..120181
FT                   /locus_tag="BC1002_0105"
FT   CDS_pept        119078..120181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0105"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   bxe:Bxe_A4328 putative 2-nitropropane dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14213"
FT                   /db_xref="GOA:D5W9Z1"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9Z1"
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /protein_id="ADG14213.1"
FT                   /translation="MNEGGFVTPFAERFRMRVPVVQAPMAGGATTPALVAAVSNAGGLG
FT                   FLAGAALAPEKIASEVAAIRALTDRPFGVNLFVLDPASPDEATVRRALDAIDPLRAELG
FT                   LPPGQPLARYAPDFRAQLEALIELRVPVAGFTFGLLPAADVERLHASGSYVVGTATHVA
FT                   EGIAWRDAGADAVAAQGAEAGAHRGTFIGAFEDALVGTIALVPQLIDATGLPVLAAGGI
FT                   MDGRGIVAALALGAQAAVMGTAFLTTRESAIPEVWKTRVRGVSDTSTTVTRAITGRHAR
FT                   GIRNPLMQRLRESAQSIAPYPVQNALTQELRQNAARAQNGDYLSLWAGQGAPLGRTRAE
FT                   GIGAAEPMAQLEQEWRATSVRNAEFMR"
FT   gene            120633..121778
FT                   /locus_tag="BC1002_0106"
FT   CDS_pept        120633..121778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0106"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bpy:Bphyt_0393 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14214"
FT                   /db_xref="GOA:D5W9Z2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9Z2"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADG14214.1"
FT                   /translation="MSIKIQKLLPISAAALLFATLATSAAADTVVKIGHVAPLTGGIAH
FT                   LGKDNENGARLAVEEINAKGLTIGGQKVTLQLDAQDDAADPRTATQVAQKLVDDKVVAV
FT                   VGHLNSGTSIPASKIYSDAGIVQISPSATNPAYTQQGFKTTYRVVATDAQQGPALANYA
FT                   AKGMKVKSVAIVDDSTAYGQGLANEFEKTAKALGLNVVSHDATNDKAVDFRAILTKIKG
FT                   ENPDAIMYGGMDATGGPFAKQAKQLGLRAKVLAGDGVCTDKLSDLAGDATDNIVCSEAG
FT                   MALEKMAGGKAFETKYEKRFGQPIQIYAPFTYDAVYIIVDAMKRANSTEPAKILAAMPA
FT                   TDYKGVIGETTFDSKGDLQHGVISLYNYKQGKKTLLDVVKM"
FT   sig_peptide     120633..120716
FT                   /locus_tag="BC1002_0106"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.837 at
FT                   residue 28"
FT   gene            complement(121883..123097)
FT                   /locus_tag="BC1002_0107"
FT   CDS_pept        complement(121883..123097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0107"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_A4324 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14215"
FT                   /db_xref="GOA:D5W9Z3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9Z3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG14215.1"
FT                   /translation="MPDHHASEFAVLPAAHRNLSVTARQRARIATMALFFIAGMMYASW
FT                   GVHVPTVRDRFHLNPAMLSFALFAVAGGSIGAMVTNASWIARVGTRRACLAGGLAMAAC
FT                   AALVLVVPAYWILLVVLAVFGAGMATLDVAMNAEASAVEKALGKPIMSSLHGMFSLGGM
FT                   FGAAVGGALLSRGMAPALHLALAATVSALVLVLACPSVLPHVPHAEHPDAAAPRASRWR
FT                   SPALWALGTMALVALIAEGAMYDWATVYMRDVVLSTPALASAAYAAFSGGMAAARFAGD
FT                   AVRARFGAPQLVMISATLACAGMVDALLLPNPVAALAGFALIGLGLANMMPVLFAAAAS
FT                   VKGIHAAEGLAHVAGLAYFGLLLGPVIIGAVAQVTNLTIGLSVVAVCAAMIAFAGPKVL
FT                   RRLKI"
FT   gene            123349..124011
FT                   /locus_tag="BC1002_0108"
FT   CDS_pept        123349..124011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0108"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: bxe:Bxe_A4323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14216"
FT                   /db_xref="GOA:D5W9Z4"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9Z4"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADG14216.1"
FT                   /translation="MNIPAHAPLHLLHTASVGTLATHARQPEGFPYPSVLPFAPDARHR
FT                   PTILVSRLAEHTHNLHADPRAGFLAIDAADGDVLSGQRVTLLGRFEPVDSSPELVRRYL
FT                   RYQPDAERYLALGDFTFWIMEIERLRYIGGFGAMGWLDGAELDPLPPLAAGEEDALITE
FT                   FGRRLSGAGDVELLGIDRYGADLKRNGVRRRFAFDDARSDSGTLHAALEVCIERHAD"
FT   gene            124406..124708
FT                   /locus_tag="BC1002_0109"
FT   CDS_pept        124406..124708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0109"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: bxe:Bxe_A4321 putative HNS-like
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14217"
FT                   /db_xref="GOA:D5W9Z5"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9Z5"
FT                   /inference="protein motif:PFAM:PF00816"
FT                   /protein_id="ADG14217.1"
FT                   /translation="MSSYKELLAQREKLEKQIEEAKSREYAEVLNEIKQKMADYGISLS
FT                   ELGGGRAPKGAKASRPRAGVAPKYRDPESGSTWSGRGKPPRWIAGLDREKFLIQK"
FT   gene            124992..126275
FT                   /locus_tag="BC1002_0110"
FT   CDS_pept        124992..126275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0110"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="KEGG: bpy:Bphyt_0399 cation diffusion facilitator
FT                   family transporter; TIGRFAM: cation diffusion facilitator
FT                   family transporter; PFAM: cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14218"
FT                   /db_xref="GOA:D5W9Z6"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9Z6"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ADG14218.1"
FT                   /translation="MPSAAIPQTAEKQRVARKSTFASIAVNTVLMTLQIIIGTIAHSQA
FT                   LVADGVHSLADLISDFVVLIANRHSGAKPDADHNYGHSRYETVASLFLGALLISVGVGM
FT                   LWRAGTRLADLQNIPAVHMSALAVAVLVLVCKEALFRYMLREAKRVRSAMLIANAWHAR
FT                   SDAASSLVVGIGVIGSLVGLRLLDPIAAAIVGFMVARMGWTFGWDALQDLSDRALDETA
FT                   TADMRALLMSTPGVRDVHEMRTRKMGDFALVDAHILVDPMISVSEGHYIAESARLRVLT
FT                   DKRVLDALIHVDPENDALAHPPVDLPPRERVTAEVDAALAAGGLRAAAVNLHYLSTGLD
FT                   VEVVLPAALSGEGRAAESAEAARLLESEAQSLGRVDLAALKRRLGARKLDVLLQRDISA
FT                   AHGGSAADLKAGVAPAGRSSATEPHNAA"
FT   gene            complement(126336..126794)
FT                   /locus_tag="BC1002_0111"
FT   CDS_pept        complement(126336..126794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0111"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="KEGG: bpy:Bphyt_0400 transcriptional regulator, AsnC
FT                   family; PFAM: Transcription regulator, AsnC-type-like;
FT                   SMART: Transcription regulator, AsnC-type"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14219"
FT                   /db_xref="GOA:D5W9Z7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9Z7"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADG14219.1"
FT                   /translation="MTLDTFSQKILRLLQLDARRSVQEISDQVGLSSTPCWRRIKDMEQ
FT                   SGVIQRYTALLDREKLGLHVCALAHIHLTRHTEGGVEQFEREIATCPEVTECYSTTGES
FT                   DYILKIVAPDIKAYDSFLHERIFKIPAVAQVRTSVVLREIKFDTQLPL"
FT   gene            complement(126885..127517)
FT                   /locus_tag="BC1002_0112"
FT   CDS_pept        complement(126885..127517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14220"
FT                   /db_xref="GOA:D5W9Z8"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9Z8"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4318"
FT                   /protein_id="ADG14220.1"
FT                   /translation="MSSEIYVSTDVEADGPIPGPHSMLSFASAAYTEDKQLIATFSANL
FT                   ELLEGAAPHPVQEAWWKTQPEAWAACRQDLQKPEAALSAYVDWVEALPGKPVFVAMPAG
FT                   FDFTYMFWYMMRFVGRCPFSWSALDIKTLAFAMTGLPYRKNIKPRFPKHWFDEHPHTHV
FT                   ALDDAIEQGALFCNMLKDLRARQPELPGDGKDDGDGSGQNAAPDPVN"
FT   gene            complement(127514..128158)
FT                   /locus_tag="BC1002_0113"
FT   CDS_pept        complement(127514..128158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0113"
FT                   /product="putative metallo-beta-lactamase family protein"
FT                   /note="KEGG: bxe:Bxe_A4317 putative metallo-beta-lactamase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14221"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5W9Z9"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4317"
FT                   /protein_id="ADG14221.1"
FT                   /translation="MKVTLIPVTPFQQNCSLLVCETTGRAAVVDPGGDLDLIQREIARQ
FT                   NVAVEKVLLTHGHIDHCAGAKTLATHYGVPIEGPHPDERFWLDKLPDQSTRFGFPAADS
FT                   FEPDRWLQDGDTVQFGGENFEVYHCPGHTPGHVVFFSRAHRLALVGDVLFAGSIGRTDF
FT                   PRGNHADLIRSIRDKLWPLGDDVTFVPGHGPTSTFGAERRTNPYVADGVGA"
FT   gene            128807..129412
FT                   /locus_tag="BC1002_0114"
FT   CDS_pept        128807..129412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0114"
FT                   /product="rare lipoprotein A"
FT                   /note="manually curated; TIGRFAM: rare lipoprotein A; KEGG:
FT                   bxe:Bxe_A4315 rare lipoprotein A; PFAM: Rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14222"
FT                   /db_xref="GOA:D5WA00"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA00"
FT                   /inference="protein motif:TFAM:TIGR00413"
FT                   /protein_id="ADG14222.1"
FT                   /translation="MKTRLSRGLGTLFAFFVLAGCATPPGASDTSADDMPQRTKNMHLS
FT                   SFGPQSFGSAPASSPSTSNAPAPSLADAKPLTDDGVDVPDFHQIGRASWYGRFFHGRRT
FT                   ANGERYDMHAMTAAHRTLPLGSYVRVTNPANSRSVIVRINDRGPYARGRVIDLSMAAAG
FT                   MLDMRHSGTARVKIEGLTQQEARAELNETLASNSDSNK"
FT   sig_peptide     128807..128890
FT                   /locus_tag="BC1002_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.735 at
FT                   residue 28"
FT   gene            129483..130064
FT                   /locus_tag="BC1002_0115"
FT   CDS_pept        129483..130064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0115"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="KEGG: bac:BamMC406_2351 transposase IS3/IS911 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14223"
FT                   /db_xref="GOA:D5WA01"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA01"
FT                   /inference="similar to AA sequence:KEGG:BamMC406_2351"
FT                   /protein_id="ADG14223.1"
FT                   /translation="MNCTPKVGHPFNDLGCFFMSRHTARFKRSVVRDYLSGKGGSNREV
FT                   AHRHGIDHGTVRKWAAAWQVHGEAAFRKKYGRFDARFRLKVLQFMQTKDLSLRETAAVF
FT                   DIRNPTTIGIWKRQYDSGGIQALQPGPRGRPVKQPKSSVPSDSTKSDESRTKEELLEEL
FT                   NYLRMENAYLKKLDALIRSESPKAPRKKRK"
FT   gene            130064..130900
FT                   /locus_tag="BC1002_0116"
FT   CDS_pept        130064..130900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0116"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bcj:BCAS0033
FT                   putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14224"
FT                   /db_xref="GOA:D5WA02"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA02"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADG14224.1"
FT                   /translation="MAGLRHQFPVDGLLKVAGLARSTFYYQCKASLVADKHAQLKARIR
FT                   SLFEQHKGRYGYRRITSAIRRLGIVVNHKTVQRLMQLMKLKCLVRPKKYRAFRGTVGRI
FT                   APNVLQREFDADAPNRKWVTDITEFRVGEHKLYLSPVLDLYNGEIVAYETATRPAFAMV
FT                   AGMIRKAMRKLKPDDRPVVHSDQGWHYQMSAYQTLLARRGLTQSMSRKGNCHDNATMES
FT                   FFGTLKSEFFHLNRFESIEALQAGIKDYIHYYNHQRIKLKLKGLSPVMYRTQPSRP"
FT   gene            complement(130986..131870)
FT                   /locus_tag="BC1002_0117"
FT   CDS_pept        complement(130986..131870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0117"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: bxe:Bxe_A4314
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14225"
FT                   /db_xref="GOA:D5WA03"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA03"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ADG14225.1"
FT                   /translation="MTPLSELAQGQQYPAAALYVVATPIGNIADITLRALHVLGLADRI
FT                   AAEDTRNTGQLLARYGISKPLVAVHQHNERAAAQRVIEYLQAGERVAYVSDAGTPGISD
FT                   PGAKLVDAVREAGFPVVPLPGASALATALSATGDWVATFSFLGFLPPKPKARAAALQAL
FT                   AQHPHAMVFYEAPHRIVETVQALADAFGGTRRLLIARELTKLHEALHQGTLAEGPAWLA
FT                   ADANRQRGEFVLVVEGASPEAAGEHDHDALLGILLEELTVSSAAKVAASLTGASRNALY
FT                   TRALALKEDKPDV"
FT   gene            131908..132381
FT                   /locus_tag="BC1002_0118"
FT   CDS_pept        131908..132381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0118"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   bpy:Bphyt_0405 protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14226"
FT                   /db_xref="GOA:D5WA04"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA04"
FT                   /inference="protein motif:PFAM:PF02021"
FT                   /protein_id="ADG14226.1"
FT                   /translation="MCHVGLREQVASKTAQETPVNTGPKTVHNFSCTHQSKSVGAAFEA
FT                   RAREFLQRQRLRFVASNVTCRGGEIDLVMSDRDGALVFVEVRARAQRHYGGAAASIGWQ
FT                   KRQRIVRAARHYLATRAATNRAPRDEPACRFDVVAFESGRLVWLRDAFRADEL"
FT   gene            132524..133111
FT                   /locus_tag="BC1002_0119"
FT   CDS_pept        132524..133111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0119"
FT                   /product="phosphoheptose isomerase"
FT                   /note="KEGG: bxe:Bxe_A4312 phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14227"
FT                   /db_xref="GOA:D5WA05"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA05"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4312"
FT                   /protein_id="ADG14227.1"
FT                   /translation="MSVERIQQHFRDSAAVKLEALETLSMPIAAAIDTMFAALANGNRI
FT                   LACGNGGSAADAQHFAAELIGRFERERPGLPAIALSTDTSVLTAIANDYSFEQIYAKQV
FT                   WALGQPGDVLLAISTSGNSANVLAAIEAAHEREMIVVALTGKGGGRAHEVLSDTDIHVC
FT                   VPSDRTARIQEVHLLTIHCLCDGIDAMLLGED"
FT   gene            133138..133929
FT                   /locus_tag="BC1002_0120"
FT   CDS_pept        133138..133929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0120"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; KEGG: bxe:Bxe_A4311
FT                   periplasmic phospholipid binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14228"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA06"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ADG14228.1"
FT                   /translation="MSVFRIKKTLVRTVLVVGFAAGLSATLQGCFLAVGAAAGGGALMA
FT                   TDRRTLGAQTEDREIQVKALSQISQNLPDSAHVNVTVFNRRVLLTGEVAGEVSKQRAES
FT                   IVRNMSNVNTIVNELAIMPASSFSSRTNDTYLETRVKTALIAEKNISANNFKVVAERGN
FT                   VYLMGLVTMDEGKIGADVTSRVPGVVQVVKVFQYIQPQEAEAAAAATSTAPAAASQPEV
FT                   SEPTVGAIPDSGVSARPLDQQAPAPVNSSTAVRPGNPKAVP"
FT   sig_peptide     133138..133254
FT                   /locus_tag="BC1002_0120"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.443 at
FT                   residue 39"
FT   gene            133929..134282
FT                   /locus_tag="BC1002_0121"
FT   CDS_pept        133929..134282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0121"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: bpy:Bphyt_0408
FT                   cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14229"
FT                   /db_xref="GOA:D5WA07"
FT                   /db_xref="InterPro:IPR002324"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA07"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ADG14229.1"
FT                   /translation="MRGMTFRVVVFALVVGALAGTMTSGARAAGGLHGQQVAAVNACMG
FT                   CHAVDRKLVGPSFQQIAAKYKGDAQAPAKLARKVRDGGSGVWGMIPMPAHQSMSDADIR
FT                   TVVDWVLAGAPSR"
FT   sig_peptide     133929..134015
FT                   /locus_tag="BC1002_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.964 at
FT                   residue 29"
FT   gene            134345..134420
FT                   /locus_tag="BC1002_R0003"
FT                   /note="tRNA-Ala1"
FT   tRNA            134345..134420
FT                   /locus_tag="BC1002_R0003"
FT                   /product="tRNA-Ala"
FT   gene            134521..136095
FT                   /locus_tag="BC1002_0122"
FT   CDS_pept        134521..136095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bgl:bglu_1g23570 phage-related integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14230"
FT                   /db_xref="GOA:D5WA08"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA08"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14230.1"
FT                   /translation="MSFRLPAYLHRNRYGMLYFRLTVPPDLRPIVGQAEIYRSLGSSSV
FT                   RQAADQAQSLRITLQRLFEDLRRGGGHAMSGHAYTALRALLDQRKITAHQTEKREELEQ
FT                   QISAMKSEQFRLSAEHQRTAVAVEAAQAAVVAQMVKMDDASAPAAGRSVSQETAGVPFS
FT                   QLFDAFCRYKEGSGEWRDPESDRLYRYGPIVKEFIACLGDVTNVSLDAAAVRQFKQAVI
FT                   GRDDFSQAKKTKYFEHIGAILRWARIEQYVRDDLAGILRMPAKKATGGYEPFSEDDLRR
FT                   LFESDDYRDGTFAKASQFWIPLIGLYTGARITEIAQLHLSDIREQDGVWLIDINDDDLK
FT                   KHLKSESATRTVPIHPVLIGIGLLRYHAEVKAEGYDRLFPDLTRTNKAKDSFGADPSEF
FT                   FTGYRRRLGVTSISETFDAGKNRWMGRGTKVFHSLRDTANSKLRHAGVTQERRERLVGH
FT                   ASRDVNNRHYRPADINQMFPLATLLEDIRKLDYGLTHASYAGTSRHRQERVKGAQRQAR
FT                   IDAEAMP"
FT   gene            136572..140093
FT                   /locus_tag="BC1002_0123"
FT   CDS_pept        136572..140093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0123"
FT                   /product="helicase domain protein"
FT                   /note="KEGG: ctt:CtCNB1_4049 hypothetical protein; PFAM:
FT                   helicase domain protein; SNF2-related protein; SMART:
FT                   helicase domain protein; DEAD-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14231"
FT                   /db_xref="GOA:D5WA09"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024975"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA09"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ADG14231.1"
FT                   /translation="MKLESVTKGALIVGIEPGKVVRIVSADPLGENSVSIVYRTDDGRL
FT                   GERQLFRADEASIAIATAGRPWSFDADGEGFKLAAEAIRINLAHLFDPMMAVHTSNVEP
FT                   LPHQITAVYESMLPKQPLRFVLADDPGAGKTIMAGLLIRELLMRADAARILIVAPGSLV
FT                   EQWQDELLEKFGLRFTLFSRELVDHSVTGNPFEDHDLLVARLDQLSRSEELQEKLKLSR
FT                   FDLVVVDEAHKLSATWFGSKINETKRFKLGQLLGSVARHFLLMTATPHNGKEEDFQLFL
FT                   SLLDSDRFYGKFRDGAHKVDVSDLMRRMVKEDLLKFDGTRLFPERVAYTANYKLSDAEA
FT                   ELYNLVTAYVKEEMNRADALDGKRKGTVGFALTALQRRLASSPEAIYQSLKRRRDKLKR
FT                   RIEEEKIKQRGGKIAASEIFADQAPENIWDSEDDMAPEDYENFEEEVVDQATAAQTIAE
FT                   LEAEVVTLEHLEKKAKALRDGGQDRKWEELREILQNTPEMRGPDGLQRKLIIFTEHRDT
FT                   LNYLADRIRGLLGKHEAVTMIHGGTHRDDRRKVQELFRNDKDTRVLLATDAAGEGVNLQ
FT                   NANLMVNYDLPWNPNRLEQRFGRIHRIGQTQVCHLWNMVAAETREGDVFQKLLEKLEVE
FT                   RKALGGRVFDILGEVFDGVSLRDLLIEAIRFGEDPARKKHLQEVVQDALDTEKLREIIS
FT                   RNALAEEVMDERRLFALKEEMEKAEARKLQPYFIRAFFSQAFDRLGGDLKPRGAGRFEI
FT                   THVPALIRERDRQLQGRDRRNMSPVVPKYERVCFEKSRIRVEDKPTEAAASLLHPAHPL
FT                   MQAVVDLTIEQHRNKLKQGAVLLDPNDEGIEPKLMLMLDHSVKEGGESGLVVSRRLQFV
FT                   TIDKSGRIENAGWAPHLDLTPLDDVQSKMVADQLDAPWIKKDLEQVALAHASERLVPEH
FT                   FEEIRARRERQVDKNLAAIRERLVKEIDYWSDRHEKLKTDLQVGKDVRLPLENVRRTID
FT                   ELTVRLETRSKELEAMRHVVSAMPVVVGGALVIPVGLLAQRNGEPQGQTWTADADARAR
FT                   VERVAMEAVRKAEEAMGHRVIDVSAEKCGWDLTAVVPAVEGKLPQARHIEVKGRAKGQS
FT                   TITVTRNEILYGLNQADKFILAVVIVDGDTHEGPHYIRNPFTQEPDWAVTSINLDLASL
FT                   LERAQKS"
FT   gene            140090..142933
FT                   /locus_tag="BC1002_0124"
FT   CDS_pept        140090..142933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0124"
FT                   /product="protein of unknown function DUF1156"
FT                   /note="PFAM: protein of unknown function DUF1156; KEGG:
FT                   ctt:CtCNB1_4047 adenine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14232"
FT                   /db_xref="InterPro:IPR009537"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA10"
FT                   /inference="protein motif:PFAM:PF06634"
FT                   /protein_id="ADG14232.1"
FT                   /translation="MIIKSPKKLIEVALPLDDINEACAYEKMPGIGAHPRGIHLWWARR
FT                   PLAAARAVIFAQMVNDPGYERNLGRGVNKERAKAERDRLFEMIRKLVRWENTNNEQLLS
FT                   EAREEIRKSWRETCELNKGSEGYDPDVLPAFHDPFSGGGALPLEAQRLGIESHASDLNP
FT                   VAVLINKAMVDIPPRFSGRSPVGPLQRFSTASHIENYGGTLGLAEDVRRYGALLHAEVS
FT                   RKVGHLYPQVNLPDSHGGGKANVIAWIWVRTVRSPNPAFSHVHVPLASSFVLSNKEGKE
FT                   AYVCPSVNGDSYSFEVKTEKPPASAKNGTKLSKGANFRCLVSDTPIEPKYIYAEANAGR
FT                   LGVRLMAVVAEGTRRRIYLPPTQETEDAAQAVKSEWRPEIAMPENPRWFSPPLYGLKNY
FT                   ADIFTDRQLVALTAFSDCVENIREKVKADAIAAGVADDGRRLESGGSGATAYADAIAVY
FT                   LAFAIDRCADFSNTCTRWVPGNQKVMNLFGKQAVGMTWDFPEANMMIETVGGFIPALNY
FT                   IADCLEKLPVSPAAGFASQSNASDSNLSEGKVVSTDPPYYDNIGYADLSDFFYIWLRRT
FT                   LKSVFPSLFQTVTVPKAEELVATPYRHSGKDAAERFFLEGMTQAMQRLAEHSHPAFPTT
FT                   IYYAFKQSETTDIGTGNTGWETFLEAVISAGFAITGTWPMRSEQEFRMVGIGTNALASS
FT                   IVLVCRKRDLAAQSISRREFLRELREELAEAVDVMIGGADGISPVAPVDLAQAVIGPGM
FT                   AIFSKYASVLEADGSPMSVHTALTLINRMLTEGDGEFDADTQFCLGWFDEQGWANGEFG
FT                   KADVLARAKGTSVQHVRDAGVVDSGSGRVRLLRPLEYPADWSPERDNNTPVWEALHQMI
FT                   RALRDQGETAAGALLAGMPQRAEPIRSLAYRLYTLCERKGWAEDARAYNELISSWTGIE
FT                   AASHEKGHFGSQARLDI"
FT   gene            142945..145848
FT                   /locus_tag="BC1002_0125"
FT   CDS_pept        142945..145848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0125"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ctt:CtCNB1_4046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14233"
FT                   /db_xref="InterPro:IPR007555"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA11"
FT                   /inference="similar to AA sequence:KEGG:CtCNB1_4046"
FT                   /protein_id="ADG14233.1"
FT                   /translation="MALKSWREIAIPHEDVLKGTFQQAEFAADISRVHQGTATPEYQDA
FT                   SLFFQRTFITEGMRLLLDSVVKRLAGRGGDPVIQLQTAFGGGKTHTLLAVYHLAEGKTP
FT                   VSKLQGLPPILDQAGIAELPKAKIAVLDGVELLGLASKPRTRGKTTVRTLWGELAYQLG
FT                   GAEAYAQVKDADESGTAPGKGELTNLLASHAPCIVLMDELVRYVSQFEEGKTLSGGTYD
FT                   TQLSFIQALTEALKAVPTAILLASLPFSDREAGSQQGVKALRALEHYFGRVQALWKPVA
FT                   TEEAFEIVRRRLFANVTDRLAAEEVCKAYADLYADNSGDFPPETQEARYLDRMKHAYPI
FT                   HPEVFDRLYEDWSSLDNFQRTRGVLKLMAKVIHRLWTSGNNDFLIQPGSLPLFDADTRN
FT                   EAIYYLPQGWDPVLERDIDGERAMTTELDNAKPLFGSIHACRRIARTVFLGSAPDAGAV
FT                   GGAKHHRGLELERLLLGCAQPGQVLGHYKDGVRALVDRLQYINSANSRYWFDTRPNLRR
FT                   EMEDRKRRFDLRQDVYPFIKDKLRFASGVFGGVHVFTPSGDVPDDWSLRLVVLPPEATF
FT                   SRSAQAPATDAALATLKSRGEHPRQKQNRLIFLAPDADSVSRLKDQVTSVLAWASIVAD
FT                   VKDGRLNLDQLQSKQASHSLDQANEAMGRMVRETYKWLLVPLQEPKPGKGIGEIQWDHF
FT                   QINPAAVNRTDEIEKVLKEHELLITHWAPTHLNKMLQAWFWKENVTTVSALDIWQKTCC
FT                   YLYLPRLHDADTMRETISAGVSSRDFFGVAYGHDDGRFQGFHFGENTTVIFDDSLLLIE
FT                   PRIASEFAARLAQEAAEREAAAISSTSGSSESGAISTSNAGSEVGGGTSTGDRGGASAP
FT                   LNAVGAGTGGTTSTLTTATKKTTFFASVELDPIKAKLQFSDVAEEVLMLFTQKPGVKVR
FT                   VSLEIEAEAPSGFDDGIQRSVRENCNQLKFKNHSFEE"
FT   gene            complement(145913..146830)
FT                   /locus_tag="BC1002_0126"
FT   CDS_pept        complement(145913..146830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0126"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_2278 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14234"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA12"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14234.1"
FT                   /translation="MIHADFTLAIGDAEHLSRFASVTPKPAFSGSWTTVELQPDIFVPQ
FT                   RFTVGVVVQSPGDRLHFKLIDDFKKFECLYQDQFPQKSARELLAYAEQSLRQAVQSRTA
FT                   IADVVFDTHCLALAPSQFTSGENRESTVERLFDEVVVMAPSTKRKVNEFQSIDTPHARR
FT                   LVNAELKKIAQMDYERIVTADNQGILLDDKGAKHFLDLNLLTRRACGSVTSAVYKSPQS
FT                   VEINLLKSSRDLTTYSRIRAMDNIGLFLLLPDPSIVDAKDFKRIEETIEEHEWKLERDG
FT                   FRVVSMASAEDLAGEIYEWAKPTI"
FT   gene            complement(146827..147627)
FT                   /locus_tag="BC1002_0127"
FT   CDS_pept        complement(146827..147627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0127"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_2277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14235"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA13"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14235.1"
FT                   /translation="MKVPILDASAWREYRGKPGSSGINETTHLAKVADVSGKLHDCFVK
FT                   LLPDGPALLCEAIGWLIARESDVACPAFGAIVLVPVEELRKCQPLPSSFDGVKLCPAWC
FT                   SEVVAGKAVRQLHKWAFFLARHSCLRSNDARKIAAFDLWSDLRDRNFGNVIQSTKGRYV
FT                   AIDHETLLHDLLWIPAGRKYEERSLLVEARKALSGVGFQRFQVDMADSAKGHANALQNA
FT                   QSDIVDIVAKLVTGNATAATQAILQALAQRAQSGWLANQLGVIA"
FT   gene            complement(147710..149359)
FT                   /locus_tag="BC1002_0128"
FT   CDS_pept        complement(147710..149359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0128"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_0503 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14236"
FT                   /db_xref="GOA:D5WA14"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA14"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14236.1"
FT                   /translation="MANDKKNTGFSGLDAMVSEVGPALEPSVARDQGEATSATTAVASE
FT                   PAEAHEVTSQAPSKSGSAAAGWVIAIPVFAIFLVLITFISTSGSSSNSQSAATYETPAS
FT                   GTDNAPTLASHAPSAANQPGNSAPAAVQNAFRAPSQDYSPAPTTESASASDEELVPPIG
FT                   SGLTLDRSQIRYCMSQRIRLEAWQGQLNANPQTLVDAFNASVNFYNARCSSYRYRTGDL
FT                   ESVRAEVELNRAALTQQGLSMAASANASVPVQNTPAIKTSFDCAKARSDAERLICNDTE
FT                   LAAADIELASLFASAKSTATDQDAFKEHARVQWNYRERNCHDRDCLTQWYATQRQWLTG
FT                   IVSNPRGSAQPGEPAPSQSAATPAGNCTTTVACAKAMLVFAGSENLAGAMQAAKTIDLL
FT                   PKPQRGDRATARKLNQDGLSALNASRPDDAVKLLEQANQADPGDEEIASNLSYAYAMNG
FT                   QLAKSEDTAVAALSLNPRRTNVWAPLAVTLAKENRLDQATQAMWLAYQFSTDKQRTLNF
FT                   IDSRLAIESDPAVLKMYSSSKTWLTKNIKPNF"
FT   gene            complement(149366..151018)
FT                   /locus_tag="BC1002_0129"
FT   CDS_pept        complement(149366..151018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14237"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA15"
FT                   /inference="similar to AA sequence:KEGG:Noc_0670"
FT                   /protein_id="ADG14237.1"
FT                   /translation="MSTNTYETPLHSSPFCVLGVTTRDDRRKIVEMAEERSLQLDSDIC
FT                   QKARSDLTNPKARLAAEMAWMPGVAPKIAENVVRTLSANSRVARSAQGLPALARANVMA
FT                   AACELVADSEPVSSVAGFIQDFAEIVESIDPEDVLRDVNEDRGVSGFPQVQGTEVIEEV
FT                   LSERRKSYRTALKDLLDTMEPARLIETMAQVVRQATDDGKKHAPILLDDLVDSYEVETQ
FT                   GFLQKEAENISTLIGQAREAAPRGDQTVDPILDRLEKVARNWHRVALPILISAKSRGTT
FT                   NRQSRDTAYELRGLSLALNNDHGMIDLADRLNRLLRELFAELPDVAEKLGEDAHALQGL
FT                   RSQADERARNNEKWEREITFRAEVGLVFKEELAISPQGVRWRGQTVPLDSITRVRWGGV
FT                   RRSINGVPTGTDYTIAFGDNRSQQSIGLRKEAIYTGFTGALWRAVCIRLLFEMVAALEK
FT                   GQSFSFGDITIQDDAVTLTRHRTFAANEQVRLGWNDVRVWTHDGNFVIGKKDDKKVYGS
FT                   ASYINGWNTHVLEHLVRGGFKKGIRKLSDYLKD"
FT   gene            complement(151220..152686)
FT                   /locus_tag="BC1002_0130"
FT   CDS_pept        complement(151220..152686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0130"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="KEGG: pna:Pnap_4272 ATPase central domain-containing
FT                   protein; PFAM: AAA ATPase central domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14238"
FT                   /db_xref="GOA:D5WA16"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA16"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADG14238.1"
FT                   /translation="MALESWFPIGYELPDGARCGRPLHAGSNWQIVETRGGGNALIATE
FT                   SLFARWSASGLVELGDVHRFKFGAETYHEVSCSPSQLLVYLSDCRSPNSKSEAMAFATA
FT                   LRDTRAIDSESSLQGAVYVEKLSRILPTYETAAPADDGIVLGHWLTGGAQISAESFQPL
FT                   RQMLTWIGSAALREVIKTAGIELVDEGAPVGANKVAHLPPSAHQKTSSPENPESSEQNA
FT                   KRMAGVELGKTFELSGRSELEAFFNEHIVDIVRNKERYSALGIEFPAATVLHGPPGCGK
FT                   TFAVEQLVGYLGWPCYQLDASTIASPFIHETSRKVSEMFEKAMQNAPSVLVIDEMEAFL
FT                   ADREAGGGASHHRVEEVAEFLRRIPEAAKNEVLIVAMTNRVEMIDPAIMRRGRFDHVVA
FT                   VGYPDEAEVAALLAKLLAALPQDQTVDPAPLAKALAGRPLSDVAFVVREGARLSARAGS
FT                   DMLGQEFLLAALAAAPSRSGGCSERRVGFV"
FT   gene            complement(152689..155181)
FT                   /locus_tag="BC1002_0131"
FT   CDS_pept        complement(152689..155181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0131"
FT                   /product="Heat shock protein 70"
FT                   /note="PFAM: Heat shock protein 70; KEGG: noc:Noc_0667 heat
FT                   shock protein HSP70"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14239"
FT                   /db_xref="GOA:D5WA17"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA17"
FT                   /inference="protein motif:PFAM:PF00012"
FT                   /protein_id="ADG14239.1"
FT                   /translation="MKNYIGIDLGTTNSAICAYDGENLRLFKSPDQNDVTPSAIFIDKR
FT                   SNKYVGKRAYDNAARSPENAATLFKRLMGTSTPVRLPGIDLTLTPEECSSEILRVLFGY
FT                   LPEEIRNAPDTGTVITVPAAFNQMQKDATMAAAEMAGLGNVALMQEPVAAVMSVMRHRK
FT                   SDGTFLVYDLGGGTLDIAIAQSINGRVSLLSHGGIAMCGGRDFDRLLLDNVVKPWLLAN
FT                   FDLPEDFSTDKRYAMLRHLATWAAEKAKIELSSSDEAVITLDDSELRVRDASGTDIYLD
FT                   IALTRERLDELISEKVEESIVAAREAMDKAGLSSHDIGRMVFVGGPTQYKPLRDKVAFE
FT                   LGIAASTDVNFMTAVAEGAAVFAESIDWASQNRGRKSGRGSLAAGGGLELSFSYQARTP
FT                   DLKAKMVAKLGGSAAQGTAFQIDSLDTGWSSGRVALKDGATIEVPLAKPGENLFKVFVF
FT                   DAAGGSVRLAEDKIAISRTAAQIDAIPASHSIGVEAREKIGGRVVLDYLVREGDQLPKG
FT                   GNKTFKAEESLRAGAAGSIKFKLWEGAIEDPVSDNRFVGMFEIKGSDFSDGVIAKGADL
FT                   LCKYEVRDSGNIVLEVSVPSIGGLFHSGRNFYSRLEGQIDYTKAAKRIQDESERVGARL
FT                   QEVAQHVDDSRLDQARKRVDRASRLGSESDAESAKQAMDDVQEAKKLLAQARKQHLPVI
FT                   RRIELNKAVEFFDSAIRQFARPAEAGAFDNLAKTAQRAIDHNSGDFESLLDEMRRRNFL
FT                   ILWRQDWFVMDRLKWLSDRPFEFPDAAEHEKLCRLGRQAAESNDMDTLRQIVGQLDGIR
FT                   VITSSEDDMLAGSNILVG"
FT   gene            complement(155178..155558)
FT                   /locus_tag="BC1002_0132"
FT   CDS_pept        complement(155178..155558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0666 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14240"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA18"
FT                   /inference="similar to AA sequence:KEGG:Noc_0666"
FT                   /protein_id="ADG14240.1"
FT                   /translation="MDVVRCEGDEDAARKALIDISIEGWRFTRVFGRLLEKLDAGEATR
FT                   YANQARYFHKRIDDGLSAFGMRIVTLEGQPYDPGMAVSALNIADFGPEDVLVVDQMIQP
FT                   VVMGPEGLVRGGTVMLAKAERE"
FT   gene            156107..156232
FT                   /locus_tag="BC1002_0133"
FT   CDS_pept        156107..156232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14241"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA19"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14241.1"
FT                   /translation="MPEDLSIRLRKLTQLRNDGAIEDAQYQKELEIICNELSKLP"
FT   gene            complement(156356..156691)
FT                   /locus_tag="BC1002_0134"
FT   CDS_pept        complement(156356..156691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0134"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14242"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA20"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14242.1"
FT                   /translation="MLGIDAAVAEQQAYEWDIAMENPLPHVDPSTWRFMRGVYRRLYHE
FT                   KSLHEWLSDMRRAHSALLGEDLRVDRMLSESIAILEFTIIAREGQLPREIAAASNDSES
FT                   VMLQKTR"
FT   gene            complement(157488..157679)
FT                   /locus_tag="BC1002_0135"
FT   CDS_pept        complement(157488..157679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14243"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA21"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14243.1"
FT                   /translation="MTKVTKLMIFEELLKTRALLLTPYGRDFLEDPYRACIKRRELEQE
FT                   VLPRLRTVQAARQVEREP"
FT   gene            157898..158494
FT                   /locus_tag="BC1002_0136"
FT   CDS_pept        157898..158494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0136"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddr:Deide_1p01585 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14244"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA22"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14244.1"
FT                   /translation="MALVSLGHDLLRCKSPKGAGAPYRPNCPSRTKHVAGPLIAPISLS
FT                   TNECQNRGFFRWRLNDAPPASAVMSTTRYEPSIAHCWSKGGTGIGKQTTSDWRLYNLSS
FT                   HATADGGGQSDSRQDYDLYARCHVRVGTRSDQQADERRAGRREGSRREARHDRPRESQT
FT                   EHRAAPKSRRCLRGEAGRNDCRVPRSRPFTASDGE"
FT   gene            complement(158661..159119)
FT                   /locus_tag="BC1002_0137"
FT   CDS_pept        complement(158661..159119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0137"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eca:ECA3636 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14245"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA23"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14245.1"
FT                   /translation="MTPAEVQTKIAQHFGISKNKVHTYSQPQLLLGGKPAITAINYEAN
FT                   GESLQVLFETVSINPADPVPAYQINYKLPFSRENAEQLKAAAIQKYGTPTVNSYPLQWC
FT                   ANATNPALCDSGQATLKVGNTDLSLEDDRYVQRYLQLLDDQRSRKPRL"
FT   gene            complement(159381..159704)
FT                   /locus_tag="BC1002_0138"
FT   CDS_pept        complement(159381..159704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hna:Hneap_0096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14246"
FT                   /db_xref="GOA:D5WA24"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA24"
FT                   /inference="similar to AA sequence:KEGG:Hneap_0096"
FT                   /protein_id="ADG14246.1"
FT                   /translation="MSDVESQAGQPGMTTGKGVGIYALCIVCLVVLIHVSAHGKLMSPA
FT                   LVFFAYLAMGFALNRIVLRGLIEWHPVYNTLGNVSRAKLGMMLLWPIRYPVLFFQLLVS
FT                   KHL"
FT   gene            160063..160818
FT                   /locus_tag="BC1002_0139"
FT   CDS_pept        160063..160818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vex:VEA_003170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14247"
FT                   /db_xref="GOA:D5WA25"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA25"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14247.1"
FT                   /translation="MDVFISWSSSVTRKIAGAFSEFLELVIHRSKPWYSDETPAGAQWS
FT                   PLISERLGKSKVGVTFVTQANKESPWLMFEAGAVAKGVPDNRVCVVLVDLKNEDIQPPL
FT                   SQFLTTPLDEEGIFRVLQTINEALDEDKFNDEMLRRVMKAHWAEFDAKVKQICADEPST
FT                   PDEPRAERDMIVEILQTVRVLDQQMRAATEAVTPLSALAKPLPPGILAQVLSRKGQFAL
FT                   SDGLGTLSGNYISNDSIVGSAGIDTTTVE"
FT   gene            161511..162245
FT                   /locus_tag="BC1002_0140"
FT   CDS_pept        161511..162245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0140"
FT                   /product="pentapeptide repeat protein"
FT                   /note="KEGG: cyc:PCC7424_3628 pentapeptide repeat protein;
FT                   manually curated; PFAM: pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14248"
FT                   /db_xref="GOA:D5WA26"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA26"
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /protein_id="ADG14248.1"
FT                   /translation="MSDQPNRRRSLADSTFISSWTTTLLASIATVVALFYLIHDRRDQA
FT                   DIAAWTLLQGYLQQEHRAPYNVGQDFAFETLAQHGVSINNLDAHDAYISWANLHDLVGP
FT                   LAIFTRARLVQIDLSNADLRSANFEGAWVLESKCRGADFSWANFRGARLWCDFQDANFH
FT                   RANLRRAYLDGDIRGANFYQADISELSILPRLSNGDVFKDSCYRPGHPPYIQHAKIDPP
FT                   VDPQGKDCIRQWGKEWAALEAQ"
FT   gene            162338..162655
FT                   /locus_tag="BC1002_0141"
FT   CDS_pept        162338..162655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0141"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_5871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14249"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA27"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14249.1"
FT                   /translation="MAARWLSIIATNKNWRHEGKGVKTRYIAAALAALALTGFVTAQQE
FT                   ADNVAAYERAEIMLKRGQEAATLTCEGKDACDRAWQLTQVSVQQESGMTVRLATDTTID
FT                   I"
FT   sig_peptide     162338..162466
FT                   /locus_tag="BC1002_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.958 at
FT                   residue 43"
FT   gene            complement(162689..163153)
FT                   /locus_tag="BC1002_0142"
FT   CDS_pept        complement(162689..163153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tac:Ta0676 penicillin amidase precursor
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14250"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA28"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14250.1"
FT                   /translation="MDIAPKDPAALVLSALALAFSVFSLWFNFRSSLHAAMLSRKPVLV
FT                   FEYDGREGWILRNIGNGPAMNVIVAQRLKTAKWVNPIRVPPLAKDGSLVLQWLGHVNTT
FT                   GLGATYDDSENTKYTSTCRQDLTRVESGEKFGPWPDGEIGRHWDNPKCVT"
FT   sig_peptide     complement(163046..163153)
FT                   /locus_tag="BC1002_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.810 at
FT                   residue 36"
FT   gene            163887..164288
FT                   /locus_tag="BC1002_0143"
FT   CDS_pept        163887..164288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0143"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   bvi:Bcep1808_7044 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14251"
FT                   /db_xref="GOA:D5WA29"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA29"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADG14251.1"
FT                   /translation="MPNSKPSHYVEPIEILSEPERRRRRTAQEKIAIVQETLISGASVS
FT                   AVARRHGVNPNQVFGWRKQYQEGSLAAVKAGETVVPASELAAAIKEIKELQRLLGKKTM
FT                   EVEILKEAVEWGRSKNLIARSPLLPGDDH"
FT   gene            164228..165121
FT                   /locus_tag="BC1002_0144"
FT   CDS_pept        164228..165121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0144"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bte:BTH_I1930 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14252"
FT                   /db_xref="GOA:D5WA30"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA30"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADG14252.1"
FT                   /translation="MGPLKKPDCALALAAGGRPLKTVCEVLGVARSGVAAKLARSSDWQ
FT                   DGRSARRTDDTKLVEEIQAHVAHLPTYGYRRIWALLRRSREQTGAQCVNHKRVYRVMRE
FT                   HQLLLRRPGVRRDKRRHDGRVAVDRSDTRWCSDGFEFRCDDGTPLRVTFALDCCDREAI
FT                   SWAATTGGHSGDVVRDVMLAAVEQRFGTTQAAQPIEWLTDNGSAYIDHRTRSFARELGL
FT                   QPLTTPVRSPQSNGMAESFVKTMKHNYVAYMDKPDAPTALSRLAVAFEHYNERHPHKAL
FT                   KYRSPREFRRAAESSI"
FT   gene            165831..166307
FT                   /locus_tag="BC1002_0145"
FT   CDS_pept        165831..166307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcj:BCAL3081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14253"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA31"
FT                   /inference="similar to AA sequence:KEGG:BCAL3081"
FT                   /protein_id="ADG14253.1"
FT                   /translation="MSDLYNTQAAAEFLSRALPDDGDSAYWSGFLINNRRTDRSPIHRI
FT                   PFSRVGKAALYSPEDLARYVEFEKARRLGTVKLTGRAAEALQAFGIGESGGSSTGRRLE
FT                   IADVSLQIDEATREPFVRLVISEPMLVYRLELSQAQSLSERLLEAAKIGKRLAK"
FT   gene            166304..167386
FT                   /locus_tag="BC1002_0146"
FT   CDS_pept        166304..167386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0146"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcj:BCAL3079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14254"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA32"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14254.1"
FT                   /translation="MTADRDFSSDTETASPIVEQAPRKSAGISTNASRPHDTVSFDYGR
FT                   ENPPQASATNPTESTCAINYNHLRFRAEVDWIEIEIKTISRTNFPTVQRALNSALQLPD
FT                   SRNVFVKALDEGPGKAASVFRFRLQDPNSWSFVASMLKQLERRFPFASEPKITAIEIAF
FT                   DAYSRTESKMELADQAARFFKFCTLIVSKNCRIYRDFGGSPDSIPFQRASLVRHLWDGW
FT                   QIGIGNKHDDRLQHIYVKTTDGNGAPLPSAKHRARIEITLRGAALPYQGISEWAGADFE
FT                   KDLRMSAKFRMLKPKLNRFTRAAIEKTTFQVGERKRRWRVTKDRTAVSGERLHSATTIA
FT                   DRHLNEKARDAFRELSRRWR"
FT   gene            168118..169224
FT                   /locus_tag="BC1002_0147"
FT   CDS_pept        168118..169224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0147"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bpl:BURPS1106A_A2770 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14255"
FT                   /db_xref="GOA:D5WA33"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA33"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADG14255.1"
FT                   /translation="MRGMDEMQEPLFTTVKLEDFVPADHPLRPVRLLVNDALKRLNGLF
FT                   SVIYADTGRASIAPEKLMRALLLQVFYSVRSERMLMEQMRYNLLFRWFVGLAIEDAVWD
FT                   HSVFSKNRDRLLEHEVVEAFFTEVMSLAEKRGLLSREHFSVDGTLIQAWASHKSFRRKD
FT                   GPDDGPPAGGGRNAETDWQGERRSNATHESTTDPEARLFKKRHKSPAILCYHGHILMEN
FT                   RSGLVVGAVVSHADGFAERASALQLLDCVPGAHAKTVGADKAYDTRDFVNDCRARSVTP
FT                   HVARNDERCGGSAIDGRTSRHVGYRISQIIRKRIEEHFGWGKTVGRIRQTVYRGIRRVD
FT                   QHFKLTMVARNLTRMARMPGLVPQGAAR"
FT   gene            169221..169385
FT                   /locus_tag="BC1002_0148"
FT   CDS_pept        169221..169385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14256"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA34"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14256.1"
FT                   /translation="MSRHGVKTARQQGCMRAHAPRGSRGKPVIQREIARASLLNVASVV
FT                   MTGRFSTAC"
FT   gene            complement(169660..169785)
FT                   /locus_tag="BC1002_0149"
FT   CDS_pept        complement(169660..169785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14257"
FT                   /db_xref="GOA:D5WA35"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA35"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14257.1"
FT                   /translation="MSDRHATKADLDAALTRLKRHVVLSMLRVLVGGVLVLRFVH"
FT   gene            complement(169782..169952)
FT                   /locus_tag="BC1002_0150"
FT   CDS_pept        complement(169782..169952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0150"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sds:SDEG_0054 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14258"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA36"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14258.1"
FT                   /translation="MTTSAETMIETLKSSQAELVAMRKDVEALREHLHRMIGNIEFCLR
FT                   EVEKNVGRDEP"
FT   gene            complement(170620..170961)
FT                   /locus_tag="BC1002_0151"
FT   CDS_pept        complement(170620..170961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0151"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; KEGG: lhk:LHK_02624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14259"
FT                   /db_xref="GOA:D5WA37"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA37"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ADG14259.1"
FT                   /translation="MARTFDIDECADFLKVERKTALKLAQQGELPGARIGRAWVFLEDD
FT                   VVEYLRVQVRHQMVERQNNEAIEKGFEKARANNIPTPAPLLRKATGGGRRRPLPVLPDL
FT                   PNGGTDSRK"
FT   gene            171514..171801
FT                   /locus_tag="BC1002_0152"
FT   CDS_pept        171514..171801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0152"
FT                   /product="transcriptional regulator/antitoxin, MazE"
FT                   /note="PFAM: SpoVT/AbrB domain protein; KEGG: afl:Aflv_0166
FT                   toxin-antiotoxin addiction module antitoxin component MazE"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14260"
FT                   /db_xref="GOA:D5WA38"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039052"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA38"
FT                   /inference="protein motif:PFAM:PF04014"
FT                   /protein_id="ADG14260.1"
FT                   /translation="MAIQTLKRRGNSLEVRIPASVATKVGFTEGQEVDVQVLDGQVVIR
FT                   PHASIGRFSRERLIQQYREGKLQPHEEIDFGEPQGTELGGPDDPTQFDKR"
FT   gene            171808..172120
FT                   /pseudo
FT                   /locus_tag="BC1002_0153"
FT   gene            complement(172317..173342)
FT                   /locus_tag="BC1002_0154"
FT   CDS_pept        complement(172317..173342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpa:RPA2287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14261"
FT                   /db_xref="GOA:D5WA39"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA39"
FT                   /inference="similar to AA sequence:KEGG:RPA2287"
FT                   /protein_id="ADG14261.1"
FT                   /translation="MRPEGSAQQFESIVAELLVKLGFEKVERNIAHPARRAEVDITFRK
FT                   KSELAVVEVKKYRYASPPPSDVFLRALHQISLIEHETGAKVSMLVMSCPLIPRLRDVAD
FT                   RFANPNLVIWDADQLLEKASPFPDLRKRLESLLEVPVSNIMQFLAGPEALGEGEGPESN
FT                   QPKGEALAKALQAVVPGKEQASIFEERCIEALKYIFDTDLVGWHEQLETEDGLHRRDLV
FT                   CRIRETSEVWALMLNDLKSRYVIFEFKNYTKPITQKEVVTTERYLYPAALRTVAIIISP
FT                   QGSAPSALKVSQGAMREHGKLILSLTVSELCSLLIGKDQGSDPNTFLFEQVDEFLMSLG
FT                   R"
FT   gene            complement(173644..174738)
FT                   /locus_tag="BC1002_0155"
FT   CDS_pept        complement(173644..174738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0155"
FT                   /product="integrase family protein"
FT                   /note="KEGG: lch:Lcho_0954 integrase family protein;
FT                   manually curated; PFAM: integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14262"
FT                   /db_xref="GOA:D5WA40"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA40"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADG14262.1"
FT                   /translation="MRFRPPFKSPPTDAPRLSEAIEAYIRAKKAKDAWTPNTERANRAT
FT                   FRLTLQHFGDRPIDRFSSDDMVRFVNLLKQLPANLSKLRVKEGKTLEEVADLDLPPMAP
FT                   RTAGEHMSRISSLFRWCCKVEQFPITFNPAEEFAAGKKQATYERRPFTNDELALLFSSA
FT                   EFAARRFRFPYEYWLMPLAIYTGARLGELCQISLADFVEIEGVHCIAINDEQPEQSLKN
FT                   DNARRLVPIHSELIVLGLLRYVDCLKVRGEVRLFPELTLTPTSSHEASKWFGRFRRHAG
FT                   VTAKQETVFHSFRHGFITCLLDDERGISEHQIAPIVGHEAKLVTGQVYWNKKDARKRKP
FT                   IVEMFALDASVRELIPPIERVSFI"
FT   gene            174940..175527
FT                   /locus_tag="BC1002_0156"
FT   CDS_pept        174940..175527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0156"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /note="PFAM: Prophage CP4-57 regulatory; KEGG:
FT                   bph:Bphy_0241 phage transcriptional regulator, AlpA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14263"
FT                   /db_xref="InterPro:IPR006448"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA41"
FT                   /inference="protein motif:PFAM:PF05930"
FT                   /protein_id="ADG14263.1"
FT                   /translation="MSGRKPSQTEREAAPAVAQRYRKESVDDRRVQELLSPAAISHWPM
FT                   AARQLRDAGVLNAVDAISLAAYCEAFARWCAAGEQVARMLIDFGVRSGRKAQVQTGALE
FT                   KPMRSASIEAGVTEPVRRARNAIMRRDEVERETGLSHSTIYKRIKDGTFPAPLKIGPGS
FT                   TGWRVTDIEAFLASPADYRVESCASQGQEGLP"
FT   gene            175785..175854
FT                   /locus_tag="BC1002_R0004"
FT                   /note="tRNA-Ala2"
FT   tRNA            175785..175854
FT                   /locus_tag="BC1002_R0004"
FT                   /product="tRNA-Ala"
FT   gene            complement(176142..176990)
FT                   /locus_tag="BC1002_0157"
FT   CDS_pept        complement(176142..176990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0157"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] iron-sulphur domain;
FT                   Aromatic-ring-hydroxylating dioxygenase, alpha
FT                   subunit-like; KEGG: bgl:bglu_2g21230 anthranilate
FT                   1,2-dioxygenase, alpha subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14264"
FT                   /db_xref="GOA:D5WA42"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA42"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ADG14264.1"
FT                   /translation="MSEKRSAGEWREFVSGCLDFRPAEGVYRIAREMFTEPELFSLEME
FT                   HIFEKTWVYACHESEISNNNDFLTMRAGRQPLIISRDGAGNLNAMINACQHRGATLTRM
FT                   SKGNQSTFTCPFHAWCYKNDGRLVKVKAPGEYCDDLDKSVRGLKKARIASYKGFVFVSL
FT                   DVDGTDTLEDYLGDARIFFDMMVAQSPTGELEVLPGKSTYTFDGNWKLQNENGLDGYHV
FT                   STSHLAAAMRSRGGWPSGNWLSAIVPSPFWVALPRLKRCILAHLRGEICQGLAIVRTGS
FT                   N"
FT   gene            177121..178854
FT                   /locus_tag="BC1002_0158"
FT   CDS_pept        177121..178854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0158"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: bpy:Bphyt_0410 diguanylate
FT                   cyclase; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14265"
FT                   /db_xref="GOA:D5WA43"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA43"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADG14265.1"
FT                   /translation="MGRKPPPDGASGAPFWRIRARIQLCKRLPMRHVCYAYVFVGRVIG
FT                   RYCRDVAAFSRATFSASQNQKRMVTRRPNNVIAISVLLAGAILAIAVSLLAQMREDALR
FT                   RAQDSIANISLLVQRDVSRNLEIYDLSLRAVIDGLRQPGVLDLPPAIRQMVLFDGSISA
FT                   QDMGSVFVLDENGNVRFDSRAWPPRAHSHADRDYFKVQRASPDVGLYISHPFSRSGTDE
FT                   DLRIALSRRISRPDGSFGGVVVGTLRLTYFHRLFDGMKLGPSGSMALMLSDGTMLMRRP
FT                   YDPKTIGINLTGTANFSRFVKQPSGDFFGTAAIDRVERWYAFRHIDGFPLILDVALSTR
FT                   DIYVQWRRRAWIIGTLIVALDVTIIALAILFSRQLRLRRAAEEELRELARTDGLTGLNN
FT                   RRTFEEHVNDEWRRAQRNGRPLSLLLIDVDNFKGFNDLYGHSAGDEALIGVARCIAQNV
FT                   RRPGDTAARFGGEEFAVLLPDTDATGAQRIAEQIRAAVQALQCRHVASTHHVLTVSAGA
FT                   ATAQDAAFATSRALVDAADQALYRAKDGGRNRVMVFDTPTDNSSRDGAAVTPDTDARGA
FT                   N"
FT   gene            179003..180310
FT                   /locus_tag="BC1002_0159"
FT   CDS_pept        179003..180310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0159"
FT                   /product="uracil-xanthine permease"
FT                   /note="KEGG: bxe:Bxe_A4294 nucleobase/cation symporter,
FT                   (NCS2) family; TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14266"
FT                   /db_xref="GOA:D5WA44"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA44"
FT                   /inference="protein motif:TFAM:TIGR00801"
FT                   /protein_id="ADG14266.1"
FT                   /translation="MAASYFPRWRRQPAVAEGGIVGIDERLDWPQMFAMGVQHVVAMFG
FT                   STVLAPLLMGFDPNLAIFMSGIGTLLFFVLVGGRVPSYLGSSFAFIGLVIAVTGYGGHG
FT                   VNPNIPVALGGIIACGVAYGVIGLIVAAVGTGWIETLMPPVVTGAIVCVIGLNLAPIAV
FT                   HGVSGSNFESWMALVTVLCVGAVAVFTRGMLQRLLILVGLLLAYVIYAIVTNGLGMGKP
FT                   IDFSIVANAAWFGMPHFMSPVFDPHAMTLLAPIAVILVAENLGHIKAVSAMTGQNLDRY
FT                   IGRAFLGDALATIVSGFAGGTGVTTYAENIGVMAVTKIYSTLVFVIAALIALVLGFSPK
FT                   FGAVIQTIPGPVLGGVSIVVFGLIAVTGARIWVVNKVDFSDNRNLIVAAVTLVLGAGDF
FT                   SLKLGSFGLGGIGTATFGAIILYALLRRKPTQGPVA"
FT   gene            complement(180373..182028)
FT                   /locus_tag="BC1002_0160"
FT   CDS_pept        complement(180373..182028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0160"
FT                   /product="Na+/H+ antiporter"
FT                   /note="KEGG: bxe:Bxe_A4293 CPA1 family Na(+)/H(+)
FT                   antiporter; TIGRFAM: Na+/H+ antiporter; PFAM:
FT                   sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14267"
FT                   /db_xref="GOA:D5WA45"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA45"
FT                   /inference="protein motif:TFAM:TIGR00831"
FT                   /protein_id="ADG14267.1"
FT                   /translation="MEIVFTVLILLLAVAASGVLARALPFKLPLPLVQIAIGAMLAWPR
FT                   LDLHVAFDPEIFMLLFIPPLLFADGWRIPKREFFMARRAILMLALGLVFMTVLVVGHFV
FT                   HVLVPQISLPVAFALAAVLSPTDAVALSGIAGKGRIPGQLMHILEGEALMNDASGLVAL
FT                   KFAIAAALTGAFSLRAASVSFVIIAVGGLAVGAAVSAVFSFVSARFLNLTEEGDPAPGV
FT                   VMTLLIPFAAYLTAERFELSGILAAVSAGMMMNYASIMEKWQVASRVRATSTWTMIEFV
FT                   FNGMVFIMLGLQFPHILGRALLDAHETNDAQVALLIGYIVAVAFALYAMRFAWVWLLRW
FT                   FSSRGATKHGVANAVPGLRMVSVTTVAGVRGAVTLAGVLSLPEVLPNGTPLPGRDLAIF
FT                   IASGVILLSLLVAVAALPLLLRGWRRGKDPHAAEEALARTLAAQSAIRAIDHLHDTECA
FT                   DLDESAQAYATDVTARVMDLYRRRLASLDDEQAPRELARRADALEFRMKLAAMRAERKT
FT                   LLDLRDTERINDETMNKLMREVDLSETALTARKR"
FT   sig_peptide     complement(181963..182028)
FT                   /locus_tag="BC1002_0160"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.858) with cleavage site probability 0.777 at
FT                   residue 22"
FT   gene            182265..183551
FT                   /locus_tag="BC1002_0161"
FT   CDS_pept        182265..183551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0161"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="KEGG: bxe:Bxe_A4292 diguanylate phosphodiesterase;
FT                   PFAM: EAL domain protein; SMART: EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14268"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA46"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ADG14268.1"
FT                   /translation="MTIAQQDRAASVPHGFEVEVTSGLRRYSVQHGELTLTSVFQPIFS
FT                   LSHLRAVGYEGLLRAHDALDRAVSPLDVFGEAVRLGDALQIDRLAQTLHLENFKVLGAE
FT                   REWLFLNVHPGVLTDPYLAAALLANLRRLDLSPRRVVLEVLEQRAEDLDRLADAVREFR
FT                   ERGFLIALDDFGAGHSNIERIWQLNPDIVKLDRIMLSHAAHRADMATILPGLVSLLHEA
FT                   GKLVLIEGVETEHEAQMALACNADFVQGFFFGRPSPGIADAIHTAICIGEVTERYREQA
FT                   EARERRSARRLAPYLRAFERAAERLAAGEPLDEVCWNFLALDHAARCFLLDAKGRQAGR
FT                   NVVLRADRAAQETRFLPLADAQGANWLRRPYFSVAINAPERVHVTRPYLSINEALPCVT
FT                   LSVATRVGGETCVLCGDIDWVEDERDARF"
FT   gene            183587..184282
FT                   /locus_tag="BC1002_0162"
FT   CDS_pept        183587..184282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0162"
FT                   /product="CutC family protein"
FT                   /note="PFAM: CutC family protein; KEGG: bxe:Bxe_A4291
FT                   putative copper homeostasis protein CutC"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14269"
FT                   /db_xref="GOA:D5WA47"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA47"
FT                   /inference="protein motif:PFAM:PF03932"
FT                   /protein_id="ADG14269.1"
FT                   /translation="MSVLLEVIATTVADARAAAQAGADRLELVTAMGEGGLTPSMGLIE
FT                   AVVAAVAIPVNVIVRPHSRSFVYDADDYAVILRDIRAVKAAGANGIVIGMLDADRAIDR
FT                   EGLARACGAADGLAITFHRAFDEARDLREALEVLLGFEAVTNVLTSGGKPSVLQAQAVL
FT                   SELVRQATGSHCTVLAGAGLTVDAVADFVSKTHVEAVHFGSGVRVNGNGLAPVDPAKVM
FT                   QVRALLDAT"
FT   gene            complement(184306..187893)
FT                   /locus_tag="BC1002_0163"
FT   CDS_pept        complement(184306..187893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0163"
FT                   /product="Pyruvate/ketoisovalerate oxidoreductase"
FT                   /note="PFAM: Pyruvate/ketoisovalerate oxidoreductase; KEGG:
FT                   bpy:Bphyt_0417 2-oxoacid ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14270"
FT                   /db_xref="GOA:D5WA48"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA48"
FT                   /inference="protein motif:PFAM:PF01558"
FT                   /protein_id="ADG14270.1"
FT                   /translation="MTARLPIDGTPALADYKLSDNLTATRGRIFLTGTQALVRLPLMQR
FT                   ALDKTRGLNTAGFISGYRGSPLGMVDQQLWKAKKLLAASDVRFLPAINEELGGTAVLGT
FT                   QRVEADPERTVDGVFAMWYGKGPGVDRAGDALKHGNAYGSSPHGGVLVVAGDDHGCVSS
FT                   SMPHQSDFAMMAWHMPVVNPSNIADMLEFGLYGWALSRFSGAWVGYKAISETVESGSTV
FT                   DLDALQTEWTPPQEFAAPTGGLHNRWPDLPSLTIEARLHAKLDAVRQFARINSIDKWIA
FT                   PSPHANVGIVTCGKAHLDLMEALRRLDLTLADLDAAGVRIYKVGLSFPLEMTRIDAFVS
FT                   DLSEVLVIEEKGPVIEQQIKDYLYNRTQGTRPVVIGKHAEDGTMLLSSLGELRPSRILP
FT                   VFANWLAKHKPALDRRERVVDLVAPQILSNAADSVKRTPYFCSGCPHNTSTKVPDGSIA
FT                   QAGIGCHFMASWMERDTTGLIQMGGEGVDWAAHSMFTKTRHVFQNLGDGTYFHSGILAI
FT                   RQAVAAKATITYKILYNDAVAMTGGQPVDGSISVPQIARQVEAEGVSRFVVVSDEPEKY
FT                   DGHHGQFPQGTTFHHRSEMDAVQRELRDTDGVTVLIYDQTCAAEKRRRRKKGEFPDPNK
FT                   RLFINEEVCEGCGDCGVQSNCLSVEPVETALGRKRRIDQSSCNKDYSCVNGFCPSFVTV
FT                   EGGTLKKAAGVAFDPQALTAHVNALPIPATPLDAAPYDILVTGVGGTGVVTVGALISMA
FT                   AHLEGKSASVLDFMGFAQKGGSVLSFVRFAARDEWLNQVRIDTQQADVLLACDMVVGAS
FT                   ADALQTVRHGRTRIVVNTHAIPNASFVQNPDATLHADALIDKMRHAAGAERMSTCDAQA
FT                   LATRFLGDTIGANILMLGFAWQLGLVPVSFAAMMRAIELNNVAVQMNQLAFSIGRMAAA
FT                   DPAALESLWQSRHAPKPSVRVDTLDELIAHREARLLAYGGAAYVTRYRALVDVARRAET
FT                   AVDAASERVTRAVATTFYRLLAVKDEYEVARLHTDGAFREALEAQFEGAAGKDFTIRFN
FT                   LAPPTLTRVQPGAVPTKKTYGQWMWPVLGLLAKWRALRGTALDPFGRTLERKMERELAS
FT                   DYETTLQRALAKLDASHLDDVAKLAELHARVRGYGHVKLANLAGVKRGERDLAARVGIE
FT                   AATGIAVKKSLDEMKGAGQLRGIPVVIAK"
FT   gene            complement(188135..189112)
FT                   /locus_tag="BC1002_0164"
FT   CDS_pept        complement(188135..189112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0164"
FT                   /product="Ion transport 2 domain protein"
FT                   /note="PFAM: Ion transport 2 domain protein; KEGG:
FT                   bxe:Bxe_A4289 putative inward rectifier potassium channel"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14271"
FT                   /db_xref="GOA:D5WA49"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR013518"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR016449"
FT                   /db_xref="InterPro:IPR041647"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA49"
FT                   /inference="protein motif:PFAM:PF07885"
FT                   /protein_id="ADG14271.1"
FT                   /translation="MASEPSDRFSTLGDSDTDTSAPRRHARGSREMRLDDRVVIAHGMP
FT                   TPLWQDLYHRALGVRWPVFFVSLALLFLLLNTVFAVLYMLGDAPIANLFPKGFGGAFFF
FT                   SVETLATVGYGDMHPQTVYAHWIATLEIFIGMSSIALATGLIFARFSRPHAKIMFARYA
FT                   VIRPIDGRMTLMVRSANARQNVIAEARARLRIMRLETSIEGFTLRKLYDLALVRDQHPV
FT                   FKLGWTLMHIIDEASPLFGENAKSLKGRDVSLLLTLEGIDESTSQTMQARHMWTCDQIV
FT                   WQHRFVDIMSEQDGVSHIDYAHFDEIVPLDAAPLQPDIAANTAQ"
FT   gene            189502..189876
FT                   /locus_tag="BC1002_0165"
FT   CDS_pept        189502..189876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0165"
FT                   /product="putative periplasmic protein"
FT                   /note="KEGG: bpy:Bphyt_0466 putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14272"
FT                   /db_xref="InterPro:IPR024289"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA50"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0466"
FT                   /protein_id="ADG14272.1"
FT                   /translation="MRPVETRVRDFYAWFIPRLAADRDYPIMDQEIYRHVAKPTVDLLR
FT                   KQYQANKLSEDAEYFTKVQDFDEKDWARHIAVHPVFMLDSVVLVAVTFGSKDKQTNIVF
FT                   LRQENGTWKITKVVDTLDYR"
FT   gene            complement(189967..190212)
FT                   /locus_tag="BC1002_0166"
FT   CDS_pept        complement(189967..190212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14273"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA51"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0421"
FT                   /protein_id="ADG14273.1"
FT                   /translation="MAEQLFQYGVYSIHVRPLELSGARWDAEYEIRHREKAVKPWTTVG
FT                   GDAGFAEQAEAVESAHRQAVDDIEHGAGIPKPRVFP"
FT   gene            complement(190281..190511)
FT                   /locus_tag="BC1002_0167"
FT   CDS_pept        complement(190281..190511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14274"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA52"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0422"
FT                   /protein_id="ADG14274.1"
FT                   /translation="MEDVTYTKGIYTATASIREVAQDAFQGIVTLARDEGEPSDDQETT
FT                   LYEVDSTSPTPGEALEEAKALAHRILGEIEL"
FT   gene            complement(190663..191571)
FT                   /locus_tag="BC1002_0168"
FT   CDS_pept        complement(190663..191571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0168"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: bpy:Bphyt_0423 PfkB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14275"
FT                   /db_xref="GOA:D5WA53"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA53"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADG14275.1"
FT                   /translation="MSATTELPVFVSAGDILTDLVRTGASHWLSRPGGAGWNVARCVAR
FT                   LGLPTACAGSLGVDNFSDELWDASVAAGLDMRFLQRVEHPPLLAIVHQTHPPSYFFMGE
FT                   NSADLAFDPARLPAGWMNAVKWAHFGGISLVRQPLGDTLAALAAELRSHGVKISFDPNY
FT                   RNLMEHGYAPRLRQMAALADLIKVSDEDLRMFFKTSDEAAALAQLRAMNPAATVLVTRG
FT                   PDAAMLLDGAAVIDAKPPRVEVVDTVGAGDASIGGLLFSLMSAPQRGWPEHLAFALAAG
FT                   AAACGHAGAHAPTLDEVVALL"
FT   gene            complement(191568..192869)
FT                   /locus_tag="BC1002_0169"
FT   CDS_pept        complement(191568..192869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0169"
FT                   /product="N-acylglucosamine 2-epimerase"
FT                   /note="PFAM: N-acylglucosamine 2-epimerase; KEGG:
FT                   bpy:Bphyt_0424 N-acylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14276"
FT                   /db_xref="GOA:D5WA54"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR034116"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA54"
FT                   /inference="protein motif:PFAM:PF07221"
FT                   /protein_id="ADG14276.1"
FT                   /translation="MTKTDPHHPSTDAAKAPPVASFRKREFLLAHIEDTLRFYAPNVLD
FT                   PSGGFYHFFRDDGSIYNRTTRHLVSSCRYVFNYAMAYRQFGDPKHLEYARHGLRFLRDA
FT                   HWDSQHEGYDWEIEWRDGRKRTLDATRHCYGLAFVLLAYSHAAMAGIEEAKPMIGATFE
FT                   LMEHRFWDAAAGLYADDASADWRVSTYRGQNANMHTTEALLAAHEATGHLVYLDRAERV
FT                   ASNITLRQAKLSQGLVWEHFHADWSVDWHYNEEDSSNIFRPWGFQPGHQTEWAKLLLIL
FT                   ERFRPLPWLLPRAIELFDAAMMHAWDEDHGGLYYGFGPDGTVCDHDKYFWVQAETFAAA
FT                   ALLGKRTGNERFWDWYDEIWRYSWTHFVDHKYGAWYRILTCDNRKYSDEKSPAGKTDYH
FT                   TMGACYEVLAHALGEDASAGSTAPAAAVSAEKAQ"
FT   gene            complement(192866..193852)
FT                   /locus_tag="BC1002_0170"
FT   CDS_pept        complement(192866..193852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0170"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: bpy:Bphyt_0425 transcriptional regulator, LacI
FT                   family; PFAM: regulatory protein LacI; Lipocalin family
FT                   protein; periplasmic binding protein/LacI transcriptional
FT                   regulator; SMART: regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14277"
FT                   /db_xref="GOA:D5WA55"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA55"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADG14277.1"
FT                   /translation="MATTIRDVARAASVSIGTVSRALKNQPGLSEATRERVVEAARQLG
FT                   YDSAQLRPRIRRLTFLLHRQHNNFAASPFFSHVLHGVEDACRERGIVPSVLTAGPTEDV
FT                   IHQMRLHAPDAVAIAGFVEPETLATLVAMQRPLVLIDLWSPGLRSVNLDNAGGATLAMR
FT                   HLFEQQRKRVAFIGGSLAHFSIAERALGYRRAFFEAGLLFDPSLEVTIDAGLDPDTGAA
FT                   RAMQRLLDAPGPRPDAVFAFNDAAALAALRVCLARGLSVPDDIAIIGFDDIPAAAHATP
FT                   PLSTIAVDKEALGRRGVELLLEDSPAELEVRLPVQLVARASTLVKTP"
FT   gene            complement(194224..195249)
FT                   /locus_tag="BC1002_0171"
FT   CDS_pept        complement(194224..195249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0171"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG:
FT                   bpy:Bphyt_0427 bile acid:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14278"
FT                   /db_xref="GOA:D5WA56"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA56"
FT                   /inference="protein motif:PFAM:PF01758"
FT                   /protein_id="ADG14278.1"
FT                   /translation="MARPKFLPDNFTLCLVGTVILASFLPVHGQAAVGFNWVTNIAVGL
FT                   LFFLHGAKLSREAIIAGATHWRLHLVVLLSTFALFPLLGLALKPVLSPLVTPSLYAGVL
FT                   FLCTLPSTVQSSIAFTSIAKGNVPAAVCSASASSLLGIFVTPALVSLIVTNQAASGGAS
FT                   PWHTIGNIVLQLLVPFVAGQLLRPLIGKWIEKNRGVLKFVDQGSILLVVYGAFSEAVTE
FT                   GLWHTIPLSALGGLVVVSCVLLALALGMTIFASKRLGFNRADQITIIFCGSKKSLAAGV
FT                   PMAKVIFASHAVGAVVLPLMLFHQIQLMVCAALAQRWGARDLSGEGEAAARRPAAAVAR
FT                   R"
FT   sig_peptide     complement(195160..195249)
FT                   /locus_tag="BC1002_0171"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.841 at
FT                   residue 30"
FT   gene            195674..196303
FT                   /locus_tag="BC1002_0172"
FT   CDS_pept        195674..196303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14279"
FT                   /db_xref="UniProtKB/TrEMBL:D5WA57"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0428"
FT                   /protein_id="ADG14279.1"
FT                   /translation="MPCAAAATRRFSPPATGPSQLERWISGKSSGVRVTKVDGLSRTRH
FT                   WAWGAVIAVLCSFAYAKGPGAPHGGGADSHHAGGHPPRMEVRGDGHYADANGAHGPRGL
FT                   RDPMVARDSRAQRGNPNIADANFGYGFGSYKSGIRRVGDPSSYAGAITPVSAESRPVPH
FT                   PPSNMPMRNGSIRADVARYNEERGAPRPMQRPADDPRQPGGSPYRN"
FT   gene            196859..197944
FT                   /locus_tag="BC1002_0173"
FT   CDS_pept        196859..197944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0173"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: bxe:Bxe_A4279
FT                   OmpC family outer membrane porin"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14280"
FT                   /db_xref="GOA:D5WAH7"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAH7"
FT                   /inference="protein motif:PFAM:PF00267"
FT                   /protein_id="ADG14280.1"
FT                   /translation="MNTSLSTVLKTTLKATACVAALASASSAFAQSSVQLYGQVDEWVG
FT                   AQKFPGGKTAVVVSGGGMSTSYWGFKGTEDLGNGYKAIFTIEGFFRAQTGEYGRFTGDT
FT                   TFSRNAYVGIEAPWGTVTAGRLTTPLFVSTILFNPFVDSYVFSPMVTHVYLGLGTFPTY
FT                   TTDQGVTGDSGWNNAVSYATPNFNGLSATAMYALGNTTQNGAKKWSGQVLYFHGPFAAT
FT                   AVYQYVNFNNVPGDLGSFETSGVPGLRSQSVAQAGVSYDLKFVKLYGQYMYTYNDQQVT
FT                   SWHVNTGQGGVTVPFGPGSVMASYAYSRNGGGSNQTRQTAAVGYDYPLSKRTDVYAAYM
FT                   YDHITGQSSGNTYGAGLRAKF"
FT   sig_peptide     196859..196951
FT                   /locus_tag="BC1002_0173"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 31"
FT   gene            198097..199029
FT                   /locus_tag="BC1002_0174"
FT   CDS_pept        198097..199029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0174"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bxe:Bxe_A4278 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14281"
FT                   /db_xref="GOA:D5WAH8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAH8"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADG14281.1"
FT                   /translation="MDTLVSMKVFRHVVEAGSFVGAAEKMEMSAAMASKHVMHLEQQLG
FT                   ARLLNRTTRRVAPTEAGREYYERLSQALTELDEAGQAVGAASVVPHGRLRVSSLSAFGL
FT                   NHVMAAVADYAEQYPQVTVDMTLSDRVVELIDEGFDVAIRASPGGLKSSSLIARQIATA
FT                   HLVLCASPAYLRKHGTPKSVADLARHNYLQYAGVSALEVATGDASSRVRLSGNLIVNQL
FT                   EAQRVVVLLGAGIAMLGTEVIGSDLAEGRLVPLLVDEVPPRELPIHVVYTSRRHLSAKV
FT                   RSFVDFLAARFANESLWPSLDEIKALAVR"
FT   gene            199148..202540
FT                   /locus_tag="BC1002_0175"
FT   CDS_pept        199148..202540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0175"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   KEGG: bph:Bphy_0156 methylmalonyl-CoA mutase, large
FT                   subunit; PFAM: methylmalonyl-CoA mutase; cobalamin
FT                   B12-binding domain protein; ArgK protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14282"
FT                   /db_xref="GOA:D5WAH9"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033669"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAH9"
FT                   /inference="protein motif:TFAM:TIGR00641"
FT                   /protein_id="ADG14282.1"
FT                   /translation="MTDLSTPQRAGSHELPAGRRLRFVTAAALFDGHDASINIMRRILQ
FT                   ASGVEVIHLGHSRSVAEVATAALNEDADGVAVSSYQGGHNEYFRYLVELLRARGGERIK
FT                   VFGGGGGVIVPEEIAALERDGVEKIYSPHDGQRLGLQGMIDDMIARCVEGARAADAARP
FT                   TPVREWLAELAARPLPLCFETNAPNGGTPPGLHTADPAAPIFRRLAQLISAFETNSVDA
FT                   AARDQLSTLAQTTRVPVLGITGTGGAGKSSLTDELIRRFRLDYDDTLNIAVLAIDPSRR
FT                   KSGGALLGDRIRMNAIGDWGGGDRRGARVYMRSMATREASTELSDSLPAALMLCKVAGF
FT                   DLIVVETSGIGQGDAAIVPFVDESLYVMTPEFGAASQLEKIDMLDFASFVAINKFDRKG
FT                   AQDALRDVAKQVQRNRADFATSPDAMPVFGTIASRFNDDGVTALYLRIAAALRTHGLRD
FT                   GGARLGAPEGLRFSSNLHAIVPPARVRYLADIAQTVRGYRERADAQAQIARERWQLVET
FT                   RRMLGEAGNDAASLDALIKQRDAALGERERKLLDAWPQTVAAYAGDEHVVRIRDREIHT
FT                   ALTVTTLSGSEIRKVSLPKFVDHGEILRWLMLDNLPGYFPFTAGVFPFRRENEDPTRMF
FT                   AGEGDPQRTNRRFKLLSEGMPAKRLSTAFDSVTLYGEEPHERPDIYGKVGNSGVSVATL
FT                   DDMKTLYDGFDLCSPETSVSMTINGPAPTILAMFFNVAIDQQIALKEQQQGRPLSEAEL
FT                   AAARRAALENVRGTVQADILKEDQGQNTCIFSTEFSLKVMGDIQAYFVEHGVRNFYSVS
FT                   ISGYHIAEAGANPISQLAYTLANGFTYVEAYLARGMSIDDFAPNLSYFFSNGMDPEYTV
FT                   LGRVARRIWAIAMRERYGANERSQKLKYHVQTSGRSLHAQEIDFNDIRTTLQALIAIYD
FT                   NCNSLHTNAFDEAITTPTEESVRRAVAIQLIINREWGLAKNQNPNQGSFVIDELTDLVE
FT                   EAVLAEFERLTERGGVLGAMETGYQRGRIQDESMLYEHRKHDGSYPIVGVNTFLSAHPH
FT                   EAPRPLVLARSTDAEKQSQLRRLRDFQTRHRDAAPEALECLKRAVIDDGNVFAVLMDVV
FT                   RVCSLGQITHALFEVGGQYRRNM"
FT   gene            complement(202579..203538)
FT                   /locus_tag="BC1002_0176"
FT   CDS_pept        complement(202579..203538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0176"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   bxe:Bxe_A4276 putative 2-nitropropane dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14283"
FT                   /db_xref="GOA:D5WAI0"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAI0"
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /protein_id="ADG14283.1"
FT                   /translation="MALPAVLQNLALPVVASPMFIVSYPELVLAQCKAGIVGSFPALNA
FT                   RPAELLDEWLTQIQAQLAEHEAANPDAVIGPIAVNQIVHQSNARLEHDVRICVEHKVPI
FT                   FITSLRAPAREIVDAVHSYGGIVLHDVINLRHAQKALDAGVDGLILVASGAGGHAGTTS
FT                   PFALVGEVRRIFDGPIVLSGSIANGGSILAAQAMGADLAYMGTRFIATKEAHAVDSYKQ
FT                   AIINAKASDIIYTNLFTGVHGNYIRESILNAGLDPDALPESDKTKMNFGSEKAKAWKDI
FT                   WGAGQGVGLMDDVPDVAELVRRLKKEYDDAKARLGIAR"
FT   gene            203853..204743
FT                   /locus_tag="BC1002_0177"
FT   CDS_pept        203853..204743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0177"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bxe:Bxe_A4275
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14284"
FT                   /db_xref="GOA:D5WAI1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAI1"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG14284.1"
FT                   /translation="MAFENFTPFRVAVGDVDIFGVKGGAGPPLLLLHGHPQSHLIWERC
FT                   AEPLAQHFTVIATDLRGYGASGKPSSDAGHTPYSKRAMAADQVAVMRHFGFERFLVCAH
FT                   DRGARVAHRMALDHADAVERLMLLDIAPTLAMYEATDRTFATHYFHWFFLIQPEPLPET
FT                   LIGANPAAYVDAVMGGRHAGLAPFDPAALDAYRAALAQPGAVHAMCEDYRASASIDLEH
FT                   DRADIERGNKIGCPLRVLWGDKGVIEKCFDALDEWRRVARDVSGRALACGHYLPEEAPD
FT                   ELVAEMLSFFEAVEQ"
FT   gene            complement(204782..205252)
FT                   /locus_tag="BC1002_0178"
FT   CDS_pept        complement(204782..205252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0178"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="KEGG: bpy:Bphyt_0434 transcriptional regulator, AsnC
FT                   family; PFAM: Transcription regulator, AsnC-type-like;
FT                   regulatory protein MarR; SMART: Transcription regulator,
FT                   AsnC-type"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14285"
FT                   /db_xref="GOA:D5WAI2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAI2"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADG14285.1"
FT                   /translation="MSKRLASIAPIALDDTDRALLAALAQDARQPVSELARVVGLSPPS
FT                   TAERVRRLEAQGVIERFTVQIDPRALGFTLQAIVRVKPLPGELHLVEEVIRRIPEFVEC
FT                   DKVTGDDCFICRLYLHSIEQLDEILSKVTERAETSTAIVKSTPVTRRLPPLG"
FT   gene            205366..206304
FT                   /locus_tag="BC1002_0179"
FT   CDS_pept        205366..206304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0179"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bpy:Bphyt_0435 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14286"
FT                   /db_xref="GOA:D5WAI3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAI3"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADG14286.1"
FT                   /translation="MASNKASATTTSSSSSDIRRGAAEMSIAMLMSGTIGWLVVSSQQS
FT                   PFNVVFFRCIFGGATLALVCAVLGLFRRELFSWKMLGLALLGGAAIVVNWVLLFAAYSR
FT                   ASISMATAVYNTQPFMLVGLGALVFRERISASTIAWLVVAFVGLVFVVKVEPAVLAVPG
FT                   QYLVGVAYAVGAAAMYAVSSIITKRLKGTPPHLLALIQVSLGVLLLAPFVRFDALPASG
FT                   VQWLELVVLGVVHTGLMYVLLYGAIQKLPTSMTGALSFIYPVVAIIVDRLAFGQTLAWI
FT                   QVLGAVLILLAAAGVNLGWRIVPQKKRLSST"
FT   gene            complement(206602..207519)
FT                   /locus_tag="BC1002_0180"
FT   CDS_pept        complement(206602..207519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0180"
FT                   /product="beta-lactamase domain protein"
FT                   /note="KEGG: bpy:Bphyt_0436 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14287"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAI4"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0436"
FT                   /protein_id="ADG14287.1"
FT                   /translation="MIALPASIRVFERGWLSSNNVLLVDDACAALVDTGYATHASQTVA
FT                   LVRNALHTRPLDLIINTHLHSDHCGGNALLQATWPCRTLIPLSEADAVRDWDETRLSFR
FT                   ATGQTCERFGFTGTLASGAHLRIGALDWQVLGAPGHDPHSLMLYCADERLLISADALWE
FT                   NGFGVIFPELEGESGFAEQQAVLDMIATLDVRVVIPGHGAPFTHVGPALERAMSRVARL
FT                   RADPARNAKNALKVLIVFKLLEVREMSVDTLLRMLDDASVMRAAASMLKPRSEWPTLLK
FT                   GMIGELAANGGPLEVDGTRILARR"
FT   gene            complement(207516..207989)
FT                   /locus_tag="BC1002_0181"
FT   CDS_pept        complement(207516..207989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0181"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   bxe:Bxe_A4273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14288"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAI5"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ADG14288.1"
FT                   /translation="MKAAPRVVTLGETFSSTLELSVDSIKSFATLVVDLNPLHHDEAYA
FT                   AQSRFGGLIASGTQPTAYFMALLATHFSTYAQPLGLEFDIKLKKAVQAHDTLTITWRVR
FT                   DAHWKPSLNGDLTYLEGTVVNQGGELMLTGTSTILVMPKPDAVEHAQSRTATP"
FT   gene            complement(207986..208231)
FT                   /locus_tag="BC1002_0182"
FT   CDS_pept        complement(207986..208231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0182"
FT                   /product="protein of unknown function DUF1289"
FT                   /note="PFAM: protein of unknown function DUF1289; KEGG:
FT                   bpy:Bphyt_0438 protein of unknown function DUF1289"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14289"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAI6"
FT                   /inference="protein motif:PFAM:PF06945"
FT                   /protein_id="ADG14289.1"
FT                   /translation="MASSKPYEQKAGDGSVPSPCINVCRMDASTGWCEGCLRTIDEIAG
FT                   WSTFDDDEKRAVWDTIEARHAEFIASRTTSATKEKQ"
FT   gene            complement(208237..208758)
FT                   /locus_tag="BC1002_0183"
FT   CDS_pept        complement(208237..208758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0183"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: bxe:Bxe_A4271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14290"
FT                   /db_xref="GOA:D5WAI7"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAI7"
FT                   /inference="protein motif:PFAM:PF04073"
FT                   /protein_id="ADG14290.1"
FT                   /translation="MNDLASFDSDDLAALPDSARRVALLLRERGHAGRIVMLPETGKTS
FT                   AEAAAGLGCSVAQIAKSILFRRREDDAPVLVIASGANRVDEKKVAAQVGEIGRADAKFV
FT                   REKTGYAIGGVCPVGHATEPVTLIDADLLELESLWAAAGHPHAVFNLTAQELIALTGAP
FT                   VVDVALRETA"
FT   gene            complement(208793..209719)
FT                   /locus_tag="BC1002_0184"
FT   CDS_pept        complement(208793..209719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0184"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   bxe:Bxe_A4270 hydroxymethylglutaryl-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14291"
FT                   /db_xref="GOA:D5WAI8"
FT                   /db_xref="InterPro:IPR000138"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAI8"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ADG14291.1"
FT                   /translation="MSLPQQVKIVEVGPRDGLQNEKEFVPTATKIELINRLSAAGFRNV
FT                   EAASFVSPKWVPQMADGADVMTGIERRAGTIYSVLTPNLRGFEGALAARADEIVIFGAA
FT                   SEAFSQKNINCSIAESIERFAPVAAAAKEHRLRIRGSVSCALGCPYQGEVPVASVVDVV
FT                   KRFAALGCDEIDIADTIGVGTPKRTREVFEAVTEVFPREHLSGHFHDTYGQALANIYAA
FT                   LLEGIEIFHASVAGLGGCPYAKGATGNVATEDVLYLMNGLGIETGIDLAQVVEIGDFIS
FT                   NAIGRANVSRAGKALLAKARSEANTCV"
FT   gene            complement(209836..210777)
FT                   /locus_tag="BC1002_0185"
FT   CDS_pept        complement(209836..210777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0185"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: bpy:Bphyt_0441 D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14292"
FT                   /db_xref="GOA:D5WAI9"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAI9"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADG14292.1"
FT                   /translation="MKILFYAPHTEAAAWLHDFARALPAAELREWQPGDNAPADFAVVW
FT                   RPPREMLAGRTTLRAIFNLGAGVDAILALERAHPGTLPPEVPLIRLEDTGMGAQMAEYV
FT                   THAVLRYLRRFDEYQMLQGERRWKVLEPHPRATFTVGVLGLGVLGTQVAQTLASFGLPV
FT                   RGYSRSAKQIDGIATFAGDAQFDSFLDGAKVLVNLLPHTPDTESVLNARVFSKLARGAY
FT                   LINVARGAHLVEADLLAALASGQLAAATLDVFREEPLPADHPFWCEPRITITPHTSALT
FT                   LREDSVAQVADKIGAMMRGEQVSGAVQLERGY"
FT   gene            211089..211691
FT                   /locus_tag="BC1002_0186"
FT   CDS_pept        211089..211691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0186"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   bxe:Bxe_A4268 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14293"
FT                   /db_xref="GOA:D5WAJ0"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAJ0"
FT                   /inference="protein motif:PFAM:PF06821"
FT                   /protein_id="ADG14293.1"
FT                   /translation="MLSCTRSSWPPRLVTVPGLHGSEGTHWQTWLERQFARSLRVEQAN
FT                   WDAPDLALWAKSLRDLLARERGPFVLAAHSFGCLATAHALQQGALASDVVGVLFVAPAS
FT                   PRKFEFAGPFDARRVGVPSILIGSETDPWMTLADARDLAQRFGSAFVNLGDAGHINTAA
FT                   GFGPWPRAKYFIDTLVHCAAPLRFREEAIDSAQHALV"
FT   gene            211792..212829
FT                   /locus_tag="BC1002_0187"
FT   CDS_pept        211792..212829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0187"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="KEGG: bpy:Bphyt_0443 sulfate ABC transporter,
FT                   periplasmic sulfate-binding protein; TIGRFAM: sulfate ABC
FT                   transporter, periplasmic sulfate-binding protein; PFAM:
FT                   extracellular solute-binding protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14294"
FT                   /db_xref="GOA:D5WAJ1"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAJ1"
FT                   /inference="protein motif:TFAM:TIGR00971"
FT                   /protein_id="ADG14294.1"
FT                   /translation="MKGNTGTSRRLKAGVTAGITVIALAFGGVSTARADTSLLNVSYDV
FT                   TRELYKDINAGFIADYRQKSGETVSVRQSHGASSAQALSVLQGLQADVVTMNQPNDIDL
FT                   LAEKGHLVPADWRARLPDDSAPYTTTMVFLVRKGNPKHIKDWDDLAKPGIQAVIANPKT
FT                   SGNGRYTYLAAWGYRKQHGGTDAQALDFVKGIFRNVPVLDTGGRGATTTFTQRGIGDVL
FT                   VTFENEVSLIDTGVGAGSYEAVYPSVSLLAAPPVSIVDKVVDKRGTRKQAQAYLDYLWS
FT                   PAAQEIIAQHHLRPRDKNVFAKHAAEFKPIKTFTVEQMFGSWQKAQDTHFSDGGTFDQI
FT                   IVDRK"
FT   sig_peptide     211792..211896
FT                   /locus_tag="BC1002_0187"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.949 at
FT                   residue 35"
FT   gene            complement(212937..214037)
FT                   /locus_tag="BC1002_0188"
FT   CDS_pept        complement(212937..214037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0188"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="SMART: Elongator protein 3/MiaB/NifB; TIGRFAM:
FT                   biotin synthase; KEGG: bpy:Bphyt_0444 biotin synthase;
FT                   PFAM: biotin and thiamin synthesis associated; Radical SAM
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14295"
FT                   /db_xref="GOA:D5WAJ2"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAJ2"
FT                   /inference="protein motif:TFAM:TIGR00433"
FT                   /protein_id="ADG14295.1"
FT                   /translation="MTQLNIAAGSADTSAANGNPTAAATEAKPLARWRVADIVALYELP
FT                   FNDLLFRAQQTHREHFDANAVQLSTLLSIKTGGCEEDCAYCPQSVHHDTGLAADKLMPV
FT                   DEVLAAAKLAKDNGATRFCMGAAWRNPKDRHLEPIKDMIRGVKAMGLETCVTLGMLETH
FT                   QAQALRDAGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLERVRDAGINVCCGGIVGMG
FT                   ESRRERAGLIAQLANMEPYPESVPINNLVQVQGTPLTGTEPIDPFEFVRTIAIARITMP
FT                   RAMVRLSAGREQMDEALQAMCFLAGANSIFYGDQLLTTSNPQAEADRQLLARLGIRAEA
FT                   AQQMPVEKSDCERGCAHGHEDHGAAN"
FT   gene            complement(214090..214830)
FT                   /locus_tag="BC1002_0189"
FT   CDS_pept        complement(214090..214830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0189"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="KEGG: bpy:Bphyt_0445 dithiobiotin synthetase;
FT                   TIGRFAM: dethiobiotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14296"
FT                   /db_xref="GOA:D5WAJ3"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAJ3"
FT                   /inference="protein motif:TFAM:TIGR00347"
FT                   /protein_id="ADG14296.1"
FT                   /translation="MSNLTNDGGALSLFVTGTDTEIGKTFVSSALLRGFVREGLQAAAM
FT                   KPIAAGAFEVNGVLHNEDADQLDAASSVLLPPAIRTPYLLKEPAAPHIAAALENVSFDL
FT                   DHIVACHRDALKLAEVVVVEGVGGFRVPLTATQDTADLAVALKLPVVLVVGMRLGCISH
FT                   ALLTAEAIAARGLTLAGWVANRIDPDMIFPDENIASIRAHLAQTYDAPLLGIVPHISPL
FT                   SPELAAEQLDIRRLLQTLRQFRAA"
FT   gene            complement(214827..216011)
FT                   /locus_tag="BC1002_0190"
FT   CDS_pept        complement(214827..216011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0190"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="TIGRFAM: 8-amino-7-oxononanoate synthase; KEGG:
FT                   bpy:Bphyt_0446 8-amino-7-oxononanoate synthase; PFAM:
FT                   aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14297"
FT                   /db_xref="GOA:D5WAJ4"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAJ4"
FT                   /inference="protein motif:TFAM:TIGR00858"
FT                   /protein_id="ADG14297.1"
FT                   /translation="MHLLDTLAEGLKEIDARGLRRRRRTADTPCAAHMTVDGREIIGFA
FT                   SNDYLGLAAHPQLIEAIAEGARLYGAGSGGSHLLGGHSRAHAQLEDDLAAFAGGFVDDA
FT                   RALYFSTGYMANLATLTSLAGRGTTLFSDALNHASLIDGARLSRADVQIYPHCDMDALS
FT                   AMLEASEADVKVIVSDTVFSMDGDIAPLPRLLELAERHGAWLIVDDAHGFGVLGPQGRG
FT                   AIAQAALRSPHLISIGTLGKAAGVSGAFVVAHATVIEWLVQRARPYIFTTASVPAAAHA
FT                   VSASLRIIGGDEGDARRAHLQQFIERTRAMLKATPWLPVDSHTAVQPLIIGANDATLDI
FT                   AASLDRAGLWVPAIRPPTVPTGTSRLRISLSAAHSHADLDRLEAALQQVGARAA"
FT   gene            complement(216011..217372)
FT                   /locus_tag="BC1002_0191"
FT   CDS_pept        complement(216011..217372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0191"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /note="KEGG: bxe:Bxe_A4263
FT                   adenosylmethionine--8-amino-7-oxononanoate transaminase;
FT                   TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14298"
FT                   /db_xref="GOA:D5WAJ5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAJ5"
FT                   /inference="protein motif:TFAM:TIGR00508"
FT                   /protein_id="ADG14298.1"
FT                   /translation="MENSAAPPVAPEHWVARSLRAVWHPCTQMKHHERLPLIPIARGQG
FT                   AWLYDRAGHRYLDAISSWWVNLFGHANPRINAALKDQLDTLEHAMLAGCTHEPAVELAE
FT                   RLHALTGNTLGHAFFASDGASAVEIALKMSFHSWRNRGYADKQEFVCLANSYHGETIGA
FT                   LGVTDVALFKDAYDPLIRHAHVVASPDARLAQAGETAADVARRALDNVRALFEARANRI
FT                   AALIVEPLVQCAAGMAMHDASYVAGLRALCDQYGVHLIADEIAVGCGRTGTFFACEQAG
FT                   VWPDFLCLSKGISGGYLPLSIVLSRDEIFAAFYHDDTARGFLHSHSYTGNPLACRAALA
FT                   TLDLFASDDVLAANARKSATLEAALAPLAEHAQVRDLRQRGTIFAFDAVIDEPQRAKTF
FT                   SRRFFENALERELLLRPIGTTVYLMPPYILDDEELALLAARTRDTFDATVAGAR"
FT   gene            complement(217816..219123)
FT                   /locus_tag="BC1002_0192"
FT   CDS_pept        complement(217816..219123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14299"
FT                   /db_xref="GOA:D5WAJ6"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAJ6"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4260"
FT                   /protein_id="ADG14299.1"
FT                   /translation="MVLSKVLTKCAAICAAATCAVTIAHADPLAYSSLSAHNATPASDT
FT                   QGPLSRARVPRLALDDDVYLPTAHLNEKIIRVPVDAAGTVTLETTIYKPDGAGPFPMIV
FT                   FNHGKIPGDPRTQERSDPLPFAREFVRRGYVVVAPNRQGFGHSDGVYEQDGCDVERNGL
FT                   GQAGDVAATINYMSKQPYVDAAHIAVAGTSHGGLATIAYGTEAAPGVRALINFSGGLRQ
FT                   DTCEDWQGNLTRAFGAYGEKSTVPSLWLYGDNDSVWNAPLVAGMYAAYGAHGASVKMVD
FT                   FGKYKNDAHRLVGDRDGVRVWWPAVEAFLARAGMPTAVQYHVADPAAPQATGFAALDAV
FT                   DAVPFLDNEGRNGYRNFLHQYPSRAFAVSDSGAWSWAEGGDDPMSVAVANCQKQSSDPC
FT                   RLYAVDNSVVWGNQNSQTADAGDADANGRKAIASRE"
FT   sig_peptide     complement(219043..219123)
FT                   /locus_tag="BC1002_0192"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.993 at
FT                   residue 27"
FT   gene            complement(219746..220201)
FT                   /locus_tag="BC1002_0193"
FT   CDS_pept        complement(219746..220201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14300"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAJ7"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0458"
FT                   /protein_id="ADG14300.1"
FT                   /translation="MNKPLLSLQRPVDCPCGGAAPAARGGSATKAPRFAQCCGRYIDGG
FT                   EAAPRALELMRSRYSAYVLGATAYLRATWDPRTCPADLDVDPAAPDAPRWLGLQIKAFA
FT                   ESDADHATVEFIARYKVGGRAHRLHELSRFLRGGDGRWRYVDGDVNE"
FT   gene            complement(220209..221339)
FT                   /locus_tag="BC1002_0194"
FT   CDS_pept        complement(220209..221339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0194"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   bpy:Bphyt_0459 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14301"
FT                   /db_xref="GOA:D5WAJ8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAJ8"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADG14301.1"
FT                   /translation="MVLDQDHLMVRDALRTFVREAITPYAAQWDRERTFPRDVHRQLAE
FT                   LGAYGVLVPDAYGGAGMDALALALILEEIAAGDGGTSTAISVNNCPVCSILLTYGNDAQ
FT                   KRDWLTPLARGEMLGAFCLTEPQAGSDASALRTTATRDGAAYVLNGVKQFITSGKNGDV
FT                   AIVMAVTDKTAGKRGISAFIVPTSTPGYVVARVEDKLGQHSSDTAQIVFEECRVPAANL
FT                   IGAEGEGYRIALSGLEGGRIGIAAQSVGMARAAFEAALTYAKERESFGAPLFSHQAVQF
FT                   RLADMATQLEAARQLIWHAASLKDTGQPCLTEAAMAKLFASEAAERICSAALQIHGGYG
FT                   YLSDFPVERIYRDVRVCQIYEGTSDIQKILIARALN"
FT   gene            complement(221373..222050)
FT                   /locus_tag="BC1002_0195"
FT   CDS_pept        complement(221373..222050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0195"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bpy:Bphyt_0460 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14302"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAJ9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG14302.1"
FT                   /translation="MKAVLIVGASRGIGQEFVRQYKKSGWRVLATARDGAALDALNELG
FT                   AETFMLDVTAPEEIAALGWKLDGERLDAAILVSGVYGPRTEGIETITAEDFDHVMHTNV
FT                   RGPMQLLPILLPLVEETDGVLAVISSRMGSIADASGTTGWLYRASKAALNAVLKLASLD
FT                   AQRATCVSLHPGWVRTDMGGAQAALDPARSVAGMREVLAQAAASRDAFHGRFFQHDGTQ
FT                   LDW"
FT   gene            complement(222078..223286)
FT                   /locus_tag="BC1002_0196"
FT   CDS_pept        complement(222078..223286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0196"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: bpy:Bphyt_0461 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14303"
FT                   /db_xref="GOA:D5WAK0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAK0"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADG14303.1"
FT                   /translation="MSDAIQSGIHADPIVIVSAARTPMAGFQGDFASLSAPQLGAVAIK
FT                   AAVERAGLKPEQIDEAVMGCVLPAGLGQAPARQAALGAGLPLATGCTTVNKMCGSGMRA
FT                   AMFAHDMLAAGSLDVIVAGGMESMTNAPYLLPKARGGMRMGHGQVIDHMFYDGLEDAYD
FT                   KGRLMGTFAEECAASFDFTREAQDAFAVESLNRAKRANEDGSFDWEIAPVTVAARKGDV
FT                   TIARDEQPFKANLDKIPTLKPAFSKTGTVTAANSSSISDGAAALVMMRESTAKRLGVAP
FT                   LARVVGHSTFAQEPAKFTTAPVGAIRKLFEKNGWRAGDVDLYEINEAFAVVTMAAMKEH
FT                   DLPHDKVNVNGGACALGHPIGASGARILVTLIGALKNRGLKRGVASLCIGGGEATAMGI
FT                   ELI"
FT   gene            complement(223358..225175)
FT                   /locus_tag="BC1002_0197"
FT   CDS_pept        complement(223358..225175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0197"
FT                   /product="(Isocitrate dehydrogenase (NADP(+))) kinase"
FT                   /EC_number="2.7.11.5"
FT                   /note="KEGG: bxe:Bxe_A4253 bifunctional isocitrate
FT                   dehydrogenase kinase/phosphatase protein; PFAM: Isocitrate
FT                   dehydrogenase kinasephosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14304"
FT                   /db_xref="GOA:D5WAK1"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAK1"
FT                   /inference="protein motif:PRIAM:2.7.11.5"
FT                   /protein_id="ADG14304.1"
FT                   /translation="MNHFPKLLSSQIGFDVAQTMLEGFDRHYRIFRDAAIHAKTLFEAG
FT                   DWHGLQKLARDRIASYDDRVQECVHQLEDEYDAENIDSEVWQQIKLHYIGLLTTHRQPE
FT                   CAETFFNSVSCKILHRSYFNNDFIFVRPAISTEYIENDEPAAKPTYRAYYPGTDGLAAT
FT                   LERVVTNFQLDPPFEDLTRDVACVVQSIREAFGVFDEAPNFQIHVLSSLFYRNKAAYIV
FT                   GRIINGDALLPFAVPLRHVKPGVLALDTVLLKREQLLIIFSFSHSYFLVDMEVPSAYVE
FT                   FLRTVMPAKPKAEIYTSVGLQKQGKNLFYRDLLHHLKHSSDRFIVAPGIKGLVMLVFTL
FT                   PSFPYVFKLIKDNFPPPKETTRAQIQQKYLLVKRHDRLGRMADTLEYSSVALPLARLDE
FT                   TLLRELEKEVPSLIEYDGDNLVIRHMYIERRMIPLNLFLQNGNDDDIEHGIKEYGNAVK
FT                   ELIQANIFPGDMLYKNFGVTRHGRVVFYDYDEIEYLTDCNVRAVPAPRNEEEEMSDEPW
FT                   YAVGPHDIFPETYGTFLLGDPRVRRSFMRHHADFFEPELWQRYKDFLLNGELPDFFPYD
FT                   QSVRFCVRYPERFVDASDAEANEPNVRVA"
FT   gene            complement(225215..225619)
FT                   /locus_tag="BC1002_0198"
FT   CDS_pept        complement(225215..225619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0198"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: bpy:Bphyt_0464 transcriptional regulator, MerR
FT                   family; PFAM: Transcription regulator MerR DNA binding;
FT                   regulatory protein MerR; SMART: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14305"
FT                   /db_xref="GOA:D5WAK2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAK2"
FT                   /inference="protein motif:PFAM:PF09278"
FT                   /protein_id="ADG14305.1"
FT                   /translation="MNTQYTITELAREFDVTPRAIRFYEDQGLLSPSREGSSGLRRVYS
FT                   GRDRTRLKLTLRGKRLGFTLSEIRDLLDVYESPTDTVPQLHAFLATVARHREVLERQRE
FT                   DLDATLEDLAQYEAQARALLDGTRHDAKPV"
FT   gene            225778..226851
FT                   /locus_tag="BC1002_0199"
FT   CDS_pept        225778..226851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0199"
FT                   /product="beta-lactamase domain protein"
FT                   /note="KEGG: bpy:Bphyt_0465 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14306"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAK3"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0465"
FT                   /protein_id="ADG14306.1"
FT                   /translation="MNALEHQLQYPFNDAMPDSGRTMEVAPGVLWLRMPLPFALDHINL
FT                   WLLRDEIDGQQGWTVVDCGITSDTIKANWESVFDSVLDGLPVLRVIVTHCHPDHIGLAH
FT                   WVCGGGEQKRWDARLWMTLGEYMQARVMATGDGSNAGGEAAARHFARHGLNDADSLDKL
FT                   RNRKSYYSSLVPAIPGQYRRLREAEDVRIGGRTWRVVTGFGHSPEHCALHCAETGTLIS
FT                   GDMVLPRISTNVSVFDIEPEGSPLELYLESLGRYEAMPEDTLVLPSHGKPFRGVRTRIQ
FT                   QLREHHDARLAEVREACAERPRSAADIVPLMFKRQLDIHQMTFAMGEALAHLHLLWRAG
FT                   ELKRTQDADGVIRFAAV"
FT   gene            complement(226952..227395)
FT                   /locus_tag="BC1002_0200"
FT   CDS_pept        complement(226952..227395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="manually curated; KEGG: dac:Daci_0892 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14307"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAK4"
FT                   /inference="similar to AA sequence:KEGG:Daci_0892"
FT                   /protein_id="ADG14307.1"
FT                   /translation="MCTMKLICFALAACLPTMVLAASAVPVASERALREECSAFSQAGM
FT                   RDCLAEKAEASKKTLRRAEEKMAGTLARWDEDEKYVNQARAQLAASNRKFVRYRESQCD
FT                   FAASLTGGAAGNAHEISRLACVSELNNRRAEQLRDAASDLPLK"
FT   sig_peptide     complement(227330..227395)
FT                   /locus_tag="BC1002_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.714 at
FT                   residue 22"
FT   gene            complement(227383..228123)
FT                   /locus_tag="BC1002_0201"
FT   CDS_pept        complement(227383..228123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0201"
FT                   /product="Peptidoglycan-binding lysin domain protein"
FT                   /note="KEGG: bac:BamMC406_0633 peptidoglycan-binding LysM;
FT                   PFAM: Peptidoglycan-binding lysin domain; SMART:
FT                   Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14308"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAK5"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ADG14308.1"
FT                   /translation="MAMQAPTRTGFERWQDGVSKAVSDARWNSWDCEIQMAVNEYNLHL
FT                   RGTSGYVALDWQIIKAILWVETGAHDPQWNSKPMQIGVSGDPGLASLLSGKEGGDLILL
FT                   PGWKGRLTMSSVRTIAAHNIRAGIGYLLMRMAKFEYRNVPGADPKIYEIAVKPGDSLDK
FT                   MAKDQGTTIETLRKLNPTAAVLRPGQVLTYRKASIQKVIAGWHPIVTTFIALRYNGGRD
FT                   PNYARKLDYALSSVRKGKAALCAQ"
FT   gene            228261..228887
FT                   /locus_tag="BC1002_0202"
FT   CDS_pept        228261..228887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc3429 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14309"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAK6"
FT                   /inference="similar to AA sequence:KEGG:RSc3429"
FT                   /protein_id="ADG14309.1"
FT                   /translation="MHPARTTMEDGMTRLTCSGDWTKSLAVLCLAGWFGGCSLAAGHYG
FT                   QDSQMTQPDMTLWQTIDSLVQQIPFTKEKVESVLATHLVGRDTSGDSIENTAFQFYVGG
FT                   PAKMADGVLVGNVDLRVRHTGGHPGFLALGKLSGECVTLAVVRAHYSNLKVTDSPRGHS
FT                   LDETTAYSAFLPWGTLSFAFAERNRDCLEGVSFDPKIAAADNAVK"
FT   gene            complement(228982..230568)
FT                   /locus_tag="BC1002_0203"
FT   CDS_pept        complement(228982..230568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0203"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bpy:Bphyt_0468 extracellular solute-binding protein
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14310"
FT                   /db_xref="GOA:D5WAK7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAK7"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADG14310.1"
FT                   /translation="MRFKLLAAAILLTAPALALAKPLTVCTESSPDGFDVVQFNSLVTT
FT                   NASADVVFNSLVSFDEAAKKVVPALADKWEVSPDGLTYTFHLRPNVQFQTTDYFKPTRA
FT                   LNADDVIFTFDRMLNDSNPWHKVAGASGFPHAQSMGLPKLIKSITKVDDNTVKFELNEP
FT                   NATFVSILTMGFASIYSAEYADQLLKAGKQVDLNAKPIGTGPFVLKSYTKDAVIRYDAN
FT                   PTYWGPKPKIERLIYAITPDATVRAQKVKAGECQIALSPKPQDLADAKKDKSLAIVQTP
FT                   AFMTAFVALNTQQKPLDNQKVRAALNMAFDRATYLKTVFDNTATPAVNPFPPNTWSYNH
FT                   SIKGWPYDPAKAKQLLTDAGFPNGFQTTIWVRPNGSVLNPNPKAGAELLQADFAKIGVK
FT                   ADVKVIEWGELIKQAKQGQHDSLFMGWAGDNGDPDNYLSPLFSCNAVKSGINFARFCDQ
FT                   DLDKLIADGRATSDIAKRTKAYQAAQQIIHDEALWIPLGYPTAAAITRTNVSGYHVSPF
FT                   GRQNFGAVVVQ"
FT   sig_peptide     complement(230506..230568)
FT                   /locus_tag="BC1002_0203"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 21"
FT   gene            complement(230849..231667)
FT                   /locus_tag="BC1002_0204"
FT   CDS_pept        complement(230849..231667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0204"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   bpy:Bphyt_0469 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14311"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAK8"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADG14311.1"
FT                   /translation="MQPRVVDAAGVAHESAGADARIVSLVPSLTETLFELGLERQIVGR
FT                   TGFCVHPRDKVRAVPKVGGTKAVKLDAIRALRPTHLIVNIDENERDTVEQLRAFVPHIV
FT                   VTHPQTPRDNLALYALLGAIFGREEEARRLSGALDARLREAAAHTFAAQNVLYLIWREP
FT                   WMSVARDTYIAAMLRLVNWHTLPDVHGGSVGATRYPTLDFDDAPWLEQVDRVLLSSEPY
FT                   RFTAAHRDALARDPRFTGKRIELIDGEMTSWYGVRAIDGIGYLLRQAAAP"
FT   gene            complement(231671..232444)
FT                   /locus_tag="BC1002_0205"
FT   CDS_pept        complement(231671..232444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0205"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bpy:Bphyt_0470 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14312"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAK9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG14312.1"
FT                   /translation="MTSPLKVFITGASSGIGLALAGEYAQRGAILGLVARRGDALAAFQ
FT                   QSHPQNTVSIYALDVRDAEALADAAARFIAEHGLPDVVIANAGISRGALTGHGDLRTFR
FT                   EVMDINYFGMVATFEPFAAAMANEKRGTLVGIASVAGVRGLPGSGAYSASKSAAQKYLE
FT                   ALRVEMRPFGVGVVTIAPGYIRTPMTEHNPYNMPFLMNADRFAAKVARAVERQTSFAVF
FT                   PWQMRVAAMLLHVLPRWLYDRVFERAPRKPRAATE"
FT   sig_peptide     complement(232379..232444)
FT                   /locus_tag="BC1002_0205"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.957 at
FT                   residue 22"
FT   gene            complement(232460..233098)
FT                   /locus_tag="BC1002_0206"
FT   CDS_pept        complement(232460..233098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0206"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: bxe:Bxe_A4247
FT                   putative thiol-disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14313"
FT                   /db_xref="GOA:D5WAL0"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAL0"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ADG14313.1"
FT                   /translation="MKKLLSILFLSLGLIAASAHASPTAPVAGKDYTVLASPQPTDVPA
FT                   GKIEVIEFFWYGCPHCNEFNPFLEAWVKKQAPDVVFRRVPVAFRDDFIPHSKMFHALDA
FT                   LGLANELTPKVFNEIHVNKNYLLTPEDQTKFLAKFGVDPKKYMEAYNSFSTQSALQKDK
FT                   KLLEGFKIDGVPTLAVQGKYLTGPAATGTLPGTIQVLDYLVSQVRAKKM"
FT   sig_peptide     complement(233033..233098)
FT                   /locus_tag="BC1002_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            complement(233275..234084)
FT                   /locus_tag="BC1002_0207"
FT   CDS_pept        complement(233275..234084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0207"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG:
FT                   bpy:Bphyt_0472 sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14314"
FT                   /db_xref="GOA:D5WAL1"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAL1"
FT                   /inference="protein motif:PFAM:PF05036"
FT                   /protein_id="ADG14314.1"
FT                   /translation="MAKPRRTTKQSKQTGGTFLGIVLGLIVGLAIAVVVALYITRAPTP
FT                   FVSKVAPPAPTDNGASQAQYDPNRPLQGKTPGQPVPQAAQPAPPNTAPGQTNAQTQSGM
FT                   LEEPQIVEVPPSGGNANNNGTAVAPNPAQENGAGGIVAPAPAKKPQTTSAPAATAAGSA
FT                   PKSTSATTLANVKPGSAAAPAPAPGDANTGYFLQVGAYKTAADAEQQRARLAFQGFESK
FT                   VTQRDAGGVTYYRVRIGPFSKFEDMNSSRQRLSDAGVDTAVIRFTKQ"
FT   sig_peptide     complement(233986..234084)
FT                   /locus_tag="BC1002_0207"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.902 at
FT                   residue 33"
FT   gene            complement(234164..235954)
FT                   /locus_tag="BC1002_0208"
FT   CDS_pept        complement(234164..235954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0208"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="TIGRFAM: arginyl-tRNA synthetase; KEGG:
FT                   bpy:Bphyt_0473 arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14315"
FT                   /db_xref="GOA:D5WAL2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAL2"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ADG14315.1"
FT                   /translation="MLPAHKHTLETLLADTVKQVATATQGATEAAFVSPAIALERPKVA
FT                   AHGDVACNVAMQLAKPLRANPRQLAQQIVEALLVNPQAKGLIDTAEVAGPGFINLRLTA
FT                   AAKQGVIAAVFAEKEAYGRSRRDAGKHVLIEFVSANPTGPLHVGHGRQAALGDALAHVL
FT                   ESQGWDVHREFYYNDAGVQIHTLALSTQARARGLAPGDEGWPASAYNGEYIADIAKDYL
FT                   NGITVEASDGEPVTGARDVEDLEAIRRFAVTYLRREQDMDLQAFGVKFDQYYLESSLYT
FT                   EGRVEKTVDALIAAGKTYEQEGALWLRTTDDGDDKDRVMRKTDGTYTYFVPDVAYHVAK
FT                   WERGFTKVINVQGSDHHGTIARVRAGLQGLGIGIPKGYPDYILHKMVTVMRNGEEVKIS
FT                   KRAGSYVTVRDLIEWSGGATPGSEAAVDLIDEETIRRGRDAVRFFLISRKADTEFVFDI
FT                   DLALKQNDENPVHYVQYAHARICSVIAECNARYGLDESVLPSVDLAPLASERSMALLNK
FT                   LAEFPDMLQHAADELAPHAVAFYLRELAGEFHSFYNDRAERVLVDDAAERNARVALLAA
FT                   TRQVLANGLATIGVSAPVKM"
FT   gene            236418..236744
FT                   /locus_tag="BC1002_0209"
FT   CDS_pept        236418..236744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0209"
FT                   /product="Domain of unknown function DUF1840"
FT                   /note="PFAM: Domain of unknown function DUF1840; KEGG:
FT                   bxe:Bxe_A4244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14316"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAL3"
FT                   /inference="protein motif:PFAM:PF08895"
FT                   /protein_id="ADG14316.1"
FT                   /translation="MLITFKCHACPDVMMLENLAQYLVGIVGKRLGQRGVITHDELGPA
FT                   IEKLEAAITSDKQERAEHEGHFHEGEDGRDRHEIPPGLAQRAYPFLDMLRAAQKENADI
FT                   VWGI"
FT   gene            complement(236879..237076)
FT                   /locus_tag="BC1002_0210"
FT   CDS_pept        complement(236879..237076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0210"
FT                   /product="putative acid shock protein"
FT                   /note="KEGG: bpy:Bphyt_0475 putative acid shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14317"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAL4"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0475"
FT                   /protein_id="ADG14317.1"
FT                   /translation="MKMLTLLLTAVSLAAGASLALAQPAAPGGSSSVSSYSPPTEAHVK
FT                   KAKKQKMKKGAAASAASESQ"
FT   sig_peptide     complement(237008..237076)
FT                   /locus_tag="BC1002_0210"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 23"
FT   gene            complement(237266..239983)
FT                   /locus_tag="BC1002_0211"
FT   CDS_pept        complement(237266..239983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0211"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /note="TIGRFAM: methionine synthase; KEGG: bph:Bphy_0190
FT                   methionine synthase; PFAM: dihydropteroate synthase DHPS;
FT                   Methionine synthase B12-binding module cap domain protein;
FT                   cobalamin B12-binding domain protein; Vitamin B12 dependent
FT                   methionine synthase activation region"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14318"
FT                   /db_xref="GOA:D5WAL5"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAL5"
FT                   /inference="protein motif:TFAM:TIGR02082"
FT                   /protein_id="ADG14318.1"
FT                   /translation="MTDHTMRLSGLEPFNVTSGTLFINVGERTNVTGSKAFARMILNNQ
FT                   FDEALAVARQQVENGAQVIDINMDEAMLDSKAAMVRFMNLIASEPDIARVPIMIDSSKW
FT                   DVIEAGLKCVQGKAIVNSISLKEGKEQFIHHAKLIRRYGAASVVMAFDEQGQADTFARK
FT                   KEICRRSYEILVNEVGFPPEDIIFDPNIFAIATGIEEHNNYAVDFIEATRWIKQNLPYA
FT                   KVSGGVSNVSFSFRGNDPVREAIHTVFLYHAIQAGMDMGIVNAGQLGVYAELDPELRER
FT                   VEDVVLNRREDGTDRLLEIADKFKSGAAKKEENLEWRNQPVEKRLAHALVSGITTFIVE
FT                   DTEEVRAKIAAEGGRPINVIEGPLMDGMNIVGDLFGQGKMFLPQVVKSARVMKQAVAHL
FT                   IPFIEEEKRQLAAAGGDVRAKGKIIIATVKGDVHDIGKNIVSVVLQCNNFEVVNMGVMV
FT                   PCNEILAKAKVEGADIVGLSGLITPSLEEMAYVASEMQRDDYFRVKKIPLLIGGATTSR
FT                   VHTAVKIAPQYEGPVVYVPDASRSVSVASSLLSDEGAAKYIDELNADYNRIRDQHANKK
FT                   AQPMVSLAEARANKTKIDWAGYQPVKPKFIGRRVFKNFDLNELANYIDWGPFFQTWDLA
FT                   GPYPAILNDEIVGESARRVFSDGKSMLARLIQGRWLQANGVITLLPANTVNDDDIEIYT
FT                   DESRTEVALTWRNLRQQSVRPVVDGVMRPNRSLADFIAPKGSGVADYIGMFAVTAGLGV
FT                   DVKEKQFEKDLDDYSAIMLKALADRLAEAFAEALHARVRRDLWGYANSENLSNDELIAE
FT                   KYRGIRPAPGYPACPDHLVKRDMFEVLQANEIGMSVTESLAMLPAASVSGFYLAHPDST
FT                   YFSVGKIGADQLDDYARRMSLTKADAERALAPLL"
FT   gene            complement(240055..241125)
FT                   /locus_tag="BC1002_0212"
FT   CDS_pept        complement(240055..241125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0212"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   bpy:Bphyt_0477 homocysteine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14319"
FT                   /db_xref="GOA:D5WAL6"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAL6"
FT                   /inference="protein motif:PFAM:PF02574"
FT                   /protein_id="ADG14319.1"
FT                   /translation="MTQPAQSITPVRSEPAYTRGAALPALLNSRILILDGAMGTMIQRY
FT                   KLDEASYRGERFKDYPRDIKGNNELLSITQPQIISEIHEQYLAAGADIIETNTFGATTV
FT                   AQADYGMESLAVEMNIESAKLARAACDKYATPDKPRFVAGAIGPTPKTASISPDVNDPG
FT                   ARNVTFDELHAAYYEQAKALLDGGADLFLVETIFDTLNAKAALFALDELFENTGERLPI
FT                   MISGTVTDASGRILSGQTVEAFWNSLRHAKPLTFGLNCALGAALMRPYIAELAKLCDTY
FT                   VSCYPNAGLPNPMSDTGFDELPADTSGLLKEFAEAGLVNIAGGCCGTTPEHIAAIAKAL
FT                   AELKPRKWPSQYRDAA"
FT   gene            complement(241417..241674)
FT                   /locus_tag="BC1002_0213"
FT   CDS_pept        complement(241417..241674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14320"
FT                   /db_xref="InterPro:IPR021951"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAL7"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0478"
FT                   /protein_id="ADG14320.1"
FT                   /translation="MQMIYNSPNYCVVEFPPQEGQLAMKSGGYEIVDKNMQREIYIDGA
FT                   MAARFREHVQKLIEGEPTLDEVDEFLGQFDSLMHQPVVLH"
FT   gene            complement(241796..242584)
FT                   /locus_tag="BC1002_0214"
FT   CDS_pept        complement(241796..242584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0214"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   bpy:Bphyt_0479 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14321"
FT                   /db_xref="GOA:D5WAL8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAL8"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG14321.1"
FT                   /translation="MQVNINGIETRYVLSNEGGGPWLTFIHQLGGDLSVWDQMAGYFRD
FT                   DYTVLRYDVRGHGHSAVAREPFTMRDLADDLAKLLDALGAPTTHLVGLSLGGMIAQQFA
FT                   LDHPSRLDTLTIADSTGGTPPENRELWNQRAHTARSDGMEALLPSTIARWLTPDFQVGH
FT                   PEAVEPIREAFARTPPEGFAMACEALRDFDLRGKHGAIRLPTLTVAGRHDTGTPPAATQ
FT                   AIAEAIEGARFELLDAAHLAPVEQSHRFAALLESFLERRV"
FT   gene            complement(242736..244019)
FT                   /locus_tag="BC1002_0215"
FT   CDS_pept        complement(242736..244019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14322"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAL9"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0480"
FT                   /protein_id="ADG14322.1"
FT                   /translation="MDFASAHRRRDRLPAFGSGPGRGARAGRWIAVLVGVAVVHWIAAQ
FT                   WFERNRVDLNPANHEHVPVQVALLTPERVERQPAPQPAAPAAHPPAPVRKPAAHPPREQ
FT                   HALTALQPAKRNEAAATPASEVAPSAPPAAASANASVNANASGAAASAPGAASAPQASQ
FT                   GVKFSVPPSAELGYDTFYNGVRNAPGTIHWASNGQGYEMVVSVPLPFVGPFVFSSHGGI
FT                   DGFGLAPAQYSEKRGRRAEDIAIFNRSDRKIAFTRTPASLPLPDGAQDRFSVVMQLASL
FT                   VRGDPDAYKPGVTRQFFVVDSDSGENWPIETIGDESIRAAQGYLQTRHFKRLPRHDGDQ
FT                   RRIDVWLAPSLGWLPARILQTEPNGTQFELVWRGKLNVDEASPQGATPAVPSATSPATL
FT                   APADASPVSPEAAPAAPVESTAPTIIKP"
FT   gene            complement(244061..244987)
FT                   /locus_tag="BC1002_0216"
FT   CDS_pept        complement(244061..244987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0216"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: bxe:Bxe_A4236 IclR family transcriptional
FT                   regulator; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14323"
FT                   /db_xref="GOA:D5WAM0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAM0"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADG14323.1"
FT                   /translation="MSANARSGTIRTRTDSASADDLLDQADATDATSADDEAGEPGEEK
FT                   LRSGIQSIEVGFRLLDVLTHEPRAMMLRDLAQRAGMSPAKAHRYLVSFLRLGVVAQDPL
FT                   SGRYELGGFALQLGLARLARVDGVKLARIALAELRDRLDLTVGIAVWGNQGPTMVHWME
FT                   SSYPAKASLKLGDVMPLLSSATGQLFAAYLPSGKTAAMVERELGDSRRSSYSGAPRTRE
FT                   DVDKLLAEVREHEAARVEGMLLPTIHAFSMPVFDSTGELALGLVALGHEGAFDIRWGGE
FT                   IDTALRECARKLSYELGYSAAPRSDNG"
FT   gene            245148..246131
FT                   /locus_tag="BC1002_0217"
FT   CDS_pept        245148..246131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0217"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bpy:Bphyt_0482 fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14324"
FT                   /db_xref="GOA:D5WAM1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="InterPro:IPR041072"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAM1"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ADG14324.1"
FT                   /translation="MKLASLKDGTRDGQLIVVSRDLHTAAIADAIAPTLQRVLDDWAFY
FT                   APQLHDLYDALNQGRARNSFSFDAKECMAPLPRAFQWADGSSYVNHVELVRRARGAEMP
FT                   PEFWTDPLMYQGGSDDFIGPRDDVVCASEAYGIDFEAEVAVITGDVPMGSTPEQALRGV
FT                   RLVTLVNDVSLRHLIPAELAKGFGFFQSKPATSFAPVAVTPDELGEHWREGRVHRPMIV
FT                   HWNGRKVGQPDAGTDMVFHFGQLIAHAAKTRNLRAGSIVGSGTVSNKDAKRGYCCIAEK
FT                   RCLETIEHGAPQTEFMKYGDTVKIEMFDDAGKSIFGAIEQGIAPLE"
FT   gene            246128..246259
FT                   /locus_tag="BC1002_0218"
FT   CDS_pept        246128..246259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14325"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAM2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14325.1"
FT                   /translation="MKRGGHAAVLRRGGARERVSPDATARARGYTDWRAGWDGANVG"
FT   gene            246328..247581
FT                   /locus_tag="BC1002_0219"
FT   CDS_pept        246328..247581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0219"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bpy:Bphyt_0483 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14326"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAM3"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADG14326.1"
FT                   /translation="MPRLDFPAAGYRRAGASLVEARTTARGSCQRGRRFARRAATLCAA
FT                   LVCALPLTSFAQVKIGLVLSLTGPAASLGIPARDTVALLPKQIGGQNVEYIVLDDASDT
FT                   TQAVQDTKKLISENHVDAIIGSSITPNSLAMIDVVAEGETPMISLASSAKIIEPVDAKR
FT                   RWVFKTPQTDAMMASAIAEHASGHGVKTIAFIGQADALGETFYAEVAKFAQLHHIDVVA
FT                   SERFNRTDPSVTGQVLKILATHPDAVVVGAAGTPAALPPKTLRERGYKGVIYHNHGVGN
FT                   NDFLRVCGADCNGTYLPASPVLVAAQLPADHPARRLALEYIARFEAQHGAGSVSAFGSY
FT                   TSDADALLEHAIPLALKSGAPGTPAFRRALRDALEGTRGLADTNGVVNMSAADHLGLDQ
FT                   RARVMVEITNGRWLYQPH"
FT   gene            247636..248493
FT                   /locus_tag="BC1002_0220"
FT   CDS_pept        247636..248493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0220"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bxe:Bxe_A4233 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14327"
FT                   /db_xref="GOA:D5WAM4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAM4"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADG14327.1"
FT                   /translation="MTQSSQPNDVYYAHYQSLRLQRHPHGVLEVVMSGEGANKSGLATA
FT                   DARMHYELAEIWRDIDRDPDTRVAIIRGEGKGFSAGGDLQLVEDMANDFEVRTRVWREA
FT                   RDLVYNVINCGKPIVSAMHGPAVGAGLVAGLLADISIAAKTARIIDGHTRLGVAAGDHA
FT                   AIVWPLLCGMAKAKYYLLLCEPVSGEEAERIGLVSLAVDESALLPKAFEVARKLADGSQ
FT                   TAIRWTKYALNNWLRTAGPAFDTSLALEFMGFAGPDVREGLSSLRERRAPDFGAGRPRH
FT                   DEPS"
FT   gene            248576..249436
FT                   /locus_tag="BC1002_0221"
FT   CDS_pept        248576..249436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4232 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14328"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAM5"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4232"
FT                   /protein_id="ADG14328.1"
FT                   /translation="MTDTPGSAPPFPGFPGFPPAEMLDRMWSMIRLSPFGAAMTGAQPG
FT                   GGTSPSLSMMSDMMAPLTSVEELDKRITDMRAVEQWLKLNLSMLQSAIQALEVQRATLA
FT                   TLRAFGAFAQTSMSQAAAAASGAAASDAPNPAPSPAPAPSWTKPAKPAPESATQADSDE
FT                   RQAPAAPAFDASAWWNLLQSQFNQIAQFAMTQPSVAVAAAGGGTQGKPESSKAGDPSGG
FT                   DPSGGDPSGGDPSGGDPSGGASDAAAQSAKPAAKRPAAKRAATSTSAKRASGEGTSAAT
FT                   SKKST"
FT   gene            250059..250937
FT                   /locus_tag="BC1002_0222"
FT   CDS_pept        250059..250937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14329"
FT                   /db_xref="GOA:D5WAM6"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAM6"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4230"
FT                   /protein_id="ADG14329.1"
FT                   /translation="MNTMLYPELYKSLESVRWDMEKDIPWDKFDASLLTDEQAATIKMN
FT                   AITEWSALPATEMFLRDNHHDSDFSAFMSVWFFEEQKHSLVLMEYLRRFKPELVPTEEE
FT                   LHAVRFEFDPAPPLETLMLHFCGEIRLNHWYRRAAEWHTEPVIKHIYETISRDEARHGG
FT                   AYLRYMKKAMAQTGDIARAAFAKIGVLMASARRTEKPLHPTNLHVNQALFPRDTIQSRL
FT                   PDPEWLERWLDEQIRFDDGWEKKVVERILHNLSLLFERTFTTAQELNRYRKEVVARLQA
FT                   AEQSPAQQQPA"
FT   gene            251091..251573
FT                   /locus_tag="BC1002_0223"
FT   CDS_pept        251091..251573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0223"
FT                   /product="rfaE bifunctional protein"
FT                   /note="KEGG: bpy:Bphyt_0487 RfaE bifunctional protein;
FT                   TIGRFAM: rfaE bifunctional protein;
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14330"
FT                   /db_xref="GOA:D5WAM7"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAM7"
FT                   /inference="protein motif:TFAM:TIGR02199"
FT                   /protein_id="ADG14330.1"
FT                   /translation="MTAIFERKILTRDALVKLRPSLRAPVVFTNGVFDILHRGHVTYLA
FT                   DAKALGACLIVGVNSDASVRMLGKGDDRPINNEADRMALLAALESVDYVVGFGEKTPVE
FT                   LISALRPDVLVKGGDYDMDALPESALVRGWGGKALAIAFEHDRSTTALLKKVRTPG"
FT   gene            complement(251642..251881)
FT                   /locus_tag="BC1002_0224"
FT   CDS_pept        complement(251642..251881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14331"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAM8"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4228"
FT                   /protein_id="ADG14331.1"
FT                   /translation="MLRWPIAILIVVNVLAYVALRGAFGPIPTASGREPNHLHRQIHPN
FT                   WLKVRPVSAADAADQAVVGGPAPQAPISTSELPQ"
FT   gene            complement(251960..252799)
FT                   /locus_tag="BC1002_0225"
FT   CDS_pept        complement(251960..252799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0225"
FT                   /product="transcriptional activator, Baf family"
FT                   /note="KEGG: bpy:Bphyt_0489 pantothenate kinase; TIGRFAM:
FT                   transcriptional activator, Baf family; PFAM: Bvg accessory
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14332"
FT                   /db_xref="GOA:D5WAM9"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAM9"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ADG14332.1"
FT                   /translation="MTQRAPFLLIDAGNSRIKWALVQPDGTQLASGALAHHDVAGPRAQ
FT                   SGSQTGWADLPAPCGAWLSNVAGAEIAAHIAAFVDAHWPQLPLATIRASAHQCGVANCY
FT                   TTPQSLGSDRWCGMIGAHAAFPGEHLLLATFGTATTLEALRADGAFIGGLIAPGWTLMM
FT                   RSLGEHTAQLPTLDVAHARGLLDGADTADAARRGPFFATDTPRSLSAGCTLAQAGLIER
FT                   MWRDLQDEWRVPVRLVVSGGAADEVASALKVPHTRHDSLVLSGLALIAAEDTARRSG"
FT   gene            complement(252796..253734)
FT                   /locus_tag="BC1002_0226"
FT   CDS_pept        complement(252796..253734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0226"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /note="KEGG: bxe:Bxe_A4226 biotin--protein ligase; TIGRFAM:
FT                   biotin/acetyl-CoA-carboxylase ligase; PFAM: biotin/lipoate
FT                   A/B protein ligase; biotin protein ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14333"
FT                   /db_xref="GOA:D5WAN0"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAN0"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ADG14333.1"
FT                   /translation="MNASKTPASRSAAASAAAASSSASADWRIDRERAVKLFGAHAHDW
FT                   PIEIVEETGSTNADLMAHMKALPRHANALPRPIVRVAYLQTAGRGRRGRPWYAEPGNAL
FT                   LFSVACVLPRPLEGLAGLSLAVGVALVDGLRSLPVAGPGQIALKWPNDVLLEGDKLAGI
FT                   LIETAWSTDDASAVVIGIGTNVKGADELAAKVGALNAEVTPQARGTVPTALQRALPNAN
FT                   LTDTLAAELSALEPMLQRFGAEGFAPFQPRWNAVHAYAGRDVVLLEQGQELARGVAAGV
FT                   DERGQLLLDTAEGRQSIATGDVSLRLADGAA"
FT   sig_peptide     complement(253657..253734)
FT                   /locus_tag="BC1002_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 26"
FT   gene            253846..255015
FT                   /locus_tag="BC1002_0227"
FT   CDS_pept        253846..255015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0227"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   bpy:Bphyt_0491 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14334"
FT                   /db_xref="GOA:D5WAN1"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAN1"
FT                   /inference="protein motif:PFAM:PF02405"
FT                   /protein_id="ADG14334.1"
FT                   /translation="MAANPITRFTRSLNYDIPPGLEVAVGSQGKIVRLSGQWTALALAR
FT                   DRDTGHVIPQLRSLTGAQGIGGWDLSRVDSMDHVGGQALWRVWGRKLPPGTALTDTQRD
FT                   IFERIALLDTVRESAEPVTRFDPFTRLGLGIFSFVEHMQGGVAMLGRVVLDLLAILRKP
FT                   KLTPWTEISANIYNAGARALPITALVAFLIGIVLSYLSAQQLRIFGANQFIVNILGLAV
FT                   IRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRVMGIPHGLRLILPRVIALAVA
FT                   MPLLVMWTNVISLTGGALAAKLVLGIDMSFFARQLPVVVPIANLWIGLGKGAVFGMLIA
FT                   IAGCHFGFRIKANSQSLGEGTTTSVVTSITIVILADAVFAILFQNVGLG"
FT   gene            255012..255890
FT                   /locus_tag="BC1002_0228"
FT   CDS_pept        255012..255890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0228"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bpy:Bphyt_0492 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14335"
FT                   /db_xref="GOA:D5WAN2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAN2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG14335.1"
FT                   /translation="MIAPLTEAVRGQPVPSIAEPVIEVIDITKRYGRNIVHQHLNLDVR
FT                   RGEIVSIVGGSGSGKTTLVRQILGLERPSRGTIKLFGEDLATISPETALLMRSRSGMLF
FT                   QRGALFSSLSVFDNVAQPVRELGKVPEDLLRDIVMLKLEMVGLPCKHASKMPSALSGGM
FT                   IKRVGIARAIALEPELLFLDEPTAGLDPQASDEFVELISGLHRALGLTVVMVTHDLDTM
FT                   VALSTRVAVIADRKVLVNAPVEEAAGVDHPFIREYFLGLRGRRALQALPPERRARLPQA
FT                   ALEPASSELSL"
FT   gene            255937..256914
FT                   /locus_tag="BC1002_0229"
FT   CDS_pept        255937..256914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0229"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: bxe:Bxe_A4223 ABC transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14336"
FT                   /db_xref="GOA:D5WAN3"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAN3"
FT                   /inference="protein motif:PFAM:PF02470"
FT                   /protein_id="ADG14336.1"
FT                   /translation="MENKAHAFWAGLFTVVLTAAIALAAYLFNVDRTVRVPYDLIARTN
FT                   VTGLFADAAVRFRGLDVGRVQSIKFDPAHPGQILIRIMVDEHAPITHSTFGSLGLQGVT
FT                   GIAFIQLDDTGRDLTPLHSSVHQVAQLPMRPGLLDQLQQRGDVLLRKLEKVTDNVNDML
FT                   SPEMVEQLHETAASIAQAASGVATLTREMAPVASKLPGTIDQLNHTLASTNQMITGLNR
FT                   PDGPLQRNLNKVGTAAQQAGEALTQMNTTMQDLSARVGFETLPRVNSLTEDVRSAAQSI
FT                   DRAADTFNTNPRSVLFGAPRAAPGPGEAGFAWPAAAAPTAPAAH"
FT   sig_peptide     255937..256011
FT                   /locus_tag="BC1002_0229"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.815) with cleavage site probability 0.738 at
FT                   residue 25"
FT   gene            256945..257571
FT                   /locus_tag="BC1002_0230"
FT   CDS_pept        256945..257571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0230"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330; KEGG:
FT                   bxe:Bxe_A4222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14337"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAN4"
FT                   /inference="protein motif:PFAM:PF03886"
FT                   /protein_id="ADG14337.1"
FT                   /translation="MSRSIHRLLSSRAAFAALLAFGVLAAGCAGTSAVVSDVRYDFGPP
FT                   PQAATASRLPAVKVLEVSAPSVLESDRLTYRLSYADAQQTAAYANSHWTMMPSQLLTQR
FT                   LRNALSERGTVLTGADGVSAPVLRVDLTEFEQVFASPTDSHGAITARATLMQGGKVVGQ
FT                   HTFVAHASAHSADAAGGARALAVASDDLVAQIATWLGSQALVAAQ"
FT   sig_peptide     256945..257046
FT                   /locus_tag="BC1002_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.427 at
FT                   residue 34"
FT   gene            257603..258760
FT                   /locus_tag="BC1002_0231"
FT   CDS_pept        257603..258760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0231"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: bpy:Bphyt_0495 VanZ
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14338"
FT                   /db_xref="GOA:D5WAN5"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAN5"
FT                   /inference="protein motif:PFAM:PF04892"
FT                   /protein_id="ADG14338.1"
FT                   /translation="MSERPWLRRPSTLARRALLLYAALIMYGSWYPFSGWRSLGIAPFA
FT                   YLFDPMPQYLTAFDVVTNVLGYMPFGALVVLAVYPRWRGTLAVALAFVLGGLLSGTMEA
FT                   VQTYLPARVASNLDLAANTLGALVGAAMMSPLTGALLDRGLLRRLRLLWFERGHATLAC
FT                   VVAAWPFATMFPAPRLFGLGNWPRALWLSVDPATQDALLAWTPSAWHVGVWPAAAAAWL
FT                   DDDTWEALITTLNLFAALALASLPMRRHAPRVRLLFVFIVATLCVKAGATFLQSQSGLA
FT                   FDWATPGALLGLGCGTVAALVALPLRRRVRATLAGVALVIALVFVNLLPVNPYFDAVLA
FT                   DWRQGRYLHFNGLARWLAWMWPYAALVWLAFAVERAWLKRRAKPA"
FT   gene            258897..259220
FT                   /locus_tag="BC1002_0232"
FT   CDS_pept        258897..259220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0232"
FT                   /product="putative ferredoxin"
FT                   /note="KEGG: bpy:Bphyt_0496 putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14339"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAN6"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0496"
FT                   /protein_id="ADG14339.1"
FT                   /translation="MDSFYKHHVFFCLNQRDPGAERPSCANCNAQAMQEYAKKRVKQLG
FT                   LAGPGQVRINKAGCLDRCELGPALVVYPEAVWYTYVDESDIDEIVESHLVNGKIVERLK
FT                   IDQ"
FT   gene            259253..259897
FT                   /locus_tag="BC1002_0233"
FT   CDS_pept        259253..259897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14340"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAN7"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0497"
FT                   /protein_id="ADG14340.1"
FT                   /translation="MNVNTKKYLIDGPVGKIEVALDLPDDVRDKSAAPRGIALVAHPHP
FT                   LFGGTMDNKVAQTLARTLVQLNYVTYRSNFRGVGQTQGEHDAGVGERDDLRAVLEHMRA
FT                   DPDYGDLPLVLAGFSFGTVVLSHVAAKLRDEGREIERIVFVGTAASRWDVAPVPEGTLV
FT                   IHGEVDETVPIQSVFDWARPQELPVVVIPGAEHFLHRKLHILKRIIVDAWR"
FT   gene            260219..261448
FT                   /locus_tag="BC1002_0234"
FT   CDS_pept        260219..261448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0234"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="KEGG: bpy:Bphyt_0498 serine-type D-Ala-D-Ala
FT                   carboxypeptidase; PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; Penicillin-binding protein 5 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14341"
FT                   /db_xref="GOA:D5WAN8"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAN8"
FT                   /inference="protein motif:PRIAM:3.4.16.4"
FT                   /protein_id="ADG14341.1"
FT                   /translation="MRFSSSGRTSFPSVASFIPTSLNRAIAVGLVLPATLVASTAFAQV
FT                   PPPGVNARSWVLVDATSNQVLASANADERVEPASLTKLMTAYLVFEALDTKKITMDQSI
FT                   EPSEAVRRVRNDESRMFIEALKPVTVHDLVYGMIVQSGNDAAIALAELVGGSEAQFVDM
FT                   MNKEAQKLGMKNTHFADVNGMPDPQHYTTAGDLAILSARLIRDYPDYYNIFSVKEFTYN
FT                   KIKQPNRNRLLWIDPTVDGLKTGHTQAAGYCLIASAKRPLPGTTDASRRLVSVMMGETK
FT                   EHDRVQDSLKMLNYGYTAYDTTRLYKANQVVATPRVYKGSQDSVQVGVKSDQYITLPKG
FT                   AGDKAKPQIELNDPLIAPIANGQQIGTAKLVADGKVLAQFPVVALQPVPQAGVVGRVWD
FT                   SLMLMFNKKK"
FT   sig_peptide     260219..260350
FT                   /locus_tag="BC1002_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.998 at
FT                   residue 44"
FT   gene            261462..262421
FT                   /locus_tag="BC1002_0235"
FT   CDS_pept        261462..262421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0235"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG:
FT                   bpy:Bphyt_0499 aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14342"
FT                   /db_xref="GOA:D5WAN9"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAN9"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ADG14342.1"
FT                   /translation="MTAVSGVSPDPIVYLNGELVPLSEARVPVLDRGFIFGDGIYEVAP
FT                   LYAHASGRRTAFRLKQHLARLARSVGKIGIANPFDDAGWRELIGRVAEANEADGGLRAD
FT                   QDAIAYIQVTRGVAKRGHAFPAGVKPTVFVMVTPLSLPGAAHRASGVACVSAEDRRWLN
FT                   CDIKSVSLLGNVLMAQYAAENDAFETLQFRDGLLTEGSSSNVWIAKDGVLAAPPRSNKI
FT                   LEGIRYGLIEELTAECGIRFEARDITEAEVRAADEIIVSSATKEVLPVTRLDGAPVGAG
FT                   QPGAVFAALYAAYQRAKAAEAAAAQEGVENESRERLTV"
FT   gene            262393..262662
FT                   /locus_tag="BC1002_0236"
FT   CDS_pept        262393..262662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0236"
FT                   /product="protein of unknown function DUF493"
FT                   /note="PFAM: protein of unknown function DUF493; KEGG:
FT                   bpy:Bphyt_0500 protein of unknown function DUF493"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14343"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAP0"
FT                   /inference="protein motif:PFAM:PF04359"
FT                   /protein_id="ADG14343.1"
FT                   /translation="MNPENDSLFEFPCDFPIKIMGKSHPEFAATIVEVVREFDSEVDAS
FT                   RVETRPSSSGTYTGLTVHVRATSRAHLDDIYRALTGHPMVKVVL"
FT   gene            complement(262690..263673)
FT                   /locus_tag="BC1002_0237"
FT   CDS_pept        complement(262690..263673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0237"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bxe:Bxe_A4215 DNA-binding transcriptional
FT                   activator GcvA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14344"
FT                   /db_xref="GOA:D5WAP1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAP1"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADG14344.1"
FT                   /translation="MDLRQLPALNAIKAFEAAARHESFSRAADELFVTHGAVSHQIRAL
FT                   EAELGVSLFARDGKRVRLTETGRRYATQVRAALMELADATRAIRAGDRERRLVISMLSS
FT                   FAARWVTPRIGSFIEAHPQWDLELLTTNALTDFARDDVDVAIRFGFGKYPGLHAELLLD
FT                   EIFFPACSPNFNGGKLPQTPADLAKVPLLRSDDELWRPWFDAAGLTDWPEPKRGVLYQD
FT                   SSNLLQAAVDGQGVALTRRSLAMHEIAAGRLVRLFDVDGPSPWQYYLVCLPQTLETARV
FT                   KAFRDWVFDEVARFRQLFDLACAAGPEACARLVVEQAPADALRVAP"
FT   gene            263772..264098
FT                   /locus_tag="BC1002_0238"
FT   CDS_pept        263772..264098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14345"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAP2"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4214"
FT                   /protein_id="ADG14345.1"
FT                   /translation="MREISSSIAYEIRTGDTLPLKVARSTKLTVRGGAVWVTRSDDTKD
FT                   YWLQPGQTLHLRRGERLWLSAEGATFAKVTFSVPTRCDKRALNWFARIGERWMMRVRGG
FT                   WRTV"
FT   gene            264218..264943
FT                   /locus_tag="BC1002_0239"
FT   CDS_pept        264218..264943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0239"
FT                   /product="lipoate-protein ligase B"
FT                   /EC_number="2.3.1.181"
FT                   /note="TIGRFAM: lipoate-protein ligase B; KEGG:
FT                   bxe:Bxe_A4213 lipoyltransferase; PFAM: biotin/lipoate A/B
FT                   protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14346"
FT                   /db_xref="GOA:D5WAP3"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAP3"
FT                   /inference="protein motif:TFAM:TIGR00214"
FT                   /protein_id="ADG14346.1"
FT                   /translation="MCATPFSPSLLAAIEPPTLRWLGREPYEASFDAMRAFTDARTADT
FT                   PDEIWLVEHPPVFTLGQAGDPAHLLAADSSIPLVKVDRGGQITYHGPGQVVAYLLLDLR
FT                   RRKLMVRELVTRIEQAVIDTLAAYNLAGERKAGAPGIYVAPGPEAGPHAGAKIAALGLK
FT                   IRNGCSYHGVSLNVNMDLRPFLAINPCGYAGLETVDMATLGVAAGWDDVARTLAASLTA
FT                   NLDGKPAAVAQPQTGALTA"
FT   gene            264957..265964
FT                   /locus_tag="BC1002_0240"
FT   CDS_pept        264957..265964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0240"
FT                   /product="lipoic acid synthetase"
FT                   /EC_number="2.8.1.8"
FT                   /note="SMART: Elongator protein 3/MiaB/NifB; TIGRFAM:
FT                   lipoic acid synthetase; KEGG: bxe:Bxe_A4212 lipoyl
FT                   synthase; PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14347"
FT                   /db_xref="GOA:D5WAP4"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAP4"
FT                   /inference="protein motif:TFAM:TIGR00510"
FT                   /protein_id="ADG14347.1"
FT                   /translation="MTDVTANSAAATSAPEGVPAPAAYDATAKQKAQAKTARIPIKVVP
FT                   IEKLKKPDWIRVKAATGNSRFYEIKQILREHNLHTVCEEASCPNIGECFGKGTATFMIM
FT                   GDKCTRRCPFCDVGHGRPDPLDADEPANLARTIAALKLKYVVITSVDRDDLRDGGAAHF
FT                   VECIRQTRELSPQTRIEILTPDFRGRLDRALGILNAAPPDVMNHNLETVPRLYKEARPG
FT                   SDYAHSLKLLKDFKALHPHVATKSGLMVGLGETEEEILQVMRDLRDHDVDMLTIGQYLQ
FT                   PSEHHLPVRAYVHPDTFKMYEEEAYKMGFTHAAVGAMVRSSYHADVQAHGAGVV"
FT   gene            complement(266062..266898)
FT                   /locus_tag="BC1002_0241"
FT   CDS_pept        complement(266062..266898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0241"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bcj:BCAS0033
FT                   putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14348"
FT                   /db_xref="GOA:D5WAP5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAP5"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADG14348.1"
FT                   /translation="MAGLRHQFPVDGLLKVAGLARSTFYYQCKASLVADKHAQLKARIR
FT                   SLFEQHKGRYGYRRITSAIRRLGIVVNHKTVQRLMQLMKLKCLVRPKKYRAFRGTVGRI
FT                   APNVLQREFDADAPNRKWVTDITEFRVGEHKLYLSPVLDLYNGEIVAYETATRPAFAMV
FT                   AGMIRKAMRKLKPDDRPVVHSDQGWHYQMSAYQTLLARRGLTQSMSRKGNCHDNATMES
FT                   FFGTLKSEFFHLNRFQSIEALQAGIKDYIHYYNHQRIKLKLKGLSPVMYRTQPSRP"
FT   gene            complement(266898..267425)
FT                   /locus_tag="BC1002_0242"
FT   CDS_pept        complement(266898..267425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0242"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="KEGG: bac:BamMC406_2351 transposase IS3/IS911 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14349"
FT                   /db_xref="GOA:D5WAP6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAP6"
FT                   /inference="similar to AA sequence:KEGG:BamMC406_2351"
FT                   /protein_id="ADG14349.1"
FT                   /translation="MSRHTARFKRSVVRDYLSGKGGSNREVAHRHGIDHGTVRKWAAAW
FT                   QVHGEAAFRKKYGRFDARFRLKVLQFMQTKDLSLRETAAVFDIRNPTTIGIWKRQYDSG
FT                   GIQALQPGPRGRPVKQPKSSVPSDSTKSDESRTKEELLEELNYLRMENAYLKKLDALIR
FT                   SESPKAPRKKRK"
FT   gene            267529..268281
FT                   /locus_tag="BC1002_0243"
FT   CDS_pept        267529..268281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0243"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: bxe:Bxe_A4202 cytoplasmic glycerophosphodiester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14350"
FT                   /db_xref="GOA:D5WAP7"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAP7"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ADG14350.1"
FT                   /translation="MATGIDRRTSAQWPYPRLIAHRCGGTLAPENTLAGFDACVRYGYR
FT                   MVEFDAKLSADNALFLLHDDTLDRTTNGHGPAATHTWQQLAALDAGAWRGAEFAGTRLP
FT                   TLADAAERCARDGIAANIEIKPCPGREVITGTLVAQGALELWEGQTPPLLSSFSFDALA
FT                   AARAAAPSLPRGMLFEQVPADWLSIVRELDCVSLHASHRYLSEPLVAQIRAAGLRVLAY
FT                   TVNDPARARVLEEWGVDMICTDRIDLLT"
FT   gene            268659..269939
FT                   /locus_tag="BC1002_0244"
FT   CDS_pept        268659..269939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0244"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   bpy:Bphyt_0518 C4-dicarboxylate transporter DctA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14351"
FT                   /db_xref="GOA:D5WAP8"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAP8"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ADG14351.1"
FT                   /translation="MKKPIHKVLYVQVIVAIIIGIVLGHFYPNLAIDMKPLGDGFIKLI
FT                   KMVIGPIIFCTVVTGIAGMEDMKKVGRVGGKALLYFEIVSTFALVLGLAATHLLRPGAG
FT                   FNVDPASLDGRAVASYAAKAHGQSTVDFFMHLIPDTLSSAFAQGEILQILLIALLFGAV
FT                   LATAGEKGKPVTNFIEGLSHILFGMVRIITKLAPIGAFGAMAFTIGKYGIGSLLPMLKL
FT                   IGTFYLTSIVFVVVVLGAIARMVGFNILRFIAYIKEEMLIVLGTSSSEAALPQLMQKLE
FT                   NLGCSRSVVGLVVPTGYSFNLDGTNIYMTMAVLFIAQATNTDLSWGQQLTLLAVTMLTS
FT                   KGASGVTGAGFITLAATLAVVPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVS
FT                   AWEKELDRSRLNKVLRGEVAVKEPAGV"
FT   gene            269985..272081
FT                   /locus_tag="BC1002_0245"
FT   CDS_pept        269985..272081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0245"
FT                   /product="histidine kinase"
FT                   /note="KEGG: bxe:Bxe_A4196 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14352"
FT                   /db_xref="GOA:D5WAP9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAP9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG14352.1"
FT                   /translation="MKPASARSSGASPASPELSAPTSGETASQTRGYARDPFDGDPLPP
FT                   YATMSDAHRSDFANVTRRLLILFALAAGLVAACWVTYSLAWKSGVDTLRRNAAVRAERT
FT                   ASALKSTLERYESLPYLLAEHPIVHDVLIDPSPANVKRANLYLEDLNRHARATVTYIIS
FT                   LDGYCVAASNWRGPGSFVGAGYQFRPYFVDAMNGGVGRFFGIGTISQAPGYYISQPVRR
FT                   DGKIVGVAVVKLDLEWFQGVDASEPLVVTDDHGVIFLSSVPAWKYHTIRPLPGRIADSI
FT                   YQARQYAQQPIEPLPVTVERMLEGNAQILRIGGGRLAPRYLASRHAMGEPDWHLITMSP
FT                   VDPVDADARKATIVTGFGYVSLVLLAFYWRMRRARVREVMRSRALLQKAYAELNQRVAE
FT                   RTADLSEANEQLHKEVAERTRAEQELRAAHDELIQASKLAALGQMAAGITHELNQPLAA
FT                   LRSFSDNTRVLLERGDQASARENLEAIAALTERMGKITNQLKLFVGRARPRSARASIVR
FT                   ALRNVVALLQKRLQGVELEFVLIDAQADIDAGAAAAPGGARMPLNLADDHPELVANCDD
FT                   LRLEQVLINLLGNALDATAGMNPPRITVEVEAGAANLSIAVGDNGPGIPDDVLPHLFEP
FT                   FFTTKEMGQGLGLGLAISSSIARDCGGSLVARNAPQGGASFVLTLRRARVQTSPSHDPL
FT                   TAGS"
FT   gene            272113..273462
FT                   /locus_tag="BC1002_0246"
FT   CDS_pept        272113..273462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0246"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="KEGG: bpy:Bphyt_0520 two component, sigma54
FT                   specific, transcriptional regulator, fis family; PFAM:
FT                   sigma-54 factor interaction domain-containing protein;
FT                   response regulator receiver; helix-turn-helix Fis-type;
FT                   SMART: response regulator receiver; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14353"
FT                   /db_xref="GOA:D5WAQ0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAQ0"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADG14353.1"
FT                   /translation="MNDGLQVLYIEDDELVRRASVQSLQLAGFDVIGHASVEAAAKLIS
FT                   ADFSGVIVSDIRLPGASGLDLLAQCHERAPDVPVILVTGHGDISMAVQAMRDGAYDFIE
FT                   KPFASERLIETVRRALERRKLVLENLALRRELAGQNAVAPRIIGRSPAIEQVRRLIANV
FT                   APTDASVLINGDTGAGKELIARSLHELSPRRDKPFIAVNCGALPEPMFESEMFGYEPGA
FT                   FTGAAKRRIGKLEHASGGTLFLDEIESMPLALQVKLLRVLQDGVLERLGSNQPIRVDCR
FT                   VVAAAKGDMAEHVADGSFRRDLLYRLNVVTIALPPLSERREDIVPLFEHFLLDAAVRYQ
FT                   RPAPMLTDRQRASLMQRDWPGNVRELRNAADRFVLGIADEPVLSFGEDDGTTHPLKERV
FT                   EQFERAMIAEALEQAGGVVAVAADRLQLGKATLYEKIKRYGLAAKGEGER"
FT   gene            complement(273525..274061)
FT                   /locus_tag="BC1002_0247"
FT   CDS_pept        complement(273525..274061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0247"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: bpy:Bphyt_0521
FT                   redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14354"
FT                   /db_xref="GOA:D5WAQ1"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAQ1"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ADG14354.1"
FT                   /translation="MSSTSPTAARRTSPLRYLIAVAVAIALAVAGYFAFAGQQRVPDAT
FT                   FTLLSGQKLTTADLKGKVYLVNFWATSCDTCMKEMPQMVETYNRFKGQGLEFVAVAMNY
FT                   DAPMYVTNYTQTRQLPFKVAMDDGSAAKQFGNVQLTPTTFVIDKDGKILKRYVGEPQFA
FT                   ELDQLLAKALKAGAA"
FT   sig_peptide     complement(273951..274061)
FT                   /locus_tag="BC1002_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.875 at
FT                   residue 37"
FT   gene            274363..274917
FT                   /locus_tag="BC1002_0248"
FT   CDS_pept        274363..274917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14355"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAQ2"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4193"
FT                   /protein_id="ADG14355.1"
FT                   /translation="MRPGRARTVLGAATAALALGVALSACSPTFDWRTVMNNEKGYTVD
FT                   FPAKPGNDQRAVQIDGTPMQMAMQTAEAGNAVFAVGTVMLPDDSDATQRAALDFLRAGL
FT                   ARNVGATPDAHAVQIPLAAGGKTSGLEMTVSGAAGAKHEPRTVYARLVARGRHVYQAAI
FT                   IADQPLPQEQVDQFFSSFQLY"
FT   sig_peptide     274363..274440
FT                   /locus_tag="BC1002_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.960 at
FT                   residue 26"
FT   gene            complement(275250..276872)
FT                   /locus_tag="BC1002_0249"
FT   CDS_pept        complement(275250..276872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0249"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; KEGG: bpy:Bphyt_0523 Mg chelatase,
FT                   subunit ChlI; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14356"
FT                   /db_xref="GOA:D5WAQ3"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAQ3"
FT                   /inference="protein motif:TFAM:TIGR00368"
FT                   /protein_id="ADG14356.1"
FT                   /translation="MSLAVVRSRAPAAGRAPEVTVEVHLANGLPSFAIVGLPDLEVRES
FT                   RERVRAALQNCGFDFPVRRITVNLAPADLPKESGRFDLPIALGILAASGQIPAESLLHR
FT                   EFAGELSLTGALRPMRGAFAMACGTARGALASAEAAGADADASSETRSALPALVDQVTA
FT                   QAFHTPQLYLPAASAAEAALVPGVDVFGAADLPSLCAHLAGAPDARLRPVAAPEPDEHA
FT                   AAPAPDMADVIGQRAARRALEVAAAGGHHVLLIGPPGAGKSMLAARLPGLLPPMTDDEA
FT                   LASAALLSASRIGFKPSQWRQRPFRAPHHSSSAAALVGGRNPPQPGEITLAHLGVLFLD
FT                   ELPEFDRVVLETLREPLEAGRITISRAAWQADFPAACQLIAAMNPCPCGWRGDPGGRCR
FT                   CTPEVAARYMRKLSGPLLDRIDIQLEIPALTATELAARAATAGEASAAIAYRVSAARER
FT                   QLVRQGKTNRELDGREVDDVCRPDGAGEALLREAGERFGWSARAYYRVLKVARTVADLA
FT                   GAAMPSAAQVAEAIQYRRAFGSL"
FT   gene            complement(276995..277288)
FT                   /locus_tag="BC1002_0250"
FT   CDS_pept        complement(276995..277288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0250"
FT                   /product="protein of unknown function DUF526"
FT                   /note="PFAM: protein of unknown function DUF526; KEGG:
FT                   bpy:Bphyt_0524 protein of unknown function DUF526"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14357"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAQ4"
FT                   /inference="protein motif:PFAM:PF04380"
FT                   /protein_id="ADG14357.1"
FT                   /translation="MKHAHFLCTKGNTMKQPNDVFNDFQARVSDLFKNSPAKDVERNVK
FT                   AMLSQGFSKLDLVTREEFDTQTQVLVRTRARLEELERRVAELEQKLPLTQTP"
FT   gene            277637..277975
FT                   /locus_tag="BC1002_0251"
FT   CDS_pept        277637..277975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0251"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   bpy:Bphyt_0525 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14358"
FT                   /db_xref="GOA:D5WAQ5"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAQ5"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ADG14358.1"
FT                   /translation="MKLITAIIKPFKLDEAREALSAIGVSGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIEAAVSDDIVDQAIEALERAARTGKIGDGKIFVTPIEQVVRIRT
FT                   GETGADAL"
FT   gene            278021..279529
FT                   /locus_tag="BC1002_0252"
FT   CDS_pept        278021..279529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0252"
FT                   /product="ammonium transporter"
FT                   /note="KEGG: bxe:Bxe_A4189 ammonium transporter; TIGRFAM:
FT                   ammonium transporter; PFAM: ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14359"
FT                   /db_xref="GOA:D5WAQ6"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAQ6"
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /protein_id="ADG14359.1"
FT                   /translation="MRKLMMSLLMAGSLLAAGVGTALADDASAPAAASAPDTTASAPAP
FT                   DASAAAAAPAASAPAADASAAPAASAPAATDASATAAAAPAAPTAPFSVDSSKINSGDT
FT                   AWMLTSTALVLFMTIPGLALFYGGMVRKKNVLATLMQSFAITCLVTIVWTVVGYSIAFT
FT                   PGNSFIGGFSRVFMTGMNYIKGDKATTLTVSHLAPTIPETVYFVYQMTFAIITPALITG
FT                   AFADRMKFSAMLVFMTLWSILVYSPIAHMVWEPSGWLATAGILDFAGGTVVHINAGIAG
FT                   LVCCLVLGKRVGYGKEAMAPHNLTLTLIGGAMLWVGWFGFNAGSAVAADGRAGFAMFAT
FT                   QVATAAAALAWMFAEWAAKGKPSVLGIVSGAVAGLVAVTPASGFVGTLGALVIGIVAGV
FT                   LCFWSATWLKHKLGYDDSLDAFGVHCVGGIIGALLTGVFAVKDISGFDGSLILQAKGVL
FT                   TTLIYSGVVSFVLLKIIDMVIGIRVTEEQEREGLDVSLHGEKVE"
FT   sig_peptide     278021..278095
FT                   /locus_tag="BC1002_0252"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            279777..281066
FT                   /locus_tag="BC1002_0253"
FT   CDS_pept        279777..281066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0253"
FT                   /product="glutamate/cysteine ligase"
FT                   /note="KEGG: bpy:Bphyt_0527 glutamate/cysteine ligase;
FT                   TIGRFAM: glutamate/cysteine ligase; PFAM:
FT                   glutamate--cysteine ligase GshA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14360"
FT                   /db_xref="GOA:D5WAQ7"
FT                   /db_xref="InterPro:IPR011718"
FT                   /db_xref="InterPro:IPR042520"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAQ7"
FT                   /inference="protein motif:TFAM:TIGR02049"
FT                   /protein_id="ADG14360.1"
FT                   /translation="MVPHLVTALNGPLLDLERKILDATPAIERWFRLEWQEHTPPFYCS
FT                   VDLRNAGFKLAPVDTNLFPGAFNNLPQEVLPLAVQAAMASIEKICPDAKNLLVIPERHT
FT                   RNAFYLENVARLASIMRQAGLNVRFGTLDETINGPVTIALSDGQKLVLEPLERSQRRLG
FT                   LKNFDPCSILLNNDLSGGIPPVLENLHEQYLLPPLHAGWAVRRKSTHFSCYDDVAKKFT
FT                   KMVEIDPWMINPYFAHVEGVDFQQRTGEEALADAIDGVLKKIARKYREYGISEKPYVVI
FT                   KSDAGTYGMGVMTVHDASEVAALTKRERTRMAATKDGLEVHDVIVQEGVYTFERIGEEV
FT                   AEPVVYMIDRYVVGGFYRVHGSRERDQNLNAPGMHFVPLGFEHTALPDAHAKPGAAPPN
FT                   RFYMYGVVARLGLLAASVELEKTDPEAIQV"
FT   gene            281170..282126
FT                   /locus_tag="BC1002_0254"
FT   CDS_pept        281170..282126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0254"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="TIGRFAM: glutathione synthetase; KEGG:
FT                   bpy:Bphyt_0528 glutathione synthetase; PFAM: glutathione
FT                   synthetase ATP-binding; glutathione synthetase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14361"
FT                   /db_xref="GOA:D5WAQ8"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAQ8"
FT                   /inference="protein motif:TFAM:TIGR01380"
FT                   /protein_id="ADG14361.1"
FT                   /translation="MDILFIADPLAHFKIYKDSTYAMMAEAARRGHTVYTCEPKHLAWT
FT                   GGDVEANVQRIAITGDTTDLHRDVWFAADAAAPRALASFGAVVMRKDPPFDMEYVTSTW
FT                   LLELAERGGARVFNKPQAIRDHSEKLAIGEFAQFVAPTLVTRDPARLRAFHEQHGDVIL
FT                   KPLDGMGGMGVFRVKADGMNLGSIVEMLSHDGARSVMAQKFIPEIKEGDKRILLIGGEA
FT                   VPYSLARIPQGNEVRGNLAAGGLGVARPLSEQDRKIADTLAPVLAARGLLLVGLDAIGD
FT                   WLTEVNVTSPTCFREIMDQTGFDVAAMFVDALERAVG"
FT   gene            282394..282921
FT                   /locus_tag="BC1002_0255"
FT   CDS_pept        282394..282921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0255"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: bpy:Bphyt_0529 PTS system fructose subfamily IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14362"
FT                   /db_xref="GOA:D5WAQ9"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAQ9"
FT                   /inference="protein motif:PFAM:PF03610"
FT                   /protein_id="ADG14362.1"
FT                   /translation="MAGILIIAHAPFATALRDCISHIYGGLPARIGVIDVSPDCDPAQV
FT                   VAFANSEVARLKEENGALVLTDMFGATPANIAGRLAAVRDVRVLCGVNLPMLVRAVCYR
FT                   ATPLDTLVDKALAGATKGVHAIGPATPEPVTAPACPADCLPALPPDAAPADCVPALPAD
FT                   ADLTQKPDAPGL"
FT   gene            283046..283315
FT                   /locus_tag="BC1002_0256"
FT   CDS_pept        283046..283315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0256"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="KEGG: bpy:Bphyt_0530 phosphotransferase system,
FT                   phosphocarrier protein HPr; TIGRFAM: phosphocarrier, HPr
FT                   family; PFAM: phosphoryl transfer system HPr"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14363"
FT                   /db_xref="GOA:D5WAR0"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAR0"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ADG14363.1"
FT                   /translation="MLQQETTIVNKLGLHARASAKLTQLAGNYQAEIWMSRNGRRINAK
FT                   SIMGVMMLAAGIGSTVLIETEGTDEQEAMDALLKLIADKFGEGQ"
FT   gene            283717..285462
FT                   /locus_tag="BC1002_0257"
FT   CDS_pept        283717..285462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0257"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="KEGG: bxe:Bxe_A4184 phosphoenolpyruvate--protein
FT                   phosphotransferase; TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein domain protein; PEP-utilising protein
FT                   mobile region"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14364"
FT                   /db_xref="GOA:D5WAR1"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAR1"
FT                   /inference="protein motif:TFAM:TIGR01417"
FT                   /protein_id="ADG14364.1"
FT                   /translation="MSFTLHGIPVSRGIAIGRAYLIAPAALDVDHYLIEPAQIEGEVGR
FT                   FRAAQQRVHEELNVLRADLAADAPTEMGAFIDVHMMILNDVMLVQETIDLIRTRRYNVE
FT                   WALTEQLERLSRHFDDIEDEYLRERKADIEQVVERVLKALAGAPGIVDNVHGACDEMIV
FT                   VAHDIAPADMMQFKTQTFQGFVTDLGGRTSHTAIVARSLGIPAAVGVQHASALIRQDDL
FT                   IIVDGDHGIVIVDPAPIVLEEYSYRQSEKELEQRKLQRLKFSPTQTLCGTRIELCANIE
FT                   LPDDARAAIESGATGVGLFRTEFLFMNHKDRMAEEEEQFSAYRRAVELMNGLPVTIRTI
FT                   DVGADKPLDSMGGGDGYETAVNPALGLRAIRWSLSEPQMFLTQLRAILRASAFGKVKIL
FT                   IPMLAHAQEIDQTLDLIREAKRQLDDAGIAYDPNVQVGAMIEIPAAAIALPLFLKRLDF
FT                   LSIGTNDLIQYTLAIDRADNAVAHLYDPLHPAVLHLIAFTLREAKRAGVPVSVCGEMAG
FT                   DPALTRLLLGMGLTEFSMHPSQLLEVKQEVLRSHLKTLEKPVADVLASFEPEEVQAALK
FT                   RVALV"
FT   gene            complement(285556..286314)
FT                   /locus_tag="BC1002_0258"
FT   CDS_pept        complement(285556..286314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0258"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: bxe:Bxe_A4183 putative
FT                   molybdopterin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14365"
FT                   /db_xref="GOA:D5WAR2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAR2"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ADG14365.1"
FT                   /translation="MNDDQLLRYSRHILVDEIGIEAQQRFIEAHAIIVGAGGLGSPAAM
FT                   YLAAAGVGRLTLVDADTVDLTNLQRQILHVSASVGRSKVESGRDMLAQINPEVVVNAVA
FT                   ERVDDAWLDREVPHADVVLDCTDNFATRHAINRACVKHRVPLVSGAALRFDGQISTFDF
FT                   RDEASPCYACVFPEDQPFEEVACSTMGVFAPTVGIVGSMQAAEALKVVGAIGTPLVGRL
FT                   TMLDSLRMEWNTMRIGRQPDCPVCGRAHGS"
FT   gene            complement(286537..288120)
FT                   /locus_tag="BC1002_0259"
FT   CDS_pept        complement(286537..288120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0259"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="SMART: peptidase S41; PDZ/DHR/GLGF domain protein;
FT                   TIGRFAM: carboxyl-terminal protease; KEGG: bxe:Bxe_A4182
FT                   peptidase S41A; PFAM: peptidase S41; PDZ/DHR/GLGF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14366"
FT                   /db_xref="GOA:D5WAR3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAR3"
FT                   /inference="protein motif:TFAM:TIGR00225"
FT                   /protein_id="ADG14366.1"
FT                   /translation="MRKNLKNFGLIAAGLATGVFATLQFSASAQQPASAAIAPLPLDQL
FT                   RLFAEVFGQIKHEYVEPVDDKKLLTAAIKGMVSSLDPHSSYLDKTDYEELQEQTKGRFA
FT                   GLGIEISSEDGLIKVISPIEDTPAFRAGIRPGDLITRINDKPVRGMTLDQAVKQMRGEP
FT                   GTKVTLTIFRKTDDRTFPLTVTRAIIKVQSVKGKIVAPGFAYVRITSFQERTTPDLAAK
FT                   LQDLARQEPNLKGLILDLRNNGGGLLQSAVGVAGAFLPPNSVVVSTNGQIPDSKQIYRD
FT                   TYDNYRLQSFDSDPLKDVPAIFKTVPMIVLTNAYSASASEIVAGALQDQHRALLLGKTT
FT                   FGKGSVQTVRPMTADTALRLTTAYYYTPSGRSIQNKGIRPDLPVDQYADGDPDDALVTR
FT                   EVDYSNHLANTQDPNEKKEAEKRESERMEQLRQLEEQNDKKTPEQRQKERERKPVEFGS
FT                   NDDFMLQQAVGKLEGKPVQESKSLMERRLAQNKPGTSASAPVAVKPTQPVPGASGPAPA
FT                   SAPALAPAGK"
FT   sig_peptide     complement(288031..288120)
FT                   /locus_tag="BC1002_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.876 at
FT                   residue 30"
FT   gene            complement(288477..289223)
FT                   /locus_tag="BC1002_0260"
FT   CDS_pept        complement(288477..289223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0260"
FT                   /product="phosphoglycerate mutase 1 family"
FT                   /EC_number="5.4.2.4"
FT                   /note="TIGRFAM: phosphoglycerate mutase 1 family; KEGG:
FT                   bpy:Bphyt_0534 phosphoglycerate mutase 1 family; PFAM:
FT                   Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14367"
FT                   /db_xref="GOA:D5WAR4"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAR4"
FT                   /inference="protein motif:TFAM:TIGR01258"
FT                   /protein_id="ADG14367.1"
FT                   /translation="MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNLEAQQAGVLLKE
FT                   SGYTFDIAYTSVLKRAIRTLWHVQDKMDLMYLPVVHSWRLNERHYGALSGLNKAETAAK
FT                   FGDKQVLVWRRSYDTPPPALEPTDERAPYTDPRYAKVPREQLPLTECLKDTVARVLPLW
FT                   NESIAPAIKSGRSILIAAHGNSIRALVKYLDNISDSDIVGLNIPNGVPLVYELDEDLKP
FT                   IKHYYLGDQDAIAKAQAAVASQGKAG"
FT   gene            289361..289786
FT                   /locus_tag="BC1002_0261"
FT   CDS_pept        289361..289786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0261"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: bpy:Bphyt_0535 rhodanese domain protein; PFAM:
FT                   Rhodanese domain protein; SMART: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14368"
FT                   /db_xref="GOA:D5WAR5"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAR5"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADG14368.1"
FT                   /translation="MKFFTEYTNLVLIAIVLISGGLLLWPTISRRGRGGLSAAEATQLI
FT                   NRRNAAVIDLRPSADYAKGHLPSARHFEFAELQAKVTQLAKNKSNPVLLVCQTGQQSNK
FT                   AARIVQEAGYAEVHVLEGGVDAWQKAGMPVVKQGAAK"
FT   gene            289783..290043
FT                   /locus_tag="BC1002_0262"
FT   CDS_pept        289783..290043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0262"
FT                   /product="glutaredoxin 3"
FT                   /note="KEGG: bpy:Bphyt_0536 glutaredoxin 3; TIGRFAM:
FT                   glutaredoxin 3; PFAM: glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14369"
FT                   /db_xref="GOA:D5WAR6"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAR6"
FT                   /inference="protein motif:TFAM:TIGR02181"
FT                   /protein_id="ADG14369.1"
FT                   /translation="MNKVIMYSTQVCPYCQMAERLLKSRGVEHVEKVLIDKDPARREEM
FT                   MTRTGRRTVPQVFIGETHVGGYDDLSALDRAGGLTPLLEAA"
FT   gene            290191..290667
FT                   /locus_tag="BC1002_0263"
FT   CDS_pept        290191..290667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0263"
FT                   /product="protein-export protein SecB"
FT                   /note="KEGG: bxe:Bxe_A4178 preprotein translocase subunit
FT                   SecB; TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14370"
FT                   /db_xref="GOA:D5WAR7"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAR7"
FT                   /inference="protein motif:TFAM:TIGR00809"
FT                   /protein_id="ADG14370.1"
FT                   /translation="MSDENNQPFFNIQRIYLKDMSLEQPNSPAIFLEQEMPSVEVEVDV
FT                   KAERLAESVFEILVTGTVTAKVSDKVAFLIEAKQAGIFDIRNIPAEQIDPLVGIACPTI
FT                   LFPYLRSNIADAITRAGFPPIHLAEINFQALYEQRLAQMSAAQQGGAAQNGVTH"
FT   gene            290690..291688
FT                   /locus_tag="BC1002_0264"
FT   CDS_pept        290690..291688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0264"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="KEGG: bxe:Bxe_A4177 NAD(P)H-dependent
FT                   glycerol-3-phosphate dehydrogenase; PFAM: NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14371"
FT                   /db_xref="GOA:D5WAR8"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAR8"
FT                   /inference="protein motif:PRIAM:1.1.1.94"
FT                   /protein_id="ADG14371.1"
FT                   /translation="MKVAVLGAGAWGTALAGHLAVRHDTVLWARESALITELSTSHENA
FT                   RYLPGVALPPALRYEADLNAALDYALADAALCVVATPVAGLRGLLRAMRDAGKVPAHIV
FT                   WLCKGFEADSQLLPHQAVAAELPAHASNGVLSGPSFAREVGQGLPVALTIASSSSVCRE
FT                   RTVAAFHHGAMRIYTGDDVVGVEVGGAVKNVLAIATGIADGLGLGLNARAALITRGLAE
FT                   MSRLGVTLGGRAETFTGLTGLGDLILTATGDLSRNRTVGLQLATGRTLDDILGGLGHVA
FT                   EGVRCAKAVLSIARAHAIEMPITQAVCAVLFDGVAPRDAVSALLRRDSKAE"
FT   gene            291786..292346
FT                   /locus_tag="BC1002_0265"
FT   CDS_pept        291786..292346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0265"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="KEGG: bpy:Bphyt_0539 Appr-1-p processing domain
FT                   protein; PFAM: Appr-1-p processing domain protein; SMART:
FT                   Appr-1-p processing domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14372"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAR9"
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /protein_id="ADG14372.1"
FT                   /translation="MPTFNLSHGTCTLEARVVDITRLAVDAIVNAANTSLLGGGGVDGA
FT                   IHRAAGKELLRECETLGGCATGDAKITAGYRLPAKHVIHAVGPVWRGGAHGEADLLASC
FT                   YQRSLEIARETHCTSIAFPAISCGIYRFPADDAVSIAVGTVLDTLPRTPHMKHVTFACF
FT                   DDAMFARYEAELERRQAPPSKPA"
FT   gene            complement(292319..292789)
FT                   /locus_tag="BC1002_0266"
FT   CDS_pept        complement(292319..292789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0266"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="KEGG: bpy:Bphyt_0540 RNA methyltransferase, TrmH
FT                   family, group 2; TIGRFAM: RNA methyltransferase, TrmH
FT                   family, group 2; PFAM: tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14373"
FT                   /db_xref="GOA:D5WAS0"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAS0"
FT                   /inference="protein motif:TFAM:TIGR00185"
FT                   /protein_id="ADG14373.1"
FT                   /translation="MFNVVLVEPEIPPNTGNVIRLCANTGARLHLIEPLGFPLDDTKMR
FT                   RAGLDYHEYAEMNVHTDWDAFIAKETPDPSRMFAFTTRGSGRFHDHAFQPGDWFVFGAE
FT                   TRGLPDTVLERFTNEQRVRLPMRPGNRSLNLSNTVAVVVFEAWRQAGFEGGA"
FT   gene            complement(292808..293593)
FT                   /locus_tag="BC1002_0267"
FT   CDS_pept        complement(292808..293593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0267"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG:
FT                   bpy:Bphyt_0541 phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14374"
FT                   /db_xref="GOA:D5WAS1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAS1"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ADG14374.1"
FT                   /translation="MRFQSFSSSCRNQAARVARGLYSAWPRALNVALPNLCALCGNMSH
FT                   KTLCDGCDAAYWNESRLRCSVCAVPLPASRWVAQAGYRCADCVAEPPPFDASFALADYR
FT                   APLDTLAVGLKFRARLMLARDFAQRLARLARDNWHDAGERPDLIAPVPLASRRLVERGY
FT                   NQAWQIARPLARALAVRSDATLLVRTLDTAPQSRLDLDARRHNVGRAFRIARPVRGLHV
FT                   GIVDDVMTSGATLEALAHTLKAAGARRVTNFVALRTPKN"
FT   gene            293676..294641
FT                   /locus_tag="BC1002_0268"
FT   CDS_pept        293676..294641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0268"
FT                   /product="Methyltransferase type 11"
FT                   /note="KEGG: bxe:Bxe_A4173 hypothetical protein; manually
FT                   curated; PFAM: Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14375"
FT                   /db_xref="GOA:D5WAS2"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAS2"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADG14375.1"
FT                   /translation="MSPTSAQSGRPAYDSRRLMRIFDRRAATFDEVAFLPREIAQRMRE
FT                   RLDYIKVAPSSVLDAGCGAGEDIPALRERFPEAPVFGADLSRGMLRRALRHDAGDTSWR
FT                   RFLPPSLGKALGARGPRFAQADFSALPFAAGAFEFIWSNLALHWHSRPDLVFPEWQRVL
FT                   KVNGLLMFSTLGPDTLKELRGAYAEIEAAHGVASRKHVIDFVDMHDLGDMLVEAGFEIP
FT                   VMDQETLTITYKSPESLLADVRRWGAYPFERDAHDGALARRLHKALLAALEARRRADGT
FT                   IALTFEVIYGHAWKAVPRTTAEGHGIVRLEDIGRGPGKRG"
FT   gene            295037..295513
FT                   /locus_tag="BC1002_0269"
FT   CDS_pept        295037..295513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0269"
FT                   /product="Protein of unknown function DUF2244,
FT                   transmembrane"
FT                   /note="PFAM: Protein of unknown function DUF2244,
FT                   transmembrane; KEGG: bxe:Bxe_A4172 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14376"
FT                   /db_xref="GOA:D5WAS3"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAS3"
FT                   /inference="protein motif:PFAM:PF10003"
FT                   /protein_id="ADG14376.1"
FT                   /translation="MGASDHLLADSEPVLKDWTMKRNCSMSPRQFVCLYVSLALFSLAI
FT                   AFMLVLVGGWLVLPFTGIELLAVGIAFAIYARHAVDYERIRLFPNRLVIEQVSAEQITQ
FT                   FEFNPRWVRIEPGATPRDQIKLVSRGQTIMIGQHLAQNRRTQFAGELRMWLARC"
FT   gene            295578..297194
FT                   /locus_tag="BC1002_0270"
FT   CDS_pept        295578..297194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0270"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="KEGG: bxe:Bxe_A4171 putative cytochrome c oxidase;
FT                   TIGRFAM: cytochrome c oxidase, subunit II; PFAM: cytochrome
FT                   c oxidase subunit II; cytochrome C oxidase subunit II
FT                   transmembrane region; cytochrome c class I; OmpA/MotB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14377"
FT                   /db_xref="GOA:D5WAS4"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAS4"
FT                   /inference="protein motif:TFAM:TIGR02866"
FT                   /protein_id="ADG14377.1"
FT                   /translation="MENLGKEAMKTIKRALMSVLATSGLLFAGAALAVGDAPGGPAVNA
FT                   INLQPPATKIAEELFSLHMFMLGLCTVIFIGVFGVMFYSVFAHRKSKGHKAANFHESTT
FT                   VEIIWTIVPFIIVVLMALPATKTVVAMKDTSNADLTIKVTGYQWKWGYDYVKGPGEGIG
FT                   FLSTLATPRAQTEGREPISTLYLQEVDNPLVVPVDKKIRIITTANDVVHSWYVPAFGVK
FT                   QDAIPGFVRDTWFKATRTGTFRGFCTELCGKEHAFMPVVVEVLSADDYAKWVDQEKKKM
FT                   AAGQDDPNKTYTMAELMERGGKVYAANCAVCHQPTGKGAGAFPALDGSKIANGPIGQHV
FT                   SLVLKGKNAMPSWAPTLNDVEIASVVTYERNSWGNHTGDILQPKQVTDARNGKLPEGGD
FT                   HLAAAGAAASGPEAASAPAASGTDAGAAAANGAEATLPASVYLETGKSTLPADAKAAVD
FT                   AAAAYAKAHPDAKFTLSGFTDATGSADVNAKLAKSRAEAVRDALKAAGIAEDHIILKKP
FT                   ETITGGTDAKEARRVQISPAA"
FT   sig_peptide     295578..295679
FT                   /locus_tag="BC1002_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.989 at
FT                   residue 34"
FT   gene            297239..298852
FT                   /locus_tag="BC1002_0271"
FT   CDS_pept        297239..298852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0271"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="TIGRFAM: cytochrome c oxidase, subunit I; KEGG:
FT                   bpy:Bphyt_0545 cytochrome c oxidase, subunit I; PFAM:
FT                   cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14378"
FT                   /db_xref="GOA:D5WAS5"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAS5"
FT                   /inference="protein motif:TFAM:TIGR02891"
FT                   /protein_id="ADG14378.1"
FT                   /translation="MSSIGHDVVAGHEHVHGDHAHETPHGWRRWLFATNHKDIGTLYLI
FT                   FSFTMFLSGGVMALMIRAELFEPGLQIMRPEFFNQLTTMHGLIMVFGAIMPAFVGFANW
FT                   MVPLQIGASDMAFARMNNFSFWLLPVAAVLLVGSFFSPGGATAAGWTLYAPLSTQMGPG
FT                   MDFAIFAVHLMGASSIMGGINIVVTILNMRAPGLTLMKMPMFVWTWLITAYLLIAVMPV
FT                   LAGAITMVLFDRHFGTSFFNAAGGGDPVMYQHIFWFFGHPEVYIMILPAFGIVSQVIPA
FT                   FSRKPLFGYSSMVYATASIAILSFMVWAHHMFVTGMPVTGQLFFMYATMLIAVPTGVKV
FT                   FNWVATMWRGALSFETPMLFAVGFLIVFTFGGLSGLMLAMAPLDIQYHGTYFVVAHFHY
FT                   VLVAGSLFALFSGWYYWAPKWTGWMYNETRGKIHFWASMFFFNLAFLPMHFVGLAGMPR
FT                   RYADYPAQFTDWNQVISIGAFGFGLSQVYFLFAVALPAYRGGGELVEAGDKPWDGATGL
FT                   EWSVPSPAPFHTFEHPPTVE"
FT   gene            299153..299776
FT                   /locus_tag="BC1002_0272"
FT   CDS_pept        299153..299776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0272"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: bxe:Bxe_A4169 cytochrome c oxidase
FT                   assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14379"
FT                   /db_xref="GOA:D5WAS6"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAS6"
FT                   /inference="protein motif:PFAM:PF04442"
FT                   /protein_id="ADG14379.1"
FT                   /translation="MSTQPPAEADRSFNRSMLIKLFVVALMMFGFGFALVPMYRAICQI
FT                   TGVNNLVQRDVSAREAKNTQVDMSRTISIEFDANARGLLGFKPEQRSLDVHPGEVTTVM
FT                   YDVSNEQSRTIRAQAIPSYAPKQATEYFRKIECFCFTQQTLNANETKRMPVVFVVDPKL
FT                   PKDVKTITLSYTFFELNTPAAGNADDAVPKTNAVNAVATPAKPA"
FT   gene            299827..300036
FT                   /locus_tag="BC1002_0273"
FT   CDS_pept        299827..300036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4168 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14380"
FT                   /db_xref="GOA:D5WAS7"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAS7"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4168"
FT                   /protein_id="ADG14380.1"
FT                   /translation="MNDNGGSPRKSSFGQSMRAVFWSFFGVRKRRDLEADATQLNPLHV
FT                   IVAALIGAAILIGVLILVVRLVVG"
FT   gene            300162..301019
FT                   /locus_tag="BC1002_0274"
FT   CDS_pept        300162..301019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0274"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: bxe:Bxe_A4167 putative cytochrome c oxidase,
FT                   subunit III; PFAM: cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14381"
FT                   /db_xref="GOA:D5WAS8"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAS8"
FT                   /inference="protein motif:PRIAM:1.9.3.1"
FT                   /protein_id="ADG14381.1"
FT                   /translation="MSGQNESPYYFVPHPSRHPISAATGLLVMLGSLAAWINDHTWAPL
FT                   GVLIGLLWLLFTLWHWFGDAIAESEGGMYGKNVDRSYRWSMSWFIFSEVMFFGAFFGAL
FT                   FYAREIAMHQLGSLDFKLIWPDFTAVWPNNGPAELVGTYKSMQPWPVPTINTALLLSSG
FT                   ATLTVSHHALRDNHRKKAIAWLAATLVLGVCFLFLQGFEYFHAYNELNLTLASGIYGST
FT                   FFLLTGFHGFHVFLGGTMLAVVLVRLIRGHFTAEHHFAFEGAAWYWHFVDVVWLGLYVV
FT                   VYWL"
FT   gene            complement(301211..301420)
FT                   /locus_tag="BC1002_0275"
FT   CDS_pept        complement(301211..301420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14382"
FT                   /db_xref="GOA:D5WAS9"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAS9"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0550"
FT                   /protein_id="ADG14382.1"
FT                   /translation="MHIIVPIAFALIIASMVSALYFMMHDKGKTKRMVWSLATRVGLSI
FT                   SLFLFILFAHWMGWIQSTGIPYGR"
FT   sig_peptide     complement(301361..301420)
FT                   /locus_tag="BC1002_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.601) with cleavage site probability 0.585 at
FT                   residue 20"
FT   gene            301532..302248
FT                   /locus_tag="BC1002_0276"
FT   CDS_pept        301532..302248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0276"
FT                   /product="Surfeit locus 1 family protein"
FT                   /note="PFAM: Surfeit locus 1 family protein; KEGG:
FT                   bpy:Bphyt_0551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14383"
FT                   /db_xref="GOA:D5WAT0"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAT0"
FT                   /inference="protein motif:PFAM:PF02104"
FT                   /protein_id="ADG14383.1"
FT                   /translation="MKFRLIPVLLILLVVVVAGRLGFWQRDRAHQKEALEARITQFENA
FT                   PALPVSAAPLALKDVEFHRVKARGSFVADKVVYLDNRPYNDQPGFYVVMPFRLADGGYV
FT                   LVNRGWLPRNLSNRETIAPYATPSGEVEIEGIARADASRAFELGEGGSAAHHLIRQNLD
FT                   VAAYAAETGLPLQSFVIQQIGDVRDGLVRDWPAPTTGVERNYGYMLQWWGMAAAALAFG
FT                   LYAARRAGKKEHAPGA"
FT   gene            302300..302974
FT                   /locus_tag="BC1002_0277"
FT   CDS_pept        302300..302974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14384"
FT                   /db_xref="GOA:D5WAT1"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAT1"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4164"
FT                   /protein_id="ADG14384.1"
FT                   /translation="MSTQTPRSPEVGKSTGKPAAARPMPGQPNGPGSWRRGRWVLLLLA
FT                   VICAAPIAISYFMYYVVKPTGGSTNYGALIDPQRPIPESLVVTGEDGKPLKLASLHGRW
FT                   LMISVDNSACDKACVTKLYFMRQIRAAQGPERERVVEVWLRTDADKVADVIQTAYPNTD
FT                   MLIADPAQVAAWLPADTGTQITDHIYLVDPNGNLMMRFPKNANPSKIKGDLTKLLKWST
FT                   IG"
FT   gene            302997..304106
FT                   /locus_tag="BC1002_0278"
FT   CDS_pept        302997..304106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0278"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG:
FT                   bxe:Bxe_A4163 putative cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14385"
FT                   /db_xref="GOA:D5WAT2"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAT2"
FT                   /inference="protein motif:PFAM:PF02628"
FT                   /protein_id="ADG14385.1"
FT                   /translation="MFVLQLGLIGLCIALLPLSYVWVKADDNKFRKLVWLTTFLTLDLV
FT                   MFGGFTRLTDSGLGCPDWPGCYGTSSPFIAHAAISAAYQAMPSGPVSMTKAWIEMIHRY
FT                   FAMAIGVLIIAQTIIAWTARIKRRPLHVSPWWPTSLLLLIVVQGAFGAWTVTMKLQPII
FT                   VTTHLLLGLALLGTLGWLATRLTPLPAYEPEAARWRAAALAGLALLVLQIALGGWVSTN
FT                   YAVLACTDFPTCNGQWIPPMDFAHGFHLWRALGMTGDGDVITQEALVAIHWTHRTFAFA
FT                   VIAYLVWFAVKMRRFESLRRPANGVLLVVLIQFVTGLSNIVLQWPLPIAVAHNGGAAIL
FT                   LLLLVMLNFRIAYSRPGRAAIPAREAAPA"
FT   gene            304112..305017
FT                   /locus_tag="BC1002_0279"
FT   CDS_pept        304112..305017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0279"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="KEGG: bpy:Bphyt_0554 protoheme IX
FT                   farnesyltransferase; TIGRFAM: protoheme IX
FT                   farnesyltransferase; PFAM: UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14386"
FT                   /db_xref="GOA:D5WAT3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAT3"
FT                   /inference="protein motif:TFAM:TIGR01473"
FT                   /protein_id="ADG14386.1"
FT                   /translation="MDSTTLSQSPGSRVSQYLALTKPRVTQLAVFCAVIGMFLSTPGMV
FT                   PWTVLIGGTVGIWLLAGAAFAINCLVEQQIDAKMRRTSWRPSARGEITTPQILLFSAVL
FT                   GGLGMWTLYTFANPLTMWLTLATFVGYAVIYTLLLKPATPQNIVIGGASGAMPPALGWA
FT                   AVTGHVPGDAWILVLIIFVWTPPHFWALALYRRKDYENAGLPMLPNTHGEKYTRLHILL
FT                   YTVILFAVTLMPFISGMSGVVYLASAVLLGAVFLAYAWKIYREYSDELARKTFRYSIVY
FT                   LSLLFAALLIDHYARVVIGA"
FT   gene            305022..305651
FT                   /locus_tag="BC1002_0280"
FT   CDS_pept        305022..305651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0280"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: electron transport protein SCO1/SenC; KEGG:
FT                   bpy:Bphyt_0555 electron transport protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14387"
FT                   /db_xref="GOA:D5WAT4"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAT4"
FT                   /inference="protein motif:PFAM:PF02630"
FT                   /protein_id="ADG14387.1"
FT                   /translation="MLNNRFARVARAAVIACALGAALGGTLLMTGCGKQPPAFTNLDIT
FT                   GNTQFASDFSLPDTSGKIRTLADYKGKVVVLFFGYTHCPDVCPTTMAELSQALQQLGPE
FT                   DAKRVQVLFVTLDPERDTPQLLAQYVPAFNPSFVGLRPASEEQLAKLAKDFRVYYAKVP
FT                   GKTPDSYTMDHTAASYVFDTDGKLRLFARDGQGATPWVHDFKLLLD"
FT   sig_peptide     305022..305096
FT                   /locus_tag="BC1002_0280"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.733 at
FT                   residue 25"
FT   gene            complement(305727..306017)
FT                   /locus_tag="BC1002_0281"
FT   CDS_pept        complement(305727..306017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0281"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: bpy:Bphyt_0556
FT                   YCII-related"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14388"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAT5"
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /protein_id="ADG14388.1"
FT                   /translation="MYVINLTYTAPLDRIDDALDAHRAFLAKQFDAGIFVAAGPKVPRD
FT                   GGIILAVRIERDRLDRILASDPFAEQQLARYEVTEFKATRIAPGLNLPTPV"
FT   gene            306290..307102
FT                   /locus_tag="BC1002_0282"
FT   CDS_pept        306290..307102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0282"
FT                   /product="lipoprotein, YaeC family"
FT                   /note="KEGG: bpy:Bphyt_0558 lipoprotein, YaeC family;
FT                   TIGRFAM: lipoprotein, YaeC family; PFAM: NLPA lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14389"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAT6"
FT                   /inference="protein motif:TFAM:TIGR00363"
FT                   /protein_id="ADG14389.1"
FT                   /translation="MQRRNILKALTAVVAGTAILTSFAAHADDKVIKVGTIGGPDAQIW
FT                   EVVTKVAKREGLNVKVVEFNDYIQPNAALDAGDLDANSFQHQPYLDSQIKQRGYKLVNA
FT                   GLTYISPLGAYSKKLKSLKDLPQGAKVAVPNDPSNENRALLLLQAQGLIKLKDGAATGG
FT                   NNATPLDVVDNPKKIKFVELDAAQLPRSLADVDAAVINTNFALAAGLQPTKDAIALEDI
FT                   HSPYANLIAVRAKDKDQPWVKKLAAAYQSEDVRQFIKTQFKGSMVPSF"
FT   sig_peptide     306290..306373
FT                   /locus_tag="BC1002_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            complement(307179..308105)
FT                   /locus_tag="BC1002_0283"
FT   CDS_pept        complement(307179..308105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0283"
FT                   /product="transcriptional regulator, MarR family with
FT                   acetyltransferase activity"
FT                   /note="KEGG: bpy:Bphyt_0559 transcriptional regulator, MarR
FT                   family with acetyltransferase activity; PFAM: GCN5-related
FT                   N-acetyltransferase; regulatory protein MarR; SMART:
FT                   regulatory protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14390"
FT                   /db_xref="GOA:D5WAT7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAT7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG14390.1"
FT                   /translation="MTDSEALRRAQAVRHFNRFYTQSIGALHEHLARSEFSLTEVRVLH
FT                   ELSRARAQTASMLGRALGLDSGYLSRLLTSFERRDLISRRPSDTDARQSLIELTEHGHA
FT                   TYAPLDAAAIHEALGLLDKLSALSQEQLIAAMKLIERLLGDKPKHKLVVLRQPRAGECG
FT                   WLVYRQAQWFAAQYGWDHTFEGLLARVVAEYAQRNDPLREKCWIAEQEGLVVGSVCLVG
FT                   VSTTVAGIRLLWVEPDVRRLGIGTQLISECVRFARRAGYTKLTLTTASALTEPRRLCER
FT                   AGFKLADSTTQRRFGHDLMIERWELEL"
FT   gene            308473..309207
FT                   /locus_tag="BC1002_0284"
FT   CDS_pept        308473..309207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0284"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: bxe:Bxe_A4156 GntR family transcriptional
FT                   regulator; PFAM: UbiC transcription regulator-associated
FT                   domain protein; regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14391"
FT                   /db_xref="GOA:D5WAT8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAT8"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ADG14391.1"
FT                   /translation="METRWSALMPDVRNVTPLYLQLARNLATAIHCGVWSAGEALPSER
FT                   TLSDAIGVSRITARKAIELLVEQGLIRRSRGAGSFITPRVEDPLSRLTGFTKKMQQRGF
FT                   RPDSVWLERDVRAANRDELLHLGLSPGAAVASLRRLRRADGIVMAVEHSALPVAIVPDP
FT                   LVIGDSLYSYLEQRGAAVVRALQHFRAVNASSEIAALMDIEPRTALLVITRIGYSADQR
FT                   AIELTDTYCRDDYYDFVAELRT"
FT   gene            309283..310386
FT                   /locus_tag="BC1002_0285"
FT   CDS_pept        309283..310386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0285"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="TIGRFAM: N-acetylglucosamine-6-phosphate
FT                   deacetylase; KEGG: bxe:Bxe_A4155 N-acetylglucosamine
FT                   6-phosphate deacetylase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14392"
FT                   /db_xref="GOA:D5WAT9"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAT9"
FT                   /inference="protein motif:TFAM:TIGR00221"
FT                   /protein_id="ADG14392.1"
FT                   /translation="MLTGNILTTEGWIHGTLEYENGRITALSGERVDPSTNDAPYILPG
FT                   FIDLHVHGGGGADVMEGGDAIETITRTHARYGTTSLLATTMTAPRHELMNVVAGLGNVT
FT                   RLRTPGCARVLGVHLEGPYINPGKLGAQPDAAVSAVLDEVLKYLSIAPIRVVTLAPEIA
FT                   GHMEIISEMAARGVRVQLGHSLGTYDDAVAALKHGACGFTHLFNAMSPLHHRNPGLVGA
FT                   ALAHAEYAEIIPDLLHVHPGAIRTALRAIPRLYVVTDSTSATGMPDGEYRLGSQHVTKC
FT                   LGGVRLADGTLAGSTLTMDQALRNLVSIGLPIADVSHRLSRYAADYLGIEDRGRIARGA
FT                   WADVVVFDRELALSATYVEGEAIVEYA"
FT   gene            310370..311386
FT                   /locus_tag="BC1002_0286"
FT   CDS_pept        310370..311386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0286"
FT                   /product="Glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="KEGG: bpy:Bphyt_0562 glutamine--fructose-6-phosphate
FT                   transaminase (isomerizing); PFAM: sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14393"
FT                   /db_xref="GOA:D5WAU0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAU0"
FT                   /inference="protein motif:PRIAM:2.6.1.16"
FT                   /protein_id="ADG14393.1"
FT                   /translation="MSNMLKEALASAATVAGQLKDTSRVAALAAKLAQQPRHVALTVAR
FT                   GSSDHAASYFASLTMSRLGVPVASLPMSVATLQQAPLQVRDQLALAFSQSGKSPDLVGT
FT                   MNALRAAGALTVAAVNAPNSPLADACEWHLPLVAGPELSVAATKSYIAMLSISAQLVAH
FT                   WQNDAELLAGLSTLPDALERAGRLDWSMAVNELRGIERMIVIGRGLGLAIAQEAALKLK
FT                   ETSGIQAEAFSSAEVRHGPMELIDRDYPLLVFAPRGPEQAGLLQLAHDMRARGARVLLA
FT                   APDDVADASLPLVATAHPALDPIAAILSFYVMAADLAAARGRNPDAPRHLNKVTETH"
FT   gene            311398..313995
FT                   /locus_tag="BC1002_0287"
FT   CDS_pept        311398..313995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0287"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="KEGG: bpy:Bphyt_0563 phosphoenolpyruvate-protein
FT                   phosphotransferase; TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PTS system, glucose subfamily, IIA
FT                   subunit; phosphocarrier, HPr family; PFAM: PEP-utilizing
FT                   protein; sugar-specific permease EIIA 1 domain; phosphoryl
FT                   transfer system HPr; PEP-utilising protein domain protein;
FT                   PEP-utilising protein mobile region"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14394"
FT                   /db_xref="GOA:D5WAU1"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAU1"
FT                   /inference="protein motif:TFAM:TIGR01417"
FT                   /protein_id="ADG14394.1"
FT                   /translation="MRRVEKSNLMSHSEDHIVLLAPLTGPVVPLAKVPDPVFAGGMFGD
FT                   GIGVDPLEGRLVAPCDGVVTHLARTGHAVTLESAEGAQILLHIGIETVGLNGKGFAPMV
FT                   AQGTQVRAGDVLIEFDQDQVALNAPSLVSVVAIANSEAFEVIERAPNGHAKAGETPLLV
FT                   LRARDGVSHDAVREACAAQMMDEARRQITLTHAGGLHARPAARAREAARGFDARVEVRY
FT                   DGRKAPIESVVGLLGLGAGEGASVELLGVGPQAQAAVDAIAHELTREAHGEVEQKREQK
FT                   PAAAPTTVVAVPATGEPLMPNTLAGVCAAPGVAVGKLVRWDDADVDPPEQASGTSAAES
FT                   RLLDNAIATVDADLDTIVRDASQRGSVGEAGIFAVHRVLLEDPTLLDAARDLISLGKSA
FT                   GFAWREAIRAQIDILSNVEDALLAERAADLRDIEKRVQRALGYTSSAHRTLPDEAVLAA
FT                   DEFTPSDLSSLDRTRVTALVMARGGATSHAAILARQAGIPALVAVGDALHAIPEGTQVV
FT                   VNASTGRLEFAPTELDVERARRERSRLADVREANRRTSQQAAATADGRAIEVAANIATL
FT                   DDANAAVDNGADSVGLLRTELLFIHRPAAPSADEHRHSYQAIVDALRGRTAIIRTLDVG
FT                   ADKEVDYLTLPPEPNPALGLRGVRLAQVRPDLLDDQLRGLLAVRPIGAVRILLPMVTDA
FT                   GELIRIRKRIDELAREAGSTEPVEVGVMIEVPSAALLADQLAQHADFLSIGTNDLTQYT
FT                   LAMDRCQPDLAAQADGLHPAVLRLIAATVEGAARHGKWVGVCGALAGDPLAMPLLVGLG
FT                   VTELSVDPVSVPGIKARVRTLDYQLCRQRARDALALDSAQAVRAASRATWPLD"
FT   gene            314127..315938
FT                   /locus_tag="BC1002_0288"
FT   CDS_pept        314127..315938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0288"
FT                   /product="PTS system, N-acetylglucosamine-specific IIBC
FT                   subunit"
FT                   /note="KEGG: bxe:Bxe_A4152 PTS system,
FT                   N-acetylglucosamine-specific IIBC component; TIGRFAM: PTS
FT                   system, N-acetylglucosamine-specific IIBC subunit; PTS
FT                   system, glucose-like IIB subunint; PFAM: phosphotransferase
FT                   system EIIC; Phosphotransferase system EIIB/cysteine,
FT                   phosphorylation site"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14395"
FT                   /db_xref="GOA:D5WAU2"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAU2"
FT                   /inference="protein motif:TFAM:TIGR01998"
FT                   /protein_id="ADG14395.1"
FT                   /translation="MDANPFLKIQRLGRALMLPIAVLPVAGLLLRLGQPDVFNIKMIAD
FT                   AGGAIFDNLPLLFAIGVAVGFAKDNNGVAGLAGAIGYLVQIAVMKDINDKLNMGVLSGI
FT                   IAGIVAGLLYNRYKDIKLPDYLAFFGGKRFVPIVTGVVCVVLGIIFGHVWAPVQSAIDL
FT                   AGHWLTTAGALGAFVFGVLNRLLLVTGLHHILNSLTWFVFGSFTPAGGAPVTGDLHRFF
FT                   AGDPTAGTFMTGFFPVMMFGLPAACLAMFHEVPKERRAVAGGLLFSMALTSFLTGVTEP
FT                   IEFSFMFLAPVLYAIHALLTGLSLAICSALGIHLGFTFSAGFIDYVLNFGLSTKGWWAI
FT                   PLGIVYSVVYYGLFRFFIRKFNMATPGREPAAAEEQVESFAAGGFVAPAAGAAVPRAQR
FT                   YIAALGGAANLSVVDACTTRLRLSVVDADKVSESELKSIGARGVLKRGANNVQVIIGPE
FT                   ADIIADEMRTAIAQGQGDAVKVASAASAPAAAAPATAAAPVARNAGHTDDAQGGPLDPD
FT                   PLRWLAVFGGAGNVVSLDAVAATRLRMVVRDPSAVDRQRLATLDTAWVSTDTFHVVVGE
FT                   AAQRYAQKLAERLSSQGGGAGATPVPA"
FT   gene            complement(316030..316146)
FT                   /locus_tag="BC1002_0289"
FT   CDS_pept        complement(316030..316146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0289"
FT                   /product="cyd operon protein YbgT"
FT                   /note="KEGG: bpy:Bphyt_0566 cyd operon protein YbgT;
FT                   TIGRFAM: cyd operon protein YbgT; PFAM: membrane bound YbgT
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14396"
FT                   /db_xref="GOA:D5WAU3"
FT                   /db_xref="InterPro:IPR011724"
FT                   /db_xref="InterPro:IPR012994"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAU3"
FT                   /inference="protein motif:TFAM:TIGR02106"
FT                   /protein_id="ADG14396.1"
FT                   /translation="MWYFSWILGIGVALAFGVVNVMWLESRELARSARRGPR"
FT   gene            complement(316190..317326)
FT                   /locus_tag="BC1002_0290"
FT   CDS_pept        complement(316190..317326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0290"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /note="KEGG: bpy:Bphyt_0567 cytochrome d ubiquinol oxidase,
FT                   subunit II; TIGRFAM: cytochrome d ubiquinol oxidase,
FT                   subunit II; PFAM: cytochrome bd ubiquinol oxidase subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14397"
FT                   /db_xref="GOA:D5WAU4"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAU4"
FT                   /inference="protein motif:TFAM:TIGR00203"
FT                   /protein_id="ADG14397.1"
FT                   /translation="MDYAALKLIWWVLIGVLLIGFALTDGFDMGAAILLPFIAKTDSER
FT                   RIVVNTVGATWEGNQVWFVTAGGAMFAAWPLAYAASFSGFYFAMLLVLFALFFRPVGFD
FT                   YRGKREDPRWRNAWDWGLFIGGFVPALVFGIAFGNLLQGVPFSFDTDLRVTYHGSFFGL
FT                   LNPFALLTGLVSVSMLAAHGASFVKWKTDGVVHERASKALRLAALCAVVLFLIAGAFVA
FT                   TMIGGYQIVDMPPLDAVSNPLMKTVIGAPGLWLNNYALYPWMAVAPLAGFVGGVLAMLL
FT                   ARSRFEATAFLSTSLMVVGVILTAGFSMFPFIMPSSLDGRSSLTMWDATSSQMTLEIML
FT                   FAVILFLPIILLYTGWVYRVMRGKVTAAAIKENHHSMY"
FT   gene            complement(317360..318952)
FT                   /locus_tag="BC1002_0291"
FT   CDS_pept        complement(317360..318952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0291"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: bpy:Bphyt_0568 cytochrome bd ubiquinol oxidase
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14398"
FT                   /db_xref="GOA:D5WAU5"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAU5"
FT                   /inference="protein motif:PFAM:PF01654"
FT                   /protein_id="ADG14398.1"
FT                   /translation="MPVSEVVELSRLQFAITALYHFLFVPLTLGLAWLLVIMESVYVMT
FT                   GKQIYKDMTQFWGKLFGINFAMGVATGLTLEFQFGTNWAYYSHYVGDIFGVPLAVEGLM
FT                   AFFLESTFVGLFFFGWNRLSKVQHLIVTFCVALGSNLSALWILVANGWMNNPVGARFNY
FT                   QTMRMELDSIGSVIFNPVAQVKFVHTVSAGYVTAAMFVLGVSSWYLLKRRDTEFALRSF
FT                   AIAAGFGLASALCVIVLGDESGYRTGEVQQVKLAAIESEWETAPAPAPFTIFGIPNQKE
FT                   QRTDYAIRVPYALGIIATRSLSEPVVGLRDLIAENEGRIRNGMLAFSALQKLKGGDSSD
FT                   EAHAAFDKYKDDLGYGLLLKQFTPNVTDATPDQIAAAAKRTIPPVLPLFFSFRMMVGLG
FT                   LLFLATFVLAFWFCAQRTLLLEKRRWFLRWAVIAIPLPWLAAELGWIVAEMGRQPWSIA
FT                   GILPTNLAASTLTPRDLYLSIGGFVLFYTGLFVIEIMLMFKYARLGPSSLHTGRYHHEI
FT                   EQQVTQPLSNTAV"
FT   gene            complement(318942..319202)
FT                   /locus_tag="BC1002_0292"
FT   CDS_pept        complement(318942..319202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14399"
FT                   /db_xref="GOA:D5WAU6"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAU6"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0569"
FT                   /protein_id="ADG14399.1"
FT                   /translation="MTIALNRSSTVRSRVRGRFTRWMRGPTLARDIAIILAIKFALLMA
FT                   LKFTFFNHPPAEHMMLPPQQVAQALLSVPAPHPSQGDQHAR"
FT   gene            complement(319618..320553)
FT                   /locus_tag="BC1002_0293"
FT   CDS_pept        complement(319618..320553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0293"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="KEGG: bxe:Bxe_A4146 RNA polymerase factor sigma-32;
FT                   TIGRFAM: RNA polymerase sigma factor RpoH; RNA polymerase
FT                   sigma factor, sigma-70 family; PFAM: sigma-70 region 2
FT                   domain protein; sigma-70 region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14400"
FT                   /db_xref="GOA:D5WAU7"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAU7"
FT                   /inference="protein motif:TFAM:TIGR02392"
FT                   /protein_id="ADG14400.1"
FT                   /translation="MSHAMTLPSSLSPSSAKAAPAGALALSHSSLLPGQLGNIDAYIQA
FT                   VNRIPMLTPAEERKFATELREHDNLEAARRLVLSHLRLVVSIARNYLGYGLPHADLIQE
FT                   GNIGLMKAVKRFDPEQNVRLVSYAMHWIKAEIHEYILRNWRMVKVATTKAQRKLFFNLR
FT                   SHKQGLGAFTPDEIEGLAKELNVKREEVAEMETRLSGGDIALEGQVEDGEESYAPIAYL
FT                   ADSHSEPTAVLASRQRDRLQSDGIASALDALDPRSRRIIEARWLKVADDGSGGSTLHEL
FT                   ADEFGVSAERIRQIEASAMKKMRGALTEYA"
FT   sig_peptide     complement(320497..320553)
FT                   /locus_tag="BC1002_0293"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.972 at
FT                   residue 19"
FT   gene            320908..321471
FT                   /locus_tag="BC1002_0294"
FT   CDS_pept        320908..321471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0294"
FT                   /product="Lipid A 3-O-deacylase-related protein"
FT                   /note="PFAM: Lipid A 3-O-deacylase-related; KEGG:
FT                   bpy:Bphyt_0571 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14401"
FT                   /db_xref="GOA:D5WAU8"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAU8"
FT                   /inference="protein motif:PFAM:PF09411"
FT                   /protein_id="ADG14401.1"
FT                   /translation="MNNKNLVVRGLTLKSALAVLLLGAAGASQADQFGVQVAAGVGDHH
FT                   VKRLDLGVVWDPNLTWWQIGDWHFALIGEAHVAWWHTNEGNVHDDIGEIGVTPVIRFIK
FT                   SSGLVRPFVEVGAGVGLLTSPRISSDFTLGTGFQFAETAGVGLQFGAHQQYVAGYRFQH
FT                   VSNGGIKEPNPGINFSQLYLQYHF"
FT   sig_peptide     320908..321000
FT                   /locus_tag="BC1002_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 31"
FT   gene            321513..321896
FT                   /locus_tag="BC1002_0295"
FT   CDS_pept        321513..321896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14402"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAU9"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4144"
FT                   /protein_id="ADG14402.1"
FT                   /translation="MAAKMIEAIRGLERERFRAMVDGDGQSLDTLLADNVSYVHTNGKR
FT                   ETKRQFIDGITAGRRRYRQIEVQSQEVLPAGRETYVVTGRALIEMEANNGALLFPIAYT
FT                   AIHTHEDGQWRLIAWQATRCALE"
FT   gene            complement(321995..323080)
FT                   /locus_tag="BC1002_0296"
FT   CDS_pept        complement(321995..323080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0296"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   bpy:Bphyt_0573 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14403"
FT                   /db_xref="GOA:D5WAV0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAV0"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ADG14403.1"
FT                   /translation="MLRNPAEKYRPFRAVRLTGRKWPSRTIDAAPVWMSTDLRDGNQAL
FT                   IEPMNAAQKLEYFEMLVAIGFKEIEVGFPSASQTDFDFVRKLIDERRIPDDVTIEVFVP
FT                   SRAELIARTFDALEGAPRAIVHLYNAICPSFRRIVFQQSKDEIKALAVEGTRIIKEYAQ
FT                   ARPGTRWTFQYSPETFNTTELPFAREVCDAVAQTWRPTRNNKMIVNLPASVEAATPNVF
FT                   ADQIEWMHRNLGYRDSIVLSVHPHNDRGTAVAAAQLALMAGADRIEGCLFGNGERTGNV
FT                   DLVTLAMNLDAMGIDSGLDFPDLAAIRRVAERCTRLPVAARHPYAGEVAMRGTRTARDA
FT                   DADGDQCGASSRDRAEDCVTA"
FT   gene            complement(323458..324633)
FT                   /locus_tag="BC1002_0297"
FT   CDS_pept        complement(323458..324633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0297"
FT                   /product="Glycosyl transferase, family 3-like protein"
FT                   /note="PFAM: Glycosyl transferase, family 3-like; KEGG:
FT                   bxe:Bxe_A4143 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14404"
FT                   /db_xref="GOA:D5WAV1"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:D5WAV1"
FT                   /inference="protein motif:PFAM:PF02885"
FT                   /protein_id="ADG14404.1"
FT                   /translation="MGAAEAARNIECNARHGAGACPAGRRASPRACFAAVRPLAIDAIL
FT                   TPNSSPNAVADAQARRATRLLRMMTDSTNTTSPFPCARFIKEIGRGPNGARALTADDTR
FT                   ALYTAMLDGRVDDLELGAVLLAYRVKGETADELAAMLAAAHTSFEPVRLPHGAFRPVSI
FT                   PSYNGARKQPNLVPLLALLLAREGVPVLVHGVTEDPGRVTSAEIFTHLRIAQARSHAQI
FT                   EAGLAERRVAFASIDVLAPKLARLLALRRRMGVRNSTHTLVKLLQPFAPAGLRLVNYTH
FT                   PPYRDSLTQLFISHPDAAVGGALLARGTEGEAVADTRRQVQVDWLHDGICETRLPHERS
FT                   SADAPEVELPEARDAATTAAWIDAVLRGEAPVPGAIERQVELIVDIAKTAA"
FT   gene            324652..325350
FT                   /locus_tag="BC1002_0298"
FT   CDS_pept        324652..325350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0298"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bxe:Bxe_A4142 putative fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14405"
FT                   /db_xref="GOA:D5WB76"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB76"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ADG14405.1"
FT                   /translation="MSYVFAPAPQVAVPVVGSSEQFAVRRIYCVGRNYEAHAREMGHDP
FT                   DREPPFFFSKPADAVVYVAPGTTGEFPYPSQTKNVHFEMEMVAAIGEGGKDIPVERALD
FT                   HVYGYALGLDMTRRDLQGEAKKMGRPWDTAKGFDHSAPLGPIHPASVVGHIGEGAIWLS
FT                   VNGEDKQRADVSQLIWSVAETIAYLSTLFELRPGDLIFTGTPEGVGAVVKGDLMKGGVD
FT                   GLGEFSVRVV"
FT   gene            325385..326029
FT                   /locus_tag="BC1002_0299"
FT   CDS_pept        325385..326029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0299"
FT                   /product="maleylacetoacetate isomerase"
FT                   /EC_number="5.2.1.2"
FT                   /note="TIGRFAM: maleylacetoacetate isomerase; KEGG:
FT                   bpy:Bphyt_0577 maleylacetoacetate isomerase; PFAM:
FT                   Glutathione S-transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14406"
FT                   /db_xref="GOA:D5WB77"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034330"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB77"
FT                   /inference="protein motif:TFAM:TIGR01262"
FT                   /protein_id="ADG14406.1"
FT                   /translation="MKLYSYFRSSASYRVRIALNVKNLSYDYVPVHLVREGGEQLKPEY
FT                   RKINPDGIVPTLADGSHLLPQSLAIIEYLEETHPEPPLLPKAPLDRAYVRSLALQVACE
FT                   IHPLNNLRVLRYLKHTLRVDDDAKDAWYRHWIDAGFTTLETHLAGDARTGKLCFGDTPT
FT                   LADACLIPQVFNAQRFKVDTAKFPTIQRICDYAMQLDAFARAAPGAQPDAE"
FT   gene            complement(326140..327294)
FT                   /locus_tag="BC1002_0300"
FT   CDS_pept        complement(326140..327294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0300"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="TIGRFAM: signal recognition particle-docking protein
FT                   FtsY; PFAM: GTP-binding signal recognition particle SRP54
FT                   G- domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; KEGG: bpy:Bphyt_0578 signal recognition
FT                   particle-docking protein FtsY; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14407"
FT                   /db_xref="GOA:D5WB78"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB78"
FT                   /inference="protein motif:TFAM:TIGR00064"
FT                   /protein_id="ADG14407.1"
FT                   /translation="MFSFFKRFKGSKESDTAADESLAAQDGATPEAEAVEPVAPAEPVA
FT                   PAAPSVPPVATTIIEPQPEPQDTALDSVEIVPPPVQDAGAKRSWLTRLKSGLAKTSSNL
FT                   TGIFVGTKIDEDLYEELETALLMSDAGVEATEFLLESLREKVRSERLTDPQQVKTALRT
FT                   LLVELLKPLEKSLMLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFHQSVLLAAGDTF
FT                   RAAAREQLAVWGQRNNVTVVAQESGDPAAVIFDAVGAARARNIDVMMADTAGRLPTQLH
FT                   LMEELRKVKRVIGKAQDGAPHEVLLVIDANTGQNALTQVKAFDDALGLTGLIVTKLDGT
FT                   AKGGILAAIARQRPIPVYFIGVGEKVDDLQPFSAEEFSDALLGG"
FT   gene            327546..328160
FT                   /locus_tag="BC1002_0301"
FT   CDS_pept        327546..328160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0301"
FT                   /product="methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /note="TIGRFAM: methyltransferase; KEGG: bxe:Bxe_A4139
FT                   hypothetical protein; PFAM: Protein of unknown function
FT                   methylase putative"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14408"
FT                   /db_xref="GOA:D5WB79"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB79"
FT                   /inference="protein motif:TFAM:TIGR00095"
FT                   /protein_id="ADG14408.1"
FT                   /translation="MPRLAPSRAAGASSKGGKPHAIRIIGGDWKRTPLPVLDLDGLRPT
FT                   PDRVRETLFNWLGQRLDGQHCLDLFAGSGALGFEAASRGAARVLMVERHARAAGQLRTN
FT                   QQRLDARMIEIAEADGLRLAASLAPGSFDVVFLDPPFDADLLGKALAVAVPLVRADGYL
FT                   YVEAGEALEPTAHEPLAGWEVVRQGKAGAVHFHLLQRENKE"
FT   gene            328261..328770
FT                   /locus_tag="BC1002_0302"
FT   CDS_pept        328261..328770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0302"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="TIGRFAM: pantetheine-phosphate adenylyltransferase;
FT                   cytidyltransferase-related domain protein; KEGG:
FT                   bpy:Bphyt_0580 phosphopantetheine adenylyltransferase;
FT                   PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14409"
FT                   /db_xref="GOA:D5WB80"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB80"
FT                   /inference="protein motif:TFAM:TIGR01510"
FT                   /protein_id="ADG14409.1"
FT                   /translation="MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFF
FT                   TLQERLAIAHEVLGHYPNVQVMSFKGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGM
FT                   NRYLLPDVETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLKEKVASLDPQ
FT                   GGAQGT"
FT   gene            complement(328828..329175)
FT                   /locus_tag="BC1002_0303"
FT   CDS_pept        complement(328828..329175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmj:BMULJ_00429 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14410"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB81"
FT                   /inference="similar to AA sequence:KEGG:BMULJ_00429"
FT                   /protein_id="ADG14410.1"
FT                   /translation="MTRPADIYLRFLQLTEALRGLPSLPALDPLEEKILEFVARMRQKN
FT                   ERLSVREMMAQSALGSPATLHARITSMREKGWLLLNDTEDARRKQVELTPAALRHFDKL
FT                   AEAFTKAAKGS"
FT   gene            complement(329336..329929)
FT                   /locus_tag="BC1002_0304"
FT   CDS_pept        complement(329336..329929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0304"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_5362 putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14411"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB82"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14411.1"
FT                   /translation="MNLREQAGTERANRPNRWASARRPVSCAPAPWLACYSVFQDALLG
FT                   SETTLGALPDFVSRAVLERLGDSNYSRVPSSALDEIRASYLELRSTRVAEEVRRYLSDT
FT                   EDSLPASRESSDALEILAAGTPRILVPPVARPPCLLSSGEGIFLGGWARFVAYWCRKDP
FT                   TIPLLAVDWPILYEHVAPYGLRHLIDDHRVIRTP"
FT   gene            330158..330787
FT                   /locus_tag="BC1002_0305"
FT   CDS_pept        330158..330787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmj:BMULJ_02753 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14412"
FT                   /db_xref="GOA:D5WB83"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB83"
FT                   /inference="similar to AA sequence:KEGG:BMULJ_02753"
FT                   /protein_id="ADG14412.1"
FT                   /translation="MSSLRLHFWSIAGTVVAFLVSLWINQEVFAHTSFVRGVNWIFLPS
FT                   GVRLLSTLLLGFDGAIGLLLAGLVTDFLYWFPHDPVRATAGALLGSLAPYLVYRFALEY
FT                   YDLRASLMNLTPKRLLVLAVAYSVANPLFHHLWFALTGTTKNWFESFFTMFVGDLTGAL
FT                   IMLYVMKGLLALLPKQPGNSRMSNGMFSIQLALNSAYANQLATKPT"
FT   gene            330890..331147
FT                   /locus_tag="BC1002_0306"
FT   CDS_pept        330890..331147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0306"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: bpy:Bphyt_0581 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14413"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB84"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADG14413.1"
FT                   /translation="MALMITDECINCDVCEPECPNDAISMGPEIYVIDPKKCTECVGHF
FT                   DEPQCIQVCPVECIPRDPNHPETREGLMAKYHALQAAKGT"
FT   gene            complement(331223..332302)
FT                   /locus_tag="BC1002_0307"
FT   CDS_pept        complement(331223..332302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0307"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="KEGG: bpy:Bphyt_0582 histidinol-phosphate
FT                   aminotransferase; TIGRFAM: histidinol-phosphate
FT                   aminotransferase; PFAM: aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14414"
FT                   /db_xref="GOA:D5WB85"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB85"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ADG14414.1"
FT                   /translation="MSRYWSDIVHRLTPYVPGEQPALAHPVKLNTNENPYPPSPRVLDA
FT                   IRRELGDTADALRRYPDPSARKLRETVAAYHGIRADQVFAGNGSDEVLALTFQALLKHD
FT                   KPLLFPDITYSFYPTYAKLFEVDYRTVPLDESFAINVDDYTVPNGAILFPNPNAPTGRP
FT                   LPLAEIERLLASHPDSVVVIDEAYVDFGAESAIALIDRYPNLLVVQTVSKSRSLAGMRV
FT                   GFAFGDAALIDALNRVKDSFNSYPLDRLAQAAATAAYEDDAWFRECCAKVIASRERLAA
FT                   ELTALGFEVVPSAANLLFARHQGYDAATLASRLREKEIFVRHFNAPRIDQHLRISVGTD
FT                   TECDVLLDALRGIFSAYVG"
FT   gene            complement(332353..332958)
FT                   /locus_tag="BC1002_0308"
FT   CDS_pept        complement(332353..332958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0308"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="TIGRFAM: peptidyl-tRNA hydrolase; KEGG:
FT                   bxe:Bxe_A4135 peptidyl-tRNA hydrolase; PFAM: peptidyl-tRNA
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14415"
FT                   /db_xref="GOA:D5WB86"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB86"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ADG14415.1"
FT                   /translation="MIKLIVGLGNPGAEYTATRHNAGCWLVDQLAREAGTTLRDERRFH
FT                   GFYAKARLHGEEVHLLQPQTYMNRSGQSVVALAQFFKILPDEILVAHDELDMPPGSVKL
FT                   KLGGGSGGHNGLKDISAHLSSQQYWRLRIGIGHPRDLIPESARAGAKPDVANYVLKPPR
FT                   REEQEVIDASIERALAVMPQIIKGELERAMMQLHRNNS"
FT   gene            complement(333103..333720)
FT                   /locus_tag="BC1002_0309"
FT   CDS_pept        complement(333103..333720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0309"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="KEGG: bxe:Bxe_A4134 50S ribosomal protein
FT                   L25/general stress protein Ctc; TIGRFAM: ribosomal 5S rRNA
FT                   E-loop binding protein Ctc/L25/TL5; PFAM: Ribosomal protein
FT                   L25-like"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14416"
FT                   /db_xref="GOA:D5WB87"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB87"
FT                   /inference="protein motif:TFAM:TIGR00731"
FT                   /protein_id="ADG14416.1"
FT                   /translation="MKVVAFERSQQGTGASRRLRNSGKTPGIVYGAGADTQLIELDHNA
FT                   LWHALKKEVFHSSILDLEVAGKSQQVLLRDVQYHPFRQLVLHVDFQRVDASKKLHTKVP
FT                   LHFLNQETNPAVKLSSAVISHVINEIEIECLPSALPEFIEVDLAKIEAGQSVHAKDIPL
FT                   PAGVALVAHVDAENPVVAAATIPAGAIAEDAAAAEGGETPAA"
FT   gene            complement(333884..334840)
FT                   /locus_tag="BC1002_0310"
FT   CDS_pept        complement(333884..334840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0310"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="TIGRFAM: ribose-phosphate pyrophosphokinase; KEGG:
FT                   bxe:Bxe_A4133 ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14417"
FT                   /db_xref="GOA:D5WB88"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB88"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ADG14417.1"
FT                   /translation="MSSHDGLMVFTGNANPALAQEVVKNLGIPLGKAMVSRFSDGEIQV
FT                   EIQENVRGKDVFVLQSTCAPTNDNLMELMIMVDALKRASAGRITAAIPYFGYARQDRRP
FT                   RSARVAISAKVVANMLEIAGVERIITMDLHADQIQGFFDIPVDNIYATPVLLGDLRKQN
FT                   YDNLMVVSPDVGGVVRARALAKQLNCDLAIIDKRRPKANVAEVMNIIGEVEGRTCVIMD
FT                   DMVDTAGTLCKAAQVLKERGAKQVFAYATHPVLSGGAGERIAASALDELVVTDTIPLGE
FT                   EARSCAKIRSLTSAGLLAETFSRIRRGDSVMSLFAES"
FT   gene            complement(334914..334990)
FT                   /locus_tag="BC1002_R0005"
FT                   /note="tRNA-Gln1"
FT   tRNA            complement(334914..334990)
FT                   /locus_tag="BC1002_R0005"
FT                   /product="tRNA-Gln"
FT   gene            complement(335043..335924)
FT                   /locus_tag="BC1002_0311"
FT   CDS_pept        complement(335043..335924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0311"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; KEGG: bxe:Bxe_A4132
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14418"
FT                   /db_xref="GOA:D5WB89"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB89"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ADG14418.1"
FT                   /translation="MIETTDSLRDCLAPAKLNLFLHITGRRPDGYHTLQTVFQLLDWGD
FT                   TLHFTRRDDGLITRRTEIASVPPEHDLTVRAATLLKSHTGSREGVDIEIDKRLPMGAGL
FT                   GGGSSDAATTLLALNRLWKLDLPRQELQELALKLGADVPFFVFGKNAFAEGVGESLDVV
FT                   QLPPRHFLVVTPRVQVPTAAIFSEKALTRDTKPLIITDFPAERSCNTEWPESFGRNDMQ
FT                   QVVIGKYAEVAQVLRWFENVAPARMSGSGASVFAAFRSKAEAEAAQAKLPGEWNSAVAA
FT                   GLDQHPLFAFAS"
FT   gene            complement(336014..336646)
FT                   /locus_tag="BC1002_0312"
FT   CDS_pept        complement(336014..336646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0312"
FT                   /product="outer membrane lipoprotein LolB"
FT                   /note="KEGG: bpy:Bphyt_0587 outer membrane lipoprotein
FT                   LolB; TIGRFAM: outer membrane lipoprotein LolB; PFAM: outer
FT                   membrane lipoprotein LolB"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14419"
FT                   /db_xref="GOA:D5WB90"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB90"
FT                   /inference="protein motif:TFAM:TIGR00548"
FT                   /protein_id="ADG14419.1"
FT                   /translation="MRLSRLISFSMAPRGIALSCAAAAVVALAGCASVKPQGPSTSNAA
FT                   TEVTAQTSRSYQGRFAVQYNDQNGQQRNAYGNFSWQETGDTVTLQLRNPLGQTLAIVTS
FT                   SPASATLELPNRLPLTADNVSTLMQNALGFTLPVEGLRYWLQPSPAPTSRAQTEKDPEQ
FT                   PSRLKQITQDGWTIDYVAYADAPATGVKRVNLSRSEPPLDIKLVLDQ"
FT   sig_peptide     complement(336542..336646)
FT                   /locus_tag="BC1002_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.488 at
FT                   residue 35"
FT   gene            complement(336646..338487)
FT                   /locus_tag="BC1002_0313"
FT   CDS_pept        complement(336646..338487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0313"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /note="PFAM: Tetratricopeptide TPR_4; TPR repeat-containing
FT                   protein; KEGG: bpy:Bphyt_0588 TPR repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14420"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB91"
FT                   /inference="protein motif:PFAM:PF07721"
FT                   /protein_id="ADG14420.1"
FT                   /translation="MNVSFVKLLSKRRARVSNVPLAVSARRMLGAAALALWALAAVPAH
FT                   AQDPSPDSDDTSVTMPDPLGPSSPEDEKSLPGVPLSSQIVFQVLAAEIALQRDQPAPAY
FT                   QTYLALARDTHDPRMAQRATEIALAAQSPSDALAAAQLWQQYAPGSERAAQLDASLLVL
FT                   SGKPDDAAPILSQELAKVPEENRGSAILALQLLLSRGPNRVGGLHVLQELLKNDMNRPE
FT                   AQLAVARQQLLADDAPGARKSLEQALTIKPDYLPAALVLSQMGPEERKEGIASLEKYVQ
FT                   QNPKSHDARLALAQMYLASDRLDDAQKQFEIMRKANANDLTPLMALALIKIQQKNLPEA
FT                   QTYLIQYAQQAEKTPGADAGQAYIYLAQLALEQKNEGAAGDWLNKISPASQQYLAAQIT
FT                   RAQLLAKQGKTDEARQLLANLQTADPRDVALIARTDAAILFDAKRYPEAEARLQQATAN
FT                   FPDDPDLTYDYAMAAEKTGHYDVMEAQLRKLIQTQPDNPQAYNALGYSLADRNQRLPEA
FT                   DKLVEKASALAPNDAFIMDSVGWVKYRMGNTADAIKLLRKAYSLQPNAEIGAHLGEVLW
FT                   KSGEQEQARAAFREARKLEPNNETLVKTLQRLQVNDL"
FT   sig_peptide     complement(338347..338487)
FT                   /locus_tag="BC1002_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 47"
FT   gene            338575..339405
FT                   /locus_tag="BC1002_0314"
FT   CDS_pept        338575..339405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0314"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="TIGRFAM: formamidopyrimidine-DNA glycosylase; KEGG:
FT                   bpy:Bphyt_0589 formamidopyrimidine-DNA glycosylase; PFAM:
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; DNA glycosylase/AP lyase, H2TH DNA-binding; zinc
FT                   finger Fpg domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14421"
FT                   /db_xref="GOA:D5WB92"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB92"
FT                   /inference="protein motif:TFAM:TIGR00577"
FT                   /protein_id="ADG14421.1"
FT                   /translation="MPELPEVEVTRRGIEPYVSGRKVERVDVRTATLRWPIPADLAKTL
FT                   RGHVVRKVERRGKYLLFEIDAGWFIVHLGMTGTLRVLRHVPHPPAAAKHDHVDWIFDDF
FT                   ILRYRDPRRFGAVLWHPREEGDILEHPLLASLGVEPFSPAFSGAQMHRLTRGRKVSVKQ
FT                   ALLAGDIVVGVGNIYASESLFRAGIRPTTAAGRVSLVRYELLADAVRVTLAAAIDKGGS
FT                   TLRDFVGSNGESGYFQLDYFVYDRAGLPCRVCGTPIKQIVQGQRSTYFCPTCQR"
FT   gene            339413..340546
FT                   /locus_tag="BC1002_0315"
FT   CDS_pept        339413..340546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0315"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /note="TIGRFAM: A/G-specific adenine glycosylase; PFAM:
FT                   HhH-GPD family protein; iron-sulfur cluster loop; KEGG:
FT                   bxe:Bxe_A4128 A/G-specific DNA-adenine glycosylase; SMART:
FT                   HhH-GPD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14422"
FT                   /db_xref="GOA:D5WB93"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB93"
FT                   /inference="protein motif:TFAM:TIGR01084"
FT                   /protein_id="ADG14422.1"
FT                   /translation="MPSRLTPTTAVRSSTSDATPAFTPMPDFSARLIAWQRQHGRHDLP
FT                   WQSTRDPYRIWLSEIMLQQTQVSTVIPYYAKFLGRFPDVAALAAAPSDDVMALWAGLGY
FT                   YTRARNLHRCAQVVVERHGGAFPVSVDELAELPGIGRSTAAAIASFAFGARATILDGNV
FT                   KRVLARVFGVEGFPGEKKVENSMWTLAESLLPSNASNAEVSAYTQGLMDLGATLCVRGK
FT                   PDCTRCPFAPDCVANVTGRQRELPTARPKKAVPTRRTWMLVLRDGNAVMLERRPPSGIW
FT                   GGLWSLPEAADEATLAERARAFGSDGEVSALASFSHVFTHFKLDIEPRLAELDRDVGAL
FT                   AALNDADTAWVALSDLDSFGVPAPVRKLLASLHGSLI"
FT   gene            complement(340568..341203)
FT                   /locus_tag="BC1002_0316"
FT   CDS_pept        complement(340568..341203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0316"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="KEGG: bpy:Bphyt_0591 peptidase S16 lon domain
FT                   protein; PFAM: peptidase S16 lon domain protein; SMART:
FT                   peptidase S16 lon domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14423"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB94"
FT                   /inference="protein motif:PFAM:PF02190"
FT                   /protein_id="ADG14423.1"
FT                   /translation="MSSTPTVYADLPLFPLHTVLFPDGLLPLKIFEARYLDMARDCLRE
FT                   KTPFGVCMLKSGAEVAREEEPSVPETIGCLAEIDECDVEAFGMLLIRARGTKRFRLLSH
FT                   RVEASGLLVGMAEPLADDLPLEGNELLAKFGACAEVLERIIATIRERDPDSLPFAEPFR
FT                   LDDPSWVSNRLAEVLPIALRARQKLMELTDAGARIDVVHHYMQQHQLL"
FT   gene            complement(341243..342181)
FT                   /locus_tag="BC1002_0317"
FT   CDS_pept        complement(341243..342181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bxe:Bxe_A4126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14424"
FT                   /db_xref="GOA:D5WB95"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB95"
FT                   /inference="protein motif:PFAM:PF03668"
FT                   /protein_id="ADG14424.1"
FT                   /translation="MEARCYDEIYAFDDSMRIILITGISGSGKSVALNALEDAGYYCVD
FT                   NLPPRFLQQLATYLAADGQDRLAVAIDARSGSSLDEMPAMIRDLKRSHDVRVLFLSAST
FT                   QSLIQRFSETRRRHPLSGSPAHDADVGLLTSLAEAIERERELVAGLAEFGHQIDTSNLR
FT                   ANVLRAWVKRFIEQEDAGLVLMFESFGFKRGVPLDADFVFDVRTLPNPYYDHELRPLTG
FT                   LDKPVMDFLDAQPVVHEMIDDIEKYLSKWLPHFRDDNRSYLTVAIGCTGGQHRSVFIAE
FT                   TLAARLATSANVIVRHRDAPVDVGESSKLVA"
FT   gene            complement(342235..343203)
FT                   /locus_tag="BC1002_0318"
FT   CDS_pept        complement(342235..343203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0318"
FT                   /product="HPr kinase"
FT                   /note="PFAM: HPr serine kinase domain protein; KEGG:
FT                   bpy:Bphyt_0593 HPr kinase/phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14425"
FT                   /db_xref="GOA:D5WB96"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB96"
FT                   /inference="protein motif:PFAM:PF07475"
FT                   /protein_id="ADG14425.1"
FT                   /translation="MDTSSINAQSIFDDNAAMLKLSWLTGHEGWERGFSSESVANATSS
FT                   ADLVGHLNLIHPNRIQVLGDAEIDYYKRQTDEDRSRHMAELIALEPPFLVVAGGVAAPP
FT                   ELVLRCTRSSTPLFTTPTSAAAVIDSLRLYMSRILAPRATLHGVFLDILGMGVLLTGDS
FT                   GLGKSELGLELISRGHGLVADDAVDFVRLGPDFVEGRCPPLLQNLLEVRGLGLLDIKTI
FT                   FGETAVRRKMKLKLIVQLVRRPDGEFQRLPLESQTVDVLGLPISKVTIQVAAGRNLAVL
FT                   VEAAVRNTILQLRGIDTLRDFMDRQRLAMQDPDSQFPGKLI"
FT   gene            complement(343284..343799)
FT                   /locus_tag="BC1002_0319"
FT   CDS_pept        complement(343284..343799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0319"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="KEGG: bpy:Bphyt_0594 PTS IIA-like
FT                   nitrogen-regulatory protein PtsN; TIGRFAM: PTS IIA-like
FT                   nitrogen-regulatory protein PtsN; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14426"
FT                   /db_xref="GOA:D5WB97"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB97"
FT                   /inference="protein motif:TFAM:TIGR01419"
FT                   /protein_id="ADG14426.1"
FT                   /translation="MERHSTAPLGRTQATFSPVNMNRLAKFLPLENVVIGLSVTSKKRV
FT                   FEQAGLIFENQNGIARSTVTDNLFARERLGSTGLGEGVAIPHGRIKGLKQPLAAFVRLA
FT                   EPIPFEAPDGQPVSLLIFLLVPEQATQQHLEILSEIAQLLSDRDARERLHTEEDRESLH
FT                   RLLTQWQP"
FT   gene            complement(344142..344498)
FT                   /locus_tag="BC1002_0320"
FT   CDS_pept        complement(344142..344498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0320"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="KEGG: bpy:Bphyt_0595 sigma 54 modulation
FT                   protein/ribosomal protein S30EA; TIGRFAM: ribosomal subunit
FT                   interface protein; PFAM: sigma 54 modulation
FT                   protein/ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14427"
FT                   /db_xref="GOA:D5WB98"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB98"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ADG14427.1"
FT                   /translation="MNLKISGHHLEVTPALREYVITKLDRVLRHFDQVIDGSVVLSVDN
FT                   HKEKEKRQKVEINLHLKGKDIFVESCDSDLYAAIDLMIDKLDRQVIRHKDRLQGHQHEA
FT                   IKYQPAPQLDVPPQ"
FT   gene            complement(344669..346186)
FT                   /locus_tag="BC1002_0321"
FT   CDS_pept        complement(344669..346186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0321"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="KEGG: bpy:Bphyt_0596 RNA polymerase factor sigma-54;
FT                   TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 DNA-binding domain protein; sigma-54 factor
FT                   core-binding region; sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14428"
FT                   /db_xref="GOA:D5WB99"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:D5WB99"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ADG14428.1"
FT                   /translation="MKASLQLRLSQHLALTPQLQQSIRLLQLSTLELQQEVAMAISQNP
FT                   LLENEDEWIASPLRVAADGSVIAQTPGSSAPADPMAGNGSTSSEGNGERAESGEPQGVD
FT                   EYNGLSGDGGGDTSQWNLDDYGRSGNASDDDDLPPLQIHESSTSLRDHLMAQLRVTQAS
FT                   QRDRALITFLIESLDDDGYLAATLEEVLADLPEELEVDVDELNAALALLHSFDPPGVGA
FT                   RSASECLKLQLLRLEPSPTRTLALDIVGRYLELLAARDFTRLRKHLKASDDDLRDAHAL
FT                   IRSLEPFPGAAYGKAEADYVVPDIMVRKTAQGWQAELNPEVVPKLRINHLYANILRNNR
FT                   GDPGSGSLRQQLQEARWLIKNIQQRFETILRVAQAIVERQKSFFVHGEIAMRPLVLREI
FT                   ADTLGLHESTVSRVTTGKYMLTPFGTLEFKYFFGSHVSTDTGGAASSTAIRALIKQLIG
FT                   AENPKSPLSDSRIAELLAEQGFVVARRTVAKYREALKIPAVNLRKSL"
FT   gene            complement(346376..347173)
FT                   /locus_tag="BC1002_0322"
FT   CDS_pept        complement(346376..347173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0322"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bpy:Bphyt_0597 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14429"
FT                   /db_xref="GOA:D5WBA0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBA0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG14429.1"
FT                   /translation="MSTVSSTITPLPHRKPAGTSSSLVVRNLKKRYGSRTVVKDVSLDV
FT                   KSGEVVGLLGPNGAGKTTSFYMIVGLVPLDAGEIDLDGKSISLLPIHKRASLGLSYLPQ
FT                   EASVFRKLTVEQNIRAVLELQHDENGKRLGKDVITSRTEALLDELQIAHLRENPALSLS
FT                   GGERRRVEIARALATNPSFILLDEPFAGVDPIAVLEIQKIVKFLKQRNIGVLITDHNVR
FT                   ETLGICDHAYIISDGSVLAAGAPSDIIENESVRRVYLGEHFRM"
FT   gene            complement(347170..347841)
FT                   /locus_tag="BC1002_0323"
FT   CDS_pept        complement(347170..347841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0323"
FT                   /product="lipopolysaccharide transport periplasmic protein
FT                   LptA"
FT                   /note="KEGG: bxe:Bxe_A4120 hypothetical protein; TIGRFAM:
FT                   lipopolysaccharide transport periplasmic protein LptA;
FT                   PFAM: OstA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14430"
FT                   /db_xref="GOA:D5WBA1"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBA1"
FT                   /inference="protein motif:TFAM:TIGR03002"
FT                   /protein_id="ADG14430.1"
FT                   /translation="MNESHPRFDIGRSRALSACRAALAALVVALPLVGFAPLAHADRAD
FT                   KDKPLNIEADNMTYDDLRQVSIFTGHVVATKGTILIKADRVEVSQDPQGYQFATGTSSG
FT                   NNLSYFRQKREGLDEYIEGTAIRIDYDGKQDLTTLTTNATVRRLQSMTTLLDQVHGSVI
FT                   TYDGQNDFYTAKAGKDVAGPGNPTGRVRAMLAPRNAGAAPLTGASATLTPSNSIQGAPN
FT                   Q"
FT   sig_peptide     complement(347716..347841)
FT                   /locus_tag="BC1002_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.974 at
FT                   residue 42"
FT   gene            complement(347881..348468)
FT                   /locus_tag="BC1002_0324"
FT   CDS_pept        complement(347881..348468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0324"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   bxe:Bxe_A4119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14431"
FT                   /db_xref="GOA:D5WBA2"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBA2"
FT                   /inference="protein motif:PFAM:PF06835"
FT                   /protein_id="ADG14431.1"
FT                   /translation="MNQFRLTSLIPLIAMAALAGITWWLLQATLPRKTDNEVRSKEHTP
FT                   DYFADNFSVSELDQSGATQYRLTAQSLIHYEDDEMSDLVKPAMRAFQPGKPIVTATGDT
FT                   GTVNADASIVNLYQNARILRAPGGGDPQMQADSEHFRVLVNDDVIETEKPVKLQRGMSV
FT                   MTASGMKYNNVTRFMQLFGNVRGAIAASDSGH"
FT   sig_peptide     complement(348409..348468)
FT                   /locus_tag="BC1002_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.946 at
FT                   residue 20"
FT   gene            complement(348465..349025)
FT                   /locus_tag="BC1002_0325"
FT   CDS_pept        complement(348465..349025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0325"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /EC_number="3.1.3.45"
FT                   /note="KEGG: bpy:Bphyt_0600 3-deoxy-D-manno-octulosonate
FT                   8-phosphate phosphatase, YrbI family; TIGRFAM:
FT                   3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI
FT                   family; hydrolase, HAD-superfamily, subfamily IIIA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14432"
FT                   /db_xref="GOA:D5WBA3"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBA3"
FT                   /inference="protein motif:TFAM:TIGR01670"
FT                   /protein_id="ADG14432.1"
FT                   /translation="MAVAPPTATERASRVKLMIFDVDGVLTDGGLLFTAEGDTMKGFNS
FT                   MDGHGMKLLRQAGIDTAIITGRQSGIVAARVKELNITHVYQGVQDKPAAFADLLQKTCL
FT                   AAEDCGYMGDDWVDLAVMLRVGFAAAPANSHPEVIARAHWVSEARGGHGAAREVVDTLL
FT                   RAQHKYEALLAAACSGEQRGLVG"
FT   gene            complement(349025..350008)
FT                   /locus_tag="BC1002_0326"
FT   CDS_pept        complement(349025..350008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0326"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="SMART: CBS domain containing protein; TIGRFAM:
FT                   KpsF/GutQ family protein; KEGG: bpy:Bphyt_0601 KpsF/GutQ
FT                   family protein; PFAM: sugar isomerase (SIS); CBS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14433"
FT                   /db_xref="GOA:D5WBA4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBA4"
FT                   /inference="protein motif:TFAM:TIGR00393"
FT                   /protein_id="ADG14433.1"
FT                   /translation="MIAKINGDRALTLARDVLDIEADAVRALRDQLDGSFVGAVDFILG
FT                   CRGRVVVSGIGKSGHIARKLAATLASTGTPAFFVHPAEASHGDLGMVTADDVFLALSNS
FT                   GETEELMAILPLIKRIGAKLIAMTGRPGSSLAQLADVHLNSGVAKEACPMNLAPTASTT
FT                   AALALGDALAVAVLDARGFGRDDFARSHPGGALGRRLLTYVRDVMRTGDQLPQVTPEAT
FT                   VSDALFQLTAKRMGMTSVVDHEGRVTGIFTDGDLRRVLERDGDFRQLPIGSVMTAGPRT
FT                   IGPDQLAVEAVELMERYRINQMLVVDESGKLIGALNMHDLFSKKVI"
FT   gene            350145..352211
FT                   /locus_tag="BC1002_0327"
FT   CDS_pept        350145..352211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0327"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; TrkA-N domain
FT                   protein; TrkA-C domain protein; KEGG: bpy:Bphyt_0602
FT                   sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14434"
FT                   /db_xref="GOA:D5WBA5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBA5"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ADG14434.1"
FT                   /translation="MSHGVLVRGSADERGRFTHAFLPMISPLEMTLFLLLASVAGVVIF
FT                   RFLNLPPMLGYLTVGIVVGPHAFGLIPDSAGAQNLAEFGVVFLMFSIGLEFSLAKLRTM
FT                   RRLVFGLGLLQVIGTVAVAVSLGFVLERWVHITWQACVALGGALAMSSTAIVSKMLAER
FT                   LEIETEHGRNIFGVLLFQDLAVVPLLIIISALGGRSENLVSALGIAAIKIVVALALLLI
FT                   VGQRFMTRWFNVVARRRSQELFILNLLLVTLGAAFITDKFGLSLALGAFIAGMLIAETP
FT                   YRHQVEEDIKPFRDVLLGLFFVTTGMLLNPRVIWEHPLVVLAFFIGPVLLKAVMITGLA
FT                   RLFGATPGVSMRTGIGLAQAGEFGFVLLNLILDRHLVDATLLQAILAAMLLSMLAAPFM
FT                   IQNADRVVLRLSSTEWMMQSLQMTRIATQSLKQSGHVIICGYGRAGQNLARMLEHEGLS
FT                   YVALDLDPDRVAAAAAAGESVVFGDAGRRESLLAAGLHRAAAIAITYANTPSALRVLHN
FT                   IHEMEPTLPVIVRTVDDADLEKLLAAGATEVIPEIVEGSLMLASHTLVVMGVPMRRVVR
FT                   RVEEMRDERYSLLRGYFHGADDIDDDDGHEQVRLQSVPVDESADAVGRTLAEVGLYELG
FT                   VEVTAIRRHGIRGVEPDPSTKLRASDIVVLRGLPEQLAQAEERLSKHRRAAAA"
FT   gene            352293..352859
FT                   /locus_tag="BC1002_0328"
FT   CDS_pept        352293..352859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0328"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="TIGRFAM: adenine phosphoribosyltransferase; KEGG:
FT                   bpy:Bphyt_0603 adenine phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14435"
FT                   /db_xref="GOA:D5WBA6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBA6"
FT                   /inference="protein motif:TFAM:TIGR01090"
FT                   /protein_id="ADG14435.1"
FT                   /translation="MSNALASAPLDAADYIRSHIRTVPDWPQPGVQFRDITPLLREPKS
FT                   LRVLIDLFVQRYIDAKLDYIAGLDARGFIIGPIVAHELSIGFIPVRKAGKLPYKRISQS
FT                   YELEYGTATVEIHEDACEPGDRVVIIDDLIATGGTMMAGKLLIERLGAVVVEGAAIVDL
FT                   PDLGGSKLLCEGGLALYTVTSFGGH"
FT   gene            353024..353638
FT                   /locus_tag="BC1002_0329"
FT   CDS_pept        353024..353638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0329"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bpy:Bphyt_0604 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14436"
FT                   /db_xref="GOA:D5WBA7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBA7"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADG14436.1"
FT                   /translation="MPNFLLFLATSIAITVAPGPDNLQVLARGISQGRAAGLVAALGFA
FT                   AGITFHTTLAALGVAALLRSSPLAFEAIKLAGAAYLVWIGIKALRSQGLATAHERAPQP
FT                   LSAVFRQSVLGNLMNPKVTLFFVVFLPQFVQPGGAQSVTVQMLELGALFMLQTVVVFSL
FT                   FGVCAGIIGGWLRRRPRVGLWLDRVAGATFIAIGIRVALRD"
FT   gene            353710..354573
FT                   /locus_tag="BC1002_0330"
FT   CDS_pept        353710..354573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0330"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bpy:Bphyt_0605 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14437"
FT                   /db_xref="GOA:D5WBA8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR031804"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBA8"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADG14437.1"
FT                   /translation="MTLPCITAARRFDANAHRPFLIGAEQVGWIRERDMQLLAHWPDVF
FT                   EITNDGVTLSAIFDTVDLRSAALASVIGALAADGRIPGWRNETYAIRNAFDAPPLAYIE
FT                   RAASRFFGTMTYAVHLNGVVEYAEGGAPRGAPQLWIARRSDTKATDPGMLDNVVAGGIG
FT                   WGFGIAETIVKECWEEAGIPAEIAAVAVAGRTAHVLQSLPEGTQAEQIFIYDLALPADF
FT                   APRNQDGEVGEHRLARIDEVARWIEEGALTVDASLATLDCLLRRRWIDEDACEGIGALF
FT                   APPALG"
FT   gene            354658..355527
FT                   /locus_tag="BC1002_0331"
FT   CDS_pept        354658..355527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0331"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="KEGG: bpy:Bphyt_0606 formyltetrahydrofolate
FT                   deformylase; TIGRFAM: formyltetrahydrofolate deformylase;
FT                   PFAM: formyl transferase domain protein; amino acid-binding
FT                   ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14438"
FT                   /db_xref="GOA:D5WBA9"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBA9"
FT                   /inference="protein motif:TFAM:TIGR00655"
FT                   /protein_id="ADG14438.1"
FT                   /translation="MSTDHSFILKLSCADRPGIVHAVSGFLFERGSNILDSAQFGDSRT
FT                   GEFFMRVHFQQVGGDPGLDALRASFVALAEQFGMSWELHDANVKPRVVIMVSKIGHCLN
FT                   DLLFRYRTGQLNIDIPAIISNHKEFYQLAASYDIPFHHFPLLGGTPEAKTAQEARVLEV
FT                   INEHQADLVVLARYMQILSPNLCKSLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIG
FT                   ATAHYVTTDLDEGPIIEQEVERVDHSMTPEQLTAIGRDVECVTLARAVKWHVEHRVVLN
FT                   GSKTVVFR"
FT   gene            complement(355586..356812)
FT                   /locus_tag="BC1002_0332"
FT   CDS_pept        complement(355586..356812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0332"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: bpy:Bphyt_0607 PepSY-associated TM helix domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14439"
FT                   /db_xref="GOA:D5WBB0"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBB0"
FT                   /inference="protein motif:PFAM:PF03929"
FT                   /protein_id="ADG14439.1"
FT                   /translation="MRRQLVRLHRWFGVATALFLFVAGLTGAIIAWDHELDAALNPSFY
FT                   QARTTGPTLSGLELANRVEAADPRLRVTYLPLAVEPGHTLQMMVLPRTDPATKRPYPLA
FT                   FNQIAVDPATGEIQGRREWGAVSLARLNLIPFIYKLHYTLQLPFTGRVDIGTWLMGIVG
FT                   IVWLFDSVIALCLSFPSLKAWRKSFAFRLKRGGYALTFDLHRSGGVWIWGLLAIVALTS
FT                   ISMNLSSQVVQPIVSRLSTLTPDPFSNPEILRAPQPGDQVLSRERIVELAERAGTEMHV
FT                   AAPPGGLYYAEFVHTYGVGFYTPGNDHGDAGLGNPWMYWDAATGKRLATRIPGQGTAGD
FT                   IFLQVQYPLHSGRILGLGGRILISAVGVAVAVLSVTGLLIWLKKLSARRRSAQNANLGK
FT                   STGGAAARS"
FT   gene            complement(357093..358178)
FT                   /locus_tag="BC1002_0333"
FT   CDS_pept        complement(357093..358178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14440"
FT                   /db_xref="GOA:D5WBB1"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBB1"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4109"
FT                   /protein_id="ADG14440.1"
FT                   /translation="MTKRNQAREEDRVQDLRPRPVRLTSDMSLPKLSAVEIGSYVVMLF
FT                   GMWAVIELKLLGALLAGLLVFQLVQMIAPRIERHMSSRRARWLAVVLLSTVIVGALTGL
FT                   TLGIISHFENDVPSVQALLDQAMQLIDQARGRIPQFVANYLPVDTEQMKTKATELMHTH
FT                   ANMLQQSGTTVARAFTHVLLGMIIGAIIAVGAQKHIQRLPLSTAFVTRVTRFADAFRRI
FT                   VFAQVKISALNAVFTAIFLLVVLPTFHDRLPLSKTLVLVTFIVGLLPVIGNLISNTIIV
FT                   AVALSVSFPAAIMSLVFLILIHKLEYFLNARIVGGQIEARAWELLIAMLVMEAAFGIAG
FT                   VIAAPIFYAYIKRELIYLRLV"
FT   gene            complement(358213..361086)
FT                   /locus_tag="BC1002_0334"
FT   CDS_pept        complement(358213..361086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0334"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="KEGG: bpy:Bphyt_0609 excinuclease ABC, A subunit;
FT                   TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC transporter
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14441"
FT                   /db_xref="GOA:D5WBB2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBB2"
FT                   /inference="protein motif:TFAM:TIGR00630"
FT                   /protein_id="ADG14441.1"
FT                   /translation="MEQIRIRGARTHNLKNVNLDLPRHKLVVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLQLMEKPDVDLIEGLSPAISIEQKATSHNPRSTVGTVTEI
FT                   HDYLRLLFARVGTPYCPDHEIPLEAQSVSQMVDAALALPEETRVMILAPVVSDRKGEHT
FT                   DLFEDMQAQGFVRFRVRSGGGTANEGTAKIYEVDSLPKLKKNDKHTIDVVIDRLRVRPD
FT                   MKQRLAESFETALRLADGRAIALEMDTDKEHLFSSKFACPICSYSLQELEPRLFSFNNP
FT                   MGACPECDGLGQITFFDPKRVVAHPSLSLAAGAVKGWDRRNQFYFQMLQSLAAFYDFDI
FT                   DTAFEDLPEKVRKILLYGSGKQEIPFSYINERGRTSVREHVFEGIIPNLERRYRETDSS
FT                   AVREELAKYQNNQPCPACAGTRLRREARFVRIGADSDARGIFEISGWPLRDALGYFQTL
FT                   RLEGSKREIADKVVKEIVARLMFLNNVGLDYLSLERSAETLSGGEAQRIRLASQIGSGL
FT                   TGVMYVLDEPSIGLHQRDNDRLISTLKHLRDLGNSVIVVEHDEDMIRMADYVVDMGPGA
FT                   GEHGGMVIAEGTPKEIQKNAASLTGQYMSGARTIEYPDERKEPDERHLRIVEAHGNNLH
FT                   NVTLDLPVGLLTCVTGVSGSGKSTLINDTLYHAVAHHLYGSATEPAPYESIEGLEHFDK
FT                   VINVDQSPIGRTPRSNPATYTGLFTPIRELFAGVPAAKERGYDPGRFSFNVKGGRCESC
FT                   QGDGVLKVEMHFLPDVYVPCDVCHGKRYNRETLDIQYKGSNISEVLDMTVEHAYEFFKA
FT                   VPVVARKLKTLLDVGLGYIRLGQSATTLSGGEAQRVKLSLELSKRDTGRTLYILDEPTT
FT                   GLHFHDIALLLEVIHRLRDQGNTVVIIEHNLDVIKTADWVIDLGPEGGAGGGQIIAQGT
FT                   PEQIAKSKASFTGKYLAPLLKRAASAK"
FT   gene            361396..362583
FT                   /locus_tag="BC1002_0335"
FT   CDS_pept        361396..362583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0335"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_0610 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14442"
FT                   /db_xref="GOA:D5WBB3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBB3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG14442.1"
FT                   /translation="MSNPSAISTRMSAPELRATVSLAAIFALRMLGLFMIMPVFSIYAK
FT                   TIPGGENVLLVGIALGAYGVTQSMLYIFYGWISDKVGRKPVIATGLLIFAIGSFVAAAA
FT                   HDMTWIIVGRVIQGMGAVSSAVIAFIADLTAEEHRTKAMAMVGGSIGVSFAVAIVGAPI
FT                   VFHWLGMSGLFTLVGVFAILAVGVVLWVVPDAPKPVHVRAPFAEVLHNVELLRLNFGVL
FT                   VLHATQTALFLVVPRILEAGGLPVASHWKVYLPVMGLSFVMMVPAIIAAEKRGKMKIVL
FT                   LSAIALILIGQLLLGVAPHTILSVAAILFVYFLGFNILEASQPSLVSKLAPGTRKGAAA
FT                   GVYNTTQSIGLALGGMVGGWLLKVNGQSAVFFACSGLVFCWLIIAAKMKQPPRKA"
FT   gene            362730..363263
FT                   /locus_tag="BC1002_0336"
FT   CDS_pept        362730..363263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0336"
FT                   /product="single-strand binding protein"
FT                   /note="KEGG: bpy:Bphyt_0611 single-stranded DNA-binding
FT                   protein; TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14443"
FT                   /db_xref="GOA:D5WBB4"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBB4"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ADG14443.1"
FT                   /translation="MASVNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASG
FT                   EMKEATEWHRVAFFGRLAEIVAEYLKKGSSVYLEGRIRTRKWQAQDGTDRYSTEIVAEQ
FT                   MQMLGGRGGASMGGGDEGGYSRGEPSERSGGGGGRGMSSGGGSRGGSGGGGGASRPSAP
FT                   AGGGFDEMDDDIPF"
FT   gene            complement(363406..364206)
FT                   /locus_tag="BC1002_0337"
FT   CDS_pept        complement(363406..364206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14444"
FT                   /db_xref="GOA:D5WBB5"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBB5"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0619"
FT                   /protein_id="ADG14444.1"
FT                   /translation="MSEIGSAVLVFALLLIATGLGVGVRPLLPEEHKAHETVQLVQLVI
FT                   GMLVTFAALVLGLMTASAKSSFDTASNDMRTYAAELIEFDTTLRELGSAADESRRLLRQ
FT                   YTAAAIASTWPREPAPSGDYPRDLGPPDNSQQLENVRLGDMLSTVGRQLRQLRTQDALQ
FT                   QRALDDALIQYRRVIDARWKIIEEAHSSISQPFFKTLTFWLGVIFLSFGLIAPRNALAL
FT                   VTITLGAVSIASAVYVIVDLDSPFTGPIVISSLPLRDTLEHLSR"
FT   gene            364468..366114
FT                   /locus_tag="BC1002_0338"
FT   CDS_pept        364468..366114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0338"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: bpy:Bphyt_0620 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14445"
FT                   /db_xref="GOA:D5WBB6"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBB6"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADG14445.1"
FT                   /translation="MLKKLSIRTSLTLMIVFFGITLLLGAAAGLLSLRSSNASLQQMYT
FT                   VDTPAVADLEGSSGQLLRLRLALATYASLVALNDQDGASAVLKRFDQYRKASDERLAHY
FT                   LSHAGTDADEQHLITDMQQKRDAFLRDGVDPTLAALKSSDTNAFQQLQAHKLPSLYSAY
FT                   EKAMLALEQLQLDHGAQRYKDAQDLFYAISTAVAIGIGLSLVGGLLARFVLVRAIVTPV
FT                   DATIAQFQRIANGDLSGHVEVLGGNEMGRLAAALRKMQESLIATVNAVRQGTESIDTGV
FT                   SEIAAGNADLSQRTEEQAAALEETAASIEELTSTVKQTADNAKQASTLAQGASTLAAQG
FT                   GELTEQVVGTMHGIVDDSRRIADIVGVIEGIAFQTNILALNAAVEAARAGEQGRGFAVV
FT                   ASEVRSLAQRSAAAAKEIKGLIDASTARVEQGSQLVERSGTTMNDIVGAIARVSSIMNE
FT                   IAAAALEQSTGIDQVNRAVGQMDEVTQQNAALVEQAAAAASSLEDQARRLSAAVAVFRT
FT                   GSESRGGVSAPGAKLAGVARARSLESEFVAA"
FT   sig_peptide     364468..364584
FT                   /locus_tag="BC1002_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.812 at
FT                   residue 39"
FT   gene            complement(366160..366462)
FT                   /pseudo
FT                   /locus_tag="BC1002_0339"
FT   gene            complement(366473..367279)
FT                   /locus_tag="BC1002_0340"
FT   CDS_pept        complement(366473..367279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0340"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: bpy:Bphyt_0621
FT                   cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14446"
FT                   /db_xref="GOA:D5WBB7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBB7"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ADG14446.1"
FT                   /translation="MNEERLFTLRNPWFVWSVGGTLGVAIVGILIGFVWLPSASSAFGD
FT                   LSLWARICGAAGVPSSWYSGNEKSQVPSDVVVLPPSGANHPLADSIGRGATLANQHCSM
FT                   CHGVLATVQVTAPPLAGQYADVIYKEMRDFQSGQRPSAVMQAIIAGRSDQDLNDLAAYY
FT                   ASLPRAPAAEKTRAGEAPDPIAVRLVMQGDPQRNIAPCAACHGQLDRKGAAPWLGGLSA
FT                   AYLTAQLQAFASGARHNDINEQMRHVARQMTPEEMDAVSRYYAAMQ"
FT   gene            complement(367276..368901)
FT                   /locus_tag="BC1002_0341"
FT   CDS_pept        complement(367276..368901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0341"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /note="PFAM: cytochrome c oxidase subunit I; KEGG:
FT                   bxe:Bxe_A4078 putative cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14447"
FT                   /db_xref="GOA:D5WBB8"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033943"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBB8"
FT                   /inference="protein motif:PFAM:PF00115"
FT                   /protein_id="ADG14447.1"
FT                   /translation="MFHAKRLVLAHFWLAFITFAIALCLGAWQMLVRSPLLPWIGDPEL
FT                   YYRSVTAHGTVMAYVMPTLIAMAFGYAIVELSLGQRLVGLKWAWAAFIMLGVGAVMAMV
FT                   PVALGKASVLYTFYPPMIGSPFYYLGVVLVVVGSWIWVALMHVNLRIWKRANPGKPVPL
FT                   AMFANVAGAYLWAWTAVGAALEILFQILPVALGFAHTIDAGLARVLFSWTLHAIVYFWL
FT                   FPAYIAFYTLVPRSIGGRLYSDSMARVSFILFLVFAMPIGIHHLFVDPQVGAGFKFLHA
FT                   VFTGMVSVPTLLTVFTICASVEIAGRLRGGKGALGWLTALPWSNPIMLAVAFSFVMLGF
FT                   GGAGGLINMSYQLNSTVHNTQWVTGHFHLIFGGAIVIMYFVIAYELWPQLTGRAIGSAK
FT                   LMRTQLWLWFIGMMVVTIPWHWVGLLGAPRRMAYYDYAMAGVQGQGVWVIMSAVGGLIL
FT                   LVSGLLFVYILAKSQFGPVEEPPAFRFAVAAHPVERVPVALNGFGLWVALMIGLTVVNY
FT                   SFPIFQLLGLPQTSVPAVVVGASR"
FT   gene            complement(368888..369460)
FT                   /locus_tag="BC1002_0342"
FT   CDS_pept        complement(368888..369460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0342"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /note="PFAM: cytochrome c oxidase subunit II; KEGG:
FT                   bpy:Bphyt_0623 cytochrome c oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14448"
FT                   /db_xref="GOA:D5WBB9"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBB9"
FT                   /inference="protein motif:PFAM:PF00116"
FT                   /protein_id="ADG14448.1"
FT                   /translation="MSTDSSHQPGSGHAVALRAERRWAIFAVALIVLMLAVVVFVGVHW
FT                   SMMPPSRVETVDPSRLQLSGEFAEDNLGSAVQPDGSVIVRFVAQQYSFTPQCLLVPADT
FT                   PITIRTTSADVVHGLLVTDTNINTMVVPGYVATLNTQFDHPADHAMPCHEFCGFGHQTM
FT                   WAHVKVIDKAAFFEQARQSRRLSCVPR"
FT   gene            complement(369463..369639)
FT                   /locus_tag="BC1002_0343"
FT   CDS_pept        complement(369463..369639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14449"
FT                   /db_xref="GOA:D5WBC0"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBC0"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4076"
FT                   /protein_id="ADG14449.1"
FT                   /translation="MKANDPPSAAPPTDDEVEHVVAAGPRGAIALAGVATVIVMLIWFA
FT                   FYFFAFLPRGIIH"
FT   gene            complement(369692..371032)
FT                   /locus_tag="BC1002_0344"
FT   CDS_pept        complement(369692..371032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0344"
FT                   /product="Gluconate 2-dehydrogenase (acceptor)"
FT                   /EC_number="1.1.99.3"
FT                   /note="KEGG: bpy:Bphyt_0625 gluconate 2-dehydrogenase
FT                   (acceptor); PFAM: cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14450"
FT                   /db_xref="GOA:D5WBC1"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBC1"
FT                   /inference="protein motif:PRIAM:1.1.99.3"
FT                   /protein_id="ADG14450.1"
FT                   /translation="MKPTLRPSGWLRPASMASVLAIGSLALALLLDGPLATTAHAATAA
FT                   PQGAESTTTAGTSPDTRPEIVRRGEYLARAGDCIACHTAPRGRLFAGGLAMETPFGTLY
FT                   SPNITPDPQYGIGTWSEEAFFKMMRTGRKPDGAPIYPAMPVAQYTKVTREDSDAIFAFL
FT                   KTVEPVRQPNHPHTLRFPFNQRDLLYGWRTLYFHEGEFKSDPTKSVEWNRGAYLVEGLG
FT                   HCTMCHTRINMLGGSSPREQFAGGLIPVQNWYAPSLTSDKDGGLGDWSIQDIVDLLQAG
FT                   ISNRGAVYGPMAEVTYHSLQHLSEEDIRAMAVYLKSLPDQGGRKTGPSATPNPKVFALG
FT                   KQIYADKCAICHGDNGEGQLPQYPPLAGNQSIEMDSAVNPIRIVLNGGFPPGTKRNPQP
FT                   FGMPPFGQELNDAEAAAVVTFIRTAWGNHGLPVSAREVNELRKAPLH"
FT   sig_peptide     complement(370907..371032)
FT                   /locus_tag="BC1002_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.927 at
FT                   residue 42"
FT   gene            complement(371029..371754)
FT                   /locus_tag="BC1002_0345"
FT   CDS_pept        complement(371029..371754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0345"
FT                   /product="putative periplasmic cytochrome c protein"
FT                   /note="KEGG: bxe:Bxe_A4074 putative periplasmic cytochrome
FT                   c protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14451"
FT                   /db_xref="GOA:D5WBC2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBC2"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4074"
FT                   /protein_id="ADG14451.1"
FT                   /translation="MYRKTIGSAVLFVLCALHALWSCAALAVTDASSAMPPSMDQRIRA
FT                   CTSCHGEQGQGRKNDYFPRIAGKPAEYLFNQLIAFRDGGRTYPPMGYLLAFLPDDYLRQ
FT                   ISEYFAALQPPYPESDRATLSPKLLAAGEKLVTHGDPARGIPACIACHGARMTGTQPGI
FT                   PGLLGLHASYIAGQMGTWRSGTRHALAPDCMRTIALKLNDNDIAAVSNWLARQPRPADP
FT                   RPAPASAERLPLACGSQPQ"
FT   sig_peptide     complement(371671..371754)
FT                   /locus_tag="BC1002_0345"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.968 at
FT                   residue 28"
FT   gene            complement(372314..373207)
FT                   /locus_tag="BC1002_0346"
FT   CDS_pept        complement(372314..373207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0346"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_A4073 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14452"
FT                   /db_xref="GOA:D5WBC3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBC3"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ADG14452.1"
FT                   /translation="MSQRGFDLAQLRTFVAVAESGGVSAGAERVFLSQSSVSEQLKKLE
FT                   ERAGQPLLVRGRQGVNPTPAGERLLEHARRIIAMSEAAFDDLQGRSLDGELRIAITDYY
FT                   RPHDIARILKTFSEQHPRLKLHVTVLPSAVIDSGADDHASFDIGLSARLVIGQPRARSA
FT                   GAGSGTASIVVRREKLLWASCADAPTRPAAPYQLVLLPTTCQLQRFVVKLLDEHKVAYV
FT                   VSHSASGVAGLQLALKAGLGISCLNESSLGGGVVACAANVGLPPLPAIEFHLLPRRPGE
FT                   SELVSNARDALVRLFA"
FT   gene            373301..374650
FT                   /locus_tag="BC1002_0347"
FT   CDS_pept        373301..374650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0347"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_0628 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14453"
FT                   /db_xref="GOA:D5WBC4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBC4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG14453.1"
FT                   /translation="MENGSMTASRGTGERGARHRWKVLGVGFAANASFSAAFSGIPTTA
FT                   VFLRSDYHLGNHGLGLVLGMLGLGIAVSELPWGLLTDRWGDRRVLLLGLLSTAAALAGL
FT                   ALFVSPGAARVPGIVPLALGLLLVGLLGGSVNGSSGRAVMAWFREGERGLAMSIRQTAV
FT                   PAGGGLGALVLPVLASHFGFASAYAVLALACAITAWFAWRWLHEPAHADDTSAVKGARA
FT                   TAAASGRSVDVSNVIAPPPMRSPLRDIAIWRVALGAGALCVPQIAVITFGTVFLHDFGR
FT                   AGVFAISATMAAVQTGAAIARVWSGAWTDRRGNRRAYMRACSLLTAVLFVLLALATGIV
FT                   GMHRAGAVALFALMIVLGGVSASAWHGVAFTELASLAGTRRAGTALAMGNTCVFLTLFV
FT                   TPLAIPPLLSIGAWPLVWTVASACALLALPVFPRAASTRAMRATRACDAA"
FT   gene            374917..375585
FT                   /locus_tag="BC1002_0348"
FT   CDS_pept        374917..375585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0348"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: bxe:Bxe_A4071 two component LuxR family
FT                   transcriptional regulator; PFAM: response regulator
FT                   receiver; regulatory protein LuxR; SMART: response
FT                   regulator receiver; regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14454"
FT                   /db_xref="GOA:D5WBC5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBC5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG14454.1"
FT                   /translation="MTNLRIILADDHPFILLGLKSTLEVHEGLTVVGQAQAPTALIALL
FT                   QQTPCDVLVVDLSMPEPAGEIGDGPGLIRRIRGEWPSLRVVVVTGQTNAAMLRVVAADA
FT                   AISVVGKADSLEELPQAVCDSARGARYLGRSVVETLERSQPDNGQFVSALLLSKRQTNI
FT                   VRRLVSGESIVQIAAALGCHRRTVSRQKREAMARLGVSDDPALFSCVRACGALLLESEN
FT                   "
FT   gene            375722..376411
FT                   /locus_tag="BC1002_0349"
FT   CDS_pept        375722..376411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0349"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: bxe:Bxe_A4070 two component LuxR family
FT                   transcriptional regulator; PFAM: response regulator
FT                   receiver; regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14455"
FT                   /db_xref="GOA:D5WBC6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBC6"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG14455.1"
FT                   /translation="MNLMAASGPPVRTIIADDHPLVLLAIENLIGNYPNLKVVGRASDV
FT                   AELLIEVDRSPCDLVLMDLYMPGGHNENRFDFVRQLKARYPNVALVILTMETEAATLRE
FT                   VMSLGVDGLLSKRDRIDLIHVALVMALARECYVGPAVRAMLADVTLTQRLDFVRATLSR
FT                   RELEVFTQYASGLGVTEIATRLGRSVKTISAQKCMAMRKLSLNSDAELFRFAVEHGVVP
FT                   ERLGQVR"
FT   gene            376520..377164
FT                   /locus_tag="BC1002_0350"
FT   CDS_pept        376520..377164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0350"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: bxe:Bxe_A4069 two component LuxR family
FT                   transcriptional regulator; PFAM: response regulator
FT                   receiver; regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14456"
FT                   /db_xref="GOA:D5WBC7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBC7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG14456.1"
FT                   /translation="MTNKIHVVVADDHDSIRAGVRSLLRDKPNIEIVGEAADTHGLAKL
FT                   LDVCACDVVVSDIGMPGLDGDTSAVPLLRRLLRRTPHPHVVVLTMIGRAHVLAGLRNIG
FT                   VTGIVDKRDAVDALIDAIEAVAAGGTHLSEQVRAALTAAEPAPPRRGGAMSAREWEVFQ
FT                   LYVRGLAVHEIATRLRRSDKTISTQKRSAMRKLGLETEADLINYATQIGLI"
FT   gene            377413..378159
FT                   /locus_tag="BC1002_0351"
FT   CDS_pept        377413..378159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0351"
FT                   /product="major intrinsic protein"
FT                   /note="PFAM: major intrinsic protein; KEGG: bpy:Bphyt_0632
FT                   major intrinsic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14457"
FT                   /db_xref="GOA:D5WBC8"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBC8"
FT                   /inference="protein motif:PFAM:PF00230"
FT                   /protein_id="ADG14457.1"
FT                   /translation="MVALGKRLWSEGVGTAWLVFVGCGSTVLDTTRILQASGALQMSLA
FT                   FGLALAIGGYAFGKISGAHFNPAVTIGLTVAQRFPVRDLLPYIAAQIGGAIVAAALLAY
FT                   LASGRPGFELAASEFAANGFGAHSPADYPLHSALVVEVLLSFVFVGTCLLVVVRKELAR
FT                   VAPFITGACLMLVYLVSIPITNGAVNPARSTAQAVFVGNWALDQLWLFWAAPLAGAIAA
FT                   GVLFSFLDGRADSSAVSLADGHGDVS"
FT   gene            complement(378200..378406)
FT                   /locus_tag="BC1002_0352"
FT   CDS_pept        complement(378200..378406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlu:Mlut_12350 conserved hypothetical protein
FT                   TIGR00046"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14458"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBC9"
FT                   /inference="similar to AA sequence:KEGG:Mlut_12350"
FT                   /protein_id="ADG14458.1"
FT                   /translation="MDDAAEEPARTEEMTGDSDAAPVGAAIQTAWVAASSHNASRHIIE
FT                   WRGERGLRHRNKRRSPNVSAALP"
FT   gene            378435..382682
FT                   /locus_tag="BC1002_0353"
FT   CDS_pept        378435..382682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0353"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; extracellular solute-binding protein family 3; PAS
FT                   fold-4 domain protein; response regulator receiver; Hpt
FT                   domain protein; KEGG: bxe:Bxe_A4067 PAS/PAC sensor hybrid
FT                   histidine kinase; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; extracellular
FT                   solute-binding protein family 3; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14459"
FT                   /db_xref="GOA:D5WBD0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBD0"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADG14459.1"
FT                   /translation="MLEGGWPPFDIPRGGQLAGVSGDLLRALVGPNVVIETKSFPDMAK
FT                   LVAAACAGEVDLLTSIARTPERERCLGFTAPYFHSFASAVVRRDDARYEKPTDLAGARI
FT                   AIERGFARERLLRAGFPRAKIVSFASTHAALNAVLNGDADVYFGFTPVVQYELATDAYR
FT                   NLRVAFEQGGKALDLRFAVSPRQLALRDQLNRALVSMNPAEAAAIRARWLSGNFNAAPV
FT                   PGASRFTLTPEEKNWLRALPPLQIGFDDDWAPFSYVDAAGRPVGLTADYLAYLSSTLGV
FT                   VFSRARTADWAATVDAFQRGDLAMLSSTSSRGALLVGADHSRVYESDPLVVAGRSGVPT
FT                   PCWFDDITSCRVVMSPHVAGSVPLALEAVPVDHIVVAGSLGEAMRMVASGEADVLVGNA
FT                   AAINVQLRQHYAGALRVLDSLGESDSLYFAVREDLSPLVKLIDRALQAMPAAEKQRIRR
FT                   KWVSPAAPDNAVWSVTAVRLLPVLIGIGVVLLVTLRAYVLLQREVRLRKQTERELALQL
FT                   NFQETMMKTVPYPLIAKGLDGRYIAINEAYERACGLERKDVLGRTTAEVGTWGDTNSRV
FT                   LDDMTRELLRGGGIAKVELQFEDRAGESRHGIFWTSVCEGGDGQPAYVLGTMVDITDIR
FT                   RAEMRARETERRLFDVTRSLPAVVFQMRRSPSGAYSFPYIGGDARHLFGESDSPDGARV
FT                   DFERVSELDRPLVLAELERSASCATPVHMQFRLESAGQLKWVRAELVPRREADGSVVWS
FT                   GYWVDASVERARSEELARARDAAEAASRAKDNFFAMMSHEIRTPMNGVLGLVEVLERTP
FT                   LSTDQSEMLGMIHESAGALLQILDDLLDYSKIEAGRLTLEAEPIDLRELVDNAVGLLAG
FT                   RAHEKGLKVRVDIGSNAAATLRGDSVRLRQILFNLLGNAIKFTPKGEVGVSVAVVEDRS
FT                   ASQTLELTVRDTGIGIAPNVQAGLFEPFVQAESSTTRRFGGTGLGLTICRKLIDLMSGT
FT                   LTLHSEPGRGTSMIVRLTMPIVEQRYSINGLRGKLGVVITRDPRVGRALAQFGEALGLE
FT                   LRSLSADAATLGRSSVLSRADLLFVGEDVTLPAHIGTKARIVTLTEKPKPTGYRILDDK
FT                   VRVSINPISWRGLGAACAAAMTGLSSEAPMASRAVGVPCTTDGIAPPPDREHALANGRL
FT                   ILVAEDHPVNQELIRHQLALLGFACDVTNDGAEALAALERTNYGCLITDCHMPNLSGYE
FT                   LTRRIREAEAMRGGAQRLPILGITANTAPDDLSLCREAGMDDSLIKPTRLATLRDYLSR
FT                   WFGPDGERQGTQRVGAEPIVPVDLTRMTQIWGSESTVKALLDSFVSSMRDDLNALAMLL
FT                   ERADRGSVQEWLHRVMGAASVLQYPPLVQVLEAYRRVIAERSPEQLRNAGYALIRQCEA
FT                   MLDGIEQQAALLA"
FT   gene            383045..383479
FT                   /locus_tag="BC1002_0354"
FT   CDS_pept        383045..383479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0354"
FT                   /product="CHRD domain containing protein"
FT                   /note="KEGG: bxe:Bxe_A4065 hypothetical protein; PFAM: CHRD
FT                   domain containing protein; SMART: CHRD domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14460"
FT                   /db_xref="InterPro:IPR010895"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBD1"
FT                   /inference="protein motif:PFAM:PF07452"
FT                   /protein_id="ADG14460.1"
FT                   /translation="MISQRKLNLAVVLWALASSAAFADTVALKANLQPSSEVPPRVSHG
FT                   HGMLNATFDTSTQSLQWTITYEGLSGPVTAAHFHGPAPVGQNAKVQVPIEKNGLASPIK
FT                   GTVKLTEQQVMDLMAGQWYFNIHTAQNPTGEIRGQVLPAN"
FT   sig_peptide     383045..383116
FT                   /locus_tag="BC1002_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            383613..384581
FT                   /locus_tag="BC1002_0355"
FT   CDS_pept        383613..384581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0355"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: bpy:Bphyt_0635 alpha/beta hydrolase fold-3 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14461"
FT                   /db_xref="GOA:D5WBD2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBD2"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ADG14461.1"
FT                   /translation="MSWQSALACWYLRRQFRPETLKPFINVERARALTSKRVWSPRVPP
FT                   GWHLRETYGAGDAPLVGEWLERVHGGTAGGAEATVLYCHGGGYYFCSPRTHRSLTFALA
FT                   TRADARLFSLDYRLAPEHRFPAALDDATAAYRQLLAMGIAPSSIVIAGDSAGGGLALAT
FT                   LVALRDAGAPMPAGGLLFSPWTDLATTGASLRTNDSVDPMFCGASIERAAKVYLGDAPP
FT                   THPYASPVYADLRGLPPLFLQAGSTEVLLDDARRVADNAHAAGVDCECEVWKNLPHVWP
FT                   MFAPFMPEANRALDRAAAFVRRTTSRAANRAQASSVMSSVR"
FT   gene            complement(384548..385387)
FT                   /locus_tag="BC1002_0356"
FT   CDS_pept        complement(384548..385387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0356"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0636 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14462"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBD3"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0636"
FT                   /protein_id="ADG14462.1"
FT                   /translation="MQPSSLAASSLSEQDLAALRRAKHQLESPALAMKLASVVGAPIEK
FT                   LLSRIPAFANEKVSDATQAALRKCLSIALRTLGRRDDARLLAPDKPNNLLHKFAVATTG
FT                   AAGGAFGLLALPVELPVTTTLMFRSICDIARSEGEDLTSVDTQLQCLTVLGMGGTSSED
FT                   DDADLGYFFMRGALAQAVSKASSEVASKGFTAHGSAALLRLINAIAARFSVQVSEQIAA
FT                   KSIPAIGAVLGAMVNTVFIDHFQQVAHGHFTVRRLERQYGQQTIEAVYRTLDMTLDA"
FT   gene            385526..387121
FT                   /locus_tag="BC1002_0357"
FT   CDS_pept        385526..387121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0357"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_A4062 major facilitator superfamily multidrug
FT                   efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14463"
FT                   /db_xref="GOA:D5WBD4"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBD4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG14463.1"
FT                   /translation="MAVHTAAHHSSGQVLPFRESLLAMLGISFVTMLVALDQTVVGTAL
FT                   PTIVSELRGFELYAWVATSYLLSSVITVPIFGRLGDYYGRKPFVIASIVVFTGASVLCG
FT                   AANDMLFLVLARGLQGIGGGMLVGTAFACIPDLFPDSVVRLRWQVLMSSAFGIANAVGP
FT                   SLGGFLTQYYGWRSVFYVNLPVGLLSLFFVWRFLPHLRHVEHEGKMRLDWPGALLIAIA
FT                   LGSLQLFVELLPKHGITLSVFALLGLSVASAIALWNWEKRCPTAILPVDMFHNRSLAAL
FT                   FTLAVLGGFTMFSLLFYAPLLFQGGFGMSPKEAGLVITPLVVFITIGSIANGRVVSRIK
FT                   NPNLMLYIGFAMLALSCLGIVVATRSMQQWVLMSFMVVGGLGLGFVMPNLTIFAQQTAG
FT                   REHLGIATALLQSLRMIGGMIGTALTGTLVTHMYKSGVRRALEGAGASHWFGDLGDPQI
FT                   LINRDAQTTLVDQLTHAGHNGAMLLESARESLVGAIHLGLAMAALIAVVSVWQSRRVPP
FT                   VKLQRKLEPVIHAD"
FT   gene            387152..387655
FT                   /locus_tag="BC1002_0358"
FT   CDS_pept        387152..387655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0358"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: bpy:Bphyt_0638 transcriptional regulator, MarR
FT                   family; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14464"
FT                   /db_xref="GOA:D5WBD5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBD5"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADG14464.1"
FT                   /translation="MEEQDRVAVMQQFGRTYRAFMSAFETQVGHPLPRWRILLALHEQA
FT                   GESSQKRLVERLRVDPGALTRQLKALESLGWIARSMDTRDNRVTNVRLTEAGRDATEAS
FT                   LPRRQAFLHDTMAGLPDEALAALSSALKMLETRIGEVAANASAAAGAAAAAPETAGDEA
FT                   AQRV"
FT   gene            complement(387770..389047)
FT                   /locus_tag="BC1002_0359"
FT   CDS_pept        complement(387770..389047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0359"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   bpy:Bphyt_0639 putative D-serine deaminase (d-serine
FT                   dehydratase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14465"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBD6"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ADG14465.1"
FT                   /translation="MKVTNYQGATIDPYSKGLGMVPGTSVQLKDAARLEWNLLAEDVSL
FT                   PAAVLYEDRVEHNLKWMQAFVAEYGVKLAPHGKTTMAPQLFRRQLETGAWGITLATAHQ
FT                   VRAAYHGGVSRVLMANQLVGRHNMMMIAELLSDPDFEFFCLVDSADGVEQLGEFFTSVK
FT                   KPLQVLLELGVPGGRTGVRDEAQRNAVLDAIARYPDVLKLAGVELYEGVLKEEPEVRAF
FT                   LQGAVAVTRELVEQGRFARSPAVLSGAGSAWYDVVAEEFAQATQTGKVEVVLRPGCYLT
FT                   HDVGIYRKAQTDIFKRNPVAKKMGEGLLPALQLWAYVQSIPEPDRAIIGLGKRDSAFDA
FT                   GMPEPARHYRPGQQAPRDIAASEGWEIFGLMDQHAYLRIPPGADLKVGDMIAFDISHPC
FT                   LTFDKWKQVLVLDPQYRVKEVIETFF"
FT   gene            389114..390091
FT                   /locus_tag="BC1002_0360"
FT   CDS_pept        389114..390091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0360"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: sugar isomerase (SIS); helix-turn-helix
FT                   protein RpiR; KEGG: bxe:Bxe_A4059 RpiR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14466"
FT                   /db_xref="GOA:D5WBD7"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBD7"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="ADG14466.1"
FT                   /translation="MTGEMLFSTTVSKAAGKGRESRAAIPPSVMNSSAEPLAFDIVARI
FT                   AECAPELRSAERKVAALILDDLTGASRASIGALAQQAEVSIATVTRFAKAVGCRDVREL
FT                   KLRLAQAAAVGQRFLERDAASDAPEPIATRVFDELQTALAHNHQLLRQAPLAEAAAALR
FT                   NARMIYVFGMGGGSTALADEMRFRLVRLGRPVATYQDGLLQRMVASTVSRDCVVVALST
FT                   TGRVPEMVENCKIARSYGATVVAVTAPASPLARLADWLIPIVAFETDFIYKPSSSRYAM
FT                   MMALDVLVTELAVSQGDESRELLRRMKHALDAHRGGGDRQPLGD"
FT   gene            390095..391576
FT                   /locus_tag="BC1002_0361"
FT   CDS_pept        390095..391576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0361"
FT                   /product="N-acyl-D-amino-acid deacylase"
FT                   /EC_number="3.5.1.81"
FT                   /note="KEGG: bxe:Bxe_A4058 N-acyl-D-amino-acid deacylase;
FT                   PFAM: Amidohydrolase 3; D-aminoacylase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14467"
FT                   /db_xref="GOA:D5WBD8"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR023100"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBD8"
FT                   /inference="protein motif:PRIAM:3.5.1.81"
FT                   /protein_id="ADG14467.1"
FT                   /translation="MHSHPEAADTLIVGAQLYDGTGAPPVERDVAIRDGRIAAIGNLSN
FT                   WLAEEVIEAEGRALAPGFIDVHTHDDTHVIRSPQMLPKITQGVTTVIVGNCGISASPVS
FT                   LKGDPPDPMNLLGERDAFQYPTFADYVSAVNAARPAVNVGALIGHTALRNNQMDRLDRA
FT                   ATAEEIERMCAQLEEALAHGALGLSSGLAYGSAFAAPTEEVMALAEPLAAAGALYTTHM
FT                   RTEFDAILDAMDEAYRVGRHARVPVVISHLKCAGPSNWGRSVEVLKSLEGARGGQPVGC
FT                   DCYPYNRSSSTLDLKQVTGDIDITITWSEPHPEMAGKLIKEVAAEWGVSQQEAGKRLQP
FT                   AGAVYHNMSEEDVRRILSHPATMVGSDGLPNDPLPHPRLWGAFPRVLGHYARDAALLPL
FT                   EEAVRKMTSLSARRFGLAQRGEVHIGYHADLVLFDPAKVHDVATFDKPQQPAAGIDAVW
FT                   VNGVLSYRDGAVTGERAGRFLTRGAPSKGDAQGAF"
FT   gene            391649..392035
FT                   /locus_tag="BC1002_0362"
FT   CDS_pept        391649..392035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0362"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: bpy:Bphyt_0642
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14468"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBD9"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ADG14468.1"
FT                   /translation="MKRYGVEGGKGTGGQVMPFARAVEADGWLFVSGQTPMENGEVING
FT                   GIVEQSHKAIQNVFAILKEAGYGAEHVVRCGVWLDDPRDFASFNKVFREYFGENPPARA
FT                   CVVSSMVIDCKVEVDCVAYKKPAA"
FT   gene            complement(392133..392957)
FT                   /locus_tag="BC1002_0363"
FT   CDS_pept        complement(392133..392957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0363"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /EC_number="1.7.1.13"
FT                   /note="TIGRFAM: 7-cyano-7-deazaguanine reductase; KEGG:
FT                   bxe:Bxe_A4056 7-cyano-7-deazaguanine reductase; PFAM: GTP
FT                   cyclohydrolase I/Nitrile oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14469"
FT                   /db_xref="GOA:D5WBE0"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBE0"
FT                   /inference="protein motif:TFAM:TIGR03138"
FT                   /protein_id="ADG14469.1"
FT                   /translation="MTPEQSPLGKSSTYTEQYDPTLLFPIARSHAREAIGITARLPFFG
FT                   TDIWNAYELSWLNARGKPQIAVATFFVPADSPNIVESKSFKLYLGSFAQTAFESTESVR
FT                   DTIKRDVSASCGATVSVHLYTPHEFGKLKMEEFDGLSLDRLELEASVYQPDASLLSAAH
FT                   DEAPVEETLFSNLLKSNCPVTGQPDWGSVQIHYAGPQIDHAGLLRYIISYRNHTGFHEQ
FT                   CVERIFVDIMKRCKPLKLAVYARYTRRGGLDINPFRTNYNLPMPDNMRLARQ"
FT   gene            complement(392954..393859)
FT                   /locus_tag="BC1002_0364"
FT   CDS_pept        complement(392954..393859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0364"
FT                   /product="5'-nucleotidase"
FT                   /EC_number="3.1.3.5"
FT                   /note="KEGG: bpy:Bphyt_0644 5'-nucleotidase; PFAM:
FT                   5-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14470"
FT                   /db_xref="GOA:D5WBE1"
FT                   /db_xref="InterPro:IPR010394"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBE1"
FT                   /inference="protein motif:PRIAM:3.1.3.5"
FT                   /protein_id="ADG14470.1"
FT                   /translation="MALSLVDKLVVAISSRALFDFEEENRVYEAGDLKAYEALQRERLN
FT                   VPAKPGVAFPLIRKLLALNAAGGHRVEVVILSRSDPISGLRAFHSCREHGLAIERGVFT
FT                   RGRAPFAYLKPLNASLFLSANQQDVRDALAAGFPAARVLPESAKMASKYPDEIRIAFDG
FT                   DAVLFSDEAERIFQKDGLRAFVGHEIDNKHLPLADGPLKPLLEALHRLQKLADAAAPMR
FT                   IRTALVTARSAPAHERAIRTLMAWNIEIDEAMFLGGLDKSAFLREFEPDFFFDDQIGHC
FT                   ESARVVTATGHVLSGIVNAS"
FT   gene            complement(393883..395406)
FT                   /locus_tag="BC1002_0365"
FT   CDS_pept        complement(393883..395406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0365"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /note="KEGG: bxe:Bxe_A4054 threonine dehydratase; TIGRFAM:
FT                   threonine dehydratase, biosynthetic; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   Threonine dehydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14471"
FT                   /db_xref="GOA:D5WBE2"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBE2"
FT                   /inference="protein motif:TFAM:TIGR01124"
FT                   /protein_id="ADG14471.1"
FT                   /translation="MASHDYLKKTLTARVYDVARETELERAPNLSARLRNPVYLKREDN
FT                   QPVFSFKLRGAYNKMAHIPAEALGRGVITASAGNHAQGVALSAARMGVKAIIVVPVTTP
FT                   QVKVDAIRTHGGPTVEVVQFGESYSDAYGHAVKLQEERGLTFVHPFDDPYVIAGQGTVA
FT                   MEILSQHQGPIHAIFVPIGGGGLAAGVAAYVKSVRPEIKVIGVQTDDSCAMAASLKAGE
FT                   RVTLNEVGLFSDGTAVKLVGEETFRLCSEYLDEVLLVNTDALCAAIKDVFQDTRSVLEP
FT                   AGSLAVAGAKQYAEREGIENQTLIAITSGANMNFDRMRFVAERAEVGEAREAVFAVTIP
FT                   EERGSFKRFCELVGTRSVTEFNYRIADANSAHIFVGVQIRNRSEPAQIADAFEAHGFAT
FT                   VDLTFDELSKQHIRYMVGGRSPLARDERLFRFEFPERPGALMKFLSSMAPNWNISLFHY
FT                   RNQGADYSSILVGIQVPESDHAAFERFIETLGYPCWEETKNPVYRLFLA"
FT   gene            395950..400056
FT                   /locus_tag="BC1002_0366"
FT   CDS_pept        395950..400056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0366"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; protein of
FT                   unknown function DUF224 cysteine-rich region domain
FT                   protein; KEGG: bpy:Bphyt_0646 FAD linked oxidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14472"
FT                   /db_xref="GOA:D5WBE3"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021817"
FT                   /db_xref="InterPro:IPR022153"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBE3"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADG14472.1"
FT                   /translation="MNAPQVFDPHGAAAAVAADPEARLREIPYNYTSFSDREIVIRLLG
FT                   NDAWDALAELRAERRTGRSARMLYEVLGDIWVVRRNPYLQDDLLDNPKRRALLIEALNH
FT                   RLAEIEKRRRADLSEHGDEAGVDRAARVEKLVQAARRAIDQFASEFQQTYDLRRRTTRV
FT                   LGKVTQKDNIKFDGLSRVSHVTDATDWRVEYPFVVLTPDSEAEIAGMIKACFELGLTVI
FT                   PRGGGTGYTGGAVPLTPFSAVINTEKLEQLGPVEMTQLPGVDRKVATIFSGAGVVTRRV
FT                   TEAAEQAGFVFAVDPTSLDASCVGGNVAMNAGGKKAVLWGTALDNLAWWRMVDPEGNWL
FT                   EVTRLEHNMGKIHDIEVARFELKWFDGNYAPGEKLLRTESLDIKGRVFRKEGLGKDVTD
FT                   KFLAGLPGVQKEGCDGLITSARWVLHKMPAHTRTVCLEFFGQAREAIPSIVEIKDYLFE
FT                   TSRQGGAILAGLEHLDERYLRAVGYATKSKRNAFPKMVLIGDIVGDDADAVAQATSEVV
FT                   RMANGKSGEGFVAVSAEARKRFWLDRSRTAAIAKHTNAFKINEDVVIPLDRMDEYTDGI
FT                   ERINIELSLKNKLQLVDALEAFFKGGKLPLGKSDDANEIPSAELLEDRVQQALDLLARV
FT                   RTRWEFVRDKLDLSLREAQHYLVGLGYESLAEKFADRVDAQPDATVFHLAQDRTIRVSW
FT                   KQEIRAELRQIFNGGEFKPILDEAQAIHKQVLRGRVFVALHMHAGDGNVHTNLPVNSDN
FT                   YEMLQDAHAAVARIMKLARSLDGVISGEHGIGITKLEFLTDDEIGEFRKYKQRVDPHGR
FT                   FNAGKLLEGADLRNAYTPSFGLMGYESLIMQQSDIGAISESIKDCLRCGKCKPVCATHV
FT                   PRANLLYSPRNKILATSLLVEAFLYEEQTRRGVSIKHWDEFNDVADHCTVCHKCVTPCP
FT                   VKIDFGDVSMNMRNLLRKMGKKKFNPGNAAGMFFLNATNPQTINLARTAMMGVGYKAQR
FT                   LGNEVLKKFTKKQTAHPPATVGKPAITQQVIHFMNKKMPGNLPKKTARALLDIEDNKIV
FT                   PIIRNPKTTTADTEAVFYFPGCGSERLFSQVGLATQAMLWEAGVQTVLPPGYLCCGYPQ
FT                   RGSGQYDKAEQIVTDNRVLFHRVANTLNYLDIKTVVVSCGTCYDQLAGYEFEKIFPGCR
FT                   IIDIHEYLLEKGIKLDGVNGVRYMYHDPCHSPIKTMDPVKLVNQLMGSEQDGYKIEKND
FT                   RCCGESGTLAVTRPDISTQVRFRKEEEIRKGAAKLRGIPLVAEAGANAINPANASAGSA
FT                   GAPNGSVLKAGDGPQPGNGNAGSTDVKILTSCPSCLQGLSRYNEDAGTEADYIVVEMAR
FT                   HVLGENWMADYVQRANNGGIERVLV"
FT   gene            400090..400518
FT                   /locus_tag="BC1002_0367"
FT   CDS_pept        400090..400518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0367"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   bxe:Bxe_A4052 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14473"
FT                   /db_xref="GOA:D5WBE4"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBE4"
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /protein_id="ADG14473.1"
FT                   /translation="MDCVFCREDGGDVLWQDDALRVVLADEHDYPGFCRVIWNAHVAEF
FT                   SDLSADERDHVMKAVYAVERAQRRVMQPAKVNLASLGNQVPHVHWHVIPRFSNDAHFPL
FT                   PIWAPRQRTVSEAMLSSRRAHATLLREAVRQEIEQALG"
FT   gene            400616..401029
FT                   /locus_tag="BC1002_0368"
FT   CDS_pept        400616..401029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0368"
FT                   /product="protein of unknown function DUF971"
FT                   /note="PFAM: protein of unknown function DUF971; KEGG:
FT                   bxe:Bxe_A4051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14474"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBE5"
FT                   /inference="protein motif:PFAM:PF06155"
FT                   /protein_id="ADG14474.1"
FT                   /translation="MSGLTPETPVPTGVVVHSKSRVLELQYANGEAYRLPFELLRVYSP
FT                   SAEVQGHGPGQETLQTGKRDVTITMIEGVGNYALQPTFSDGHSTGIYSWDLLYDMAVRQ
FT                   DELWRAYLAKLAAAGIDRDTPMVPAAAAHGHCH"
FT   gene            401096..401827
FT                   /locus_tag="BC1002_0369"
FT   CDS_pept        401096..401827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0369"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="KEGG: bpy:Bphyt_0649 ubiquinone/menaquinone
FT                   biosynthesis methyltransferase; TIGRFAM:
FT                   ubiquinone/menaquinone biosynthesis methyltransferase;
FT                   PFAM: UbiE/COQ5 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14475"
FT                   /db_xref="GOA:D5WBE6"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBE6"
FT                   /inference="protein motif:TFAM:TIGR01934"
FT                   /protein_id="ADG14475.1"
FT                   /translation="MSKTHFGFQSVDEQDKAQKVAGVFHSVAANYDLMNDLMSGGLHRA
FT                   WKVFTIAQANVRPGYKVLDIAGGTGDLSKAFAKQAGETGEVWHTDINESMLRVGRDRLL
FT                   DKGIITPTLLCDAEKIPFPDNYFDVVTVAFGLRNMTHKDIALAEMRRVLKPAGRLLVLE
FT                   FSKVWNPLKKVYDLYSFKVLPWLGERFAKDAESYQYLAESIRMHPDQETLKTMMEQAGL
FT                   DGVKYYNLSAGVVALHVGTKY"
FT   gene            401866..402870
FT                   /locus_tag="BC1002_0370"
FT   CDS_pept        401866..402870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0370"
FT                   /product="import inner membrane translocase subunit Tim44"
FT                   /note="PFAM: import inner membrane translocase subunit
FT                   Tim44; KEGG: bxe:Bxe_A4049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14476"
FT                   /db_xref="GOA:D5WBE7"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBE7"
FT                   /inference="protein motif:PFAM:PF04280"
FT                   /protein_id="ADG14476.1"
FT                   /translation="MSDSNLLSTRKVKGSLARRIGLIAMVGLLTAGTLASLDAEARRMG
FT                   GGRSFGRQSNSLQQQRQTPPPSQPAQNNQATQQSAQPAAPATKPTPPAAPNRNRWLGPI
FT                   AGLAAGLGIAALLSHFGLGEAFAGMFANVIVIALIAMVVIWLIRRFTGRKRDAAQPAYA
FT                   GTAPSLNTRGTDYIQEPRYTAPPTGSYLEPQGNPLTTPSLGATPSVPAGFDSEAFLRNA
FT                   KVYFVRLQAAWDVGNIDDIREFTTPEMFAEVRVDLTARGTQQNQTDVVQLNAELLGVEE
FT                   RATEYFASVRFSGLIREAPGAAAEPFVEVWNLTKANRAGEGWLLAGIQQVEQH"
FT   sig_peptide     401866..401973
FT                   /locus_tag="BC1002_0370"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.628) with cleavage site probability 0.390 at
FT                   residue 36"
FT   gene            403045..403689
FT                   /locus_tag="BC1002_0371"
FT   CDS_pept        403045..403689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0371"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   bpy:Bphyt_0651 sterol-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14477"
FT                   /db_xref="GOA:D5WBE8"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBE8"
FT                   /inference="protein motif:PFAM:PF02036"
FT                   /protein_id="ADG14477.1"
FT                   /translation="MTLAAKPFAAAVNHLLARESWARERLAPYAGKTARLSCPPVVLAL
FT                   LVQPDGYLGTLDEADAHQFDVTISVPSDALPAFLQGGQAAVMKHVKIEGDAEFATVIAK
FT                   LAEHLRWEPEEDLAKLIGDGPAWRITALVRSVGEHVQRTGRNLLDTAAEYLLDENPQLV
FT                   RRTALADFNVELARARDSLARVEKRIERLEQKVEARGPQASGGAATSRGTR"
FT   gene            403705..405282
FT                   /locus_tag="BC1002_0372"
FT   CDS_pept        403705..405282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0372"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /note="KEGG: bxe:Bxe_A4047 putative ubiquinone biosynthesis
FT                   protein UbiB; TIGRFAM: 2-polyprenylphenol 6-hydroxylase;
FT                   PFAM: ABC-1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14478"
FT                   /db_xref="GOA:D5WBE9"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBE9"
FT                   /inference="protein motif:TFAM:TIGR01982"
FT                   /protein_id="ADG14478.1"
FT                   /translation="MRFLRFLKIFFTVIRFGLDEMMLSRINDRRVRLLLRITTLGRKFD
FT                   APPGVRLRLALESLGPIFVKFGQVLSTRRDLLPVDIANELAKLQDQVPPFDSAVAIALV
FT                   EKSLGAPVDVLFDDFERVPVASASIAQVHFATVKAGQHAGKAVAVKVLRPNMLPVIDSD
FT                   LALLRDIAVWAERLWADGKRLKPREVVAEFDKYLHDELDLMREAANGSQLRRNFQGLDL
FT                   LLVPEMYWEFCTPTVLVMERMVGVPISQVDTLRAAGVDIPKLAREGVEIFFTQVFRDGF
FT                   FHADMHPGNIQVSLDPAHFGRYIALDFGIIGALSDFDKNYLAQNFLAFFKRDYHRVATL
FT                   HLESGWVPPTTRVEELESAIRAVCEPYFDRALKDISLGQVLMRLFSTSRRFNVEIQPQL
FT                   VLLQKTMLNVEGLGRSLDPELDLWKTAKPYLERWMNEQIGVRGWYERLKIEAPQWSKTL
FT                   PQLPRLVHNMLAERHHPVGGANDDVIRQILLEQKRTNRLLQGLLLFGVAVGVGAMLARA
FT                   FLTLAYGG"
FT   gene            405377..406000
FT                   /locus_tag="BC1002_0373"
FT   CDS_pept        405377..406000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0373"
FT                   /product="thiopurine S-methyltransferase"
FT                   /note="PFAM: thiopurine S-methyltransferase; KEGG:
FT                   bxe:Bxe_A4046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14479"
FT                   /db_xref="GOA:D5WBF0"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBF0"
FT                   /inference="protein motif:PFAM:PF05724"
FT                   /protein_id="ADG14479.1"
FT                   /translation="MSDPTQPPMPDFENRDPNSPEFWDERFERRFTPWDQAGVPSAFRA
FT                   FADRHRDVAVLIPGCGSAWEAKWLARQGNPVRAIDFSAAAVAAAREQLGAQRASLVEQA
FT                   DFFSYAPPFTPAWIYERAFFCALPPTRRADYAQRMAELLPSGGLLAGFFFIGATPKGPP
FT                   FGVERDELDALFTPRFELIEDEAVDDSIGVFAGHERWLTWRRRG"
FT   gene            406175..406507
FT                   /locus_tag="BC1002_0374"
FT   CDS_pept        406175..406507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0374"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="KEGG: bxe:Bxe_A4045 hypothetical protein; TIGRFAM:
FT                   regulatory protein, FmdB family; PFAM: Putative regulatory
FT                   protein FmdB"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14480"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBF1"
FT                   /inference="protein motif:TFAM:TIGR02605"
FT                   /protein_id="ADG14480.1"
FT                   /translation="MPIYAYRCGSCGFGKDVLQKMSDPQLTQCPECGKDTFSKQLTAAG
FT                   FQLKGSGWYVTDFRGGSGGTSAPAASEAKSEPSAAAASAEQAAPAAPAAPAAAAAAASP
FT                   SGSGSA"
FT   gene            406547..407239
FT                   /locus_tag="BC1002_0375"
FT   CDS_pept        406547..407239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0375"
FT                   /product="protein of unknown function DUF502"
FT                   /note="PFAM: protein of unknown function DUF502; KEGG:
FT                   bxe:Bxe_A4044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14481"
FT                   /db_xref="GOA:D5WBF2"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBF2"
FT                   /inference="protein motif:PFAM:PF04367"
FT                   /protein_id="ADG14481.1"
FT                   /translation="MGLGPRSFLAVYMTTKKFTLKSVFLTGLLVLVPLAITLWVLGLII
FT                   GTMDQTLLLLPTSWQPERAIGYRLPGLGAVLTLAFIFVVGLLTQNFIGQKLVKWWELLV
FT                   AHIPVVGPLYTSVKQVSDTLLSSSGNAFRKALLIEYPRRGSYTIAFLTGIPGGDVANHL
FT                   KEDYVSVYVPTTPNPTSGFFLMVPKSEVIELDMTVDAALKYIVSMGVVAPSAPPPAPVR
FT                   RTTVEPPL"
FT   gene            407315..409114
FT                   /locus_tag="BC1002_0376"
FT   CDS_pept        407315..409114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0376"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="KEGG: bxe:Bxe_A4043 aspartyl-tRNA synthetase;
FT                   TIGRFAM: aspartyl-tRNA synthetase; PFAM: tRNA synthetase
FT                   class II (D K and N); nucleic acid binding OB-fold
FT                   tRNA/helicase-type; GAD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14482"
FT                   /db_xref="GOA:D5WBF3"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBF3"
FT                   /inference="protein motif:TFAM:TIGR00459"
FT                   /protein_id="ADG14482.1"
FT                   /translation="MSMRSEYCGLVTEELLGQSVSLCGWVSRRRDHGGVIFIDLRDREG
FT                   LVQVVCDPDRADMFKIAEGVRNEFCVQVKGVVRGRPEGTTNASLKSGKIEVLCHELIVL
FT                   NASVTPPFQLDDDNLSETTRLTHRVLDLRRPQMQHNLRLRYRVAIEVRKYLDEQGFIDI
FT                   ETPMLTKSTPEGARDYLVPSRTNPGQFFALPQSPQLFKQLLMVANFDRYYQITKCFRDE
FT                   DLRADRQPEFTQIDCETSFLSEQEIRDLFEAMIRHVFKTTIGVQLDEKFPVMEYAEAMR
FT                   RFGSDKPDLRVKLEFTELTDAMRDVDFKVFSTPANTKDGRVAALRVPKGGELSRGDIDS
FT                   YTEFVRIYGAKGLAWIKVNEAAKGRDGLQSPIVKNLHDDALKAIIERTGAQDGDIIFFA
FT                   ADRAKVVNDSLGALRLKIGHSEFGKANGLVESGWKPLWVVDFPMFEYDEEDNRYVAAHH
FT                   PFTSPKDEHLEYLETDPARCLAKAYDMVLNGWEIGGGSVRIYREEVQSKVFRALKINAE
FT                   EAQAKFGFLLDALQYGAPPHGGIAFGLDRIVTMMAGADSIRDVIAFPKTQRAQDLLTQA
FT                   PSEVDERQLRELHIRLRSPEPKA"
FT   gene            409295..409810
FT                   /locus_tag="BC1002_0377"
FT   CDS_pept        409295..409810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0377"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bxe:Bxe_A4042 dATP
FT                   pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14483"
FT                   /db_xref="GOA:D5WBF4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003564"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBF4"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADG14483.1"
FT                   /translation="MPKPPKIPQSVLVIIHTPALDVLLLERADHAAFWQSVTGSKDRLD
FT                   EPLADTAVREVGEETGIMVGGALVPRSALFDWQYSIDYEIYPEFRYRYEAGVLYNTEHW
FT                   FSLQVPERIDVSLAPREHTAYMWLPYEEAASRCFSSSNADAILQLPRRLATRTIDPQSG
FT                   PLAGERGQ"
FT   gene            409807..411066
FT                   /locus_tag="BC1002_0378"
FT   CDS_pept        409807..411066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0378"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="KEGG: bpy:Bphyt_0658 phospholipase
FT                   D/transphosphatidylase; PFAM: phospholipase
FT                   D/Transphosphatidylase; SMART: phospholipase
FT                   D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14484"
FT                   /db_xref="GOA:D5WBF5"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR030872"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBF5"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ADG14484.1"
FT                   /translation="MSAGGSGRLARLRHTLLGRRYWQRYRFTSNNEVELLRSGDDFFDA
FT                   LIERIDAAEHSVALETYIFCDDEAGQAVSEALLRAAARGVRVRVITDGIGTARLKMFEQ
FT                   WPSGGIEHRIYNPHLFGRFGFSRTHRKLAVIDDRIAYCGGINIVDDYENNGEKLPYHRW
FT                   DFAVELRGPVVGDVRDAIEVQWRRIRLGHRPLDSIRPDPSSQDANSLGSLRRRRRRRNE
FT                   ELWARGEPCVAFVARDNLINRRAIEKAYLAAIGQARHEILLANPYFMPGRKLRRALVFA
FT                   ARRGVVVKLIIGRKEFKALDYAVPFLYHALLRAGVQIAEYEKTLLHGKVAVVDSNWGTV
FT                   GSSNLDALSLMLNNEANVVLVNDPSIAKLRDAILDAFADARRIDEAHYESRPARVRALS
FT                   WIAYTSYRVAMKLLTVGGYD"
FT   gene            411276..411875
FT                   /locus_tag="BC1002_0379"
FT   CDS_pept        411276..411875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0379"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bpy:Bphyt_0660
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14485"
FT                   /db_xref="GOA:D5WBF6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBF6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG14485.1"
FT                   /translation="MRKGEQTRAAILDAALDLAGRDGLEGLTIGLLAERMQMSKSGVFA
FT                   HFGSREDLQVEVVREYHRRFEDEVFFPSLREPRGLPRLRAMISRWFEKRIQEVTTGCIY
FT                   ISGAVEYDDRADSQVREQLVSSVTTWRAALTRAISQAMEEGHLRADTDPELMLFELYSV
FT                   TLGLHHDARFLHLPDAVRLTWAALEKLINSYQSESR"
FT   gene            411974..413761
FT                   /locus_tag="BC1002_0380"
FT   CDS_pept        411974..413761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0380"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   bxe:Bxe_A4038 putative acyl-CoA dehydrogenase
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14486"
FT                   /db_xref="GOA:D5WBF7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBF7"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADG14486.1"
FT                   /translation="MGQYAAPLRDMQFVLHELLNVEGELRHMPKHADLDADTINAVLEE
FT                   AGKFCSEVLFPLNHSGDKEGCTYVGDGVVTTPKGFKEAYQQYVEAGWPALGCDPEYGGQ
FT                   GLPAFVNNALYEMLNSANQAWTMYPGLSHGAYECLHAHGTPELQQRYLPKLVAGVWTGT
FT                   MCLTEPHCGTDLGILRTKAEPNGDGSYSISGTKIFISSGEHDLAENIVHLVLARLPDAP
FT                   KGTKGISLFIVPKFVPNEAGEPGERNGVKCGSIEHKMGIHGNATCVINLDNAKGWMVGE
FT                   PNKGLNAMFVMMNAARLGVGMQSLGLTEVAYQNSLTYAKERLQMRSLTGPKAPEKAADP
FT                   IIVHPDVRRMLLTQKAYAEAGRAFSYWSALQIDKELSHADEAERKEAADLVALLTPILK
FT                   AFLSDNAFEGTNHAMQIYGGHGFIAEWGMEQYVRDARINMIYEGTNGIQSLDLLGRKVL
FT                   GDMGAKLKKFGKLVAEFVEAEGIKPEMQEFVNPLADIGEKVQKLTMEIGMKAMQNPDEV
FT                   GAAAVPYLRTVGHLVFSYFWARMARIALDKEASGDPFYKAKLATARFYFAKLLPETAMT
FT                   IRQARAGSKPMMDVEEALF"
FT   gene            413885..416320
FT                   /locus_tag="BC1002_0381"
FT   CDS_pept        413885..416320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0381"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein; Enoyl-CoA
FT                   hydratase/isomerase; KEGG: bpy:Bphyt_0662 3-hydroxyacyl-CoA
FT                   dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14487"
FT                   /db_xref="GOA:D5WBF8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBF8"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ADG14487.1"
FT                   /translation="MSNLIIRKVAVLGAGVMGAQIAAHLINAKVPVLLFDLPAKEGPKN
FT                   GIALKAIENLKKLSPAPFGVKDDAQYIQPANYDDDIEKLAECDVVIEAIAERMDWKHDL
FT                   YKKVAPHIGPSAIFATNTSGLSITALSEGFSDELKARFCGVHFFNPPRYMHLVELIPTA
FT                   TTRPEILDQLETFLTSVVGKGVVRAKDTPNFIANRVGVFSILAVIAEAGKFGLRFDEVD
FT                   DLTGARLGRAKSATFRTADVVGLDTMAHVIKTMQDTLPDDPFLPVYETPAVLAELVKKG
FT                   ALGQKSGAGFYRKEGKAIKVLDPKTGEYVDGGGKADEIVGRILKRPAGERLKLLRETQH
FT                   PQAQFLWSIFRDVFHYIALHLESIAGNARDVDLAIRWGFGWNEGPFEGWQTAGWKQVAE
FT                   WVQQDIAAGKSLANVPLPSWVLEGAVADKGGVHTAEGSWSPATQTFVPRSSLDVYKKQV
FT                   FRAPLIGETGADPKTYGKTLFETDAVRAWVDDRAGEDDVLIVSFKSKMNTIGPAVIEGL
FT                   TQAIELAEKEYKGLVVWQPTSLKLGTPGGPFSAGANLEEAMPAFMMGGAKGIEPFVKSF
FT                   QQGMLRVKYANVPVVAAISGIALGGGCELALHSAKRVAHIESYLGLVEVGVGLVPAGGG
FT                   LKEAALRAAEAASQVGATNDLLKFLQKSFENAAMAKVSSSALDARAMGYLKPSDTIVFN
FT                   VFELLDVAKKEARALAAAGYRAPLRATQVPVAGRSAISTIKASLVNMRDGRFISDHDFL
FT                   IASRIAEAVCGGDVEAGSLVDEEWLLQLERRAFVELLGTQKTQERIMGMLQTGKPVRN"
FT   gene            416346..417545
FT                   /locus_tag="BC1002_0382"
FT   CDS_pept        416346..417545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0382"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   bxe:Bxe_A4036 acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14488"
FT                   /db_xref="GOA:D5WBF9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBF9"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADG14488.1"
FT                   /translation="MTKQLQDAYIVAASRTPIGKAPRGMFRNTRPDELLVHAIKSAVAQ
FT                   VPGLDTGVLEDAIVGCAIPEAEQGLNVARIGALLAGLPNTVGGVTVNRFCASGLTALAM
FT                   AADRIRVGEAHALIAGGCESMSMVPMMGNKPSLSPHIFDRNEDVGIAYGMGLTAEKVAE
FT                   RWKISREAQDAFSVESHRRAIAAQQAGEFNDEIAAYTITDRVPDLATGEINVKTREVKL
FT                   DEGPRADTSMEGLAKLRAVFANKGSVTAGNSSQTSDGAGALIVVSEKILKQFNLTPLAR
FT                   FVSFAVRGVPPEIMGIGPKEAIPAALKAAGLKQDDLDWIELNEAFAAQSLAVIQDLGLD
FT                   ASKLNPLGGAIALGHPLGATGAIRAATVVHGLRRRNYKYGMVTMCVGTGMGAAGIIERL
FT                   "
FT   gene            417653..418432
FT                   /locus_tag="BC1002_0383"
FT   CDS_pept        417653..418432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0383"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bpy:Bphyt_0664 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14489"
FT                   /db_xref="GOA:D5WBG0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBG0"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADG14489.1"
FT                   /translation="MSGMMTDILVERADAVLTISFNRPGRKNAITAAMYQTMADTLVEA
FT                   QGDASVRAILIRGSAGIFSAGNDLEDFMKTPQVGGNPPVIQFLRAISAAEKPLVAAVAG
FT                   PAVGVGTTLLLHCDLVYAADTASFSLPFTQLGLCPEAASSLLLQRVAGYQAAAEKLLLG
FT                   EAFDAAEALRMGLVNRVLPAGEVDAFAASQAAKLAALPASSLRVTKSLMKRASQQEVQT
FT                   QMTEEFVHFGKMLLAPEAREAFKAFFEKRKPDFRQFD"
FT   gene            complement(418501..419385)
FT                   /locus_tag="BC1002_0384"
FT   CDS_pept        complement(418501..419385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0384"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="KEGG: bpy:Bphyt_0665 formate dehydrogenase family
FT                   accessory protein FdhD; TIGRFAM: formate dehydrogenase
FT                   family accessory protein FdhD; PFAM: formate dehydrogenase
FT                   subunit FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14490"
FT                   /db_xref="GOA:D5WBG1"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBG1"
FT                   /inference="protein motif:TFAM:TIGR00129"
FT                   /protein_id="ADG14490.1"
FT                   /translation="MNGQENGRATEAPNGQPHDLDSDEQAGAVQLEVHRHRGTAIETAT
FT                   DHVGQEWPVALVFNGISHAVMMCTPRDLEAFAVGFAISEGIVERGSDIQDIEVELHGHG
FT                   ELPHAEVQLQVVQQAFAGLKEKRRALAGRTGCGVCGIESIDLLDLKPQRVPDTGFLQRL
FT                   APDAIARAARALPEHQALTRLTGGLHAAAWCDAQGVIRYAFEDVGRHNALDKLIGQLVL
FT                   DRADTRDGFVFLSSRASYELVRKAARVDVPMVATISAPSSLAIAIAREARVRLVSFCRE
FT                   GSYVDYDTWQPQV"
FT   gene            419544..420020
FT                   /locus_tag="BC1002_0385"
FT   CDS_pept        419544..420020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bxe:Bxe_A4033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14491"
FT                   /db_xref="InterPro:IPR013481"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBG2"
FT                   /inference="protein motif:PFAM:PF09655"
FT                   /protein_id="ADG14491.1"
FT                   /translation="MGLNEAPLLFDFEVASSENFTYIPMSVRFNLDRFGLRITLAQWQQ
FT                   LPLEDRKLLARFPVEEDTQIEPNFDHALFEMLRTHANIEPEWFTPEESPAWRQTDSVPD
FT                   GVAHQAGLAGLAAPSVARWAELDPFKRYVLAKLSRKPEANHDFVPAMKEFGAAG"
FT   gene            420274..423441
FT                   /locus_tag="BC1002_0386"
FT   CDS_pept        420274..423441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0386"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   PAS fold domain protein; PAS fold-4 domain protein; KEGG:
FT                   bpy:Bphyt_0667 diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s); SMART: EAL domain protein; GGDEF domain
FT                   containing protein; PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14492"
FT                   /db_xref="GOA:D5WBG3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBG3"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADG14492.1"
FT                   /translation="MNPFLSKRLLINIAVVVVAVGANAFVAYTQIRGQRDADARLARST
FT                   SVRQNLDAYHAALGKALAVVHRRKESGDPVPPDAAASMMNTLASREDALRDELASEPSM
FT                   SGALASLSAARHALQHDLEDTLRGTASDLPGAASATSGAAPTGAPISAPLDASVDSAPS
FT                   NPQLASSLERVEAALATLRSEETRSLQAALAASASDSQRAMFVLLVTMLSGSVLLMLTF
FT                   GVRENSVREKLRSARALARNDERFRSLFDDHTVPMYIFDRDTLRFLAVNTAAIEQYGYT
FT                   ESEFLGMTIRAIRPTSEVARLERHLARSADLRQSHTMAGIWRHRRKDGSIISVNVSYHA
FT                   LNFMGRDASFVLADDVTDQINAEAEALRSNQMLEAVIDNIPQRIFWKDLNSRYLGCNMA
FT                   FARDAGLAYPEQVVGKSDTDLPWRAFADLLNEHDREVASTGVPKMNFEVDFVIDGVHRT
FT                   RVTSKLPFTDGDGQVIGVLGSYTDITEQKRADLALRLQSRALDASVNAILITAPSPSGN
FT                   LIEYVNPAFMRITGYDLDEVIGHDCRVLQRDDRDQEGVALIREALAANREVSAVVRNYR
FT                   KDGALFWNQLFIAPVPNAEGVITHHIGVINDVTELIRYQEQLEYQANYDGLTRLPNRNL
FT                   LRDRLEHALVVAQRHHTGVAVVFLDLDGFKNVNDSLGHSVGDRLLGVVAERLARCSRTS
FT                   DTVARHGGDEFVIVMTDTVDEQSLITWMERVRASIAEPVWLDGTELYVGCSMGASLFPQ
FT                   DGDDAETLMKKADVAMYRAKDMGRNTFQFYQPEMNASAGARLNLERRLRRALRDNEFLL
FT                   HYQPQVDIVSGQIVGIEALVRWHDPEAGLVPPSSFIPLAEESGLIGPLSEWVLREACRQ
FT                   NKAWQDQGLPPARVSVNLSARVFQQRNIAKLVMQVLAETGLEPRYLELELTESTIMRNA
FT                   EEAVLMLNELHALGIGLAIDDFGTGYSSLSYLKRFPVDRLKIDRSFVSDIGVSGDDETI
FT                   TSAIIALAHSLKLQVIAEGVETSAQLDFLKERACDEMQGFYFAKPLSTEGISELLHGGL
FT                   VPELEPA"
FT   gene            complement(423515..424126)
FT                   /locus_tag="BC1002_0387"
FT   CDS_pept        complement(423515..424126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0387"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bxe:Bxe_A4031 putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14493"
FT                   /db_xref="GOA:D5WBG4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBG4"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ADG14493.1"
FT                   /translation="MKLIGMLDSPYVRRVAICMKLLALDFEHESISVFRTYDQFAKINP
FT                   VVKAPTLVADNGAVVMDSAVILQYLATLAGPTPLFPTQADAALRAARLTGLALAACEKS
FT                   VQIVYERNLRPQEKQHEPWVERVRTQLLAAYAELERELREGPLPDTQQQFSAADVAVAV
FT                   AWQFTHMMLPDEVSKTDHPRLEQFSAFAESLPVFNDTPAQ"
FT   gene            complement(424249..424644)
FT                   /locus_tag="BC1002_0388"
FT   CDS_pept        complement(424249..424644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0388"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   bpy:Bphyt_0671 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14494"
FT                   /db_xref="GOA:D5WBG5"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBG5"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADG14494.1"
FT                   /translation="MTDLLQLPSKPCALRVMPQPSDANIHGDVFGGWIMAQVDIAGSIP
FT                   ASRRANGRVATIAVNSFLFKQPVFVGDLLSFYADIVKTGNTSVTVSVEVYAQRMSLSQE
FT                   VVKVTEAILTYVATDSDRRPRALPVLD"
FT   gene            424850..426748
FT                   /locus_tag="BC1002_0389"
FT   CDS_pept        424850..426748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0389"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bxe:Bxe_A4027 ABC transporter, fused ATPase
FT                   and inner membrane subunits; PFAM: ABC transporter related;
FT                   ABC transporter transmembrane region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14495"
FT                   /db_xref="GOA:D5WBG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBG6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG14495.1"
FT                   /translation="MRRAPSSEPSPISTGPRNDWQTILSLLPYLATYKWRVGIALGCLI
FT                   GAKVANLGVPIVMKHIVDSLASIRHLTALGRAQDAPGIVLLGGVGLLVVAYAVVRLSTS
FT                   FFTELREMLFSKVTESAVRQLALKVFRHLHGLSLRFHLERQTGGMSRDIERGTRGITQL
FT                   ISYSLYSILPTLVEVGLVLGFFVVKYEAYYAIVTFIALAAYIAFTVKVTEWRTHFRRTM
FT                   NELDSKANSRAIDSLLNYETVKYFGNEEWEASRYDENLKRYRAAAIKSQRSLSALNFGQ
FT                   QAIIGTGLVFILWRATQGVMAGRLTLGDLVLINTFMLQLYIPLNFLGVVYRELKQSLTD
FT                   MDRMFTLLGAPQEVPDAPNAVALQVRGAQVRFDNVSFAYESSRPILHDVSFTIAAGTTT
FT                   AVVGHSGSGKSTLARLLFRFYDLDRATGGAIRIDGQDIRDVTQDSLRASIGIVPQDTVL
FT                   FNDSIYYNIAYGRPSATRDEVIAAARAAHIHEFIESLPKGYDTPVGERGLKLSGGEKQR
FT                   VAIARTILKNPPILLFDEATSALDSRSERAIQHELDLIARERTTLIIAHRLSTVVHAQQ
FT                   IIVMDKGRIVERGTHAELLRANGLFAQMWALQQRAAQTTDAVERAEAVGAGDSAAK"
FT   gene            complement(426752..427465)
FT                   /locus_tag="BC1002_0390"
FT   CDS_pept        complement(426752..427465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0390"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: bpy:Bphyt_0673
FT                   nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14496"
FT                   /db_xref="GOA:D5WBG7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBG7"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ADG14496.1"
FT                   /translation="MTMSVKKAMIFAAGRGERMRPLTDTCPKPLLEVGGKPLIVWQIER
FT                   LARAGIRSIVINHAWLGAQLEAALGDGSRWQVELHYSPEHEALETAGGIAQALPLLTDD
FT                   GADHVFVAAAGDVYTDYDYAALHAHAGALKALPEPGMHLVMVPNPAFHPNGDFGLVDGV
FT                   LSLDTQPRLTFGSFGLYDTRMFRDLPRGTRRALSPYYRATIARGLASGELYEGVWENVG
FT                   TQAQLEALDRLLRAR"
FT   gene            complement(427469..428536)
FT                   /locus_tag="BC1002_0391"
FT   CDS_pept        complement(427469..428536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0391"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   bxe:Bxe_A4025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14497"
FT                   /db_xref="GOA:D5WBG8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBG8"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADG14497.1"
FT                   /translation="MTLPSTQDFTDPRLSLLKAWLQGHAARHALELDTIVPASSDASFR
FT                   RYFRLAGKPPQGNGAATLIAVDAPPPEKCREFAQIAQLLDAAGVHVPRVLEVDFDAGFM
FT                   LVTDLGTAPYLGALTDAQAAGDTRAARKLMRDALDALIRWQLCSREDVLPPFDEAFLHR
FT                   EMELMPEWFIGRHLGREVDAATRAQLDRTFALLIASARAQPQSFMLRDFMPRNLMIAEP
FT                   NPGVIDFQDAVYGPISYDVVSLLRDAFLSWDEEFELDCFVYYWERAKKAGLPVDADFGE
FT                   FYRQLEWMGLQRHIKVLGLFCRINYRDGKAHYMKDLPRFIGYARKVAERYAPLRGFAKL
FT                   LDDLEGRAQEIGYTF"
FT   gene            428761..431133
FT                   /locus_tag="BC1002_0392"
FT   CDS_pept        428761..431133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0392"
FT                   /product="Organic solvent tolerance protein"
FT                   /note="PFAM: Organic solvent tolerance protein; KEGG:
FT                   bxe:Bxe_A4024 putative organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14498"
FT                   /db_xref="GOA:D5WBG9"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBG9"
FT                   /inference="protein motif:PFAM:PF04453"
FT                   /protein_id="ADG14498.1"
FT                   /translation="MPPRQLSDTTPSCAVAPRKRRLVAALVAVPGLMPALAHAQLVGEA
FT                   AQPQPVYPPWGMQLAPQLEDHPLQTGQRPATFVLGDHASGTVDQDLAAKGSAEVRHNTS
FT                   VIKADGLHYDQDTDMADAYGNVHVINTGNTFIGPEAHLRVDSTEGFMTAPKYRFTLTGG
FT                   SGSAQRVDLLDAERSVFTKATYTACACTDDPAWYIKGSEFDFDTGADEGVAYNSVLFFQ
FT                   GVPVFASPWLSFPLSGERRSGLLPPTFSLSSSNGFELSVPYYFNIAPNRDLTVTPRLIS
FT                   KRGVQLQSTFRYLSPTYSGSITGEFLPDDRLTKTNRYALYIQHNQNFGNGFGGYIYYNK
FT                   VSDNTYPQDLSSSVNQFMNGLQLLYQQEAGVTYNNGPWSVLAREQHWQTLQESVAPYGR
FT                   EPQLNVKYAKYNVGGFDFGAEADYTNFRITTADLTEGQRVLFNPYVSYSVVGPGYFVTP
FT                   KVQWHFASYNLNNIGTDLNGVPNPQKNFTESIPTFTFDTGLTFERSVRLFGQDFIQTLE
FT                   PRLYYVYTPYRNQNNAPLFDTAESDFGLAEIFTPNTFVGNDRIADANRLTAGLTTRFIN
FT                   PATGDERARFVIAQQYYFRDQRVTLQPSQTSAQATHSDLIAGAAIKLGAGFASETAFQY
FT                   NADNNQLTKTSVGFGFSPETGKVLNVAYRYTRANTTLDNQPINQVLISGQWPLSHRMYG
FT                   VGRFNYDLGGHRIVDGLVGLQYDADCWTLGAGIQRYANGLNSSGQTQSSTRFLAQLTFK
FT                   GLSSVDNGLMTAFRSSVAGYTPLPPPPPPESRFTNYE"
FT   gene            431130..432563
FT                   /locus_tag="BC1002_0393"
FT   CDS_pept        431130..432563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0393"
FT                   /product="SurA domain protein"
FT                   /note="PFAM: SurA domain; PpiC-type peptidyl-prolyl
FT                   cis-trans isomerase; KEGG: bpy:Bphyt_0676 SurA domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14499"
FT                   /db_xref="GOA:D5WBH0"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBH0"
FT                   /inference="protein motif:PFAM:PF09312"
FT                   /protein_id="ADG14499.1"
FT                   /translation="MTVARSFMACEKTGEAPDIIGVSVAIMKQLRLAILAAGLVAAASF
FT                   VPVASVQAQALGGNSGQTVDTIAAVVNNGVITQRELDERVGLIAHRLNQQNAPVPPTDQ
FT                   LRQQVLTQMVLERIQLQKAKEDGINIDDAAVQRTLERLAQANNMPLAMYRARIEAQGVP
FT                   WATFSNDARTELTLSRLREKEVDSKITVTDAEVANYIASQRGPGAGQTSDLHMQHIFVS
FT                   APLNAPETDIEAAQKKAQGLLAEAKGGADFGKLAKANSQAPDASKNGGDLGFLAPSKLP
FT                   PEFVKAASTLRPGEISPDLIRTNDGFEIVRLVERRAGQGTSADAPKLVQTHVRHILLRV
FT                   GDGQSEPQARQKLIDIRNQIAAGGDFAKFAHTYSQDGSSSQGGDLGWISPGETVPEFER
FT                   AMNALQDGQISEPVRSEYGYHLIQVLGRRDAEGSIAQQMDLARQAIGQRKAEQAYADWL
FT                   RELRDTAYVEVKPTTANVQ"
FT   gene            432577..433587
FT                   /locus_tag="BC1002_0394"
FT   CDS_pept        432577..433587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0394"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="TIGRFAM: 4-hydroxythreonine-4-phosphate
FT                   dehydrogenase; KEGG: bpy:Bphyt_0677
FT                   4-hydroxythreonine-4-phosphate dehydrogenase; PFAM:
FT                   Pyridoxal phosphate biosynthetic protein PdxA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14500"
FT                   /db_xref="GOA:D5WBH1"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBH1"
FT                   /inference="protein motif:TFAM:TIGR00557"
FT                   /protein_id="ADG14500.1"
FT                   /translation="MTSAAQPTHRPLQIAITTGEPAGVGPELTVQALAGAAAHWPHAQF
FT                   TVLGDAQLLAERARAVGVDWTALLVQGPRVRLEPHPLGAPAQAGKLDAANGRYVLDLLD
FT                   AAIDGAVAGKFDAIVTAPLQKSTINDAGVPFTGHTEYLAERTHTPRVVMMLAGTGKRPL
FT                   RVALATTHLPLKDVSAALTIESLVATLRIIDHDLRHHFGLPAPRILVTGLNPHAGENGY
FT                   LGREEIDVITPALQQVNGEGIDARGPYPADTLFQPRYLEEADCVLAMFHDQGLPVLKFA
FT                   TFGEGINVTLGLPIIRTSVDHGTALDLAGTGRADAGSLMAAIDTAVSMAQHRRAG"
FT   gene            433696..434538
FT                   /locus_tag="BC1002_0395"
FT   CDS_pept        433696..434538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0395"
FT                   /product="dimethyladenosine transferase"
FT                   /note="TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; KEGG:
FT                   bxe:Bxe_A4021 dimethyladenosine transferase; SMART:
FT                   Ribosomal RNA adenine methylase transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14501"
FT                   /db_xref="GOA:D5WBH2"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBH2"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ADG14501.1"
FT                   /translation="MSTSRQQGRHQGHLARKRFGQNFLVDMGVIDSIVDVIRPKRGERM
FT                   VEIGPGLGALTEPLIERLATPESPLHAVELDRDLIGRLKTKFGELLELHSGDALEFDFG
FT                   SLAAPGDKASLRIVGNLPYNISSPLLFHLATFADRVIDQHFMLQNEVVERMVAEPGTKA
FT                   FSRLSVMLQYRYVIDKQLDVPPESFQPPPKVDSAIVRMIPYERHELPMVDENVLGEVVT
FT                   AAFSQRRKMLRNTLAALRDTVDFDALGFDLQRRAEDVPVAEYVSVAQAVAARSAAAPE"
FT   gene            complement(434584..435531)
FT                   /locus_tag="BC1002_0396"
FT   CDS_pept        complement(434584..435531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0396"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bxe:Bxe_A4020 DMT family permease"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14502"
FT                   /db_xref="GOA:D5WBH3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBH3"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADG14502.1"
FT                   /translation="MSTTTALPARRAPDSFAILLMIGLCAIWGLQQVAIKTTNAAVPPV
FT                   FQAGLRSTIAALLVWAWARSRGTPLFRDDGTLGAGLVAGVLFAAEFVCIFFGLTLTSAS
FT                   RMAVFLYTAPCFTALGLHWFVDGERMRRIQWLGIVVAFAGIALAFADGFLHPDAGATAS
FT                   AAHGSTLAGAAGDALGVLAGIAWAATTVVVRGSRLAQTSASKTLFYQLTVSAVVLLALA
FT                   LTLGEVRVESVTPLAFASLAYQAVIVAFVSYLLWFWMLTRYIASRLSVFSFLTPMFGVT
FT                   FGVLLLGESFGARFLIAALLVLTGIALVNAPAKR"
FT   gene            complement(435701..436096)
FT                   /locus_tag="BC1002_0397"
FT   CDS_pept        complement(435701..436096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0397"
FT                   /product="lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /note="TIGRFAM: lactoylglutathione lyase; KEGG: bav:BAV0701
FT                   lactoylglutathione lyase; PFAM: Glyoxalase/bleomycin
FT                   resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14503"
FT                   /db_xref="GOA:D5WBH4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBH4"
FT                   /inference="protein motif:TFAM:TIGR00068"
FT                   /protein_id="ADG14503.1"
FT                   /translation="MRILHTMLRVGDLDASIRFYTEVLGMRLLRKNDYPEGKFTLAFVG
FT                   YEDESEGAAIELTYNWDTSKYDLGTGYGHIALEVDDAYAACEQVKKRGGVVTREAGPMK
FT                   HGTTVIAFVADPDGYKIELIQKKGRVD"
FT   gene            436433..437269
FT                   /locus_tag="BC1002_0398"
FT   CDS_pept        436433..437269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0398"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: bph:Bphy_6677 extracellular solute-binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   3; SMART: extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14504"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBH5"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADG14504.1"
FT                   /translation="MKLANRGAKAAFLFAVAGLLAITGCTKVATPEQGAAASPSTLQGV
FT                   LQRGTLRVGDCLTFAPFGFYNKDGQPDGYDVDLAKELAKQMGVKLEVVNTTSANRIPNL
FT                   QTSKVDVVFCNFTRNLERAKVIEFTAPYVVASEALLVRKNSGIQSIKDMSGRTIATVKG
FT                   STNGDEVRSLNIPVKIQEYDSSQAAILAVKQGQADAMIEDNNFLAYQAKLDPELAVTNE
FT                   ALVPLEYNAFGVKAGDQEWLNYLNLFLFNVNASKLNAQLYNKWFGTDPRYPLNPQF"
FT   sig_peptide     436433..436519
FT                   /locus_tag="BC1002_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.779) with cleavage site probability 0.657 at
FT                   residue 29"
FT   gene            437321..438037
FT                   /locus_tag="BC1002_0399"
FT   CDS_pept        437321..438037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0399"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: bph:Bphy_6678 polar amino acid ABC
FT                   transporter, inner membrane subunit; TIGRFAM: polar amino
FT                   acid ABC transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14505"
FT                   /db_xref="GOA:D5WBH6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBH6"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADG14505.1"
FT                   /translation="MSYQWLTLWGYVPEFLSASWLTLQVTVLAFVLALVLGLLTALAGA
FT                   SPLAVLRWIARGYVEIIRNTPVLLQIFIVFFGLPSAGVSLDAYWAGVIALGLNVGAYLS
FT                   EVFRAGIQSVPRGQIEAAGILGLERAQIFVEVVLPQATRAVYPAIVNYLIQLLLGTSLL
FT                   SAIALPELTGTATVINSRTLLYLQTFSVTLVAYLVLSNVLSWLAAQLGARLFHPPLAMP
FT                   ARTGFGTGFMRRTKRA"
FT   gene            438059..438703
FT                   /locus_tag="BC1002_0400"
FT   CDS_pept        438059..438703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0400"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: bph:Bphy_6679 polar amino acid ABC
FT                   transporter, inner membrane subunit; TIGRFAM: polar amino
FT                   acid ABC transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14506"
FT                   /db_xref="GOA:D5WBH7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBH7"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADG14506.1"
FT                   /translation="MSVELLKTSLSILLQGLVTTLLLSIASIVGSTLIGLFAAVLRSFG
FT                   PWGTDRIARLYTELFRGTPVLITLMFIYFGVSYFGYAIDVFAAGVIGLSVYQGAYIAEI
FT                   FRSGIEAVPKGQWEVSQILGLTRAQAFSFVVLPQTGKIVLPPLVGQYLSLIKDTSIVSM
FT                   IGMSELMHGGQAIVDRIGKPVEIYGLVALIYFAVCFPLSQWVRHHDRRRLS"
FT   gene            438700..439452
FT                   /locus_tag="BC1002_0401"
FT   CDS_pept        438700..439452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0401"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bph:Bphy_6680 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14507"
FT                   /db_xref="GOA:D5WBH8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBH8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG14507.1"
FT                   /translation="MSNQSQTRPIISLTGVSKAFGSTRVLNEINLEVRSGEVLVLIGAS
FT                   GSGKSTVLRIMAGLETTDSGEVWVNEVPLHDPRRAREIRGHVGMVFQQFNLFPHNTALG
FT                   NVTLALIKARRMSPADARKRAMETLDRVGLADRAEHYPSQLSGGQQQRVAIARALAVEP
FT                   GIMFFDEATSALDPELVGEVTEVMRGLARDGMTMVVVTHEMGFARKTADRVVFMDKGVI
FT                   AEQGDPEQIFVNPSNERTRQFLHRVLDH"
FT   gene            439552..440301
FT                   /locus_tag="BC1002_0402"
FT   CDS_pept        439552..440301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0402"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bph:Bphy_6681 IclR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14508"
FT                   /db_xref="GOA:D5WBH9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBH9"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADG14508.1"
FT                   /translation="MAVTESSRARGVDRVIAIFRQLHIAQRPLTMRELIEATGAPRSSI
FT                   YELVAILTEVGWLETAADGSVFFGREMHYYGSDYATHNDLISRAHQSILGLVRKYDETT
FT                   QLCMLEGNKYTVVLSEHSARPFNISSDIGVRVPIPWTATGRLLLGHLGADEIRALIPAE
FT                   DFILDNGASIEFDEFLKDVQAAKERGYCCTEGLSNAFRLCMAAPIRDRAGLPIAALCFM
FT                   TGRDTSLDRRGAMLDDLLQSAKALSQR"
FT   gene            complement(440311..441204)
FT                   /locus_tag="BC1002_0403"
FT   CDS_pept        complement(440311..441204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0403"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   bpy:Bphyt_0683 protein of unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14509"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBI0"
FT                   /inference="protein motif:PFAM:PF01863"
FT                   /protein_id="ADG14509.1"
FT                   /translation="MQKSPTPQPAAALENRQLDLPLFAEPGSTSSTPSPSTPGSSGTAP
FT                   ARPPVAPLAPDGSKLRSLTIGSRTLHYALKRSARRSIGFAIDSTGLTITAPRWVTLGDI
FT                   ETAITEKQRWIFTKLIEWQTRVEQRALPKIDWKDGAEVPYLGQPVRVTLGAPQGMLAFS
FT                   AEQCALQLPLPLQADPQQIKDRVQGWLQGEAKRLFGERLEIYAEKLGVNYRAYALSSAA
FT                   TRWGSCSSDGKIRLNWRLIHFPLSIIDYVVAHELAHLREMNHSPRFWQTVESIFPEFRE
FT                   ARQTLKSHPPELLPTL"
FT   gene            complement(441253..442011)
FT                   /locus_tag="BC1002_0404"
FT   CDS_pept        complement(441253..442011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0404"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="KEGG: bpy:Bphyt_0684 phospholipid/glycerol
FT                   acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; SMART: phospholipid/glycerol
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14510"
FT                   /db_xref="GOA:D5WBI1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBI1"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ADG14510.1"
FT                   /translation="MRFIRSLLLLIYFVVATVPYATACFIAFPFLRAEKRYWMAAGWCR
FT                   LTLWTVRYLNGIRYRIEGFENLPNGPAVLLSKHQSAWETIAFPALMPRPLCYVFKRELL
FT                   YVPFFGWALGMLKMVHINRKEGKYAFESVTNQGKARMAEGAWVIMFPEGTRTPTGKQGK
FT                   YKTGGARFAIATGAPVVPIAHNAGRVWPRNSFTKYPGIVTVSIGKPIETTGLTPDEVNT
FT                   RVEQWIEAEMRRIDPTAYSAAANDSAAAPI"
FT   sig_peptide     complement(441940..442011)
FT                   /locus_tag="BC1002_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.883) with cleavage site probability 0.799 at
FT                   residue 24"
FT   gene            complement(442051..442605)
FT                   /locus_tag="BC1002_0405"
FT   CDS_pept        complement(442051..442605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0405"
FT                   /product="histidinol-phosphate phosphatase family protein"
FT                   /note="KEGG: bxe:Bxe_A4014 D,D-heptose 1,7-bisphosphate
FT                   phosphatase; TIGRFAM: histidinol-phosphate phosphatase
FT                   family protein; hydrolase, HAD-superfamily, subfamily IIIA;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14511"
FT                   /db_xref="GOA:D5WBI2"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBI2"
FT                   /inference="protein motif:TFAM:TIGR01656"
FT                   /protein_id="ADG14511.1"
FT                   /translation="MPIKKVVILDRDGVINVDSDAFIKSPDEWVALPGALEAIARLNQA
FT                   GYRVAIATNQSGIGRGLFDMDALNAMHLKMHRMAAAVGARIEAVFFCPHTAEDHCECRK
FT                   PKPGMLKMIAERFEVDPAHTPTVGDSLRDLQAGAALGHPIHLVLTGKGRKTLAAGGLPE
FT                   GTIVHDDLRAFALDFLANAQE"
FT   gene            complement(442616..444715)
FT                   /locus_tag="BC1002_0406"
FT   CDS_pept        complement(442616..444715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0406"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="TIGRFAM: glycyl-tRNA synthetase, beta subunit; KEGG:
FT                   bpy:Bphyt_0686 glycyl-tRNA synthetase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14512"
FT                   /db_xref="GOA:D5WBI3"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBI3"
FT                   /inference="protein motif:TFAM:TIGR00211"
FT                   /protein_id="ADG14512.1"
FT                   /translation="MTQSQHATLLVELLTEELPPKALARLGDAFAEGIAQRLAARDLIE
FT                   GEPSFERFATPRRLAVTIHNVRAVAPEKHVREKVLPVSVALDKDGQPTAPLAKKLAALG
FT                   FPDFTVNDLERAQDGKAEAFFLRYAAPGATLADGLQAALDETLGKLPIPKVMTYQRPDG
FT                   SSVQFVRPVHRLTALHGEEIVPVSALGIDADDTTLGHRFLSEGFVQIQHAQSYAETLEH
FT                   RGRVIASFARRKEAIRSQLLAHAAEDKVVMPEALLDEVTSLVEWPVVYECRFEDEFLQV
FT                   PQECLILTMQTNQKYFALTDANGKLRSRFLIVSNIETATPVEIVEGNERVVRPRLADAK
FT                   FFFTQDKKKPLADRVPLLANVVYHNKLGSALQRVERLEGLAGAIAAMTGADVARATRAA
FT                   RLAKADLITDMVGEFPELQGTMGTYYARHDGEQEEVALACSEHYQPRFSGDALPTTETG
FT                   TVVALADKLETLVGIWGIGLQPTGEKDPFALRRHALGVLRILIEKQLNVDFVDLLRIAY
FT                   AQFAGMPNVADATDAIYEFSMDRLRGLLRERGYAAGEIDAVLALNPTRLDDIVARLDAV
FT                   REFASLAEAASLAAANKRISNILKKSEGVTNGGVQPGLLTEAAEKALNAQLEQVTPRVQ
FT                   SQLAVRDYTGALTALAALREPVDTFFNDVMVNSEDPALRANRLALLGALHQQMNCVADI
FT                   SRLAA"
FT   gene            complement(444731..445738)
FT                   /locus_tag="BC1002_0407"
FT   CDS_pept        complement(444731..445738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0407"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   KEGG: bxe:Bxe_A4012 glycyl-tRNA synthetase subunit alpha;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14513"
FT                   /db_xref="GOA:D5WBI4"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBI4"
FT                   /inference="protein motif:TFAM:TIGR00388"
FT                   /protein_id="ADG14513.1"
FT                   /translation="MLTFQQIILTLQSYWDKQGCALLQPIDMEVGAGTSHVHTFLRAIG
FT                   PEPWRAAYVQPSRRPKDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDL
FT                   KQNDVRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLE
FT                   RLAMYLQKVENVYDLVWTEWEEQGPNGPELRRLTYGDVYHQNEVEQSTYNFEHANVDLL
FT                   FTFFNSYEAEAKRMIDAQIALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALS
FT                   RLVAQAYYDSREKLGFPMLGNPVHGVPGLTTDEQDAAMPAWAPPLKVERKIDQD"
FT   gene            complement(445921..446304)
FT                   /pseudo
FT                   /locus_tag="BC1002_0408"
FT   gene            complement(446564..447028)
FT                   /pseudo
FT                   /locus_tag="BC1002_0409"
FT   gene            complement(447416..447889)
FT                   /locus_tag="BC1002_0410"
FT   CDS_pept        complement(447416..447889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0410"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: drm:Dred_0903 helix-turn-helix
FT                   domain-containing protein; PFAM: helix-turn-helix domain
FT                   protein; SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14514"
FT                   /db_xref="GOA:D5WBI5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBI5"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADG14514.1"
FT                   /translation="MKKSSEPATLRERFARNLRAYRIELGMSQEELGSYIGADRTAISR
FT                   LERTFGNPTLERAEALASALDIDVRVLMTFSGKGEIERRPPTGDVSSAAVGAKVATLRE
FT                   KMGLTQKQLGELAGVDRNFISRVEAPHGRGTPLELATLEKLAEAFGIHPVELL"
FT   gene            448050..449708
FT                   /locus_tag="BC1002_0411"
FT   CDS_pept        448050..449708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0506 metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14515"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBI6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14515.1"
FT                   /translation="MTLDNPASSTWKLFRDRPFPRVQLLGGGNPAERVRALECVGKCDV
FT                   LVVPGGLSDIVEAVSALSTLGMPVLYVAGLDECRGRDWSQVVASGKQAASGTAVHILDR
FT                   DRVVLDGVRYLGCTFWSSPECAGLSARDWAREVDLVLSEVDTAAWLSDSMNAPQASAIA
FT                   FAHQWEPVTAGSKASADSARRAFALIENRRTIAWLANELRQRFEGPTVVVTHFAPELRP
FT                   RIAGAGGATQSGVRALLRQYPGAVDLWLHGQTNTTTDVAIEGTRVFGGFAEENAALGVS
FT                   ELLDKALSAAATGKGRRKRVPSEPKQIMSRVISFEDGLRAPLSSEVAFIVEEMRQTHKN
FT                   VDAIVPHTMTRSSTLRMCVRRTIHDEMQAFTKAVSAAAELERQIYQPANHLQSLLLTTR
FT                   TDYAVPPGYPAKDSQGSSFDYYELLNRMEAHIDSVRGLAGQATLTLSKWAKRAGAILRE
FT                   LEALGIDARAVAPPVQSLRMPKVCEYLEIYARCKEVEVDRLRERLGKMFKRDEEWPFIT
FT                   RLTRVAQFSKDGPRLLDLHTVLDSLDYAGRLAVTS"
FT   gene            449730..450257
FT                   /locus_tag="BC1002_0412"
FT   CDS_pept        449730..450257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0412"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: yen:YE4110 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14516"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBI7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14516.1"
FT                   /translation="MDDMVMSTTCQSDDGVETKLRWSSLRTGEDGVLAARKSRLEDRVM
FT                   RSIRARVGVVILRSELSHLGAPSQLTRVLARLVATGQLIRVGHGIYAKTRINRFTGRHA
FT                   PAAPFEAIAAEAFRKLGIDIGPGVLTRDYNAGRSTQLPMVAVVTTGRRRITRRIQVGTK
FT                   SVAYERVGKDTP"
FT   gene            450693..451334
FT                   /locus_tag="BC1002_0413"
FT   CDS_pept        450693..451334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pna:Pnap_4834 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14517"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBI8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14517.1"
FT                   /translation="MALMLFERQLPSVSKSHFITEVQRLEEIMLTGIPGPTFSVPSPRY
FT                   MGGHVLMLDFDGVLHPESVYLLHRHGPTLMNAPGHKLFENCPLLEEVLGPYPDLRIVLS
FT                   TSWVRRYRGSIQRVARRLSPGLQARVVGATYHSAMDPAEFAQAPRGMQVWSDVLRRNPE
FT                   AWLALDDDYLHWPAWCREQLVRTDPMLGISEPSVLADLQTRLSAMYNRSG"
FT   gene            451522..451821
FT                   /locus_tag="BC1002_0414"
FT   CDS_pept        451522..451821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0414"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bps:BPSL0761 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14518"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBI9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14518.1"
FT                   /translation="MRVRHLLRHLQEADPDAVVLYLPQYGEMTDAEEVLNVAVIAEPWA
FT                   CERHYAAEGKTTDVHHPAEHGLSIGWQAATDRQWRERVVILSADSGAGTSEAGG"
FT   gene            451793..452650
FT                   /pseudo
FT                   /locus_tag="BC1002_0415"
FT   gene            complement(452674..452997)
FT                   /pseudo
FT                   /locus_tag="BC1002_0416"
FT   gene            453217..453648
FT                   /locus_tag="BC1002_0417"
FT   CDS_pept        453217..453648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0417"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pna:Pnap_4884 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14519"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBJ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14519.1"
FT                   /translation="MSAINGYIPQVTPLLFETEEGQRKASALVEFGGWNAKEKTLSPIH
FT                   VSALSHMPHAPILEWVMDSMAAAAEAGRLHGSNYLEQLFASREDIRVFRTQLREEGPNL
FT                   WVNDRHHNAMCKLGSTQADSSTYQRITAFFDPPETERSS"
FT   gene            complement(453883..454215)
FT                   /locus_tag="BC1002_0418"
FT   CDS_pept        complement(453883..454215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14520"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBJ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14520.1"
FT                   /translation="MGKLQYISRQDIVKVQACAVHVQAGAEPLLRPHRVLAATTADSRL
FT                   SSASYSGGPSSARVVTRVEAIVDEELSARVLRREMTILQREVAKLQNEVNALKSSTASA
FT                   SAQKSD"
FT   gene            complement(454219..454524)
FT                   /locus_tag="BC1002_0419"
FT   CDS_pept        complement(454219..454524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0419"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_5008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14521"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBJ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14521.1"
FT                   /translation="MATVVRWFIGRFNGVLDCTLPVRISNLDQRVVLVSVSEGDNADNT
FT                   QAPERFLGSAAMWVENVCPRANDIQFRLVVDWDKPLAVWADVFIADEFPQGFLLSR"
FT   gene            complement(455827..456081)
FT                   /locus_tag="BC1002_0420"
FT   CDS_pept        complement(455827..456081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0420"
FT                   /product="coproporphyrinogen III oxidase, anaerobic"
FT                   /note="KEGG: mlu:Mlut_12400 coproporphyrinogen III oxidase,
FT                   anaerobic"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14522"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBJ3"
FT                   /inference="similar to AA sequence:KEGG:Mlut_12400"
FT                   /protein_id="ADG14522.1"
FT                   /translation="MSAQPHDLAALARRIEAFHGVIKRVDEEHKAETLIRIIHQPGYTT
FT                   VAEWAFLAHTLENAIAQAEAAASTYAALVEDAQKVGAST"
FT   gene            complement(457361..459250)
FT                   /locus_tag="BC1002_0421"
FT   CDS_pept        complement(457361..459250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0421"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: GGDEF domain containing protein; MASE1 domain
FT                   protein; PAS fold-4 domain protein; KEGG: aca:ACP_0517
FT                   sensory box-containing diguanylate cyclase; SMART: GGDEF
FT                   domain containing protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14523"
FT                   /db_xref="GOA:D5WBJ4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBJ4"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADG14523.1"
FT                   /translation="MGNPAARRSPSLRAVTQTSRLAKRLGDVWCLLLTVTATTLTCLAS
FT                   GALKTMAGEIAPIWFTNAVLLSQLMVVSRRRRYWVLAGGVLGNLAANLYVGESLGVSVS
FT                   YSSADIVEVLIAFAFAPLVSSVSELVRPKVLMRFVAGGVLLAPVVSGLLATILLRGQLS
FT                   GNMFPNLANWFISDALSLAIFTPAALVFWTGEVAQLLRADRRRKTAFLLVVVCIVTAGV
FT                   FGQSKFPLLYWALPPIVLLAFQADLAGVMVGLLLCLAIAVSFTIRGTGPLWVFPYESMQ
FT                   GRIFGLQLFLVAALGIALPITATQAQRNRLFTMLRDGERRYRVLAENATDIVMSLGLDG
FT                   RLTYVSPRVTALLGLSPDHLIGLHLADLAVSDDRNALAMAIGKVASGEVEASETSRFLR
FT                   KGVKALWMETHLRCVVDPFSGKPDSLTATVRDVTEQRLNEERAADERAELHSLAFRDGL
FT                   TGLFNRRHFDRELGRRWQQGARADKSGYMAVIMTDVDAYKKYNDFYGHQSGDECLRIIA
FT                   GAIASSAARFTDTVARYGGEEFALILCDTDQEGALAVAERIRRSVESLHLPHAGSESGI
FT                   VTISLGVAAFCTNEHRDPTLLVAAADRALYAAKRQGRNCTCVADGVDGDLADV"
FT   gene            459557..460195
FT                   /locus_tag="BC1002_0422"
FT   CDS_pept        459557..460195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0422"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: mxa:MXAN_5418 NUDIX
FT                   family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14524"
FT                   /db_xref="GOA:D5WBJ5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBJ5"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADG14524.1"
FT                   /translation="MPTLPADQLARTRLDQARRLLAIAQTGLHYTTGSFDRERYEEIAS
FT                   IAHNQIAELASMNTGKVAQLFSLESGYANPKLDVRCAVFDEAGRILLVREAADGLWSIP
FT                   GGWADVGLSPAENAAKEAREESGYTVRIKRLLAVWDMNKHAHPPSAFHIWKVVFLGATE
FT                   KAGAIVGSETNSVDFFSLEDLPSLSLGRILPEQIRRLAELYRAGNVDFD"
FT   gene            complement(460263..461477)
FT                   /locus_tag="BC1002_0423"
FT   CDS_pept        complement(460263..461477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hha:Hhal_1150 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14525"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBJ6"
FT                   /inference="similar to AA sequence:KEGG:Hhal_1150"
FT                   /protein_id="ADG14525.1"
FT                   /translation="MTVYLEEFSEGNPTIFERVSLSSSDGHNERWLQERLFKHPNLIPM
FT                   VEMFGHGEAFIPLCRELPLRHGSSNVFLDLLGVSPTGRLVLVECKLWRNPEARREVVAQ
FT                   IFEYAALLADWTYSDLEARLKQARGLTGENPIFQAVRAVDPNCDEARFVDAVNASLSRG
FT                   DFLLAIAGDGIRSDLHALRRLMASQGGLLSKLALLEIKVFKDASGRALLVPNVPVQTEI
FT                   VKREVLVRADGESLEKTGPAVPRDQPVLGTLERAATSNDARLQNRAFWDKFISLVKFDH
FT                   PDQTTPRHGGNNWVRIELPGPIKGLVAYRTAAGEAGFMVKFLGADGRDVLRSLLDDQPA
FT                   LEQELGQSVRFDIGEPGEESADVVGQMLVDYVPSSDSNSQDSSQLSWLVATANSIVTAL
FT                   RPRLK"
FT   gene            complement(461534..462154)
FT                   /locus_tag="BC1002_0424"
FT   CDS_pept        complement(461534..462154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vap:Vapar_4573 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14526"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBJ7"
FT                   /inference="similar to AA sequence:KEGG:Vapar_4573"
FT                   /protein_id="ADG14526.1"
FT                   /translation="MPLPNGVDPTGAIEKVCPSAAWLGNRGEIHDAERRIVRGWKIKAW
FT                   VTCQLSFKGWSRKPLMQPGSYTELFFLDEATALSAGHRPCGMCRKREYVSFKSLWLAAN
FT                   GYQRDLGIADVDKTLHAERNSRGGSGDWVRAADSLPPGVIVEFDGAPHLWNGRSLRRWT
FT                   ATGYGPDIKLCELPPRLQLLTPPSVVNAIQAGYQVQMHPTALA"
FT   gene            462304..462510
FT                   /locus_tag="BC1002_0425"
FT   CDS_pept        462304..462510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0425"
FT                   /product="conserved hypothetical protein"
FT                   /note="manually curated; KEGG: bxe:Bxe_A2487 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14527"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBJ8"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A2487"
FT                   /protein_id="ADG14527.1"
FT                   /translation="MEFWIQLSTQCADLRGKSTSEPPHRHLVLNGAGAMNDVRAEEHFT
FT                   CGRCRVVFAKILAGPPARHVWML"
FT   gene            462765..463100
FT                   /locus_tag="BC1002_0426"
FT   CDS_pept        462765..463100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14528"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBJ9"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B0407"
FT                   /protein_id="ADG14528.1"
FT                   /translation="MTDNNELAGSPEYVPESLRTLAVYLERSLDNAISIVMMRHTPDAC
FT                   TVYLGDPEGSREDLKQIGTITIPAANGILESTSSGANTMQVGGQVYRFVRSFTQVGDMA
FT                   AVVFSTT"
FT   gene            463192..463695
FT                   /locus_tag="BC1002_0427"
FT   CDS_pept        463192..463695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14529"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBK0"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0200"
FT                   /protein_id="ADG14529.1"
FT                   /translation="MDIFYYSQKLEQNLRNGELGHVGSNNAKIVKLAERLPKRIWVFKT
FT                   PKGMKGSIQLVGSLLVSDEPRVAVNTEYPYVIYYDPFSPESVIYTDSNTPERIREVSGY
FT                   FQYRFHTAFSANFNGDAGVQVMESNVVRGLEALITDWGTCQMLERVKDRTKVQPINPFA
FT                   HRST"
FT   gene            464061..464771
FT                   /locus_tag="BC1002_0428"
FT   CDS_pept        464061..464771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0428"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="KEGG: bpy:Bphyt_5696 phospholipid/glycerol
FT                   acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; SMART: phospholipid/glycerol
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14530"
FT                   /db_xref="GOA:D5WBK1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBK1"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ADG14530.1"
FT                   /translation="MRSTLTKWLFIVYLLGSGTLYSMAILLLFPFVGRAGRYWLAKQWC
FT                   RALVVVMRSLPGVSVSIEGLENIPEGPAILLCRHESTWETLAFLALFPRRISFVFKEEL
FT                   LRIPFFGWVLRGLDMVSLNRGSPRQAHQAVTQESAERLAKGDVVVIFPEGTRVPHDAPL
FT                   RMTSGGVRLACATGVPAVPVVLNAGKVWPAKGWPSGRGQIRVVVGPAFSPRDLSQQELS
FT                   RAVHDWMKDELLRL"
FT   sig_peptide     464061..464135
FT                   /locus_tag="BC1002_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.817) with cleavage site probability 0.483 at
FT                   residue 25"
FT   gene            464955..465755
FT                   /locus_tag="BC1002_0429"
FT   CDS_pept        464955..465755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0429"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="KEGG: bxe:Bxe_B0144 histone-like
FT                   nucleoid-structuring protein H-NS; PFAM: histone family
FT                   protein nucleoid-structuring protein H-NS; SMART: histone
FT                   family protein nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14531"
FT                   /db_xref="GOA:D5WBK2"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBK2"
FT                   /inference="protein motif:PFAM:PF00816"
FT                   /protein_id="ADG14531.1"
FT                   /translation="MATLEQIEAKLKKLKTQAEALAAKKTQAVVDQIRDIMSKHGLTTA
FT                   DIEAKTSAKRATKGQKVSAAAGKTKIVDGTKAKAAPKYQHPKTGATWTGHGRAPAWIAD
FT                   AKDRNKFLIATGTEATVATTAGAVSRAKAAAKEASKAVRATAGKGQRKGPQPALYRDPK
FT                   SGATWSGRGRAPAWLAGAKDRSKFLIDGASTAADVKPAVTKAVAKKAPAAKKTAAKKAE
FT                   SAKVPTKKAAAKNSVPAAVKNAPHKTAAVTAPVATIESGAELTA"
FT   gene            complement(465827..466063)
FT                   /locus_tag="BC1002_0430"
FT   CDS_pept        complement(465827..466063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_4466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14532"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBX7"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_4466"
FT                   /protein_id="ADG14532.1"
FT                   /translation="MKGSPIRIALIATTLAFATAGTANAAGCLKGAVVGGVAGHYAGHH
FT                   AVVGAVGGCMVGRHLAKQHAQQQAAQRQAAQAQ"
FT   sig_peptide     complement(465986..466063)
FT                   /locus_tag="BC1002_0430"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 26"
FT   gene            complement(466117..466434)
FT                   /locus_tag="BC1002_0431"
FT   CDS_pept        complement(466117..466434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_4467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14533"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBX8"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_4467"
FT                   /protein_id="ADG14533.1"
FT                   /translation="MNKKILGAALGLAVLAASTASTAASAHVDVGIGIGIPVGVYAPAE
FT                   PVYAPPPPVVYAPAPVAVAYGGDDWRAREWRERREWREREWRRQEWREHEWREHRDWRG
FT                   Y"
FT   sig_peptide     complement(466354..466434)
FT                   /locus_tag="BC1002_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.512 at
FT                   residue 27"
FT   gene            467251..468120
FT                   /locus_tag="BC1002_0432"
FT   CDS_pept        467251..468120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0432"
FT                   /product="Protein of unknown function DUF2167, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2167, membrane;
FT                   KEGG: ctt:CtCNB1_2266 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14534"
FT                   /db_xref="GOA:D5WBX9"
FT                   /db_xref="InterPro:IPR018682"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBX9"
FT                   /inference="protein motif:PFAM:PF09935"
FT                   /protein_id="ADG14534.1"
FT                   /translation="MKRTFEGMSHPVFAARKGKRVLAVAVVALFLTSAQADEQVVTDPH
FT                   HGPYNQQIASIGTWKVDKGYLSLDPTDTTRLMEEMHNPGVQNTWLYAPEGLKRWFSVIR
FT                   YEDTGHVKDDEKIDPAAILEQLKKGGELSNEERRKRGWPELHLIGWQVEPHYEPDTKRL
FT                   SWATLSETNGEKVVNYTTKVLSRTGVATVILVTDPASVDQSVAELKTQLDRFAFNPDQT
FT                   YAEFRDGDKIAEYGLTGLIVGGAAAAAVKTGAWKWLLGILAAGWKVVAAAMMALLAGVK
FT                   SLFKRRSA"
FT   sig_peptide     467251..467361
FT                   /locus_tag="BC1002_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 37"
FT   gene            468192..468860
FT                   /locus_tag="BC1002_0433"
FT   CDS_pept        468192..468860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0433"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctt:CtCNB1_2265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14535"
FT                   /db_xref="GOA:D5WBY0"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBY0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14535.1"
FT                   /translation="MLKAPGHGVLYLCPGQMRVRFPSWRAAFGRHLALFVYPIHSFWPM
FT                   ADVELLAASRTGAMDELAGFAQQLARPMGFARPFLVAVTCLVVVIIPVWILTRGADLIF
FT                   LAMATLAYVLYAVGLAVLLRTGRNQGHHRLHGHWKTLLEPLFCLPYGAHLCRRLSERYQ
FT                   LSVPLIDVLRSDAELSAADLQDLSSHLGEVRDVSDDPADHAFLAELKALIDARLAGHSE
FT                   "
FT   gene            468857..469210
FT                   /locus_tag="BC1002_0434"
FT   CDS_pept        468857..469210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0434"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="KEGG: eic:NT01EI_0700 DnaJ domain protein; PFAM:
FT                   heat shock protein DnaJ domain protein; SMART: heat shock
FT                   protein DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14536"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBY1"
FT                   /inference="protein motif:PFAM:PF00226"
FT                   /protein_id="ADG14536.1"
FT                   /translation="MKIAILAIAALVGFWLVGAIVEHFQKKAPKAAPSTGAGPKSASEP
FT                   EPERADPIEEACRVLQLSRPFTTEQLRAAYRQRMSQYHPDKVTSIGPEFRELAESKSKE
FT                   INRAFDLLARFLR"
FT   gene            complement(469382..470506)
FT                   /locus_tag="BC1002_0435"
FT   CDS_pept        complement(469382..470506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0435"
FT                   /product="membrane-anchored nucleotide-binding enzyme"
FT                   /note="KEGG: xca:xccb100_3123 membrane-anchored
FT                   nucleotide-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14537"
FT                   /db_xref="GOA:D5WBY2"
FT                   /db_xref="InterPro:IPR025330"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBY2"
FT                   /inference="similar to AA sequence:KEGG:xccb100_3123"
FT                   /protein_id="ADG14537.1"
FT                   /translation="MGISYRKSISAGPFRFNLSGSGIGVSVGVPGFRIGTGPRGNYVSI
FT                   SKGGFTYRATLPTSGIRPPASSQPSSGAPAARPIYTSPATATVGPMMSVASATADQLTS
FT                   SSLDSLVEEINRKAGMMPLWPWCAVLALVCIALAVLSSDGGLFVATASGALAMAVCAAS
FT                   LWVYYWDTARRATVLFYDLDVTSEQAFSSVVNGLTQLAASARKWRIDATGRVLDSKYHA
FT                   GASNVVKRKPLQLGIGPFSKVRCNLDIPYIVAGANVLYFCPDRLFVVTGPRVAAVRYGD
FT                   LNLRDGSTQFIEDEGVPNDAVVVGRTWKYVNKSGGPDRRFKDNRELPVVRYDELSLTSA
FT                   SGLNELFQFSKSGVAAAFCHSARNLLTLRAAGIS"
FT   gene            complement(470526..471191)
FT                   /locus_tag="BC1002_0436"
FT   CDS_pept        complement(470526..471191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0436"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hne:HNE_0466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14538"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBY3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14538.1"
FT                   /translation="MTKTSRYQKARVVRACITMFATCITVAGHGQEAPNPVGEFLNAFH
FT                   GKPVGAVAPPSASASADGGPQTAMVNATPAPITAAQANAPVSTPPSCPPGVDRLGCPSS
FT                   TAQRPRNDCPAGMTTGPTGCVPMAMPANAHRVSDDGQWQCDDGYMRFGAICVAIQSTPS
FT                   NAHLTGTGTNWECNTGYRRLGNTCVAVSVPPNAHLANTWNGWECDSGYRMVGNWCIAH"
FT   sig_peptide     complement(471099..471191)
FT                   /locus_tag="BC1002_0436"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.925 at
FT                   residue 31"
FT   gene            complement(471188..473137)
FT                   /locus_tag="BC1002_0437"
FT   CDS_pept        complement(471188..473137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eum:ECUMN_2408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14539"
FT                   /db_xref="GOA:D5WBY4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBY4"
FT                   /inference="similar to AA sequence:KEGG:ECUMN_2408"
FT                   /protein_id="ADG14539.1"
FT                   /translation="MSVAFDELGNQLQLGKKLGEGGEGAVFDTTHNGENVAAKIYSHAL
FT                   PPERQAKLRAMAQVGDTYLKQIAAWPINVLLTKRPGPVSGFTMPKFSGYHAVHELYGVG
FT                   SRRQTFPKADFSFLVGTARNIAAAFDAIHAHGHAIGDVNENNIIVSHQGTVKLLDCDSF
FT                   HVNTPTMSFPCTVGVPHYTPPELQGLGSFHGVTRTANHDNFGLAVLIFQLLFMARHPFS
FT                   GIPKMPGDLPLERSIKEFRFAYGADRLARLNDMPPKALGLDYLPSGFGDLFWRAFTETG
FT                   VKHGRPKAKEWVAALDSLLHSLRSCSAEPRHKYPGQLNTCIWCERDKQGTPYFTPASAT
FT                   GPTINFQAANASVAALWSQIQGLSSLPVMPVFAAPALTLTGRPAPASAGSSVTRNRLAY
FT                   AGICLVAFVLSIVAPKLWWLWLTAGGLAIHGVKPHSPVELNTRKSALAVAQRGYDAALA
FT                   EYDRVRGDRRLADAFRDLGQLKAQLDDLPQILARQMKQLQATLVARQLHDFLDRHFIRG
FT                   AKITGVGEQRKQTLASFGIETAADISSAAIGAIPGFGAGLTNNLMAWRRSIEQKFVPSN
FT                   NVMPTPQDVNSVNAKIASMRAKLEQQLRDGATHLQSVRNEVLARQNTAKGALEAAHHNL
FT                   TQAQADLAVMQRSP"
FT   gene            complement(473121..473906)
FT                   /locus_tag="BC1002_0438"
FT   CDS_pept        complement(473121..473906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0438"
FT                   /product="serine/threonine phosphoprotein phosphatase"
FT                   /note="KEGG: cyn:Cyan7425_2108 serine/threonine
FT                   phosphoprotein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14540"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBY5"
FT                   /inference="similar to AA sequence:KEGG:Cyan7425_2108"
FT                   /protein_id="ADG14540.1"
FT                   /translation="MSWKVIGASVVGSSHIHNSAPCQDSCFYHVASDATGAELLVALVS
FT                   DGAGSAQFGEIGSEISCEAGGKRLLEIVETNGEAALESSVAAEVLDVIRTRIDEAAQAR
FT                   GVTPRALACTLLGAVVGPTRAFYFQVGDGAIVSREGGALAPVFWPESGEYANMTYFVTD
FT                   ANASEHLRSELRNAPDELSLFSDGIQRLALVFATETAHEPFFEPMFKALRGSPDDQTDS
FT                   LCAALEHFLSSDAINERTDDDKTLILATRLPGAGSVSSV"
FT   gene            complement(473903..474580)
FT                   /locus_tag="BC1002_0439"
FT   CDS_pept        complement(473903..474580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0439"
FT                   /product="von Willebrand factor type A"
FT                   /note="KEGG: ecq:ECED1_2419 hypothetical protein; PFAM: von
FT                   Willebrand factor type A; SMART: von Willebrand factor type
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14541"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011392"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBY6"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ADG14541.1"
FT                   /translation="MSEHNDFATQVAFGTDNFAENPEQRCPCILVLDRSGSMGGQPIEQ
FT                   LNAGLVTFKDELSADSLAMKRVDTAIVSFGPATLEMPFHTAPNFFPPTLTAQGDTPMGS
FT                   AINLALDTLEARKAEYKANGISYYRPWVFLITDGGPTDAWQQAAARVREGEASKKFAFF
FT                   AVGVQGANMDTLAQISTRQPLSLQGLKFRELFQWLSASMAAVSRSTPGTEVPLVAPTGW
FT                   ASV"
FT   gene            474662..475585
FT                   /locus_tag="BC1002_0440"
FT   CDS_pept        474662..475585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0440"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: proteophosphoglycan 5"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14542"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBY7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14542.1"
FT                   /translation="MSASKAPAYFSLAVAVAAGVLISGANRSAPYAAAPSLDTASAPAA
FT                   SASQDVETKPNTPVIWKSQTLNLGSLRVKATLPWSGENARCMMPRPTDDEVGLCQAVSA
FT                   VDETPSWQIRIVTQRDRFVPVSWFDNALQSLRTLQPDAVTRQLGEEANAVTKAGFTNAG
FT                   LLTPIQFPGGLAIRGSASGLSASASSAIQSCVYAFFLTANRPTTLLYCATTDEESLSGA
FT                   QKIASSLSKLNPSNEYKRSSAQAAEHATYLKRLKAAGGPVAAPDLTASEQAFEQAVADA
FT                   CGKYPMISQERFQCFEGYAANRLSSL"
FT   sig_peptide     474662..474748
FT                   /locus_tag="BC1002_0440"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.747) with cleavage site probability 0.366 at
FT                   residue 29"
FT   gene            475675..475920
FT                   /locus_tag="BC1002_0441"
FT   CDS_pept        475675..475920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl01_2135 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14543"
FT                   /db_xref="InterPro:IPR025234"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBY8"
FT                   /inference="similar to AA sequence:KEGG:Pfl01_2135"
FT                   /protein_id="ADG14543.1"
FT                   /translation="MAFEYKMVQVPPNIAVRAREHRGNEAAAYLEGVVNEHARDGWEFY
FT                   RVDSIGVNVQPGCFDALFGRKAQSATYFVVTFRRPD"
FT   gene            475895..476116
FT                   /locus_tag="BC1002_0442"
FT   CDS_pept        475895..476116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0442"
FT                   /product="protein of unknown function DUF37"
FT                   /note="KEGG: cms:CMS_3113 hypothetical protein; manually
FT                   curated; PFAM: protein of unknown function DUF37"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14544"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBY9"
FT                   /inference="protein motif:PFAM:PF01809"
FT                   /protein_id="ADG14544.1"
FT                   /translation="MSRSDALISASEQLIGVYRRYAPVRLREACVYEPSCSEYGLRAIR
FT                   KHGAVRGWSMALRRIIRCRQPNGGIDEP"
FT   gene            476133..476960
FT                   /locus_tag="BC1002_0443"
FT   CDS_pept        476133..476960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0443"
FT                   /product="lipoprotein-like protein"
FT                   /note="KEGG: bcm:Bcenmc03_7075 lipoprotein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14545"
FT                   /db_xref="GOA:D5WBZ0"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBZ0"
FT                   /inference="similar to AA sequence:KEGG:Bcenmc03_7075"
FT                   /protein_id="ADG14545.1"
FT                   /translation="MLFSRVGIVQKSRTINLIFTAREDNCLRELKMANFGVGLVLLGIL
FT                   TALVGVGGFFDTRKVDRRFKTGYKNNEPDNRNFGRSAKRVLYGIGICIIGAAITSLSSP
FT                   SGQGAPSASAVDVAASAPKVVSESAPASSNVVQLDPTPAEQKADSGVTLGSNERVVIPE
FT                   TGADPNTPKSITSVGSKGISPQVSTASVSCIEDGTFFGTNVCKSGTLAAAYDREVKEYE
FT                   EAQARIGGKDVGVRIEQENWLDKVTRGCSDMTCLTDAFDARIADLHGRYRKDS"
FT   gene            477306..482360
FT                   /locus_tag="BC1002_0444"
FT   CDS_pept        477306..482360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0444"
FT                   /product="TOPRIM domain protein"
FT                   /note="KEGG: pol:Bpro_5347 DNA topoisomerase; PFAM: TOPRIM
FT                   domain protein; SMART: Toprim sub domain protein; DNA
FT                   topoisomerase I ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14546"
FT                   /db_xref="GOA:D5WBZ1"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBZ1"
FT                   /inference="protein motif:PFAM:PF01751"
FT                   /protein_id="ADG14546.1"
FT                   /translation="MAACDAYIDKFKESVPQKAAQPPGESQKKLAAWIFKTLPDSISEQ
FT                   EFERAMTESRLCHAFIDRYKSAFEEHRTKEEQGKQHHKCRMLLNKLEFIPKSLRRAFED
FT                   TASIEDRNALLDAHLKGPGGFSGLNPAELHSVHERLIGYWLEGMQSSAFEGLAKLENIL
FT                   GKDRKAQFDLIGLQRALAEAATEGVQDAGGQTPVRHIVLKLIEEGDTQQKKTTVVSVLP
FT                   ISPAEDADNPRGYRWVLAEERLPKFNRNLLGESAKLPGLGFDNVGPFDVWALQQVENES
FT                   ADVEEPVTELPEAFALWDEAFDVLSTLGAIDDEMGQGLEGWIARFMNSRAKQWLTKRRR
FT                   PVFTVVDGSAASGTTRNVVNAFRQVLADPGYLEGPKLGLFRQIAGTKETSRISYEPTEE
FT                   AANIGHILRYAGHMDTFKDGKRKAFPLDPAQRDALIALTTTKYGDLLAVNGPPGTGKTS
FT                   LLRAVIASMWLEPLLGEEAWPESPLILACAATNQAVTNIISSFDETPGPSLFNEDGTMA
FT                   DGVDVWENSRWLPNLTSYGWYAPASPETDTDYQDYQLIGRKRPDLPWNFYGTSSGLNNL
FT                   EPQQAEAAYVECASRYFERPMTLTKALAWLRELVKVDVERLGATKDAANVWMQRLAAWC
FT                   ALPAWTKAHQARRDSLRGELTALGGQGGRIVACQLQTDRWDKALTTLLSLQTYTGPVER
FT                   QVDALLAGNEDSHQVEVQQYRLLKQLDEDLAALAAEVERHRHATLLQRIKRTVANLLTP
FT                   EELERTWSELREAMRACGLAATGGGLPDFIVMAQTIEFRRRKLQSELTAAAALVLRMRA
FT                   QEVVELPANGTSDATQPQADVARRIEHARERLAGLSNDMVVFKERYDIVQAELRELDAA
FT                   YARYSAARTAVHGAREALIAALCGEGKGLPDEHPILTSLDSAIADRDNMSASALPIHQR
FT                   ELVKLLQDWLDQNVRPQLFHFCARYWEGRFAQSRLETQKRLRVDTTYNPSSEVRLRELA
FT                   MLAPVFVVTAYSAPKLMRRQLDDLEGDVPPYLFGEADLLIVDEAGQGTPEVGASAFLFA
FT                   KRAIVVGDIEQLEPVWNLDAATDRLLAQRFGVSAIQTETEGDAYEALLPAGVLMARGSV
FT                   MRMAQRATRRSVPDAAAAGLTLTNHYRCLKPIIEICNQMVYGDALKVATPTPEKLWRPE
FT                   FERLGYLVVDSAVDTKNPGGSRRNLDEATCIARWVKENESSLRRHFDPKGEKDLTDIVA
FT                   IVTPFKGQKDHLVSAVAKAYGVTRLDHNDKTALYNRMVIDTVHSLQGAERPVVIFSMVE
FT                   STQPSEKQFYDDGTNLINVAVSRAKEMFIVAMTQTAVDYARGLTDKKLRKPSDFLWRAV
FT                   VQQGTRLNSRHVVVVESPNKRETIHAALGGSLEWEVVDTAGHITQLANPGQWDIAKATE
FT                   PVWAPLQPNGEKALSRLQQLWPGMATLYLATDPDPEGEAIAWHILRVLSERQTRGQIST
FT                   GAGAAPVVKRMRFHRLERDEIQRAQREASDGLDAGLVKSALARSFLDQLISTLYPKRLG
FT                   LSDGTGFSAGVGRVQLGILDLVNEAEQRPSCQRIRVSIPVSDGSALTAWLANRGSMGTG
FT                   TVTERPLSEDMSPTLEKLKVLLRHPQTTVSASWSGRLDQRPPYPAINTARFTALAYRAL
FT                   GLPPEETAKELQALYEGTAQPAIVKRVRGLPDGAQAGMRYEEMVDE"
FT   gene            482353..483603
FT                   /pseudo
FT                   /locus_tag="BC1002_0445"
FT   gene            483613..484350
FT                   /locus_tag="BC1002_0446"
FT   CDS_pept        483613..484350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_5348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14547"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBZ2"
FT                   /inference="similar to AA sequence:KEGG:Bpro_5348"
FT                   /protein_id="ADG14547.1"
FT                   /translation="MHFISYPRTAAELADLLKLGMSEVLRLLRENKLRVNLKGFLSYFF
FT                   KTKNDDPVFISNANEKLLNWYAQRLEGGMPPAALVYHRTGVRALHGFKIERVSYVRKLD
FT                   RRQYEHERKREFETIRPAWIREIGAKHASELEGAGISRADIARMVETGKAPLGYQVHHR
FT                   MPLDDGGTNAYDNLILMRDDVEHRAVHGYYNPGEQRIDRMNYGESGHVALPMPPADTIV
FT                   YPNIAMGYVSEPVPNVEFLEIFE"
FT   gene            484347..484775
FT                   /locus_tag="BC1002_0447"
FT   CDS_pept        484347..484775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_5349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14548"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBZ3"
FT                   /inference="similar to AA sequence:KEGG:Bpro_5349"
FT                   /protein_id="ADG14548.1"
FT                   /translation="MSIVELVEKMTLELNETNRPAARKEAEIFAASDRFASEFGVVLPD
FT                   AYKEVLRHADGVLHNGLAIWPIAEHAIFRQTIFEANADLRDSFDSRFVYFGQRDEELYV
FT                   FEPAKQRYSAIEFVGKPVWAEFHDDAEMFEFMLGRAWK"
FT   gene            complement(484997..491206)
FT                   /locus_tag="BC1002_0448"
FT   CDS_pept        complement(484997..491206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0448"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_0770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14549"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBZ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14549.1"
FT                   /translation="MIGVPAAIKALVTQAASWLKPKVIARAKALRAEHTAYRSGKPADS
FT                   IGMYESFNRTYERLLATDSTSQHDSPSFLTRVESLAVVAIHLRSPSVQRWLALSETKAS
FT                   IFTLAEFRIYSQAPDGASIRAGLADAYARETGEAANLADGAINSVIDALVQSYNSGLED
FT                   QSALVIGAVTGQLRVESKAVRGDLSSVKVQLQEIAQTVEALPTTTAEPLATREVERQLD
FT                   AILKTRTFDEQAVTRIRALAEAVLGGNLREASSEQKQAVFLWATRLLAADRASTDDVRK
FT                   YFSLVEGDETSSRYLVTKAMVLECTGHADEALRLIRDVSTDEARSAVLNILRRRDGWEV
FT                   VIAWYEQASTSISAKFLTPTGWTNLAGAFAEAGRWEDAIEKFQIARPLYESFPDLYFIE
FT                   GMYRAVMVVPPDFRLRVLNHNLVYGVVPLLEGDVAEEHRRNAIDLLSQAETRMVSYSAL
FT                   RAGQAREVKLWLSLRSRDDATRDFATKETQEALSDQARAVNIYHIARQFSAFQIDGPKL
FT                   WTYLSSRLGLGGLSDDEWINFYFLAVDTLLPTQLLKFLDEHDAKLSSLVDARILTTARI
FT                   AALMQDGGQAMRARTLLNVNRSAFSQGEAELIEAQISAAEGTDIRLQLVALYEQSPSLS
FT                   NASALVSYLAGVKDFAALLPVAQEVYRLDRTAAHALNVVSALQHLSGRAPEIVAFLAPE
FT                   GDIVRESEALRSALAWARLEVGDWRGAKSLNDSLLAEYPHIENHVGLDFNIAVKSGDWD
FT                   HFHVIFEREWPVREKYDSSTLLLLAQLAGDSQASRIKAFELLKLAVDRGNGSARVLVSA
FT                   YNAAVNLGMEDELTASWLALAASTDNEGIIQHITLRQIVEEVIPSNQRRSQSVVDSFGK
FT                   SAAPIQLLASVLNLPLGRLFCAIPAANENQHDPRKRFVLPLFGSRIDYPPLTASGDIGL
FT                   DVTAVLTLARLDLLDKTLSVFSHVYIAADTMPLLLKESRRIRFHQPSQIRLAETILEAL
FT                   DSAVLVSNSIPGTAPDWLIEEVGEELATALARAQAENGLIVASYPILKAGTLAEERADL
FT                   GEYADRAITVRTFVHGLLAAGKIPKVLAEQADAKLAQFDRGEKLEAPSSFLGKFIYADT
FT                   VAIRHLQQSGVLDALRPVRFQLYAPADLKDELEQTVAEAKERERTVAILDGARIALRRA
FT                   METDRVRLLPDRRPSEQLSELTSKGMGESFTAIGFLQSDSEISRLVVDDRYFTRLNHVV
FT                   SDDNRPIASYSSLDVIDALSACDAMSVTDGLYQRNRLRSMGAAYVAVMLDEVLGSLLAC
FT                   SLENDVSIVETHELKTIRQSIALSCTVDASNVLDRQYLDSTHRVLTTALSALWTSDNCS
FT                   IERAIAGSSWVLDNLARPIWTAAATVDGKPNHDVGIKIVALTTGTLLFQAVAWEAEKRR
FT                   TFHTFVEERLLRPARRANMDFIDSIVSHITHHLLALLDLKTHPAGGERVVAMTISELPI
FT                   WMHERLITHEKLGPLAKLSLAETIQFGSAEPISVSSLFEAAQSAARNGSFESAGAGGFR
FT                   ITRNTDSMSLQFRTDNGWENADVIELNGLLLSDSARVQRIAEVLRAYGPTFPEASSIKA
FT                   VVTRRPLSESEFLSLMMERAGGVMASWARIARRGSTPPHVSTLAPSDLKYYVRLMGPLE
FT                   TQRTVSTYLSEVAGPYRTHLVQRDLTMGLRITMFGYVDSRLSPSILVSSVDNDTLWNAL
FT                   NSMGQIADPYSLAALVDITLSRSGDERFLKLAGTTLSLLCVDGDSQEQLYEPISVFARL
FT                   ALSEMQTAEGAAAVQPYWKRIAAWIQGGVVVEHHKTSRINVQSLRSWAHEQMNATSDIT
FT                   EIQDMYLEPSVTGAWMTGEACRCNVLRLVHEVVNAVTVTGVVVPEAERLQSLIDELHQT
FT                   RRVTFLTSGPCTTLDDREDAELSESDRLFVAKRFEENAFSKAWAALASTNHLVRVSADC
FT                   YRVGADALREARLQTDDPEWIEKALMLHQVANLATTSEDHNLADIVRDILVDAAAQSNT
FT                   PERVVAVLNGIFLSAGSRRDYELRESWLQNATNLVAHAVPAGIPAGVAAAHLGLFSEAG
FT                   KWRNGPASWPEIYTQAAS"
FT   gene            complement(491698..493152)
FT                   /locus_tag="BC1002_0449"
FT   CDS_pept        complement(491698..493152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0449"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfs:PFLU0016 ribosomal RNA small subunit
FT                   methyltransferase B"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14550"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBZ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14550.1"
FT                   /translation="MYTLAEHESPKFAEFLSLTKPWQGAYTDATFSFIAVKDGGRLRLV
FT                   QGHVILPSNAVPQALQLQTPSVCACAVSLSTLGLDCEALIHALLRDELETPIGTLSLIE
FT                   QEGVGPQDISVYFPRYPDDFNSSREHALSLTLSCGRMPFGSRQAEFRNDLRTAQQPYDS
FT                   IVELANELWLKPLRWDTCTLDISAHSPVAIDLTREIIGGKVRLALLALRGIDVTPARFG
FT                   YRVVATGSVVQRRTLAATELAWSAGAGERIQVGEIDVCVPDGAIVQCFASYDGLLLQQG
FT                   FVVQPGILPNVRRMTHEVFDPALENTKKCLFDAKTQKQDARNLEAGVANLLYMLGFAVD
FT                   PLFGKPQSNNPDLIATTPSGDVLVVECTTAAIDIEGKLSKLLARTAALREKLAETGNSH
FT                   IRCLPVTVTSLAEPAITNMEEAVKARILVVSAEDLGRALDSTMVPQNADALFNEKWHTL
FT                   NPPPDPLFPDGIQPVSLPLSNSSSTI"
FT   gene            complement(493238..495511)
FT                   /locus_tag="BC1002_0450"
FT   CDS_pept        complement(493238..495511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0450"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: pol:Bpro_1706 putative
FT                   ATP-dependent exoDNAse (exonuclease V), alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14551"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBZ6"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ADG14551.1"
FT                   /translation="MSEVRLVRVSTIRSDNPKGFGGYIFYGPTIDSCGTVLDAKEHVVV
FT                   FLSRDLGIVGLQVGQWWRVTGKATRRERTINGFLIVEQQVHAESAELALPSGEHLVTFI
FT                   AESDAFPGVGMVKARKLWETFGDRLYSILDEGDESTLSTSVSPETAQVLVDGWKFFGNA
FT                   RTISWLSQHGFEVELGKKVVDYFGAEAPEAISEDPYRLLSFCASWHVTDRLAREHFGVG
FT                   QDDPRRLRGAIEETLYRLFGDGHTAATDAMVMTRLASVLGDDATRAPRSLVRSALETGR
FT                   QHGCFVVADDGMLHPLGAYVMETTVASALAIRLRTIAPANSRLLSRVRVEELIAEFESD
FT                   EQISFSAEQRIAVHLAAENRLCVISGGAGVGKTTILRCIYRVYREASILVIQAALAGRA
FT                   AKRMESVTGLPARTLAALQRKVTPEQLSEHCVIVVDEASMVDIITMYRLCSLLPPHVRL
FT                   LLVGDALQLMPVGPGLVLHALTSNSRIPQVHLEVPQRFAGEIARAATSVRTGTWPEIPS
FT                   DLDAPVVFLRRKPALATGRVDSAWSIAQTVLSLFQLEPKASQILCARKRGKEGVLALNE
FT                   ACQNVLTGSAPCLTIWNSELDALCNTGFRLGDPVVCTRNLYSAGLQNGSLGTLCKIEPE
FT                   PKPVIADRGDMLGNAIAWIDWDDGECRPVFESLLDHLDLAYALTIHKAQGSQWERVIIP
FT                   ITRHRLLDRTLIYTALTRAQRQVILVGDEEAARHAVESLPRAGLRNTALGSFLEELLAR
FT                   HVAA"
FT   gene            complement(495508..495948)
FT                   /locus_tag="BC1002_0451"
FT   CDS_pept        complement(495508..495948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="manually curated; KEGG: pol:Bpro_1707 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14552"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBZ7"
FT                   /inference="similar to AA sequence:KEGG:Bpro_1707"
FT                   /protein_id="ADG14552.1"
FT                   /translation="MPNTESPSDRNFSIFSNWSASKTDADFRQLAGRGVLSRTEIAREC
FT                   QFAKSVLDQNPRVKAALRRLEDGLRSRGVLPPLAIPAPQRTEAEPALTHRPSRKAVDKS
FT                   DRERQLEVENASLKAELDELKQRLSKYESLHTALALTGRVPR"
FT   gene            complement(495984..496649)
FT                   /locus_tag="BC1002_0452"
FT   CDS_pept        complement(495984..496649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14553"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14553.1"
FT                   /translation="MSTVLPLTDDEFDRLYEASENSRERESLTRLKRACDYLEQNGLKI
FT                   SPTTVERYCLDHQWGGPKGQSIRNSRDVLYRYLLRRQASQTVERASPCKEYKPAIADET
FT                   LRAYVALIEQERDVAVAARQRIEAALRTIPGVSLDEIIRIGFTATPNKQVKTPRHPSND
FT                   LRFALSNLLDEAHLASCGLQLYRDRVRAITSKSVLLEKAQVEAIREFLDEVEKSETSS"
FT   gene            complement(496646..499873)
FT                   /locus_tag="BC1002_0453"
FT   CDS_pept        complement(496646..499873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0453"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   rsq:Rsph17025_0725 phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14554"
FT                   /db_xref="GOA:D5WBZ9"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR024965"
FT                   /db_xref="UniProtKB/TrEMBL:D5WBZ9"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADG14554.1"
FT                   /translation="MRDMHSLIFEYERLRLNEFWDTVILARSKQGKWLGGFDSNGPTLL
FT                   YFKSATMQRLAASSLQGKTLWGRLRSLPLYKQKALLESIKPSRVDELKQISNTPYYAVA
FT                   PDFHSMLSDAGSSVAFVKKLCSHLRDGGEPLYHPLRYGEFLTMLLSKSLMLYPTGMRCW
FT                   KSVKYQTLFNPIYSSKATLLLTLVTKKMARRSAPNYITVCNALASSNVATSQDLSPELI
FT                   SAYESTFVRQTEERFPKERDVEKWRSSRASARKGIIWLKQAYNKGNPQHPIVISRPQYT
FT                   DSTSEQRLDGTFAWLREVRPDLAAWANNFRLYIAQSTDMRLYSPTGKLNVLGDFLCLLE
FT                   DAPLSPWELMREHVLCPTDPDRLTFLKYLGERFPNENPKRKNDIISKARQFFDWLKDQL
FT                   IAQGHKAAEHFANPIHANDNFGTRGTPSSTHRPRLDNYILSTMKEILTEDDFRFAKGLP
FT                   HQYAQVLDSLTNTTANVWDPSMTVCLYVLLETPIRSHQARWLDSGELDQKVYDEATNTL
FT                   IPNPSKLAIKGRKESALQLTSDSVNSETWMSLWVNTNKSAQYNSKDIGYPIPYMSSKLQ
FT                   ELLVTQRSWQRRYLPPILRPIPYADYQRDVRERPRTAAYLPDISPLFRDARSPSQEKPI
FT                   SYDKLKAFYRQLLVETQKRIEEKYGRKVQLVRMNGKAVEWSVDLHTLRVSGITALIEAG
FT                   VPLEIVSRFVAGHRTLVMTLHYLKYAPSKLRARLKAAYEQLEADVDFVNSPDFQHNLDD
FT                   FAPYLLGQEGAGVGAGFIALQCASGLLTINAEGICPGTSCDNGGPLIAKSQDSHGPVPG
FT                   GQRCGLCRFWITGPAHLHGQVAAVNNLAYKIRKKGLEIAELNDKRLDAEDRGNQREARS
FT                   LNDKVELLSRELAIDVNEWFSRYRYAERSMELMNDYLASKRRITGKGRKLIALTSATPT
FT                   ELKVTLESAHEFALLDHITQMTDFTTGFRNNEAELEKRSVLSTLMMENGVRPFLLELTE
FT                   QQAREAGNLLSSMILHQVEGQDLDEVMTGHRPLSDYPALSRAINIMANHVESGSVNAPL
FT                   LSPKLSKLLNQIQSPNGASPEDVETFA"
FT   gene            complement(499964..501361)
FT                   /locus_tag="BC1002_0454"
FT   CDS_pept        complement(499964..501361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acr:Acry_0811 phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14555"
FT                   /db_xref="GOA:D5WC00"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC00"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14555.1"
FT                   /translation="MQVTAHSIIELNISEGAIGNSIPLLILQDGSISFLVLLWAQHLML
FT                   HELTSAKNLWTKVCGVGRFYDFLILVKGGKRIPNNAMLIILEEFYQARRFGSTTLNWKP
FT                   VAPKTAKADEEAVTQFSEWCAANLGLPTLNAVERKLVTSLNFRAQQTFRRKQQHKRTYD
FT                   KLSHLEPSTLSGKGYNDEREFNPKENNTGALSYIKKYFPPDRVGVFIKSLSIRDALYFL
FT                   LLFFGGLRASEPLHLYVYDVTIQPDGIAKVVLSHPELGPYRWFDAHGKAHFGNRATFLA
FT                   ERYGIGPRNRLGEKHPLHAGWKGMRYDDGKWESEVFWLRPDAGRLFAKLHVQYMKTIRS
FT                   RVPDNHPFYFVNTRLSSDFGYPVTLSNMSKAFYRAAARVGLSSSDEGVNPHGGRHYYGF
FT                   FHANIFKTQLELLQLYMHHVSIESTKVYYNVTKSTARDELKKGWERISNDFPSSLRLDS
FT                   LFHPEMV"
FT   gene            complement(501531..502910)
FT                   /locus_tag="BC1002_0455"
FT   CDS_pept        complement(501531..502910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0455"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase; KEGG:
FT                   bpy:Bphyt_0688 ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14556"
FT                   /db_xref="GOA:D5WC01"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC01"
FT                   /inference="protein motif:PFAM:PF01645"
FT                   /protein_id="ADG14556.1"
FT                   /translation="MFSRRYLAMWCAIALAAVCAALAATHRLSWFWILVPVALVALGVF
FT                   DLTQQRHAILRNYPLWGHLRFIFEFIRPEIRQYFVEDDTDEKPFSRAQRSIVYQRAKND
FT                   VDSRPYGTELDVKAIAHEWISHSLAPTTLDGHDFRIVVGPDRAQPYSMSIFNVSAMSFG
FT                   SLSANAIMALNLGAKKGNFAHDTGEGSMSKYHREHGGDIIWEIASGYFGCRNDDGTFNA
FT                   EKFAKQAAEPQVKMIEVKLSQGAKPGHGGVLPAAKITPEIAETRGVPMGRDCISPATHS
FT                   EFSTPRELLEFVERLRTLSGGKPTGFKLCIGHPWEFFGIAKAMLETGILPDFIVVDGAE
FT                   GGTGAAPLEFTDHVGVPLQEGLLLVHNTLVGIGLRQRIRIGASGKMITAFDIAKTLAIG
FT                   ADWVNAARGFMFAVEIPPILDQLLERFNLLFLHLIHLSDELLLLAQEILSLNSASVSAS
FT                   L"
FT   sig_peptide     complement(502839..502910)
FT                   /locus_tag="BC1002_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.876 at
FT                   residue 24"
FT   gene            complement(503172..504434)
FT                   /locus_tag="BC1002_0456"
FT   CDS_pept        complement(503172..504434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0456"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /note="KEGG: bpy:Bphyt_0689 tRNA-specific 2-thiouridylase
FT                   MnmA; TIGRFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   PFAM: tRNA methyl transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14557"
FT                   /db_xref="GOA:D5WC02"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC02"
FT                   /inference="protein motif:TFAM:TIGR00420"
FT                   /protein_id="ADG14557.1"
FT                   /translation="MSKRKVVVGMSGGVDSSVTAWLLKEQGYDVVGLFMKNWEDDDDSE
FT                   YCSTRQDWIDVVSVADLIGIDVEAVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEI
FT                   KFKAFLDHAMSLGAETIATGHYARVRQNHERDGRFELLKALDHTKDQSYFLHRLNQAQL
FT                   SKTLFPLGEIPKTKVREIAAQIGLPNAKKKDSTGICFIGERPFRDFLNRYLPTRPGPMK
FT                   TTDGKIVGEHIGLAFYTFGQRKGIGLGGSKDGSGEPWFAAGKDIPTNTLYVAQGHDHPW
FT                   LLCHTLSAGNTSWVAGEPPADGFACGAKTRYRQADAACTFNAAAAGGSGDGLFELTFDA
FT                   AQWAVTPGQSAVLYDGDVCLGGGIIERAMTGQPAELPPDQAPKQTRAQRRKQAHKPKQP
FT                   QRASQDEPQTPRQKAALLGAR"
FT   gene            complement(504495..504974)
FT                   /locus_tag="BC1002_0457"
FT   CDS_pept        complement(504495..504974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0457"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bxe:Bxe_A4009 putative
FT                   NTP pyrophosphohydrolases including oxidative damage repair
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14558"
FT                   /db_xref="GOA:D5WC03"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR033713"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC03"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADG14558.1"
FT                   /translation="MKPETWLPHVTVAAIVERDGRFLLVEEHTAAGLRLNQPAGHLEAG
FT                   ETLLEAVVRETLEETAHPFAPEALVGMYMTHFERPDRAGTTYLRFTYCGAGGEPDPASS
FT                   LDPDIVRTLWMSADELRGCPERHRTPLVMQCIDDYLAGRRFPLDFVHTHSVGPKR"
FT   gene            505257..506399
FT                   /locus_tag="BC1002_0458"
FT   CDS_pept        505257..506399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0458"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="KEGG: bpy:Bphyt_0691 NAD(P)(+) transhydrogenase
FT                   (AB-specific); PFAM: alanine dehydrogenase/PNT domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14559"
FT                   /db_xref="GOA:D5WC04"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC04"
FT                   /inference="protein motif:PRIAM:1.6.1.2"
FT                   /protein_id="ADG14559.1"
FT                   /translation="MHIGVPAETRAHETRVAATPETVKKYVAQGHRVTLQSGAGAGASF
FT                   PDDAYTAVGAEIVDAATAFGADLVLKVQSPTDSELPLLKRGATLVGMLDPFNAENAGKL
FT                   AAAGVTAFALEAAPRTTRAQSLDVLSSQANIAGYKAVLLAATLYPRFMPMLMTAAGTVK
FT                   AARVLILGAGVAGLQAIATAKRLGAVLEASDVRPAVKEQIESLGAKFLDVPYETDEERD
FT                   AAQGVGGYARPMPPSWLARQSALVHERAKQADVVISTALIPGRPAPTLLSVETVQAMKP
FT                   GSVLVDLAAGRGPEVDGRRGGNCPLTETDQVVVRYGVQIVGYTNLAAMVPADASSLYAR
FT                   NLLDFLKLIVTKEGTLNIDLADDIVAATLLARDGQVTRNA"
FT   gene            506410..506736
FT                   /locus_tag="BC1002_0459"
FT   CDS_pept        506410..506736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0459"
FT                   /product="putative NAD(P) transhydrogenase subunit alpha"
FT                   /note="KEGG: bpy:Bphyt_0692 putative NAD(P)
FT                   transhydrogenase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14560"
FT                   /db_xref="GOA:D5WC05"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC05"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0692"
FT                   /protein_id="ADG14560.1"
FT                   /translation="MDVINHTVINLIIFVLAIYVGYHVVWNVTPALHTPLMAVTNAISA
FT                   IVIVGAMLAAGLTVGSAGKFFGTIAVALAAVNVFGGFLVTRRMLEMFKKKEPKKLPAGG
FT                   KEGA"
FT   gene            506737..508188
FT                   /locus_tag="BC1002_0460"
FT   CDS_pept        506737..508188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0460"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="KEGG: bxe:Bxe_A4006 putative NAD(P)
FT                   transhydrogenase, beta subunit; PFAM: NAD(P)
FT                   transhydrogenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14561"
FT                   /db_xref="GOA:D5WC06"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC06"
FT                   /inference="protein motif:PRIAM:1.6.1.2"
FT                   /protein_id="ADG14561.1"
FT                   /translation="MSLNVVTLLYLVASVCFIQALKGLSNPKTARVGNTFGMVGMAIAI
FT                   LTTIALISRQAEVLGSNLGLGLGLLLFGLVIGGAIGAFVAARVEMTKMPELVAAMHSLI
FT                   GLAAVCIAYGVVSEPAAFGLVDPEVPIEGFLPYGNRIELFIGTFVGAITFSGSVIAFGK
FT                   LSGKYKFRLFQGAPVVYGGQHLINLMLAIAMLGFGVLFFLTQSWLPFIIMTIIAFVLGV
FT                   LIIIPIGGADMPVVVSMLNSYSGWAAAGIGFSLNNPMLIIAGSLVGSSGAILSYIMCRA
FT                   MNRSFFNVILGGFGNEPGAAAGGAAEQRPVKSGSADDASFMMGNAETVVIVPGYGLAVA
FT                   RAQHALKELTDKLVEKGIEVKYAIHPVAGRMPGHMNVLLAEAEVPYDMVYEMEDINGEF
FT                   GQVDVVLVLGANDVVNPAAKNDPKSPIAGMPIIEAYKARTVIVNKRSMAAGYAGLDNDL
FT                   FYMDKTMMVFGDAKKVIEDMVKAVD"
FT   gene            complement(508243..508986)
FT                   /locus_tag="BC1002_0461"
FT   CDS_pept        complement(508243..508986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0461"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein; KEGG:
FT                   bpy:Bphyt_0694 helix-turn-helix type 11 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14562"
FT                   /db_xref="GOA:D5WC07"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC07"
FT                   /inference="protein motif:PFAM:PF08279"
FT                   /protein_id="ADG14562.1"
FT                   /translation="MRRYHRGTVPLLLYPTQTMTRRADRLFQIAELLRGRRLTTAQQLA
FT                   DWLNISLRTVYRDVRDLQLSGVPIEGEAGIGYRLSRSASLPPLTFTADELAALAAGARM
FT                   LESWGGAGFASGARGALAKIASAMPADKRAALERLAIFAPSFHIKAEFSTQLDTLHRAI
FT                   DMRQVVRFAYTDANGADTERRVWPLALAYWGARWTLGAWCELRGDFRNFGLEKMRDLTV
FT                   LETYPDQAGRRLADLLRHLNARPKK"
FT   gene            complement(509025..509408)
FT                   /locus_tag="BC1002_0462"
FT   CDS_pept        complement(509025..509408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0462"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bpy:Bphyt_0695
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14563"
FT                   /db_xref="GOA:D5WC08"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC08"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADG14563.1"
FT                   /translation="MSALPKVVAWFEIPSVDFDRAVRFYEAALDAPLNRQEIGGQPIAV
FT                   FSYEEPATGGAIVHSPSITPAADGVTVYLNAQPTVDAALERIERAGGKTDGPVIKLPQD
FT                   IGYIAFFTDTEGNRLGLHSRTNG"
FT   gene            complement(509522..511072)
FT                   /locus_tag="BC1002_0463"
FT   CDS_pept        complement(509522..511072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0463"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: bvi:Bcep1808_6282 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14564"
FT                   /db_xref="GOA:D5WC09"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC09"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADG14564.1"
FT                   /translation="MFSNLTIRTRLALAMGFLGLLMAIGAALGVTGIALSNADQKALYT
FT                   NELAAASALGKFNFFYARGRLGLDRIAAQPDRADIASLQQHAREQFAIGDKAWQAYRAL
FT                   PSDAQERQLADALEAKRAQAINGPVAQVFAAIERRDTTQLADLISNKMTDPFNEITDLS
FT                   AKLEKMQGDDARSRYEAAQERFHAILAIAGVGLLIGLSMAAFAWHALRKSIAGPLEEAT
FT                   GHFRAIANGDLSRRIDVRSRDEMGRMMDDLRMMQTRLRQALLSVRDGTQSISTATAQIS
FT                   AGNIDLSQRTEEQAASLEETASSMAELTSTVRQNADNARQASELARAAVSVTTEGSDVV
FT                   SRVVMTMGEIDASSKQIAEIIGVIEGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEV
FT                   RTLAQRSASAAKEIKTLISESVERVGNGTELVGRAGKTMTEINDAVRRVTEIMAEIAAA
FT                   SEEQSDGIEQVNRTVSQMDEVTQRNAALVEQAAAAAASLEEQATRMSDVVGVFQLPAE"
FT   sig_peptide     complement(510983..511072)
FT                   /locus_tag="BC1002_0463"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.632 at
FT                   residue 30"
FT   gene            complement(511280..512566)
FT                   /locus_tag="BC1002_0464"
FT   CDS_pept        complement(511280..512566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0464"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; THUMP domain protein;
FT                   KEGG: bxe:Bxe_A4003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14565"
FT                   /db_xref="GOA:D5WC10"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC10"
FT                   /inference="protein motif:PFAM:PF01170"
FT                   /protein_id="ADG14565.1"
FT                   /translation="MSFDFFLPCPRGLEAPLAAELAEIAAKHLNGAAFTAGAQVPGGVH
FT                   FRGGWAAGMAANLHSRLASRVLLKIAQRPYRSEQDIYALTLEQRWEQWFSAHETLRVDV
FT                   TAIKSPLRSLEFTTLRVKDAICDRLREKSGARPSIDTAMPDVRVFAFLTATDCTLYLDT
FT                   SGDPLFKRGWRLDKGAAPLRENLAAGILRLTGWQAGTPLYDPMCGSGTFLAEAAQVALD
FT                   IAPGVQRRFGFEKLIQFDTRTWQTLRGAALEAKNAARGSRGADLQIFGSDISGDMLEKA
FT                   RANFERAGLPAIALKQLDARDMTPPASSPGILVANPPYGERIEVRGRNARGELREGRGN
FT                   RDDDGFRRIQEEAPDSEFFQLLGNALKQRFAGWHAFILTSDRKLPGQLRLRESTKTPLF
FT                   NGALECRLFRFDLIAGSVRQRPQGDTQAG"
FT   gene            complement(512752..513501)
FT                   /locus_tag="BC1002_0465"
FT   CDS_pept        complement(512752..513501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0465"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330; KEGG:
FT                   bxe:Bxe_A4001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14566"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC11"
FT                   /inference="protein motif:PFAM:PF03886"
FT                   /protein_id="ADG14566.1"
FT                   /translation="MMFARLPRPPRALVRGAARGVVYGTALAAALAIAACSSPSSRFYT
FT                   LGGADSAAAAARTGAAPAWLIEIAPVNVPPQVARNQLVVQTGPTQVQLLEQERWASLPG
FT                   DEIRRALSTNLTQQLGTIDTFGTAHPDDAAVYRIAMNVQRFESWPGSHALIDAVWSVRA
FT                   VRSNAVMTCRSVVSETVGGGYDALVDGHRRALAEVSTQIATGVRAMAAAAAATTNGTGR
FT                   TSSSSRPAAAPVVPPCPSAGTAAEAGA"
FT   gene            complement(513498..515159)
FT                   /locus_tag="BC1002_0466"
FT   CDS_pept        complement(513498..515159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0466"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: bpy:Bphyt_0709 mammalian cell entry related domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14567"
FT                   /db_xref="GOA:D5WC12"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC12"
FT                   /inference="protein motif:PFAM:PF02470"
FT                   /protein_id="ADG14567.1"
FT                   /translation="MTSPQGPTPASGDAPRNDSNGPRLPPQLPDPDIEPRSRWLPSLVW
FT                   VIPLIAALIGIALVVRSVTERGPVITISFISAEGLEPGKTQVKYKDVAIGSVKTITLAP
FT                   DLSHVLVQVQLTKEGGKFAVKDSRFWVVRPRVGASGVSGLTTLLSGAYIGADAGRSSDS
FT                   ESNFVGLETPPPITGDQKGRQYTLHGESLGSIDIGSPIFYRRVQVGQVVGFSLDKSGTG
FT                   VTMQVFVSAPFDQYVGTNTRWWHASGVDLRLDSSGFKLNTQSLATVIVGGLSFQSPPGQ
FT                   NMGPQAPNNQTFRLGSDQADAMREPDGVPLRVVMNFNQSLRGLSIGAPVDFRGIVLGQV
FT                   TDIGIDYDPTTRSFTMPVTMNVYPDRLGKRFRESAPQPGSLAGENLLQELVKHGLRGQL
FT                   RTGNLITSQLYVALDIFPKAAPAKVDVTKDPLELPTIPNTLDELQLQVADIAKKLDKVP
FT                   FDQIGANLNTALKNADQLFSRLDKEVVPQARDTLSAAKQTFNSAQATLQQDSPMQSDVH
FT                   QALQELTRTLQSLNALSDYLERHPESLLRGKSGDKP"
FT   gene            complement(515152..515802)
FT                   /locus_tag="BC1002_0467"
FT   CDS_pept        complement(515152..515802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0467"
FT                   /product="Paraquat-inducible protein A"
FT                   /note="PFAM: Paraquat-inducible protein A; KEGG:
FT                   bxe:Bxe_A3999 putative paraquat-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14568"
FT                   /db_xref="GOA:D5WC13"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC13"
FT                   /inference="protein motif:PFAM:PF04403"
FT                   /protein_id="ADG14568.1"
FT                   /translation="MKYVTAKRAGLVSCHSCGRVEPRIRSVTPQHCSRCGAHLHSRNPD
FT                   SLMRTWALLIAAALLYIPANLLPVMHTSSLLGTEDDTIMSGVVYFWTSGDWPLAVIVFI
FT                   ASIMVPMLKLSVLVLLTITAQRRSRWRPQQRTTLYRMVERIGRWSMLDVFVVTLTVALV
FT                   RFKSLAVITAGPGAIAFGSVVILTMLASMQFDPRLIWDPVESSTPKPQDLAHD"
FT   gene            complement(515810..516589)
FT                   /locus_tag="BC1002_0468"
FT   CDS_pept        complement(515810..516589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0468"
FT                   /product="Paraquat-inducible protein A"
FT                   /note="PFAM: Paraquat-inducible protein A; KEGG:
FT                   bpy:Bphyt_0707 paraquat-inducible protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14569"
FT                   /db_xref="GOA:D5WC14"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC14"
FT                   /inference="protein motif:PFAM:PF04403"
FT                   /protein_id="ADG14569.1"
FT                   /translation="MEHDNLIACHECDTLFRKPRLVGRVAARCPRCRATLYRGVSRKLD
FT                   AICALTLAALITFVIAQGFPIVELETNGITSQTTLFGALVALWSEDMQIVAVMVFCSTI
FT                   LFPLTELVALLYVLVPLRSGYVPPHFHRVLRAIQFVRPWGMIEVFMLGVLITIVKMVSL
FT                   ARVIPEAALFAFGALTLMFAVVVTFDPRVLWDVADEIDASGDRPLPRTSADSAALALGS
FT                   LAGPPAPSTRVAGSTAGSADGAAGGAPPGLPPAPREG"
FT   gene            516935..517495
FT                   /locus_tag="BC1002_0469"
FT   CDS_pept        516935..517495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0469"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: bpy:Bphyt_0706
FT                   cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14570"
FT                   /db_xref="GOA:D5WC15"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC15"
FT                   /inference="protein motif:PFAM:PF01292"
FT                   /protein_id="ADG14570.1"
FT                   /translation="MTLNPSFGTRESYTRTAIAFHWLIALLIVCGFALGWVMTDIPGFT
FT                   PTKLRYFSWHKWIGVTVFALAIVRILWRATHAGPPMPRRMPTWQRAAAHLTHLLLYALM
FT                   IVIPVSGYLYSSAANVPVVYLGLIPLPRIIAPDPHLKEVLKDLHIALNYTLLVLVALHV
FT                   AAALKHQWLDRDGLLSRMIPFLK"
FT   gene            517504..518067
FT                   /locus_tag="BC1002_0470"
FT   CDS_pept        517504..518067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0470"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: bpy:Bphyt_0705 YceI
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14571"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC16"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ADG14571.1"
FT                   /translation="MKVSFYRYMLAAFAAASLSAAGAALAQVDVAKSSVTATSKQMNVP
FT                   VEGKFNKFSAQVSFDPTKPTAGSAQIDIDVASYDLGDESYDEQVRGKEWFDAKAFPRAT
FT                   FVSSEIAPAGANQFKVTGKLTIKGKSQTVVVPVTVSQQGATQTFDGALPIKRSQFDVGT
FT                   GEWKDTSVVADEVVIKFHIVAAHK"
FT   sig_peptide     517504..517584
FT                   /locus_tag="BC1002_0470"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 27"
FT   gene            518167..518745
FT                   /locus_tag="BC1002_0471"
FT   CDS_pept        518167..518745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0471"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: bpy:Bphyt_0704 YceI
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14572"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC17"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ADG14572.1"
FT                   /translation="MKTSMLIAVGALASSLSLGAFADTYTLDPMHTFPSFEADHFGGLS
FT                   IWRGKFTKTTGTVTLDRAGKTGTLDVTVDPASVQTGNPKLDDHLKSGEFFDVAKYPTVT
FT                   YKGTEIRFDGDKPVEVIGNLTIRGITKPVNLKVDSFKCMQHPVLKREVCGVEASTEFNR
FT                   ADYGMDFGAKYGFSMQTRLHIQSEGIKQQ"
FT   sig_peptide     518167..518235
FT                   /locus_tag="BC1002_0471"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            519064..520341
FT                   /locus_tag="BC1002_0472"
FT   CDS_pept        519064..520341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0472"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_0703 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14573"
FT                   /db_xref="GOA:D5WC18"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC18"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG14573.1"
FT                   /translation="MNATTAASIAGSRQNSWRAVVAASIGNALEWFDLVVYGFFAVTIS
FT                   KLFFPAGNDTVSLLLTLGTFGVSFFMRPLGAIVIGAYSDRAGRKAALTLSIMLMMGGTL
FT                   IIAILPTYQSIGLAAPLILVLARLMQGFSAGGEFGSATAFLAEHEPGRRGFYASWQMAS
FT                   QGLTTLLAAGFGALLTGGLSPEQMTSWGWRVPFFFGLLIGPVAFYIRTKLDETPEFLAA
FT                   ETTQTPLRDTFATQKLRLVIAMGVVILGTVSSYLMLFMPTYGVRQLGLAPSVAFSAIAV
FT                   TGLIQMVFSPVAGHWSDLHGRTRIMLGAAVLLFVLVYPAFAFLIAHPSFGTLIVWQIVF
FT                   GFLVSGYFGATPGLLSEIFPVQTRTTGMSLAYNIAVTIFGGFGPFIIAWLISVTGSKAA
FT                   PSYYVMFAALLSIAALIGARRKLGFR"
FT   gene            complement(520442..521392)
FT                   /locus_tag="BC1002_0473"
FT   CDS_pept        complement(520442..521392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0473"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="KEGG: bxe:Bxe_A3993 preprotein translocase subunit
FT                   SecF; TIGRFAM: protein-export membrane protein SecF;
FT                   protein-export membrane protein, SecD/SecF family; PFAM:
FT                   SecD/SecF/SecDF export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14574"
FT                   /db_xref="GOA:D5WC19"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC19"
FT                   /inference="protein motif:TFAM:TIGR00966"
FT                   /protein_id="ADG14574.1"
FT                   /translation="MEFFRFRKDIPFMQRALIFNAISLITFLAAVFFLVHRGLHLSVEF
FT                   TGGTVIEVQYPSAAPLDPVRATLGKLGYADAQVQNFGTARDVLIRLPLKSGFTSAQQSE
FT                   QVMSALKADTPEVQLQRVEFVGPQVGKELATDGLLALACVVIGIVIYLSFRFEWKYAVA
FT                   GVIANLHDVVIILGFFAFFQWEFSLSVLAAVLAVLGYSVNESVVIFDRIRETFRRERKM
FT                   SVIEVINHAITSTMSRTIITHGCTQMMVLSMFLFGGPTLHYFALALTVGILFGIYSSVF
FT                   VAAALAMWFGVKREDLIKEKKESHNPDDPNAGAQV"
FT   gene            complement(521411..523498)
FT                   /locus_tag="BC1002_0474"
FT   CDS_pept        complement(521411..523498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0474"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="KEGG: bxe:Bxe_A3992 preprotein translocase subunit
FT                   SecD; TIGRFAM: protein-export membrane protein SecD;
FT                   protein-export membrane protein, SecD/SecF family; PFAM:
FT                   SecD/SecF/SecDF export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14575"
FT                   /db_xref="GOA:D5WC20"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC20"
FT                   /inference="protein motif:TFAM:TIGR01129"
FT                   /protein_id="ADG14575.1"
FT                   /translation="MNRYPLWKYAVMLVALVIGLVYTLPNLYGEAPAVQVSSGKATVRL
FT                   DATTLASVEAALAGNQIKPTAVTFDNSQNNANIRVRLTDTDTQLRVKDLLQKSLNSDPN
FT                   DPQYIVALNLQSASPTWMTALRALPMYLGLDLRGGVHFLLQVDMAGALNKKLDSDASDV
FT                   RTLLRDNNVRDGGVNRVNQSVVVNLADQATADAALKLLGRGVSELQWTSQPSPGADGGV
FT                   QLVGTFTPAVQRAVQDAALKQNITTLHNRVNELGVAEPVIQQQGADRIVVELPGVQDTA
FT                   KAKDIIGRTATLEARLADPVNTHPNPNDPVPPGDELFTQGNQAPVLLRKQVIFTGDRII
FT                   DASAGFDEHQRPSVNIRLDSAGGRAVRAVSRDNIGKPMAMVLFERGKGEVLTVATIQSE
FT                   LGDRFQITGQPTPQAAADLALLLRAGSLAAPMEIIEERTIGPSLGADNIKKGFHSVVWG
FT                   FAAIAVFMIAYYMLFGVISMIGLSVNLLLLVAVLSMLQATLTLPGIAAIALALGMAIDA
FT                   NVLINERVREELRHGAPPQLAIQNGYAHAWATILDSNVTTLIAGLALLAFGSGPVRGFA
FT                   IVHCIGILTSMFSAVFFSRGLVNFWYGGKKKLKSLSIGQVWRPQAAAGSAAYAGGLGSS
FT                   DAATDTAQAIATAKASAKASSKAPAAAGAQGRAKPTVRRRNAPGTPTSNGSTPQKPGSS
FT                   R"
FT   gene            complement(523615..523944)
FT                   /locus_tag="BC1002_0475"
FT   CDS_pept        complement(523615..523944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0475"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="KEGG: bxe:Bxe_A3991 preprotein translocase subunit
FT                   YajC; TIGRFAM: preprotein translocase, YajC subunit; PFAM:
FT                   YajC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14576"
FT                   /db_xref="GOA:D5WC21"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC21"
FT                   /inference="protein motif:TFAM:TIGR00739"
FT                   /protein_id="ADG14576.1"
FT                   /translation="MSFISNAFAQGAAAGGIESNLMSFLPLILMFGVLYFIMIRPQMKR
FT                   QKEHRNMLAAMAKGDEVVTNGGIVGKVTKVGEAYVGIEISEGTEITVQKASVTTILPKG
FT                   TIKSL"
FT   gene            complement(524155..525345)
FT                   /locus_tag="BC1002_0476"
FT   CDS_pept        complement(524155..525345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0476"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="TIGRFAM: queuine tRNA-ribosyltransferase;
FT                   tRNA-guanine transglycosylase, various specificities; KEGG:
FT                   bxe:Bxe_A3990 queuine tRNA-ribosyltransferase; PFAM:
FT                   Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14577"
FT                   /db_xref="GOA:D5WC22"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC22"
FT                   /inference="protein motif:TFAM:TIGR00430"
FT                   /protein_id="ADG14577.1"
FT                   /translation="MTFGHPSQHPAHERPENGLKFELLGTDGLARRGRVTLNHGVVETP
FT                   IFMPVGTYGTVKAVQPRELDEMHAQIILGNTFHLWLRPGLETIEAHGGLHGFMGWKKPI
FT                   LTDSGGFQVFSLGDLRKITEDGVTFASPINGDRLFLSPEVSMQIQKVLNSDIVMQFDEC
FT                   TPYATNNVPTSHKEAAESMRMSMRWAQRSIDEFQSLGNPNALFGIVQGGMFEDLRDESL
FT                   AGLAEKNFHGLAIGGLSVGEPKEDMMRILNHIGPKLPANKPHYLMGVGTPEDLVAGVAA
FT                   GVDMFDCVMPTRNARNGWLFTRFGDIKIRNATHKNSLRPLDEQCGCYTCRNFTRGYLHH
FT                   LHRVGEILGAQLNTIHNLHYYLELMQEMRDAIEAKLFDAFRKRFHEDRARGVEPSS"
FT   gene            complement(525460..526518)
FT                   /locus_tag="BC1002_0477"
FT   CDS_pept        complement(525460..526518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0477"
FT                   /product="S-adenosylmethionine/tRNA-ribosyltransferase-isomerase"
FT                   /note="KEGG: bpy:Bphyt_0698 S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase; TIGRFAM:
FT                   S-adenosylmethionine/tRNA-ribosyltransferase-isomerase;
FT                   PFAM: Queuosine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14578"
FT                   /db_xref="GOA:D5WC23"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC23"
FT                   /inference="protein motif:TFAM:TIGR00113"
FT                   /protein_id="ADG14578.1"
FT                   /translation="MFTLSDFDFDLPPELIAQVALPERSASRLLDVDAAGTADGAARLI
FT                   DRRFTELPERLAPGDLLVFNDTKVLKARFFGQKASGGKIEVLVERLTGERSALAQIRAS
FT                   KSPQAGTTIRLADAFDVTVGERVDQFYTLHFPDDCLTLIEQYGRLPLPPYIEHDPDATD
FT                   ETRYQTVYAQNPGAVAAPTAGLHFDDALLARLDALGIERATLTLHVGAGTFQPVRVENI
FT                   AEHKMHSEWYHLPQALADKIAATKARGNRVIAVGTTSMRALEAAARDAEAAGHPLAAAS
FT                   AETDIFITPGYRFRVVDRLVTNFHLPKSTLLMLVSAFAGVETIRAAYRHAIDERYRFFS
FT                   YGDAMLLTRRDA"
FT   gene            526711..528999
FT                   /locus_tag="BC1002_0478"
FT   CDS_pept        526711..528999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0478"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase RecG; PFAM:
FT                   DEAD/DEAH box helicase domain protein; nucleic acid binding
FT                   OB-fold tRNA/helicase-type; helicase domain protein; KEGG:
FT                   bpy:Bphyt_0697 ATP-dependent DNA helicase RecG; SMART:
FT                   DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14579"
FT                   /db_xref="GOA:D5WC24"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC24"
FT                   /inference="protein motif:TFAM:TIGR00643"
FT                   /protein_id="ADG14579.1"
FT                   /translation="MPLSDRRSSVATVEAGAEPRRRSARAEAGEPEAADDGAQGGMIAA
FT                   GHDAGRDGDPASGDKPAAKTKATAKPAAKPAAKTADKLAKLGLTRDIDLVLHLPMRYED
FT                   ETSLTPIGHLLPGGVAQTEGVVFDNEIAYRPRRQLLVKLRDAEGDELVLRFLNFYGSQV
FT                   KQMAPGARLRVRGDVRGGFFGMEMVHPTVRVVDEDTPLPQALTPVYPSTAGVSQAYLRK
FT                   AIDNALARTSLPELLPAPVARAFLEPLGVPALMDAVRTLHHPGAQSDETALIDGTHPAW
FT                   VRIKFEELLAQQMSLKRAHDERRNRAAPAMPRRKLGDESALVARLLKALPFSLTAAQQR
FT                   VGGEIALDLTQPHPMQRLLQGDVGSGKTIVAALAAAQAIDAGYQAALMAPTEILAEQHA
FT                   RKLRGWLEPLGVNVAWLAGSLKTKEKRAAIEAAALGTAQLVIGTHAIIQDAVEFARLGL
FT                   VIVDEQHRFGVAQRLALRAKAQGAADGASDFQPHQLMMSATPIPRTLAMTYYADLDVST
FT                   IDELPPGRTPILTKLVSDARREEVIGRVREAALTGRQVYWVCPLIEESETLQLQTAVET
FT                   YETLVAALPELKVGLVHGRLAPAEKATVMDAFSRNEIQLLVATTVIEVGVDVPNASLMV
FT                   IEHAERFGLAQLHQLRGRVGRGSAASVCVLLYTGPLSMTARARLQTMRETTDGFEIARR
FT                   DLEIRGPGEFLGARQSGAAMLRFADLQNDQHLIEPAREAAATLLDQYPDVVLQHLARWL
FT                   GAREQYLKA"
FT   gene            529104..530063
FT                   /locus_tag="BC1002_0479"
FT   CDS_pept        529104..530063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0479"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bph:Bphy_2522 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14580"
FT                   /db_xref="GOA:D5WC25"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC25"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADG14580.1"
FT                   /translation="MTLTELKYIVAVARERHFGRAAEACFVSQPTLSVAIKKLEDELNV
FT                   QIFERGTSEVSVTPIGEQIVTQAQRVLEQTLAIKEIAKQGKDPLVGPLRLGVIYTIGPY
FT                   LLPTLVKQMIQRVPQMPLMLQENYTLKLIELLKQGEIDVAIMALPFPETGLMLRPLYDE
FT                   PFVVALPSGHAWEGRSKIDPDDLKQETMLLLGSGHCFRDHVLGVCPELMRFSQNADGIQ
FT                   KTFEGSSLETIRHMVASGVGITVLPRMSVHEVKPHAGGIDAGLLSYVAFDEPVPDRRVV
FT                   LAWRKSFTRMPAIDAICEAIAACELPGVKKLDLPAAVN"
FT   gene            530274..530393
FT                   /locus_tag="BC1002_0480"
FT   CDS_pept        530274..530393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14581"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC26"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14581.1"
FT                   /translation="MQAVSQRIHAFPTQPTMTAAAPSIRAVAMSLLVDRVLAA"
FT   gene            530475..531929
FT                   /locus_tag="BC1002_0481"
FT   CDS_pept        530475..531929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0481"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="KEGG: bpy:Bphyt_0712 catalase; PFAM: Catalase
FT                   related subgroup; Catalase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14582"
FT                   /db_xref="GOA:D5WC27"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC27"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ADG14582.1"
FT                   /translation="MSERKLTNAAGAPIADNQNSMTAGPRGPVVLQDVWLLEKLAHFDR
FT                   EVIPERRVHAKGSGAFGTLTVTHDISRYTKAKVFAQVGKETPLFMRFSTVAGERGAADA
FT                   ERDVRGFSIKFYTEEGNWDVVGNNTPVFFIRDPLKFPDFIHTQKRDPYTNLRNNVAAWD
FT                   FWARHPESLHQVTILMSDRGIPKNYRQMHGFGSHTYSFTNANNERFWVKFHFKSQQGIE
FT                   NFTDAEAAQVVAHDRESAQRDLVTSIDAGNFPKWRFAIQVMPEADAANYRFNPFDITKV
FT                   WSQKDYPLIDVGTIELNRNAANYFADVEQAAFTPANVVPGIGFSPDRLLQGRLFSYGDT
FT                   QRYRLGINHHQIPVNAPRVPNPHSFHRDGAMRTDGNLGGNVNYEPNRFGDFAQDANASE
FT                   PPLAAGAVARYEHREDDDYYTQPRMLFALFDDAQRQRLFGNIARHIDGVPQDIVARQIE
FT                   HFRRADPAYAEGVIAALAALQEGRNR"
FT   gene            532025..532189
FT                   /locus_tag="BC1002_0482"
FT   CDS_pept        532025..532189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3985 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14583"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC28"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A3985"
FT                   /protein_id="ADG14583.1"
FT                   /translation="MIQMMTASIGGPAATPSMQAQRQALMLRKAMGVAIVASGFAVIAA
FT                   QALQHALGG"
FT   sig_peptide     532025..532084
FT                   /locus_tag="BC1002_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.655) with cleavage site probability 0.614 at
FT                   residue 20"
FT   gene            532345..532842
FT                   /locus_tag="BC1002_0483"
FT   CDS_pept        532345..532842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0483"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   bpy:Bphyt_0714 ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14584"
FT                   /db_xref="GOA:D5WC29"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC29"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ADG14584.1"
FT                   /translation="MAKKEAAAAVQHVNIGISDKDRKKIAEGLSRLLADTYTLYLKTHN
FT                   FHWNVTGPMFNTLHLMFETQYSELALAVDSIAERIRALGVHAPGSYKDFAKLSSIPEAD
FT                   GVPTAEDMIRQLVEGQEAVVRTARAIFPATEAANDEPTADLLTQRMQTHEKTAWMLRSL
FT                   LA"
FT   gene            533076..533939
FT                   /locus_tag="BC1002_0484"
FT   CDS_pept        533076..533939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0484"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /note="KEGG: bpy:Bphyt_0715 4-hydroxybenzoate polyprenyl
FT                   transferase; TIGRFAM: 4-hydroxybenzoate polyprenyl
FT                   transferase; PFAM: UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14585"
FT                   /db_xref="GOA:D5WC30"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC30"
FT                   /inference="protein motif:TFAM:TIGR01474"
FT                   /protein_id="ADG14585.1"
FT                   /translation="MFARLPLYLRLVRMDKPIGSLLLLWPTLNALWIASGGHPSWQLLV
FT                   IFTLGTVLMRSAGCAINDYADRDFDRHVKRTENRPITSGKINAWEAVVLATVLSLIAFL
FT                   LIQPLNALTKELSVVALFVAGTYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDHVPLL
FT                   AWVMLVANIFWAVAYDTEYAMVDRDDDIKIGIRTSALTFGRFDVAAVMLCYAVTLGIYV
FT                   GIGLTLGFGPLYWLGWAAAVGCAIYHYTLIRNRERMPCFAAFRHNNWLGGALFAGIAAH
FT                   YAVTSF"
FT   gene            complement(534071..534886)
FT                   /locus_tag="BC1002_0485"
FT   CDS_pept        complement(534071..534886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0485"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="TIGRFAM: pyrroline-5-carboxylate reductase; KEGG:
FT                   bxe:Bxe_A3982 pyrroline-5-carboxylate reductase; PFAM: NADP
FT                   oxidoreductase coenzyme F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14586"
FT                   /db_xref="GOA:D5WC31"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC31"
FT                   /inference="protein motif:TFAM:TIGR00112"
FT                   /protein_id="ADG14586.1"
FT                   /translation="MKIAFIGGGNMAAALIGGLIKRGVAPADLYAIDPNEDARKRNEQQ
FT                   FGIRTGAAADGTLADYDAVVLAVKPQILKSVAETLAPHLRASQLIVSIVAGIRIGDMSR
FT                   WLNGHGRIVRVMPNTPALIGMGVTGLVASGSVDEAGRALASQVLGAVGETVWFDAEAKI
FT                   DAVTAISGSGPAYVFYFIEALQEAARQLGMDEAQGRALAVATFTGAAQLAANSEEPPSV
FT                   LRERVTSKGGTTAAALASFDASGIKDAIVRGALAADARAREMGDEFGKH"
FT   gene            complement(534963..535685)
FT                   /locus_tag="BC1002_0486"
FT   CDS_pept        complement(534963..535685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0486"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   bxe:Bxe_A3981 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14587"
FT                   /db_xref="GOA:D5WC32"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC32"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ADG14587.1"
FT                   /translation="MSDLPRRFADHFAHNLADVHERIAKAAQAAGRDAQSVMLLAVSKT
FT                   FPADAVRDAHAAGQRAFGENYVQEALDKIQTLADLRASLEWHFIGPLQSNKTRPVAEHF
FT                   DWVHSVDRLKIAQRLSEQRPDNLPPLNVCLQVNVSGEASKSGVAPDEAAAIAHQITALP
FT                   KLKLRGLMSIPEPAGDLDAQRAPHRQLRELFERLRNDGLALDTLSMGMSADLEAAVLEG
FT                   ATIVRVGTAIFGARDYSR"
FT   gene            complement(535722..536948)
FT                   /locus_tag="BC1002_0487"
FT   CDS_pept        complement(535722..536948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0487"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; KEGG: bpy:Bphyt_0718
FT                   glycolate oxidase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14588"
FT                   /db_xref="GOA:D5WC33"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC33"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ADG14588.1"
FT                   /translation="MQTNLADFIRNTPDGNEADAILRKCVHCGFCTATCPTYQLLGDEL
FT                   DGPRGRIYLIKQMVEGAPVTRSTQVHLDRCLTCRNCETTCPSGVQYGRLVEIGRKLTEE
FT                   KVTRPLNQRLMRRLLASVLPNSAIFTPAMRLGQHVRGLLPKKLRDKVPARQRPLEWPSA
FT                   KHDRKVLMLAGCVQPSMMPNVNIATARVFDALGIETLIAPEAGCCGAIRLHLGYNEEAL
FT                   DDVRANIDAWWPYVEQGVEAIVMNASGCGATVKEYAHLLRLDPEYAEKARRIVELTRDV
FT                   SEILPEFEEQLVAITRRRSVHTVAFHPPCTLQHGQQIRGKVEQLLGALGLEVRLPADSH
FT                   LCCGSAGTYSLLQPRLSYALRDQKLERLQAQEPQVIVSANVGCIAHLQSGTSTPVAHWI
FT                   ELVEHMLSV"
FT   gene            complement(536957..538045)
FT                   /locus_tag="BC1002_0488"
FT   CDS_pept        complement(536957..538045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0488"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   bxe:Bxe_A3979 glycolate oxidase FAD binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14589"
FT                   /db_xref="GOA:D5WC34"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC34"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADG14589.1"
FT                   /translation="MEEDDIVAVWSERVRSASAEGRAVRIRGGGTKDWYGQTLEGEILD
FT                   TRAYRGIIAYDPAELVITARAGTPLLEIEAALAEHDQMLPFEPPHFGPQATFGGCIAAG
FT                   ISGPRRPAVGAARDFVLGAVVMNGQGQVLHFGGQVVKNVAGYDVSRLLAGSLGTLGLIL
FT                   ELSVKVLPRPQAEATLKFDMNGTDAVRKLNEWGGRPLPITASAWRNGTLAVRLGGAEAA
FT                   VKAARTGLGGEVVDAVEAERFWGGLREQTDSFFASIPPKAALWRLALPSITEPLQLPGA
FT                   QLMEWGGGQRWWITDTDAQTVRISAKQAGGHATIFRSGHGYDRSAGVFTPLPAPLMKIH
FT                   RGLKQAFDPARIFNRGRLYPDF"
FT   gene            complement(538230..539723)
FT                   /locus_tag="BC1002_0489"
FT   CDS_pept        complement(538230..539723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0489"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   bpy:Bphyt_0720 FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14590"
FT                   /db_xref="GOA:D5WC35"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC35"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADG14590.1"
FT                   /translation="MNAPAELSAEVLAQRQREVVQALMAVLPTHCLLYREEDTVAYECD
FT                   GLAAYRRLPLAVALPETESQVQRIVQICHRLEVPIVPRGAGTGLSGGAMPIRHGVVVSL
FT                   ARFRKIVEVDPYARIATVQPGVRNLAISEAAAPYGLYYAPDPSSQIACTIGGNVSENSG
FT                   GVHCLKYGLTVHNVLRVRAVTMDGEIVEFGSLAPDAPGLDLLAVLIGSEGMFAIVTEVT
FT                   VKLIPKPQTAQVIMASFDDVVKGGDAVAGIIAAGIIPAGLEMMDKPATRAVEEFVNAGY
FT                   DLDAAAILLCESDGTPEEVAAEIVRMTAVLREHGATRIQISRTEAERLRFWSGRKNAFP
FT                   AAGRISPDYYCMDGTVPRRSIGPLLARIEEMEKTYQLRCINVFHAGDGNMHPLILFNGN
FT                   DQDEWHRAELFGSDILEACVELGGTVTGEHGVGIEKINSMCVQFSPEERDTFHAVKRAF
FT                   DAPGLLNPDKGIPTRARCAEYGKMHVRGGLLPHPELPRF"
FT   gene            complement(539853..541271)
FT                   /locus_tag="BC1002_0490"
FT   CDS_pept        complement(539853..541271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0490"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   bxe:Bxe_A3977 putative FAD-binding oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14591"
FT                   /db_xref="GOA:D5WC36"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC36"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADG14591.1"
FT                   /translation="MNHPVPPAPLRRPFPAELLNQLKAAFGDRVSVAEAVRAHHGRDES
FT                   PFDPQLPDAVVFARTAEDVQTAVRLCGRYDVPIIPYGNGSSLEGHLLAVQGGVSIDLSE
FT                   MNRVLSINAEDLTVTVEPGISRKQLNEALRDTGLFFPIDPGADASIGGMSATRASGTNA
FT                   VRYGTMRENVLGLTVVLADGRVIKTGSRARKSSAGYDLTRLFVGSEGTLGVITEITLRL
FT                   YPQPEAVSAAVCTFPSMGDAVRAVIETIQIGVPIARVEFVDSLAIRSINRHSNLTLREA
FT                   PTLFFEFHGTEAGVKEQAELVQEIAAQNAGEGFEWATRPEDRSRLWNARHSAYFAMLQL
FT                   KPGSRAVTTDVCVPISRLAECVVETEQDLLASPLPCPIVGHVGDGNFHVAILIDPDKPE
FT                   ELEEAERLNHRIVQRALRMDGTCTGEHGVGLHKMGFLLEEHGDVAVDTMRSIKHALDPR
FT                   NLMNPGKIFAWTAA"
FT   gene            541497..542051
FT                   /locus_tag="BC1002_0491"
FT   CDS_pept        541497..542051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0491"
FT                   /product="ATP/cobalamin adenosyltransferase"
FT                   /note="KEGG: bpy:Bphyt_0722 ATP/cobalamin
FT                   adenosyltransferase; TIGRFAM: ATP/cobalamin
FT                   adenosyltransferase; PFAM: cobalamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14592"
FT                   /db_xref="GOA:D5WC37"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC37"
FT                   /inference="protein motif:TFAM:TIGR00636"
FT                   /protein_id="ADG14592.1"
FT                   /translation="MGNRLSKIATRTGDDGTTGLGDGRRVRKDSVRIAAIGDVDELNSN
FT                   LGVLLCENLPENVRAALVAIQHDLFDLGGELCIPGHTMITERHLAQLDGWLADYNATLP
FT                   PLKEFILPGGSRAAALAHVCRTVCRRAERAIVALGEHEALNAAPRQYVNRLSDLLFVLA
FT                   RVLNRADGGTDVLWQHDRGAP"
FT   gene            complement(542106..542438)
FT                   /locus_tag="BC1002_0492"
FT   CDS_pept        complement(542106..542438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0492"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: bpy:Bphyt_0723 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14593"
FT                   /db_xref="GOA:D5WC38"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC38"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADG14593.1"
FT                   /translation="MTIDTNIRHVTRAGANVFLELGFSAEEAKRLHAASQKQINDTRLL
FT                   KEQLMTELSTWIEQHHLKQAEAAEILMVSRPRVSDVVNKKTTKFTIDTLVEMLSRIGKP
FT                   VTLAVG"
FT   gene            complement(542435..542779)
FT                   /locus_tag="BC1002_0493"
FT   CDS_pept        complement(542435..542779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0493"
FT                   /product="protein of unknown function DUF891"
FT                   /note="PFAM: protein of unknown function DUF891; KEGG:
FT                   bxe:Bxe_A3974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14594"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC39"
FT                   /inference="protein motif:PFAM:PF05973"
FT                   /protein_id="ADG14594.1"
FT                   /translation="MEQGKEIRWLGSSYRDLLAFPNEARRLAGFQLHKIQSGLDPDDWK
FT                   PFESIGAGTREIRIRDEDGIFRVMYVTKYAEALYVLHCFQKKTQKLGPRDRKIAETRYR
FT                   AITHYRTTQP"
FT   gene            complement(542981..544054)
FT                   /locus_tag="BC1002_0494"
FT   CDS_pept        complement(542981..544054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0494"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; KEGG: bpy:Bphyt_0725
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; PFAM: DAHP
FT                   synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14595"
FT                   /db_xref="GOA:D5WC40"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC40"
FT                   /inference="protein motif:TFAM:TIGR00034"
FT                   /protein_id="ADG14595.1"
FT                   /translation="MPPHNTDDVRIRELKELTPPAHLIREFPCDETVSNVIYESRTAMH
FT                   RILHGMDDRLIVVIGPCSIHDPKAAIEYAGRLIEQRKRFAGELEVVMRVYFEKPRTTVG
FT                   WKGLINDPHMDNSFKINEGLRTARELLLRINELGLPAGTEYLDMISPQYIADLISWGAI
FT                   GARTTESQVHRELASGLSCPVGFKNGTDGNVKIAVDAIKAASQPHHFLSVTKGGHSAIV
FT                   STAGNEDCHVILRGGKTPNYDADSVNAACADIGKAGLAARLMIDASHANSSKKHENQIP
FT                   VCADIGRQIAAGDERIVGVMVESHLVAGRQDLQEGCQLTYGQSITDACIGWDESVAVLE
FT                   GLAEAVKQRRVARGSGN"
FT   gene            complement(544395..545861)
FT                   /locus_tag="BC1002_0495"
FT   CDS_pept        complement(544395..545861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0495"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   bpy:Bphyt_0726 peptidase U62 modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14596"
FT                   /db_xref="GOA:D5WC41"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC41"
FT                   /inference="protein motif:PFAM:PF01523"
FT                   /protein_id="ADG14596.1"
FT                   /translation="MNIIEPGIRNLAAAKDILLTPYGLDESLLTRTLAEIFTHRVDYAD
FT                   LYFQTTRSEAWSLEEGIVKSGSFSIDQGVGVRAVSGDRTAFAYSDDLSPEAIRQAAIAT
FT                   RAIAKAGGGKQKIKVASSLTGIAGRDLYLPSDPLHSLDATAKVKLLERIEQMARGRDPR
FT                   IQQVMAGLAGEYDVVLVARSDGGFAADIRPLVRVSVTVIAEQNGRREIGSGGGGGRFDY
FT                   GYFTDEVLSRYVDDAVHAALVNLEARPAPAGAMTVVLGPGWPGVLLHEAIGHGLEGDFN
FT                   RKGSSAFAGRIGEQVAAKGVTVVDDGTLPNRRGSLNIDDEGNPTQCTTLIEDGILKGYI
FT                   QDTLNARLMKMPVTGNARRESYAALPMPRMTNTYMLNGDKDPQEILASVKNGLYAVNFG
FT                   GGQVDITNGKFVFSASEAYMIENGKITYPVKGATLIGSGPESLKYITMIGNDMKLDSGV
FT                   GVCGKEGQSVPVGVGQPTLRIEKMTVGGTA"
FT   gene            complement(545949..546812)
FT                   /locus_tag="BC1002_0496"
FT   CDS_pept        complement(545949..546812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0496"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: bpy:Bphyt_0727 nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14597"
FT                   /db_xref="GOA:D5WC42"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC42"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ADG14597.1"
FT                   /translation="MSETHVTSSASAATSSGPVASAFRVAALQMVSTPDRDRNLADAER
FT                   LIAEAAADGAQLVLLPEYFCFMGFKDTDKLAVREPHQDGPIQRFLADAARRHQLWVIGG
FT                   TLPLNAPEASRVLNTTLVFDPLGNEAARYDKIHLFNFEKGEESFDEARTIRPGTSVQSF
FT                   EAPFGRVGLSVCYDLRFPELYRRLGDCALIVVPSAFTYTTGRAHWELLLRTRAIENQCY
FT                   VLAAAQGGKHENGRRTWGHSMLIDPWGEIVAVRDEGAGVVAGNLERARIDEVRQSLPAW
FT                   RHRVLT"
FT   sig_peptide     complement(546732..546812)
FT                   /locus_tag="BC1002_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.636) with cleavage site probability 0.201 at
FT                   residue 27"
FT   gene            complement(546961..551223)
FT                   /locus_tag="BC1002_0497"
FT   CDS_pept        complement(546961..551223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14598"
FT                   /db_xref="GOA:D5WC43"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC43"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A3970"
FT                   /protein_id="ADG14598.1"
FT                   /translation="MSERNESADPQAPSQVRHGSGSDHIVLRRTLRVLATLALVLYFIA
FT                   GGVFLGLRYVVLPRIDTFRPRIEAAVSDKLRTQFTIGRLAPHWSGFQPGLDVTNLVIRD
FT                   HDGQPALTIPHATATVSWRSLWEFHPALSSLIVDQPDVLVSRSDDGVLSVAGVPVPTRH
FT                   SGNDALSTWLLRQQAIVVRGGVLRWRDATRHEPELALRDIRIAILNDGHDHRMALQAPP
FT                   DGQVLKGPLDFRTHFRHAPLSAIGKPINWTGQVYMSTGPVDLPTLARYVEFPIETFAGR
FT                   IDNAIWIDFSEGRMNQATGQLSGNDVAMRVRPTQPKLLVPIAHFLWRVESDAGEYRLQL
FT                   SDLRAELGQPPLEDGTPLTRILRFRTLDSRYRTASQQHGQLLSISGDRVDLGILAEFSR
FT                   ALPLPRQFLNELVRINPRGLVANYVIEVERGKPESGEVGSDHRPTGAEPIERYRFKGDL
FT                   QGISFAAQEPGPGLTPRGHPRAGVPGIENLWGTVDANEKGGHANLDTSNVALTLPGVFD
FT                   DPRLTLARLRGRAEWTMGAKAPGDTRPAFAVKLNDFSVSNPDVDASATASYSNPGHGRG
FT                   SLDLKADFQRAQVTRIARYLPTAVSEKLRIYLGHGLQAGASRGGTIEVHGDLTKFPYAR
FT                   DPDAGIFHIVAPFTGGKFDPTPFPPRNMRNGTPNVWPPLDGIDGVFELKQNVLRFDIDR
FT                   GRYKRVALTGVNGRIDDLGTKGSNLTIQGNGRGPLADMLDYVNRSSLGIMARHQTEKIR
FT                   ADGPASLALKLTIPRTPKPHVGVEGALGFLNNRLSVSNAPPLSRLNGRVRFTERTAEVE
FT                   RLSGQFLGGDVHANGGLRQDGTYALALNGHIAVDAARELHPPGAAAQVLTHMSGSAPYA
FT                   LRVAGAKGRLPQVSANSDLSGLALDFPAPFKKQAGTPMPLHFSVNPSTVQGEAGLERAD
FT                   LTLGPVAAAYLLRYRPNAQPRTPPTVVRGAIGVNRPVELPSEGVVAAVDIKEFNADAWR
FT                   ALAAQLRAGAAGANGVNDGANGGNSASSATNANRAVTPAAAPNPMLTQFLPNRFALHID
FT                   TLTLLKRHWDNVIVGASHMDRTWQANIASNQVSGHVSWLPGATRESPGELQARFARVVI
FT                   PSVEDKDLLGPAMSAPALNMPSIDLVVNELIVHDRNVGRLEVDAHNYDENGVPVWQLDK
FT                   LDVTNPTATLTATANWRTSTELPISADEATPRRTVFDFKLDIKDAGAMLERFGLPRTLK
FT                   GGIGSIQGKAVWQGGPTTIDYSTLNGNLALDLRHGQILKVDPGVATLLGVLSLQSLARI
FT                   ATLNFRDVIGEGLPFSSVTGTAQIHDGIARTENFRMVTAPARAEMVGSVDIAQRTQDLH
FT                   LHVIPTVSAGSAVIAATIINPLIGLGALIADVAFSQGIQHVFARDYAITGSWSKPQVQR
FT                   LTGERGKIDAPASTVEAH"
FT   gene            551489..554284
FT                   /locus_tag="BC1002_0498"
FT   CDS_pept        551489..554284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0498"
FT                   /product="(Glutamate--ammonia-ligase) adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="KEGG: bpy:Bphyt_0729 (glutamate--ammonia-ligase)
FT                   adenylyltransferase; PFAM: glutamate-ammonia ligase
FT                   adenylyltransferase; GlnD PII-uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14599"
FT                   /db_xref="GOA:D5WC44"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC44"
FT                   /inference="protein motif:PRIAM:2.7.7.42"
FT                   /protein_id="ADG14599.1"
FT                   /translation="MTDATLLSSSYSHYAARAAAARPQLVAHVGALADEPLTRERIDAR
FT                   LDALCAEAAGPAGAPVNEDALKRALRQLRTEVFCAVMERDLAGEADIAEVTGAMTDLAE
FT                   ATIQRALTVLSAELEALYGEPRDQQGERLTLGVVGMGKLGGRELNVSSDIDLIFVYEDD
FT                   GETTGGQRSPLATQEFFTRLGKRLIGALAEVTADGYVFRVDMRLRPNGDSGPLVCSLGM
FT                   LEEYFYVQGREWERYAWIKGRLVSEGASASAQRLQKQLDAIVTPFVYRRYLDFGVISAI
FT                   RALHLQIRQEAQRRASMRPDKADDIKLGRGGIREIEFSAQVFQLIRGGQDAGFRVRPTL
FT                   AVLRHAATHGLMDTSVCLKLSQAYRFLRELEHRLQYRNDAQTHAMPVDAEDRAALARAM
FT                   GCDDYPELMTKLDAHREFVEQQFDQIFADKVGGRDGCGAPEDGAAAWVWSSALADDSAD
FT                   DALRARLVELGVAEPGELLARLQAVWRSSRYAGLNERSRQRFDIVAQRALEAARTLEPA
FT                   GRRGDTVARLFDLLEAVSRRGAYLALLTEYPQALHQVLSVLGGSRWAAGYLIRHPQLLD
FT                   ELLDGEAINSPFDWPEFKRTLRLRLAAADGVEQQMDLLRHAHQAEVFRILLIDLAGKLS
FT                   VEHVSDRLSELADAVLDVTIEAVWNQLAKRHRDVPRFAVIAYGKLGGKELGYASDLDLI
FT                   FLYDDPDDAAADVYATFTRRLITWLTSATGAGTLFDIDLRLRPNGESGLLVTDLDAFRR
FT                   YQLREGDAANTAWVWEHQALTRARYCAGDPEIGAKFEAIREQVLTTPREAPPLAKEIVE
FT                   MRARVEAGHPNQTPALFDLKHDRGGMVDIEFTVQYWVLLHAARDPELIRNTGNIALLRE
FT                   VSRFGLMSEAEAETVGAAYRRYRKLQHTLRLDGMEKARVDPALVAAEREAVLALWKRVF
FT                   G"
FT   gene            complement(554397..556064)
FT                   /locus_tag="BC1002_0499"
FT   CDS_pept        complement(554397..556064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0499"
FT                   /product="DNA repair protein RecN"
FT                   /note="TIGRFAM: DNA repair protein RecN; PFAM: SMC domain
FT                   protein; KEGG: bpy:Bphyt_0730 DNA repair protein RecN;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14600"
FT                   /db_xref="GOA:D5WC45"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC45"
FT                   /inference="protein motif:TFAM:TIGR00634"
FT                   /protein_id="ADG14600.1"
FT                   /translation="MLRHLSIRDFVIVAALDLEFDSGFTVFSGETGAGKSILIDALALA
FT                   LGARAEASVVRTGESRADITAEFETHAQVDQWLDEQALGAADDGQHGGTVMLRRVVDAN
FT                   GRSRAFINGTAATLAQLREVGEMLVDIHGQHAHQLLMRPDAQRELFDTHAGLSDLAAAV
FT                   TRAWRTWRDKAQAVEHAQTRDRELQLERERLAWQLTELDKLAPQPGEWEEVNTEHRRLS
FT                   HSANLIDGVQGALGALSESDDAMITHLGSIVSKVRDLAEIDPALNDVLAALEPAEIQLQ
FT                   EAAYSLSHYAQKLELDPERLAQVEKRLDALHSAARKFRLQPETLPEEHEARRKQLAALD
FT                   AAADLDGLRAAEAQAKEVFIGEAKKLSKARAKAGKALGEAVTTGMQELSMKGGSFEVAL
FT                   VPLPEGGAHGLEQIEFRVAGHAGVPLRPLAKVASGGELARISLALAVIASAASPTPTLI
FT                   FDEVDTGIGGGVAEVVGRLLHQLGEARQVLCVTHLPQVAARGDHHFQVAKMSNGSGGTL
FT                   SSVTSLDKASRIEEVARMLGGLEITATTRKHAKEMLAA"
FT   gene            complement(556119..557033)
FT                   /locus_tag="BC1002_0500"
FT   CDS_pept        complement(556119..557033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0500"
FT                   /product="ATP-NAD/AcoX kinase"
FT                   /note="PFAM: ATP-NAD/AcoX kinase; KEGG: bxe:Bxe_A3967
FT                   NAD(+)/NADH kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14601"
FT                   /db_xref="GOA:D5WC46"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC46"
FT                   /inference="protein motif:PFAM:PF01513"
FT                   /protein_id="ADG14601.1"
FT                   /translation="MQVTSQFKTVALVGRSNTPGIGEPLTALAACLAKLGLEVVFEADT
FT                   AAEIGVTDYPALRPAEIGARADVAVVLGGDGTMLGIGRQLAPYRTPLIGINHGRLGFIT
FT                   DIPISDMLETVPQMLSGTFEREERVLLEARIVRDGTPIYHALAFNDVVVNRSGFSGMAE
FT                   LRVSVDGRFMYNQRSDGLIVATPTGSTAYALSSQGPILHPQLQGFVLVPIAPHALSNRP
FT                   IVLPDDSKVSIQIVSGREVNVNFDMQSFTSLELGDTIEVRRSRHTVPMLHPVGYSYYAT
FT                   LRKKLHWHEYPSHEEDQRPQAAP"
FT   gene            557172..558263
FT                   /locus_tag="BC1002_0501"
FT   CDS_pept        557172..558263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0501"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="KEGG: bxe:Bxe_A3966 heat-inducible transcription
FT                   repressor; TIGRFAM: heat-inducible transcription repressor
FT                   HrcA; PFAM: Negative regulator of class I heat shock
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14602"
FT                   /db_xref="GOA:D5WC47"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC47"
FT                   /inference="protein motif:TFAM:TIGR00331"
FT                   /protein_id="ADG14602.1"
FT                   /translation="MAHSLGAGAAGARGCDAIELKFFVMLDPRAQTLLKTLIERYIAEG
FT                   QPVGSRTLSRYSGLELSPATIRNVMSDLEDLGLVISPHTSAGRIPTPRGYRLFVDTMLT
FT                   VESAADEEAVMRAVKTTLQVGEPQKIVAAAASVLSNLSQFAGVVLTPRRSHVFKQIEFM
FT                   RLSDKRILLIIVTPEGDVQNRILATQRDFSPSQLVEASNYINAHFAGLSFDEVRRRLRE
FT                   EIDELRGDMTSLMHAAVTASTDESDTGETVLISGERNLLEVADLSSDMARLRKLFDVFD
FT                   QKTSLLQLLDVSSHAAGVQIFIGGESTLVPIEEMSVVTAPYEVNGKIVGTLGVIGPTRM
FT                   AYNRVIPIVDITARLLSMTLSQQ"
FT   gene            558442..559512
FT                   /locus_tag="BC1002_0502"
FT   CDS_pept        558442..559512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0502"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="TIGRFAM: ferrochelatase; KEGG: bxe:Bxe_A3965
FT                   ferrochelatase; PFAM: ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14603"
FT                   /db_xref="GOA:D5WC48"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC48"
FT                   /inference="protein motif:TFAM:TIGR00109"
FT                   /protein_id="ADG14603.1"
FT                   /translation="MRFDLERPSQNATSHRVAVLLINLGTPDAPTPRAVRRYLAQFLSD
FT                   PRVVEIPTLLWQLILRLLILPFRGRSSAKKYAAVWMPEGSPLRVHTEKQVEGLRHLLQV
FT                   NDYTVLVDYAMRYGTPGIPAMLNQLKLAGAERVLLMPMYPQYSASTTATAFDEAFSALK
FT                   RMRNQPEIRTVRQYADHPAYIAALAAQVRHHWHLHGRPDFAAGDKLVLSFHGVPKRTLD
FT                   LGDPYHEQCQQTGALLMQALELTPVECRITFQSRFGKAEWLQPYTAPTLKELGAAGVRR
FT                   ADVFCPGFTADCLETIEEIGMEVRDEFLQAGGKEFHRIACLNASQPWVAALGEIVAQHL
FT                   QGWPVQAVPVPHTTGA"
FT   gene            559521..559928
FT                   /locus_tag="BC1002_0503"
FT   CDS_pept        559521..559928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0503"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="KEGG: bpy:Bphyt_0734 RNA-binding S4 domain protein;
FT                   PFAM: RNA-binding S4 domain protein; SMART: RNA-binding S4
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14604"
FT                   /db_xref="GOA:D5WC49"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC49"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ADG14604.1"
FT                   /translation="MNYRISTEPGAKLRIDKWLWAARFFKTRSLAADAVDKGRVRIGGA
FT                   VVKPAKDVRVGDLVEIEIERYVWQVEVLGVCDVRGPASVAQTLYVETAQSKEKRQVEQE
FT                   RRKVYHEPAAALHGRPTKRDRRTIDRFSGGN"
FT   gene            560424..561011
FT                   /locus_tag="BC1002_0504"
FT   CDS_pept        560424..561011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0504"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: bpy:Bphyt_0736 GrpE
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14605"
FT                   /db_xref="GOA:D5WC50"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC50"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ADG14605.1"
FT                   /translation="MENTQENPTSQNPTPADEAARQAAEAAEAATQQQGTGATTESAQA
FT                   AAEQALADAQAKIAELQEDFLRAKAETENVRRRAQEDVAKAHKFAIENFAEHLLPVVDS
FT                   LEAAVAHSSDDLQKVREGVELTLRQLSGALEKGRVVAINPVGEKFDPHRHQAISMVPAD
FT                   QEPNTVVAVLQKGFVIADRVLRPALVTVAAPK"
FT   gene            561343..563292
FT                   /locus_tag="BC1002_0505"
FT   CDS_pept        561343..563292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0505"
FT                   /product="chaperone protein DnaK"
FT                   /note="KEGG: bxe:Bxe_A3961 molecular chaperone DnaK;
FT                   TIGRFAM: chaperone protein DnaK; PFAM: Heat shock protein
FT                   70"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14606"
FT                   /db_xref="GOA:D5WC51"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC51"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ADG14606.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMEGNSVKVIENSEGARTTPSIIAYMED
FT                   SEILVGAPAKRQSVTNPKNTLFAVKRLIGRRFEEKEVQKDIGLMPYKIIKADNGDAWIE
FT                   VRDQKLAPPQISAEVLRKMKKTAEDYLGETVTEAVITVPAYFNDSQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAFGLDKAEKGDRKIAVFDLGGGTFDISIIEIADVDGEMQFEVLST
FT                   NGDTFLGGEDFDQRIIDYIIGEFKKEQGVDLSKDVLALQRLKESAEKAKIELSSSQQTE
FT                   INLPYITADASGPKHLNLKITRAKLEALVEELIERTIEPCRVAIKDAGVKVGEIDDVIL
FT                   VGGMTRMPKVQEKVKEFFGKDPRRDVNPDEAVAVGAAIQGQVLSGDRKDVLLLDVTPLS
FT                   LGIETLGGVMTKMINKNTTIPTKHAQVYSTADDNQSAVTIKVFQGEREMAAGNKLLGEF
FT                   NLEGIPPAPRGVPQIEVSFDIDANGILHVGAKDKATGKENRITIKANSGLSEAEIEKMV
FT                   KDAEANAEEDHKLRELADARNQGDALVHSTKKALTEYGDKLEAGEKDKIEAALKELEDT
FT                   LKSGSSDKAAIEAKIEAVATASQKMGEKMYADMQAAQGAEAAAGAAGGAGASAGASQQA
FT                   DDVVDAEFKEVKKD"
FT   gene            563561..564700
FT                   /locus_tag="BC1002_0506"
FT   CDS_pept        563561..564700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0506"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: chaperone
FT                   DnaJ domain protein; DnaJ central domain protein; heat
FT                   shock protein DnaJ domain protein; KEGG: bpy:Bphyt_0738
FT                   chaperone protein DnaJ; SMART: heat shock protein DnaJ
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14607"
FT                   /db_xref="GOA:D5WC52"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC52"
FT                   /inference="protein motif:TFAM:TIGR02349"
FT                   /protein_id="ADG14607.1"
FT                   /translation="MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKHHPDRNPGNKDAEE
FT                   HFKEVKEAYEMLSDSQKRAAYDQYGHAGVDPNMGGAGAQGFGGFADAFGDIFGDIFGQA
FT                   AGAGARGGGRAGPQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEVCHGSGAKPG
FT                   TKPETCPTCSGSGAVRMSQGFFSIQQTCPKCHGSGTYIPDPCNHCHGAGKVKETKTLEV
FT                   KIPAGIDDGMRIRSAGNGEPGINGGPSGDLYVEIHIKQHSVFERDGDDLHCQMPIPFTT
FT                   AALGGDIEVPTLAGRATFTVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVK
FT                   LTEAQRDLLKQFEKALVEGGARHSPQSKSWFDRVKSFFD"
FT   gene            564719..566605
FT                   /locus_tag="BC1002_0507"
FT   CDS_pept        564719..566605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0507"
FT                   /product="para-aminobenzoate synthase, subunit I"
FT                   /note="KEGG: bpy:Bphyt_0739 para-aminobenzoate synthase,
FT                   subunit I; TIGRFAM: para-aminobenzoate synthase, subunit I;
FT                   PFAM: Chorismate binding-like; aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14608"
FT                   /db_xref="GOA:D5WC53"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC53"
FT                   /inference="protein motif:TFAM:TIGR00553"
FT                   /protein_id="ADG14608.1"
FT                   /translation="MTVDRRGAVFALLDDCGATAARPSSRLYTGFVLERVCTEAAQLEA
FT                   VCDSVAADTRNGLHAVVLADYEFGRALVGNDKLRSTETQRGNAMLRFLLFERCAKLSRD
FT                   EVDAWLMTRDNGALEPSVAGTANVRESVDRAEFDAAIDAIHAALRAGDSYQVNYTYRLG
FT                   FDVFGSPLAFYRRLRARQPVSFGALIALPDDAWVLSCSPELFVEKHGPTLRARPMKGTA
FT                   PRSQDPSIDRGNAEFLATDLKNRAENVMIVDLLRNDLSRVARIGSVNVPALFTVEPYAS
FT                   VWQMTSTVEATLLDRTSFAAILRALFPCGSITGAPKHRTMQLIDELESTPRGLYTGAIG
FT                   WLDAPDGDHDCGDFCMSVAIRTLTLTSSTAKVGGTDGLRGSMGIGAGIVLDSVAADEHE
FT                   ECRLKARFLTGAEPGFELFETMYATREDGVRHVERHLRRLSSSAATLGFEFDEARVRAE
FT                   ISARCATLPAQTPHRMRLALSKSGVTQITAAMLTPLADAIVGVLLGPEAQFAPTRAADP
FT                   LLRHKTTRRADYDRGWREAEANGAFDTLFFNERGELTEGGRSNVFVKLAGRWWTPPLAS
FT                   GVLPGVMRSVLLEGASGLQAGEKVLTQEDVLNAEALLVCNALRGAIPARVVA"
FT   gene            complement(566654..567469)
FT                   /locus_tag="BC1002_0508"
FT   CDS_pept        complement(566654..567469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0508"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; KEGG: bxe:Bxe_A3958
FT                   3-methyl-2-oxobutanoate hydroxymethyltransferase; PFAM:
FT                   Ketopantoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14609"
FT                   /db_xref="GOA:D5WC54"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC54"
FT                   /inference="protein motif:TFAM:TIGR00222"
FT                   /protein_id="ADG14609.1"
FT                   /translation="MTYLQEASRSAITVPKLQAMRDAGEKIAMLTCYDASFAALLDRAG
FT                   VDVLLIGDSLGNVLQGQATTLPVTLADIAYHTASVARARPSALIMADLPFGTYGTREDA
FT                   FRSSVELMRAGAQMVKLEGGEWLADTVRFLVERSIPVCAHVGLTPQSVHAFGGFKVQGK
FT                   TEAGASQLLRDSLAMQSAGAQALLMEAIPAQLAGEVTGQLRIPTIGIGAGLDCSGQVLV
FT                   LHDMLGIFPGKRPRFVKDFMQGQPNIQAAVEAYVRAVKDGTFPGAEHTF"
FT   gene            complement(567507..568187)
FT                   /locus_tag="BC1002_0509"
FT   CDS_pept        complement(567507..568187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0509"
FT                   /product="deoxynucleoside kinase"
FT                   /note="PFAM: deoxynucleoside kinase; KEGG: bpy:Bphyt_0742
FT                   putative deoxynucleoside kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14610"
FT                   /db_xref="GOA:D5WC55"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC55"
FT                   /inference="protein motif:PFAM:PF01712"
FT                   /protein_id="ADG14610.1"
FT                   /translation="MSSPPLTVTAPQLRPPFGYIAIEGPIGVGKTSLARRLAQRWSMHE
FT                   LFERWQDNPFLERFYRDTARYALPVQLHFALQRAQQAQEVSAAQASGTPLIADFITQRN
FT                   DIFARLTLQEDEWLLYRALAARLDVSAPEPDFVVYLQASPEVLFARIQKRAVPMELQIS
FT                   DAYLRALCDAYNDFFYHYDRTPVLTVNAEHLNPLDSDADLALLAERIETMRGRKEFFVK
FT                   ATSL"
FT   gene            complement(568184..568726)
FT                   /locus_tag="BC1002_0510"
FT   CDS_pept        complement(568184..568726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0510"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; KEGG: bxe:Bxe_A3956
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14611"
FT                   /db_xref="GOA:D5WC56"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC56"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ADG14611.1"
FT                   /translation="MTVAYLGLGANLGDARQTLKDAVVCLAQQHTITVLAKSSLYRTAP
FT                   IDAGGDDYFNCVVKLETTLPVRHLLALCHKIEHQFGRERPFRNAPRTLDLDILLYGDQS
FT                   IDEADLIVPHPRLVERAFALVPLVEIDAAIVIPQHGRAAALLDSVSDQRIEKVKGPCQC
FT                   PMLNALAGNSAEKGRCE"
FT   gene            complement(568778..570373)
FT                   /locus_tag="BC1002_0511"
FT   CDS_pept        complement(568778..570373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0511"
FT                   /product="poly(A) polymerase"
FT                   /EC_number="2.7.7.19"
FT                   /note="TIGRFAM: poly(A) polymerase; KEGG: bxe:Bxe_A3955
FT                   poly(A) polymerase; PFAM: Polynucleotide
FT                   adenylyltransferase region"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14612"
FT                   /db_xref="GOA:D5WC57"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC57"
FT                   /inference="protein motif:TFAM:TIGR01942"
FT                   /protein_id="ADG14612.1"
FT                   /translation="MIKKLIRKLFGQDTASADDTLSAASVGGNANDKPPARGTTASGTA
FT                   ARPRRKSTAAAAAQAPREPDVPVIIPHDVHGIDPTLISRNAIRVTEGLQQAGFRAFIVG
FT                   GAVRDLLLGVKPKDFDVATDATPEQVQKLFRRARIIGRRFQIVHVQFGQEIIETSTFRA
FT                   LVDPPAADAAPPKRLKRDELDRRTHAVDASGRVLRDNVWGEQHEDATRRDFTINAMYYD
FT                   PATQTVLDYHNGMADMRTRLLRMIGDPATRYREDPVRMLRVVRFAAKLDFDIDDATRAP
FT                   IEKMADLINNVPAARLFDEMLKLMLSGHALACLKRLRQEGLHHGLLPLLDVVLEQPTGE
FT                   KFISLALSNTDARVLAGKPVSPGFLFATLLWHDVQQRWQKFEAEGEYPVPALHRAMDEV
FT                   LDMQTEKLAIHKRFSADMREIWGLQLRLEKRSGRSALKLLEHQRFRAGYDFLLLRCASG
FT                   ELDESVGAWWTEFIEGDAAAREALLTQGGKDRSPRKRRRRGGARNRKSGDGVEGGSSAE
FT                   RTDNDAGREGSHED"
FT   gene            complement(570370..571056)
FT                   /locus_tag="BC1002_0512"
FT   CDS_pept        complement(570370..571056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0512"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); KEGG: bxe:Bxe_A3954 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14613"
FT                   /db_xref="GOA:D5WC58"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC58"
FT                   /inference="protein motif:TFAM:TIGR01490"
FT                   /protein_id="ADG14613.1"
FT                   /translation="MANLALFDLDHTLIPTDSDHEWGRFMVKKGMVDAENFARENDRFY
FT                   ADYKAGKLDIHAYLIAMLTPLAKYTRAQLADFHAQYMHEVITPAIQPVAIELVKQHREA
FT                   GDLCCVVTATNEFITRPIAQAFGVDTLIACEAETVGGDPHGAYTGRPTGTPSYKEGKIV
FT                   RTEMWLASLGKTWSDFEHSYFYSDSHNDIPLLEKVTDPIATNPDDTLRAHAQAKGWRIL
FT                   ELFQPS"
FT   gene            complement(571049..571801)
FT                   /locus_tag="BC1002_0513"
FT   CDS_pept        complement(571049..571801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0513"
FT                   /product="DnaA regulatory inactivator Hda"
FT                   /note="KEGG: bxe:Bxe_A3953 DnaA regulatory inactivator Hda;
FT                   TIGRFAM: DnaA regulatory inactivator Hda; PFAM: Chromosomal
FT                   replication initiator DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14614"
FT                   /db_xref="GOA:D5WC59"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR017788"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC59"
FT                   /inference="protein motif:TFAM:TIGR03420"
FT                   /protein_id="ADG14614.1"
FT                   /translation="MLRQLTLDLGTPPPSTFDNFFAGANAELVTRLRELDDALASGPVA
FT                   DRTFYIWGEAGSGRTHLLQALVHEAPPGHARFAGPQSSLAAFSFDPRVALYAIDDCDAL
FT                   SAAQQIAVFNLFNEVRAHPTSALVAAGNAAPIGMTVREDLRTRLGWGLVFHLAPLPDDA
FT                   KAAVLKRAARERGIMLADDVPAYLLTHFRRDMPSLMALLDALDRFSLEQKRAVTLPLLR
FT                   TMLASPDPATTPGSLAAFPASSKIGPHG"
FT   gene            572078..573145
FT                   /locus_tag="BC1002_0514"
FT   CDS_pept        572078..573145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0514"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; KEGG: bpy:Bphyt_0748
FT                   phosphoribosylaminoimidazole synthetase; PFAM: AIR synthase
FT                   related protein domain protein; AIR synthase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14615"
FT                   /db_xref="GOA:D5WC60"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC60"
FT                   /inference="protein motif:TFAM:TIGR00878"
FT                   /protein_id="ADG14615.1"
FT                   /translation="MNQPKSAQPSTDSAQGLSYRDAGVDIDAGDALVDAIKPFAKKTLR
FT                   DGVLGGIGGFGALFEVPKKYKEPVLVSGTDGVGTKLRLAFQLNKHDTVGQDLVAMSVND
FT                   ILVQGAEPLFFLDYFACGKLDVGTAATVVKGIAQGCELSGCALIGGETAEMPGMYPDGE
FT                   YDLAGFAVGAVEKSKIIDGSKIAPGDVVLGLASSGIHSNGFSLVRKIIERANPDLNADF
FT                   DGRSLADALMAPTRIYVKPLLALMQQLEVKGMAHITGGGLVENIPRVLREGLTAELDHR
FT                   AWPLPPLFSWLQKHGGVADAEMHRVFNCGIGMAVIVPAADAQAAIGLLSAAGEQVWKIG
FT                   TVRESAAGEAQTVVV"
FT   gene            complement(573273..574217)
FT                   /locus_tag="BC1002_0515"
FT   CDS_pept        complement(573273..574217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0515"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="TIGRFAM: tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase; KEGG: bpy:Bphyt_0749 tRNA
FT                   delta(2)-isopentenylpyrophosphate transferase; PFAM: tRNA
FT                   isopentenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14616"
FT                   /db_xref="GOA:D5WC61"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC61"
FT                   /inference="protein motif:TFAM:TIGR00174"
FT                   /protein_id="ADG14616.1"
FT                   /translation="MTSRPTLIPCLLGPTASGKTAAALALAARRPVEIISVDSALVYRE
FT                   MDIGTAKPTAEELAVAPHHLIDIIDPADSYSAAQFRADTLRLVGEIHARGRLPLLVGGT
FT                   MLYYKALTQGLNDLPGADAEVRATLDADAARDGWPALHARLAALDPVTAARLAPNDSQR
FT                   IQRALEVFMLTGQPMSALLAAPARTDDAASAWRFVPVALEPSERGVLHARIEQRFDAML
FT                   AHGFIDEVVKLRARGDLLPEMSSMRCVGYRQVWEYLDGAVDYRTMRDKGIFATRQLCKR
FT                   QLTWLRSMPERQVVDCCDPHATARVVELIETLV"
FT   sig_peptide     complement(574149..574217)
FT                   /locus_tag="BC1002_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.794) with cleavage site probability 0.687 at
FT                   residue 23"
FT   gene            complement(574263..576359)
FT                   /locus_tag="BC1002_0516"
FT   CDS_pept        complement(574263..576359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0516"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="KEGG: bxe:Bxe_A3934 DNA mismatch repair protein;
FT                   TIGRFAM: DNA mismatch repair protein MutL; PFAM: MutL
FT                   dimerisation; DNA mismatch repair protein domain protein;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14617"
FT                   /db_xref="GOA:D5WC62"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC62"
FT                   /inference="protein motif:TFAM:TIGR00585"
FT                   /protein_id="ADG14617.1"
FT                   /translation="MSEFSETPAGTAAAAAPSDGSRAAPAPRPLRAIQPLPDQLISQIA
FT                   AGEVVERPASVVKELLENALDAGAQTLRILLDEGGVKRISITDDGCGIPENELVLALTR
FT                   HATSKIRSLAELEAVATLGFRGEALASIASVAQMSITSRTADVPHAVRIDAETGVLSPA
FT                   AGTQGTTIEVRELYFNTPARRKFLKSEQTELGHCLEQIRRAALARPDVAISVLHNGKAV
FT                   EHWNASEPPARVAKILGDTFATAHLPLDESAGPLAIYGCAGLPTASRGRADQQYFFVNG
FT                   RFVRDKLLTHAVRAAYEDVLHGERYPSYVLFLDLPPEGVDVNVHPSKIEVRFRDSRSIH
FT                   QFVFHAVQRALARHAGASPETTAGGHAAHLEPSAGGPASFGSTPLGRTSGVGDGIGAGA
FT                   GVSSGAGFGAGSRGNFGGGSGFSSFGASQPGNTWMRQARMTQGTLPVAQPLAGYDALFG
FT                   RKDPLAGRVEGASLLEARDSASETTSPYDAASFASRPASPAFDATDDQPLGFALGQIHG
FT                   IYVLAQNRHGLVIVDMHAAHERILYEQFKNALADHAIAVQPLLIPQTMQADPVEIGTVE
FT                   EERDTLGALGFDLAVLSPTTLAIRAVPALLKDADLQALARAVLSDLHAFGGSRVLTERQ
FT                   HELLGTLACHHAVRANRRLTLDEMNALLRQMEATERADQCNHGRPTWYQLTLADLDRLF
FT                   MRGQ"
FT   gene            576552..577223
FT                   /locus_tag="BC1002_0517"
FT   CDS_pept        576552..577223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0517"
FT                   /product="SNARE associated Golgi protein-associated
FT                   protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   bxe:Bxe_A3933 DedA family transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14618"
FT                   /db_xref="GOA:D5WC63"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC63"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADG14618.1"
FT                   /translation="MDTLLHFANLVLHIDKFLGDFIQVYGTWVYAVLFAIVFAETGLVV
FT                   LPFLPGDSLLFIGGAFCAAGQMHLGLLILLLLVAAIGGNTVNYLIGRAIGPRVFNSHIP
FT                   VLERFLDRAALQKTHDFYEKHGGKTIVLARFIPVVRTFAPFVAGASSMTWSRFQMFNVV
FT                   GALSWVLLLVLLGYFFGNIPFIRQYLNVIVLVGIGAAIVPVVLAALWKMLRKNDANAST
FT                   R"
FT   gene            complement(577345..578163)
FT                   /locus_tag="BC1002_0518"
FT   CDS_pept        complement(577345..578163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0518"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   bpy:Bphyt_0752 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14619"
FT                   /db_xref="GOA:D5WC64"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC64"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADG14619.1"
FT                   /translation="MDIETARAFIMTRGIDIGTKVIGAIVLWVVGRWVIGLISNLLRKV
FT                   LARNGKVDPTLAHYLASILGALLNLLLVLAILQIFGVQTTSFAALLAGLGLAIGTAWGG
FT                   LLAHFAAGVFMQVLRPFKVGDFVTAGGVTGTVTELGLFGTTIVTPDNVMTIVGNNKIFS
FT                   DTISNYSVLPFRRVELTAKIANGVDPTDAIARLKAAVAKIPNVFENPAPDIEVLSFTPE
FT                   GPLLCVRPYSSNQNYWQVYFDTNRAIVQTFKEAGYPTPETPLAPRAIMRD"
FT   gene            complement(578357..578731)
FT                   /locus_tag="BC1002_0519"
FT   CDS_pept        complement(578357..578731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0753 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14620"
FT                   /db_xref="GOA:D5WC65"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC65"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0753"
FT                   /protein_id="ADG14620.1"
FT                   /translation="MTDFLFDLLSNLALLAIVSMTCRLYNRFGSGATMSGPVIFIVLAL
FT                   VACVLDGLLTFVVFADAQSRYGQFVRPTLFLRRAGAYALAIVIAFSWHRMSKRRRAVKS
FT                   NLDDAVVIRTSPYSESRLRM"
FT   gene            complement(579001..579600)
FT                   /locus_tag="BC1002_0520"
FT   CDS_pept        complement(579001..579600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcm:Bcenmc03_5834 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14621"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC66"
FT                   /inference="similar to AA sequence:KEGG:Bcenmc03_5834"
FT                   /protein_id="ADG14621.1"
FT                   /translation="MKAGKVIWVVALPCLSETSDAQEVYLQGGTLGIGVGAAWSVTSWF
FT                   GVRADFNAINLSHNFEVGGNRYEDDIRLRQGGLYGDFFPWAGTGFRVTAGLRLTDNEVS
FT                   GNSVPTNGMYVFEGKASPAFPGEYATATARYPTTMPYLGIGYGLHPRKRLGARGRSRCR
FT                   LWHSEDLVHAVAGTIAGGRTGDESADHQYWIAATTR"
FT   sig_peptide     complement(579535..579600)
FT                   /locus_tag="BC1002_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.647) with cleavage site probability 0.646 at
FT                   residue 22"
FT   gene            580003..580326
FT                   /locus_tag="BC1002_0521"
FT   CDS_pept        580003..580326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_2080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14622"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC67"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_2080"
FT                   /protein_id="ADG14622.1"
FT                   /translation="MSSIPLIWAAVPHNSDGVVFQIQLGRGLQRFHVSRRVLEDVFELE
FT                   RKASDARQLEFFYVHEQRILARASAKRATASSTTVSLRPADFGVSNDSERWARPSGIAH
FT                   GLV"
FT   gene            complement(580490..580565)
FT                   /locus_tag="BC1002_R0006"
FT                   /note="tRNA-Lys1"
FT   tRNA            complement(580490..580565)
FT                   /locus_tag="BC1002_R0006"
FT                   /product="tRNA-Lys"
FT   gene            complement(580753..581502)
FT                   /locus_tag="BC1002_0522"
FT   CDS_pept        complement(580753..581502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0522"
FT                   /product="tol-pal system protein YbgF"
FT                   /note="TIGRFAM: tol-pal system protein YbgF; KEGG:
FT                   bpy:Bphyt_0757 tol-pal system protein YbgF"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14623"
FT                   /db_xref="GOA:D5WC68"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR032519"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC68"
FT                   /inference="protein motif:TFAM:TIGR02795"
FT                   /protein_id="ADG14623.1"
FT                   /translation="MTHRFSWLRVAAAACVAGTALAAVPAHAGMFDDDQARQAILDLRS
FT                   KTDSLSSQLSAAQRTILDQSNRLDQLNQQVATLRGQNEDMANQLTTLQKQQKDYYTDLD
FT                   TRLKKFEPQQQTVDGVQGEVQPGETEAFNAASQQFRSGDFKSAAASFRSFISKYPSSPY
FT                   QPTAQYWLGNALYALRDYKGSTAVWQGIVAKYPQHPRAPEALLAIANNQLEQGQKAAAK
FT                   KTLEQIVAQYAGSDVAQSAQSKLSQIK"
FT   sig_peptide     complement(581416..581502)
FT                   /locus_tag="BC1002_0522"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.939 at
FT                   residue 29"
FT   gene            complement(581523..582029)
FT                   /locus_tag="BC1002_0523"
FT   CDS_pept        complement(581523..582029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0523"
FT                   /product="peptidoglycan-associated lipoprotein"
FT                   /note="KEGG: bxe:Bxe_A3921 OmpA/MotB family outer membrane
FT                   protein; TIGRFAM: peptidoglycan-associated lipoprotein;
FT                   PFAM: OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14624"
FT                   /db_xref="GOA:D5WC69"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC69"
FT                   /inference="protein motif:TFAM:TIGR02802"
FT                   /protein_id="ADG14624.1"
FT                   /translation="MMSKLRFAFAVVMVGALAACHSGVKLDENAGKGAGSGQPNPNDVA
FT                   TVNVDPLNDPNSPLAKRSIYFDFDSYSVKDDYQPLLQQHAQYLKGHPQRHVLIQGNTDE
FT                   RGTSEYNLALGQKRAEAVRRSLSLMGVSDSQMEAVSLGKEKPLATGHDEASWAQNRRAD
FT                   LAYQQ"
FT   sig_peptide     complement(581961..582029)
FT                   /locus_tag="BC1002_0523"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.534 at
FT                   residue 23"
FT   gene            complement(582062..583354)
FT                   /locus_tag="BC1002_0524"
FT   CDS_pept        complement(582062..583354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0524"
FT                   /product="Tol-Pal system beta propeller repeat protein
FT                   TolB"
FT                   /note="KEGG: bxe:Bxe_A3920 translocation protein TolB;
FT                   TIGRFAM: Tol-Pal system beta propeller repeat protein TolB;
FT                   PFAM: TolB domain protein; WD40 domain protein beta
FT                   Propeller"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14625"
FT                   /db_xref="GOA:D5WC70"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC70"
FT                   /inference="protein motif:TFAM:TIGR02800"
FT                   /protein_id="ADG14625.1"
FT                   /translation="MSLMTKLGLRTLVATCLIAVGGAANAQLNVLVTGVGSTQFPIATA
FT                   NFANEANSPQQVSTIVRQDLQRSGKFTNVDAGSTPVSETDSVDLGAWKAKGANAFVAGS
FT                   VNRLPNGQYEVRFKLYDTVKGESLGGLVLVSPESGLRMSAHKVADYIYAKLMGNRGVFA
FT                   TRLSYVIKSGNRYQLQISDSDGQDAHIALSSPEPIISPAWSPDGTKVAYVSFEKKKPIV
FT                   YIHDLPTGRRIVVSDQKGNNSAPAWSPDGRTLAVALSRTGNTQIFAVNADGSGLRRLTQ
FT                   GSSIDTEPTYSPDGQWIYFTSDRGGAPQIYKMPAQGESAGNAQRVTFTGSYNTSPRVSP
FT                   DGKELAYISRVGGGFKLYIQDLQGGTATGLTDTSHDESPSFAANGQYILYATQVNGRGV
FT                   LAAVSTDGRTRQVLSVQGGSVREPSWGPFMQ"
FT   sig_peptide     complement(583274..583354)
FT                   /locus_tag="BC1002_0524"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.982 at
FT                   residue 27"
FT   gene            complement(583492..584535)
FT                   /locus_tag="BC1002_0525"
FT   CDS_pept        complement(583492..584535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0525"
FT                   /product="protein TolA"
FT                   /note="KEGG: bxe:Bxe_A3919 TonB protein; TIGRFAM: protein
FT                   TolA; PFAM: Tol-Pal system TolA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14626"
FT                   /db_xref="GOA:D5WC71"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR014161"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC71"
FT                   /inference="protein motif:TFAM:TIGR02794"
FT                   /protein_id="ADG14626.1"
FT                   /translation="MIRKNTEYPLQPPRERGTGRAFLFALVMHALLGFFLYHGIQWQNS
FT                   TPEGEQAELWTEVPDSAIPHPVVTPPPAPVAPAPPVRDEQADIALQEKKRQQQEAARAA
FT                   QLAEQQRQQKLKEQQEAEAKRQQQLAAEQAAQLAAQKAAKLKQQQAQQQQQQQQQAEKL
FT                   KQQQLAEQQKQQQLKEQQEQQQKQAQAEAQKKADAEKAAKAKAQAEAAAQAKKQLDNER
FT                   RARLAQMQGLAGGVGGSSSSSNGLGKSGTGSGSGGTAASPGYADKVRRLVLQHVNWGGE
FT                   TEGLETVIAVRCSPDGNQLSANITRSSGNAAWDAAALRAVKASDPMPRDVNGKTPDYFT
FT                   ITLRPAA"
FT   gene            complement(584532..584978)
FT                   /locus_tag="BC1002_0526"
FT   CDS_pept        complement(584532..584978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0526"
FT                   /product="protein TolR"
FT                   /note="KEGG: bpy:Bphyt_0761 protein TolR; TIGRFAM: protein
FT                   TolR; PFAM: Biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14627"
FT                   /db_xref="GOA:D5WC72"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC72"
FT                   /inference="protein motif:TFAM:TIGR02801"
FT                   /protein_id="ADG14627.1"
FT                   /translation="MAGSRSSSMRGSRSRRAMADINVVPYIDVMLVLLVIFMVTAPLVA
FT                   PSIVNLPTVGGAAPQQQTPPVIVNIRADGNMSVKYKDDSGTQQQEDMTKAGLKGFIADR
FT                   AQSHPDQPVVIAADKTVKYEVVMNVMSELKAQGVKRVGLLVKSQ"
FT   gene            complement(584989..585666)
FT                   /locus_tag="BC1002_0527"
FT   CDS_pept        complement(584989..585666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0527"
FT                   /product="protein TolQ"
FT                   /note="KEGG: bph:Bphy_2452 protein TolQ; TIGRFAM: protein
FT                   TolQ; PFAM: MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14628"
FT                   /db_xref="GOA:D5WC73"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC73"
FT                   /inference="protein motif:TFAM:TIGR02796"
FT                   /protein_id="ADG14628.1"
FT                   /translation="MNTTQDLSIVSLVLNASLLAQAVMALLLLLSLLSWTFIFRKWFAI
FT                   RRARAQTERFERDFWSGGDLQALYQSAANNRHTIGALERIFESGMREFLKGKEKRLNDP
FT                   GAILDGARRAMRAAFQREMDVLEANLAFLASVGSVSPYIGLFGTVWGIMNAFRGLANVQ
FT                   QATLANVAPGIAEALTATAIGLFAAIPAVVAYNRYAHDIDRLAIRFETFIEEFSNILQR
FT                   QAH"
FT   sig_peptide     complement(585598..585666)
FT                   /locus_tag="BC1002_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.868) with cleavage site probability 0.490 at
FT                   residue 23"
FT   gene            complement(585854..586318)
FT                   /locus_tag="BC1002_0528"
FT   CDS_pept        complement(585854..586318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0528"
FT                   /product="tol-pal system-associated acyl-CoA thioesterase"
FT                   /note="KEGG: bpy:Bphyt_0763 tol-pal system-associated
FT                   acyl-CoA thioesterase; TIGRFAM: tol-pal system-associated
FT                   acyl-CoA thioesterase; PFAM: thioesterase superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14629"
FT                   /db_xref="GOA:D5WC74"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR014166"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC74"
FT                   /inference="protein motif:TFAM:TIGR02799"
FT                   /protein_id="ADG14629.1"
FT                   /translation="MRRMNMSTSQPGTEIGYTWSIRVYYEDTDAGGIVFYANYLKFFER
FT                   ARTEWLRACGVDQHRLAEENDAIFIVRSTAVDYRAPARLDDLVKIISRIERVGRASVDF
FT                   VQEAWREGTLLASGSVRVGCVDRATLRPAAIPPSVLAALRQGPGVGDSAD"
FT   gene            complement(586519..587265)
FT                   /locus_tag="BC1002_0529"
FT   CDS_pept        complement(586519..587265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0529"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bpy:Bphyt_0764 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14630"
FT                   /db_xref="GOA:D5WC75"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC75"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG14630.1"
FT                   /translation="MIVFVTGASAGFGAAIARSFVRGGHRVVATARRKDRLQALADELG
FT                   DALLPYELDVRDRAAVDAVPASLPADFAAIDVLVNNAGLALGTEPAHKASLDEWNTMIE
FT                   TNCTGLVQVTHALLPGMVERNRGHIFNLGSVAGRWPYAGGNVYGATKAFVRQFSLNLRA
FT                   DLAGTALRVTDIEPGLCGGTEFSNVRYRGDDDKAAKVYENVQPLTAEDIADSIYWIATR
FT                   PAHVNINTIELMPVAQSFAGLSVHRG"
FT   gene            587818..589065
FT                   /locus_tag="BC1002_0530"
FT   CDS_pept        587818..589065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0530"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="KEGG: bpy:Bphyt_0765 serine
FT                   hydroxymethyltransferase; PFAM: glycine
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14631"
FT                   /db_xref="GOA:D5WC76"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC76"
FT                   /inference="protein motif:PRIAM:2.1.2.1"
FT                   /protein_id="ADG14631.1"
FT                   /translation="MFDRAQSTIANVDPELWKVIEQENRRQEEHIELIASENYTSPAVM
FT                   AAQGSQLTNKYAEGYPGKRYYGGCEYVDVAEQLAIDRVKQLFGAEAANVQPNSGSQANQ
FT                   GVFFAMLKPGDTIMGMSLAHGGHLTHGSPVNMSGKWFNVVSYGLNEAEDIDYDAAEKLA
FT                   QEHKPKLIVAGASAFALRIDFERLSKIAKSVGAYFMVDMAHYAGLVAAGVYPNPVPHAD
FT                   FVTTTTHKSLRGPRGGVILMKAEYEKPINSAIFPGIQGGPLMHVIAAKAVAFKEALSPE
FT                   FKAYQQQVVENARVLAETLVKRGLRIVSGRTESHVMLVDLRAKKITGKAAEAALGAAHI
FT                   TVNKNAIPNDPEKPFVTSGIRLGSPAMTTRGFGVKEAEQVGNLIADVLDNPEDAATIER
FT                   VRAQVAELTQRFPVYG"
FT   gene            589072..589554
FT                   /locus_tag="BC1002_0531"
FT   CDS_pept        589072..589554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0531"
FT                   /product="ATP-cone domain protein"
FT                   /note="PFAM: ATP-cone domain protein; KEGG: bxe:Bxe_A3913
FT                   transcriptional regulator NrdR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14632"
FT                   /db_xref="GOA:D5WC77"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC77"
FT                   /inference="protein motif:PFAM:PF03477"
FT                   /protein_id="ADG14632.1"
FT                   /translation="MHCPFCRHADTQVVDSRVSEDGATIRRRRRCPACDKRFTTYERVE
FT                   LALPSVVKKDGTRTEFDRRKIVASMQLALRKRPVAVDAIEAAVARIEYQLLGSGEREVR
FT                   SERLGELVMNELRALDTIAYVRFASVYRRFEDVSEFEDVIEEFRRASSPPKPSRKR"
FT   gene            589774..590334
FT                   /locus_tag="BC1002_0532"
FT   CDS_pept        589774..590334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0532"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14633"
FT                   /db_xref="GOA:D5WC78"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC78"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0767"
FT                   /protein_id="ADG14633.1"
FT                   /translation="MEIKGTRRPSRAGFTLVETLAVIALVMLMAVMAMPSFTAWHMRDQ
FT                   IDARSKALLSTFAYARSEALRRGARITVCRVDAARVCLASGQACADGIADWACGWAVFA
FT                   ERGGKPSLLRAQPALAAVSITGVQTDMTFTPPAGQLIGAFRSFDIAPRSPSKSVQGNPW
FT                   RRCISVAAGGRARISEGACGATS"
FT   sig_peptide     589774..589890
FT                   /locus_tag="BC1002_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.846) with cleavage site probability 0.753 at
FT                   residue 39"
FT   gene            590331..590780
FT                   /locus_tag="BC1002_0533"
FT   CDS_pept        590331..590780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0768 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14634"
FT                   /db_xref="GOA:D5WC79"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC79"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0768"
FT                   /protein_id="ADG14634.1"
FT                   /translation="MRRPTFHTGLRARASACGGSSLIEVMLAVALVAVSALGLIAAQVW
FT                   AAREARAMSLRESAAWIADSIAEATRTPSAGDAAVNQWNAWASVLLPHGDASIGGSGAV
FT                   AAARVTWASVRDRPAAGDGVGPPAELCGDVDAPVGSSCVALAFAK"
FT   sig_peptide     590331..590471
FT                   /locus_tag="BC1002_0533"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.806) with cleavage site probability 0.667 at
FT                   residue 47"
FT   gene            590777..591583
FT                   /locus_tag="BC1002_0534"
FT   CDS_pept        590777..591583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14635"
FT                   /db_xref="GOA:D5WC80"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR032092"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC80"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0769"
FT                   /protein_id="ADG14635.1"
FT                   /translation="MKRPDCPRGHTLVEFLIAMALGLIVTAGAVSLYTAQRNAFVQASN
FT                   ANRIREAGLTAMMLIGQQLQMAGFVPADVVGYNAAPALFGCSGGRPTGADDSLACTTLS
FT                   TGSDGVAIRYVADLVSTWPSSSGQVTDCVGQAVKSSDAVLGDQGAPVVNRYFANVSGST
FT                   GEPELYCVGSGNAGSAQPLVEGVERVRLRYWLDGAADAVNASAVAADQWMNVVAVDVCV
FT                   LVRGAPQGRRSKYIDCDGVSTLGTDLRPRQVFSRRVALRNRAGASS"
FT   gene            591583..592182
FT                   /locus_tag="BC1002_0535"
FT   CDS_pept        591583..592182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14636"
FT                   /db_xref="GOA:D5WC81"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC81"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0770"
FT                   /protein_id="ADG14636.1"
FT                   /translation="MDRDAATQRCRAYDMCGGVGAKAKHLVRRSCPVGARRAHQRGVVL
FT                   AIVLLIAAMMLTTSAIWFETSLAAARAATNARDYLQAFHAADSALSLCERNVLSATGDA
FT                   PNPPLTSGEPAQWRLETAFDAGALTPVPQWPGSSRAPQCLIERWRLASRPNASAYLLSA
FT                   RGFGQSSESQVWLQLELVTEDGAIERHWRRVVARSF"
FT   gene            592205..592636
FT                   /locus_tag="BC1002_0536"
FT   CDS_pept        592205..592636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3909 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14637"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC82"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A3909"
FT                   /protein_id="ADG14637.1"
FT                   /translation="MKRPNTTAFTLLELVIALAIAATLAAFAIPSYRSHIARTHRIDAA
FT                   SALYRAAQFVEAAASDGVPALPAGIDQAPQFGAPVYRVRALPADDTNGGYSIEAAPVEA
FT                   GPMRDDPCGTFTLDATGQRGNRNDASGATPMSSECWNTG"
FT   sig_peptide     592205..592291
FT                   /locus_tag="BC1002_0536"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.795 at
FT                   residue 29"
FT   gene            complement(592729..593241)
FT                   /locus_tag="BC1002_0537"
FT   CDS_pept        complement(592729..593241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0537"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3908 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14638"
FT                   /db_xref="InterPro:IPR021751"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC83"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A3908"
FT                   /protein_id="ADG14638.1"
FT                   /translation="MSPSRPDTAFRNKRHPSKDLSAPHLRALRKELLLVRADVERVELA
FT                   QAAFELRQAVTHFSWLKFVIPGFGGVRVGKGSKASVLNAGTIGALLKQYPFISSVVSLL
FT                   LAKPLRATVVRSARPALKWGSLALGAWEAFRIWQQMKNESAAARAAAASATAQSAAEQA
FT                   DSTRSGY"
FT   gene            complement(593299..593688)
FT                   /locus_tag="BC1002_0538"
FT   CDS_pept        complement(593299..593688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0538"
FT                   /product="Protein of unknown function DUF2311, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2311, membrane;
FT                   KEGG: bxe:Bxe_A3907 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14639"
FT                   /db_xref="GOA:D5WC84"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC84"
FT                   /inference="protein motif:PFAM:PF10072"
FT                   /protein_id="ADG14639.1"
FT                   /translation="MTTETHSQRAGHSPLRRILSSVFAILQTRLELVGIELAEEKDRLL
FT                   GVLFLGLAAMMLATMALIALTALVAIAFWDTYRWQALAGITAVYAIAGLACALKARSGL
FT                   RNAPLVFEATIAEFEKDREAFRSRD"
FT   gene            complement(593822..594124)
FT                   /locus_tag="BC1002_0539"
FT   CDS_pept        complement(593822..594124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0539"
FT                   /product="protein of unknown function DUF883 ElaB"
FT                   /note="PFAM: protein of unknown function DUF883 ElaB; KEGG:
FT                   bph:Bphy_2440 protein of unknown function DUF883 ElaB"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14640"
FT                   /db_xref="GOA:D5WC85"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC85"
FT                   /inference="protein motif:PFAM:PF05957"
FT                   /protein_id="ADG14640.1"
FT                   /translation="MSEVNKERLMSDIKTVLADAEDLLKQAASATGERASELRETALTR
FT                   LKQAKEKAADVQVVVVEKGKKAARATDDYVHEHPWASIGIAAGIGVMVGLLINRK"
FT   gene            594467..595105
FT                   /locus_tag="BC1002_0540"
FT   CDS_pept        594467..595105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0540"
FT                   /product="Peroxidase"
FT                   /EC_number="1.11.1.7"
FT                   /note="KEGG: bxe:Bxe_A3905 1-Cys peroxiredoxin; PFAM: alkyl
FT                   hydroperoxide reductase/ Thiol specific antioxidant/ Mal
FT                   allergen; Peroxiredoxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14641"
FT                   /db_xref="GOA:D5WC86"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC86"
FT                   /inference="protein motif:PRIAM:1.11.1.7"
FT                   /protein_id="ADG14641.1"
FT                   /translation="MSLRLGDIAPDFEQESSIGRISFHDWLGNSWGVLFSHPADFTPVC
FT                   TTELGLTAKLASEFEKRNVKTIALSVDSAESHKEWIKDINETQAASVGFPILADGDRKV
FT                   SQLYDMIHPNANETFTVRSLFIIDPNKKVRLIITYPASTGRNFDEVLRVIDSLQLTDSH
FT                   SVATPGNWKQGDDVVIVPSLKDEEVIKQKFPKGYKALRPYLRMTPQPNR"
FT   gene            complement(595182..596372)
FT                   /locus_tag="BC1002_0541"
FT   CDS_pept        complement(595182..596372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0541"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   bpy:Bphyt_0776 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14642"
FT                   /db_xref="GOA:D5WC87"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC87"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADG14642.1"
FT                   /translation="MAVAAQFHWEDPLLLDQQLTEDERMVRDAAAAYSQDKLLPRVLEA
FT                   FRHEKTDLGIFREMGELGLLGPTIPEQYGGPGLNYVAYGLIAREVERVDSGYRSMMSVQ
FT                   SSLVMVPIYEFGSDAQKEKYLPKLARGEWIGCFGLTEPNHGSDPGSMVTRAKKVDGGYS
FT                   LSGSKMWITNSPIADVFVVWAKLEENGKDNIRGFILEKGWKGLSAPAIHGKVGLRASIT
FT                   GEIVLDDVFVPEENIMPGVSGLRGPFTCLNSARYGIAWGALGAAEACWHIARQYVLDRK
FT                   QFGRPLAANQLIQKKLADMQTEITLGLQGVLRLGRMKDEGTAATEITSIMKRNSCGKAL
FT                   DIARLARDMLGGNGISDEFGVARHLVNLEVVNTYEGTHDVHALILGRAQTGIQAFF"
FT   gene            596468..597253
FT                   /locus_tag="BC1002_0542"
FT   CDS_pept        596468..597253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0542"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: bpy:Bphyt_0777 transcriptional regulator, IclR
FT                   family; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14643"
FT                   /db_xref="GOA:D5WC88"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC88"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADG14643.1"
FT                   /translation="MSLPSTFSAPLDERKFVVALARGLDLLRAFQPGDTMLGNRDFVER
FT                   TGLPKATVNRLAYTLTVLGYLRLDERHGKYALDAGVLSLGFALLSGSDMLELARPHLRS
FT                   LAREVGAAVSLGCRDGLDMVYLETIRSETALTLGLASGSKLSMLTSSMGRAYLAVQPPD
FT                   ARAALLAELKKAAGRAGAMLVAEAEQEIAAFATERCCYSFRAWHDDVNAVAVPFREPRE
FT                   NRWLVLSCSGPASSMGEEVFRENVAPRLKALAARLGEPG"
FT   gene            complement(597296..598129)
FT                   /locus_tag="BC1002_0543"
FT   CDS_pept        complement(597296..598129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0543"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; KEGG: bpy:Bphyt_0778
FT                   putative diguanylate phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14644"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC89"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ADG14644.1"
FT                   /translation="MISPTIPDLIARAAHHPFLGEHLAMGQGAHAGIALAHFDGIELTS
FT                   AYEPIFDISVHGLAQSLSCGAEGVDRFGDELGFQAVTHRLGAPPFDVFDPFDNIADDQQ
FT                   LVALDRMSRALHAINFFGPQRHGLLFLRVHERLLKSVKYDHGLHFSNVLTSFNLSPARI
FT                   VIELPAAAVAHKTFLGYLTRSYQHYGFKVAGNLSNAGQILSVSETARLDFIKMDASVAL
FT                   RDATVKPLVGYAGRLKVPLIFNRVMDETQFSALQQYDVRFVQGPLFNAHYHDRAA"
FT   gene            598395..599750
FT                   /locus_tag="BC1002_0544"
FT   CDS_pept        598395..599750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0544"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_0779 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14645"
FT                   /db_xref="GOA:D5WC90"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC90"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG14645.1"
FT                   /translation="MRDQPAANVIEVERVLAETHRPTFHAMLLALCGLCLLIDGFDAQA
FT                   MGYVAPSVIAEWHVAKTALGPVFSASLFGMLLGALGLSVLADRIGRRPVLIGATFFFSL
FT                   SMLATPFVATIPALIALRFITGLGLGCIMPNAMALVGEFSTPAHRVKRMMVVSCGFTLG
FT                   AAVGGFVSAALIPAYGWRAVFWVGGAVPLLLAFAMLATLPESLQFLVLKGRSERAMSWL
FT                   AKFDPALRIDANTRLVVSEKRSNGAPVAELFRAGRTPVTLILWAISFMNLIVLYFLSNW
FT                   LPTVMRDAGYTPGTAVIVGTVLQTGGVIGTLLLGWFIERMGFVRVLFACFAVATVAVAT
FT                   IGAVAHVLPWLLVVVFAGGFCVVGGQPAVNALAGHFYPTALRSTGIGWSLGIGRIGSVI
FT                   GPLVGGQLIALNWSNAALFHAAAVPVLCSALLVAVLAGATRQPNRASEAEPA"
FT   gene            599813..601159
FT                   /locus_tag="BC1002_0545"
FT   CDS_pept        599813..601159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0545"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /EC_number="1.13.11.5"
FT                   /note="TIGRFAM: homogentisate 1,2-dioxygenase; KEGG:
FT                   bxe:Bxe_A3900 homogentisate 1,2-dioxygenase; PFAM:
FT                   homogentisate 12-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14646"
FT                   /db_xref="GOA:D5WC91"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR022950"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC91"
FT                   /inference="protein motif:TFAM:TIGR01015"
FT                   /protein_id="ADG14646.1"
FT                   /translation="MDTSTRTPADQRLRPEIEPGYQSGFANEFATEALPGALPTGRNSP
FT                   QRAAYGLYAEQISGTAFTAPRGHNRRSWLYRIRPAAMHKPFTLMPSERLVANFAEVPPT
FT                   PPNQLRWDPLPMPSEPTDFIDGWVTMAGNGSAEAMSGCAIHLYAANRSMHERFFYSADG
FT                   ELLIVPQQGRLHIATEMGRIDIEPFEIAVIPRGVRFAVSLPDGSARGYICENFGALLRL
FT                   PELGPIGSNGLANPRDFLTPHAAYEDREGAFELVAKMNGKLWRADIGHSPLDVVAWHGN
FT                   YAPYKYDLRRFNTIGSISFDHPDPSIFLVLQSQSDTPGVDTLDFVIFPPRWLAAEDTFR
FT                   PPWFHRNVASEFMGLVHGVYDAKAEGFVPGGASLHNCMTGHGPDADTFEKASHIDTSVP
FT                   KKVDDTMAFMFETRTLIKPTRFALESAQLQAHYYECWQGLEKHFNPEQR"
FT   gene            601156..602454
FT                   /locus_tag="BC1002_0546"
FT   CDS_pept        601156..602454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0546"
FT                   /product="fumarylacetoacetase"
FT                   /EC_number="3.7.1.2"
FT                   /note="TIGRFAM: fumarylacetoacetase; KEGG: bxe:Bxe_A3899
FT                   fumarylacetoacetate hydrolase; PFAM: Domain of unknown
FT                   function DUF1969; fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14647"
FT                   /db_xref="GOA:D5WC92"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC92"
FT                   /inference="protein motif:TFAM:TIGR01266"
FT                   /protein_id="ADG14647.1"
FT                   /translation="MNAVNDLQATLDASRKSWIESANEPACDFPIQNLPFGIFSDRGND
FT                   ARRVGVAIGDQIVDLAALQEANLLNAPAQNVFARDALNDFIALGRDAWRGVRIQLSQLL
FT                   ARDTATLRDDAALRAKVLVRAADARLHLPVQIPGYTDFYSSKEHATNVGAMFRDPKNAL
FT                   LPNWSEMPIGYNGRASSVVVSGTPVRRPNGQLKLPDQERPVFGACRKLDIELETGFIIG
FT                   GGNALGEPIACEDAEAHIFGMVLLNDWSARDIQQWEYVPLGPFNAKTFATTISPWVVTL
FT                   DALEPFRVAQPVQEPEPLAYLRHQGKHAFDIHLEVSLRAPHARQASTIARTNFKYMYWT
FT                   MAQQLAHHTVAGCNTRVGDLMGSGTISGPTEDSYGSLLELTWNGKKPLELQEGGTRTFI
FT                   EDGDELTLVGWCQGDGYRVGFGTCAGEILPARE"
FT   gene            complement(602562..604355)
FT                   /locus_tag="BC1002_0547"
FT   CDS_pept        complement(602562..604355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0547"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /note="KEGG: bpy:Bphyt_3192 hypothetical protein; PFAM:
FT                   Pyrrolo-quinoline quinone; SMART: Pyrrolo-quinoline quinone
FT                   beta-propeller repeat"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14648"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC93"
FT                   /inference="protein motif:PFAM:PF01011"
FT                   /protein_id="ADG14648.1"
FT                   /translation="MVSMRLLLRATLLGTAIAVAAIVAANCGGGGGGNSSAPTGTSAGG
FT                   SAASGASTPAAASGGSTTTGGTTSGGTSTGSTGTSGSGSGTSMGGTSAAAVQEVLTYHN
FT                   DIARTGQNLGETTLTPANVTAATFGKVGFFSVDGKVDAQPLFVASLAIAGGTHNVLYVA
FT                   TENDSVYAFDADTGATLWQVRTLGSGETPSDDLGCSQIVNTIGITSTPVIDRSRGTHGT
FT                   IYVVAMSKDAAGGYHHRIHALDLATGAELLNGPTEVAVTSYPGTGAGNTNGVLPFTTPL
FT                   YAERAGLLLLGSTLYTSWTSHCDHGGYTGWIMGYGADTLQQTTVLNVTPNGIGGAIWMS
FT                   GAGPASDGSSIYLLDANGTFETTMTSNGFPSNNDFGNTFLKLGTSGGLSVADYFAMTNV
FT                   VQEANDDIDLGSGGALVLPDLTDANGVVQHLTLGAGKDSTIYVLNRDSMGKFNPTINNI
FT                   YQEIPAQLAGGEFGMPAYFNGRVYFGSVGDHLKAFTVTNAKLSITPTAQSAMTFAYPGT
FT                   TPSISANGTTNGIVWAAENGNVAALHAFDPVTLNELYNSNQMGTRDQFGTGNKFITPMI
FT                   ANGKVYVGTTNGVAVFGLLGG"
FT   gene            complement(604481..605641)
FT                   /locus_tag="BC1002_0548"
FT   CDS_pept        complement(604481..605641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0548"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_0783 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14649"
FT                   /db_xref="GOA:D5WC94"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC94"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG14649.1"
FT                   /translation="MKVIFTRDFLALILSVAVVGLGSGATLPLTALALAQAGYGTDVVG
FT                   LLTAAQAGGGLAVVPLAGGIAARFGGRQVIVGAVLVVACATALMQLTANLWLWALLRVL
FT                   CGAALMLLFTIGEAWVNQLADDASRGRVIAIYATNFTLFQMSGPVLVSQIAGFTQGRFL
FT                   LCGAIFLLALPLLAAIRGTPHASSEEHAEHGGWRRVLPRMPALVIGTGFFALFDTIALS
FT                   LLPLFAMSHGISSEEAVLFASALLLGDTTMQFPIGWLADRLGRERVHIGCGIVVVALLP
FT                   LLPWAVGSPWLRWPLLYVLGAAAGAIYTLSLVACGERFRGVALVSASSLVGASWSAASF
FT                   GGPLVAGALMKTVGHDAVVGVLLCAALAFLAAVRWERRRITLRAAS"
FT   sig_peptide     complement(605534..605641)
FT                   /locus_tag="BC1002_0548"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.545 at
FT                   residue 36"
FT   gene            complement(605767..606318)
FT                   /locus_tag="BC1002_0549"
FT   CDS_pept        complement(605767..606318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0549"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_1406 serine/threonine protein
FT                   kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14650"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC95"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14650.1"
FT                   /translation="MKHPTVHTTAPITGVCATLLWDEGSFTVSCEVRYPILPSPPESQN
FT                   SLSTLLDTRFGIGTPSFVVTAGTLSMLLDQQHRLTGLDFYTNPQRWTVTTSELADPTDA
FT                   TPHIETEFDQHGHAEDMGPPVVFYEPRHHTLYLSWGPVARWYGIAPALAIGVADDNRLT
FT                   EIRLRGLTLPPRSSKSADVG"
FT   gene            complement(606315..606941)
FT                   /locus_tag="BC1002_0550"
FT   CDS_pept        complement(606315..606941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_A2495 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14651"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC96"
FT                   /inference="similar to AA sequence:KEGG:H16_A2495"
FT                   /protein_id="ADG14651.1"
FT                   /translation="MATTLSYTASEPSLTWNGRNPGGTALFDARPPTVPRNAKPIYDEN
FT                   LGCIVGYKQEAAGVFRIYTLDGAVSWSEKPLEAPLIDPVDLLFVVGGVWTAGARGITRA
FT                   GIRGIGSAIDRTTLFGLRTRYHALMQRPLRFAAKPLAHMGNPGRYVPVHILRLTLKYGK
FT                   RVADPAGHTGVFQYPITRNGTAYTLEVVVRESDYTVLHFAYKSLR"
FT   gene            complement(607334..608491)
FT                   /locus_tag="BC1002_0551"
FT   CDS_pept        complement(607334..608491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0551"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_0784 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14652"
FT                   /db_xref="GOA:D5WC97"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC97"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG14652.1"
FT                   /translation="MPLPLLALAVAAFGIGTTEFVIMGLLPDVARDLSVSIPAAGMLVS
FT                   AYALGVTIGAPIVAIAVANMPRKKALMSLIGVFIVGNLLCAIAPGYAVLMAARIVTAFC
FT                   HGAFFGIGSVVAAGLVAPNRRAQAIALMFTGLTLANVLGVPLGTALGQAVGWRATFWAV
FT                   TGIGVLAAAALAVCLPAKIEMHKASIVREFSVLKNPQVLMVLGISVLASASLFSTFTYI
FT                   TPILEDVTGFTPHTVTLVLLLFGLGLTVGSTLGGKLADWRLMPSLVAFLMAIVVILCVF
FT                   AGTMHARIPAMLTVFVWGVLAFAIVPPLQMLIVDRASHAPNLASTLNQGAFNLGNATGA
FT                   WLGGMAIGAGAPLTTLPWVGVATALGALLLTLWSVSIERRVAVAG"
FT   gene            complement(608663..609055)
FT                   /locus_tag="BC1002_0552"
FT   CDS_pept        complement(608663..609055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0552"
FT                   /product="Polyketide cyclase/dehydrase"
FT                   /note="PFAM: Polyketide cyclase/dehydrase; KEGG:
FT                   bra:BRADO6767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14653"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC98"
FT                   /inference="protein motif:PFAM:PF10604"
FT                   /protein_id="ADG14653.1"
FT                   /translation="MATIYREIAVETAAADAWAALRDPADVARAFAGVLTEARMDGELR
FT                   WVTFADGTVVEERVIAVDDAHLRLAYSVGGGRFEHHHSTLQVVADTPARCRVIWISDFK
FT                   PDERANVVEMLVDAGCAALQRNLARH"
FT   gene            complement(609091..609924)
FT                   /locus_tag="BC1002_0553"
FT   CDS_pept        complement(609091..609924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0553"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bpy:Bphyt_0785 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14654"
FT                   /db_xref="GOA:D5WC99"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D5WC99"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADG14654.1"
FT                   /translation="MIATEYFNNHVRIESDDVAGVATIVLDRPARRNAVDRQAADALSA
FT                   AFSRFEAEPAWRAAVLFGAGGTFCAGADLSALADDTRRNELHADGSGPGPMGPTRTRFS
FT                   KPVIAAIAGYAVAGGLELAAMCDLRIVEEDAVLGVFCRRVGIPLIDGGTIRLPRLIGLS
FT                   RALDLILTGRAVDAREALAFGLANRVVPKGEARAGAEQLAAELAAFPQAALLADRRSVL
FT                   ENSMLDDLAEALRREGAGGYAAVFAEGVAGAARFASGAGRHGDRLDADQPAPPSS"
FT   gene            610025..610648
FT                   /locus_tag="BC1002_0554"
FT   CDS_pept        610025..610648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14655"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCA0"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0786"
FT                   /protein_id="ADG14655.1"
FT                   /translation="MFPSHPARSVSALLMRWRPAASLPSVPLSLPLPNTSPAAAPTSAE
FT                   TVWIVPLREHSWYDHVRLKRVFVTDGTRHQVVLVDLRKLLVCANRDNTDYVLKPVAEWH
FT                   AGKIRGIREFLDPDSARIPQMPYVTISTRRAPGLLGWIGIEREGVVAFRNGQHRARYLA
FT                   EAGARWCPVEVHEREAALLRELCGAADDARTEIRATHLGGDSGV"
FT   gene            complement(610693..611688)
FT                   /locus_tag="BC1002_0555"
FT   CDS_pept        complement(610693..611688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0555"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: bpy:Bphyt_0787 D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14656"
FT                   /db_xref="GOA:D5WCA1"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCA1"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADG14656.1"
FT                   /translation="MRTILFSSRQYDVDTFTEANAAHGYELHFQESPLDTETAILAHGY
FT                   DVVCPFVNDNVDAATLERLHAGGTRMIALRSAGFNHVDLAAAERLGMPVARVPAYSPYA
FT                   VAEHAVGLILALNRRLPRAVARTREGDFSLHGLLGFDLHGKTVGVIGTGIIGRVFGRIM
FT                   AGFGMQVLAYDPGPHADELIALGARYVPLDTLLAESDVVSLHCPLLPDTYHLINRAALA
FT                   KMKRGAMLINTGRGGLVEANALIGALKDGQLGHLGLDVYEEEGGIFFEDHSNLPLQDDV
FT                   LARLLMFPNVIVTAHQAFFTREAMTEIAQTTLANIAAWQAGTPRNVVQAG"
FT   gene            612070..613293
FT                   /locus_tag="BC1002_0556"
FT   CDS_pept        612070..613293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0556"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG: bpy:Bphyt_0791
FT                   aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14657"
FT                   /db_xref="GOA:D5WCM8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCM8"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ADG14657.1"
FT                   /translation="MPTSTPTTVASSVPCPVVESLDAILPEEPLLMMGAGPVPIPAAVA
FT                   KANAIVINHLGGTMAKVVNQVKTMARYVFQTQSKWVLGVAGPGSGAMEMAVSNLAWEGT
FT                   RMLCIKNGFFSDRMGEMGRRVGARVSVLEVADRTVASVDQIADALRRERPEVVTVVQGE
FT                   TSNTVWNHHLKDIVALAKEAGALVIVDAVCTLSTMPLEMDNWGIDAVITGGQKGLSSIP
FT                   GVSLIAFSDAAWARVKGRTVPNTHWCLDASLAENFWHNAGYHYTAPVSGVLALHEALRL
FT                   VCAETLEKRFARHLKCSLALQQGVTAMGLQLYAPENCRLNSVIGIEVPDGLSPADVCAH
FT                   ISRQHQVEIAGSFGLPIVRIGQMGEQCREHNLFRTVHALGRTMVDLGVKVDLPAGVAAL
FT                   ERGLSEGK"
FT   gene            613812..615002
FT                   /locus_tag="BC1002_0557"
FT   CDS_pept        613812..615002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0557"
FT                   /product="ATP-dependent carboxylate-amine ligase domain
FT                   protein ATP-grasp"
FT                   /note="PFAM: ATP-dependent carboxylate-amine ligase domain
FT                   protein ATP-grasp; KEGG: bac:BamMC406_1119 ATP-grasp
FT                   enzyme-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14658"
FT                   /db_xref="GOA:D5WCM9"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCM9"
FT                   /inference="protein motif:PFAM:PF02222"
FT                   /protein_id="ADG14658.1"
FT                   /translation="MASAYDSGQSAGVIVGAELNGLGVARSLAQARVPVVAVDTRSRAA
FT                   TWCRHVHAHQVKSFVGKIFVDDMIELGKRFDRLPVLILTDEDAVHAVSENRVALSHWYR
FT                   FRLPVDDTVKMLSSKARFHEFAQSHGFPVPRSVVLDKLADVERLAELRYPCVLKPDDKR
FT                   NVLRGEKERAVRVDTLQQARDRAIAMLATPGGIIAQEWIEGPDSNIHFTLFYRGADGNM
FT                   VSMFTGRKVLSSPPGVGNTAICVAAPEARGTLEPLTRRFADVAGFDGMGSIEYKWDDNY
FT                   NEFVMVEPTVGRTDWQEEIATLCGVNIPLAAYRHELGLPLPVERLSRLPVAWRATFSDR
FT                   PPPELLSERTKIFDGYFRWNDPFPALQHYVVMNPLRRMKRSWKKAIRAPESRQAKA"
FT   gene            615040..616293
FT                   /locus_tag="BC1002_0558"
FT   CDS_pept        615040..616293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0558"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: bam:Bamb_6485
FT                   putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14659"
FT                   /db_xref="GOA:D5WCN0"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCN0"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADG14659.1"
FT                   /translation="MSLTDTIIIGAGPYGSSLAAHLKAAGVDHQILGEPMGAWRNYMPP
FT                   GMLLRSEAFASSMHAPRSGFTVEDYCRLKGLPYRPLGMALPLETFVEYGLWFQSNLVGE
FT                   IQPVDVLALRRVGDQFQLSLSDGRSLAARRVVIALGLKGFAQTPPALQDLPPQYASHSE
FT                   LYGNLEWARGKDIAIVGGGQSALGLSALLNELGARAHVLMRESSVVWHERPHGGRNILS
FT                   RIKGPDAGLGRGWRSLFLSEFPGVFHMLDPRRRKLIMEHTYGASGAWWLHDRVVGKVQI
FT                   SHRTVVRSAAIENERVVLNVLTDGKEARVSADHVIAATGFKTDMRQHAFLSKDLADAIS
FT                   NQGGMPDLSSHYETRVRGLYVIGPASAHSFGPVMRFVYGTKHASPTVARHLIGSLKAGS
FT                   RQRAWPLTHAPMPERSGE"
FT   gene            616286..617239
FT                   /locus_tag="BC1002_0559"
FT   CDS_pept        616286..617239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0559"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   bpy:Bphyt_0854 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14660"
FT                   /db_xref="GOA:D5WCN1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCN1"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADG14660.1"
FT                   /translation="MNKTQTTGASMRSRLSDSYRGPRMKRYKALVKEMLAGFVLISGLA
FT                   WCTRKLLWRDRVAVLLYHDPDPDTLDRHLTYLSKLCEFVPLTDVSAPGRGRPRVAITLD
FT                   DGHAGNAKLLPVFIKHKVRPTIFLCSRIVGRPRSHWWLHPGSLRVGHERLKRMTNDERL
FT                   AALAAQGYQQDGDDRPTGLSIEQMQAMREHIDFQAHTRFHPILTHCSDAESKAEISDSR
FT                   HEIAALLQQPCEHFAYPNGNYGEREVEFVRAAGFKTARTCDIGWNDQHTDPYRLRTIII
FT                   DDAASTLRFAAQLSGIALFLRYLREGGGWRGKFPQF"
FT   gene            617332..618576
FT                   /locus_tag="BC1002_0560"
FT   CDS_pept        617332..618576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0560"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bpy:Bphyt_0856 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14661"
FT                   /db_xref="GOA:D5WCN2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCN2"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADG14661.1"
FT                   /translation="MQRCRVLVINDYAHMGGAEVVYQQSAELLGTLRGVEVERFDDSQF
FT                   SGRSTMLTRSWNTTAARALEKTLHRFRPHRLMVHNYHNVLSPSILSVIARNQRQFGYRA
FT                   YHTCHDYHLVYYNPSLQYFDKDKRPIILPLDVLRTRAVLTLRPTPKGLVHDLMTKAWWH
FT                   AVRAAYQPARVFDRILCPSLFMQQALHRVGIENTVIVHNPSAVPNAMPIVTVRNKERFN
FT                   IAFVGRISPEKGLLQFLTLCEAAGFERINSIGVYGDGPDRAAIEQRYASLIAQRKLILF
FT                   GTMPQQQLFPAMREFADAVVVPSVGAENAPLVVVEAAMLGLPVLIRDGGSMAVTAESVG
FT                   NKIKFKFDPGSLKQALAELAVHLADEHRKYDVGEYLPEHYAQRLAEIMHIGESSAPIAA
FT                   SRRRARYADNPRPAP"
FT   gene            complement(619026..619409)
FT                   /locus_tag="BC1002_0561"
FT   CDS_pept        complement(619026..619409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0561"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GG16353 gene product from transcript
FT                   GG16353-RA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14662"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCN3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14662.1"
FT                   /translation="MKKLLAAVLPVLLTAQAGYAQSIVSASSSAYAPRYVAKHSQLEAM
FT                   TPHAASSTTLYGSPSDFAYAKKNRYVAPNVYTQTKNSLPKQKRTSVAQPVRGKNSADPY
FT                   GSDLWNSDQTYASPETSDPYSVR"
FT   sig_peptide     complement(619347..619409)
FT                   /locus_tag="BC1002_0561"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.839 at
FT                   residue 21"
FT   gene            619631..621850
FT                   /locus_tag="BC1002_0562"
FT   CDS_pept        619631..621850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0562"
FT                   /product="exopolysaccharide transport protein family"
FT                   /note="TIGRFAM: exopolysaccharide transport protein family;
FT                   capsular exopolysaccharide family; PFAM: lipopolysaccharide
FT                   biosynthesis protein; KEGG: bcm:Bcenmc03_6747
FT                   exopolysaccharide transport protein family; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14663"
FT                   /db_xref="GOA:D5WCN4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005700"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCN4"
FT                   /inference="protein motif:TFAM:TIGR01005"
FT                   /protein_id="ADG14663.1"
FT                   /translation="MNQSSAPFDSRNNNSEHPPAGFANYLDALYDNRKLIALTTAIAVA
FT                   LGIGYSVFSQPVYRADILVQVEENAGTSSKSVIGDVSAMFDVKTATSGEAQVIGSRMVV
FT                   GRAVDKLNLDIEAAPRYFPLFGRWLGRHSDHLSTPGPHGYVYGNERITVSKFDVPEELF
FT                   DRPFVLRMGEGSSYELQYGKLKLDGTVGQPLNATTNYGPLTLVVDRIDAKPGATFEVRR
FT                   QSALTTTEKLRKELSISEKGKESDILGVSLEGSDPKKISAILATIAGEYVSQNLKRKSE
FT                   EAERSIRFLEMQLPEMRQQLSDSETRFNDFRAKHGTVDLGEEATNLLQLSVQAQTRLAE
FT                   LQQKRNELLSRFTDQHPAVQSINAQLRAAQQEAKDLASRTQSLPPLEQNVLRLQRDVQV
FT                   GTELDTSLRNTLEQLKLIKAGKAGNVRIVDGAVAPDTPVRPKPLLIIIGALMLGVFVGS
FT                   VIALVRQRLFDAIDDPYEVELRTGLPVYASVPFSRQEERFAHSRRRPESKALVLAGEAV
FT                   IDPAIESLRGFRTALEFTMTKARNHIVLITGPTPGIGKSFVSLNLAAVIGATGKRVLLV
FT                   DGDLRRGFLHRHLGGDRGPGLSDLIQGAYRPEELIRATRFQGVDFIASGRQVASPSDVL
FT                   SNVRLESVLRQVATGYDVVLLDGPPVLLAADAVRLACVAGTTFFVARQGVTGIGELRES
FT                   VRQMQKVGLPVRGVIMNGLRMRPGRYSYGYGRYRYAAYIYKPYDR"
FT   gene            621993..623093
FT                   /locus_tag="BC1002_0563"
FT   CDS_pept        621993..623093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0563"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   gme:Gmet_2880 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14664"
FT                   /db_xref="GOA:D5WCN5"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCN5"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADG14664.1"
FT                   /translation="MKQLFVTPFLPQKNAPQAGHRLAYDYLIKLSAESELDVLIVSRVP
FT                   VDEKDIEFRANVRNVYIQYVSRFDLIPSFLANPLTFSPRLFSRYKPAIGKFLCELVDRH
FT                   RYDTVRLEFSQCFTYAQNLRERFRDGVKIVMCAHDVQIQVMLRIKSIEGWLFMRQTFML
FT                   EQRLLKLADKVLVLSSKDAQLINGLYPGVGTLQVVPISLPAFLKEVRRTKDTIEKGNIL
FT                   FWGAMQRRENEEALLNFIDTIFLPLRRRGLPLKLFVVGSDPSDRVKRLNSDDICVTGFV
FT                   ENPGKYFESADIGVVPLLSGAGVKLKTLEMLAAKLPVVSTPLGAEGVEHDGTLLNVCEI
FT                   DEFEHVIERIYRGEPVNLNASVAYQA"
FT   gene            623098..624303
FT                   /locus_tag="BC1002_0564"
FT   CDS_pept        623098..624303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0564"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpa:RPA4581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14665"
FT                   /db_xref="GOA:D5WCN6"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCN6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14665.1"
FT                   /translation="MIATIAYLLAVVLCASRGVLEYLIGKDAAYLIQVGGIVGLLVWYI
FT                   SPTAIAAYFRDEGRLSFGFLVGMLFSIGLSLVATLAVTDQLGLSYLFVFIFTLFIYFFA
FT                   ISNYQKRFVRPRVAYVGLVLIALIEAGVALAQQQNVFPIDLPGATYGFDNLRAPSLTGS
FT                   YLHYPLFVAIGASLCGLDYLVRKNVLSGLACAVLSFAIFSALSRSGMLIILGTFGLAFV
FT                   QAPIQFVTRNAKLIVATVFATMAIMIFGVAVSSQNDSVVNVGTERMMGATDLQSEGNDG
FT                   RTEAWDKAQSLALPVNVIAGTYFGLVTNSAPEPVKQEFGVVESSVLQQILNIGLLGAIF
FT                   YYGVLISVTKLVSSASRISLCIWAALFQTLFYQSIEVIPFVFILMTLPVFDYVDGPRRN
FT                   SA"
FT   gene            624461..625378
FT                   /locus_tag="BC1002_0565"
FT   CDS_pept        624461..625378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0565"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bvi:Bcep1808_5619 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14666"
FT                   /db_xref="GOA:D5WCN7"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCN7"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADG14666.1"
FT                   /translation="MNLKGMFSVVIVNYNTPKLVGNCVRSVLELSIADKEDIVVVDNAS
FT                   PDNSFSYLRETLPTGVRLVKTSINRGFGAGVNFGMVGCLRELVLVLNPDTYFVDTSLEN
FT                   AVQLFKTEKDVGLVGLDLVYPDGERQFSARRFYSVLDILGRRSPLGRLGVFKRRIDTHM
FT                   MREAWAAGTPFEADWVLGTGFIVRRSLFGELGGMDEHFFLYMEDVDFCARIWQAGYRVL
FT                   CVPGARLTHEHQRASAAGFLSKAGRRHMNSLWRFSRKYRVPLFRPPGVQGLMRGAKARA
FT                   LPVPVPAVSARPAAAEQAQSITVE"
FT   gene            625436..627172
FT                   /locus_tag="BC1002_0566"
FT   CDS_pept        625436..627172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0566"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmi:MMAR_0614 membrane protein, IniB"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14667"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCN8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14667.1"
FT                   /translation="MKTRRQALKTFLLGGLAGASASAADLGIARATGHAPRAPDAFATL
FT                   GNGADDGAGGILRVAASVPERAASEPVAPSYLKTLSDIVAGLEVSVARFVDPRRLAAIQ
FT                   RGASGYDVGAELREAFASGARGLYLPRGIWRYTGDLTTANGSRLRGDGGGEYVVITDIA
FT                   MGATVLERQDAGGPTSAALKLGDSAFVEHVQVRPAHYDKVIYYLANYPAHTGNTAIGIH
FT                   FGTSAGASRCTAIGFSRAGYELGVTSTLERCYAYMCERGFYATEHTDGSLINCIGMFCH
FT                   TAGADIVDNFWQVIGGRWEWNARHGVILGAESLIVGAVFDRNGYAGVYMKSGNWGKVVN
FT                   GNYFSRNGCGGDGKIGRWKFSTRGHPSYLDVPPGQSCHIQIDYQQGATIVGNRYRPGQD
FT                   DENAGCDGPQFVYGSSTAPGSTPLDGITIQGNFGDRAGDSIVGYAKAYPGGGAIAGGKD
FT                   ASLVHALNLGVGYERGGVAAALHCGNQTVSQETTRISINVLRSTSGRVVLRAATRGHAL
FT                   LAEILFATDASDANYKTVVSNLIGNAVKSAVLNANSEDDRYNKIDIALSEPAFVSYSVF
FT                   ST"
FT   sig_peptide     625436..625507
FT                   /locus_tag="BC1002_0566"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.879 at
FT                   residue 24"
FT   gene            627197..628486
FT                   /locus_tag="BC1002_0567"
FT   CDS_pept        627197..628486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0567"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   ddc:Dd586_1248 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14668"
FT                   /db_xref="GOA:D5WCN9"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCN9"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADG14668.1"
FT                   /translation="MSTRNVIIALYSVYALNYVLPLVTLPYLSHVLGPAGLGVIGYAQS
FT                   ISQILLVIVDFGFGLSSARKVAVHIDNPQVVNRIYWSTTIGRAILALLCSLVLVVWAFA
FT                   AHMSPQERGATLLGSLVIWGGVLTPGCFYEGTQRLPVLAGTLLATRVGLLIPLFLFVNT
FT                   RDDVMLAAALQYAPTFVCGLILMGALIWKREILLTVRVSWADVMAEAKEAYHIFLGSAL
FT                   TSVYMYANVIMLRMISGPGAVGYYVAAERLTNALRACTAPAIQAFFPKICVAYERNDFG
FT                   YIHKVNRGFMLAFAASAVLILVGFTVLGEWFVGRFLGEAFGETFRILRILVFVPAIVGM
FT                   TTTQVMLTVIASGNQSLLKRIYIYGALFHLVQAPISIYFWGGVGTACSVAATELFMLIG
FT                   VYNVASRINHGQIAVRSQTTIKQEMAAERD"
FT   gene            complement(628506..629717)
FT                   /locus_tag="BC1002_0568"
FT   CDS_pept        complement(628506..629717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0568"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_A3887 major facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14669"
FT                   /db_xref="GOA:D5WCP0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023008"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCP0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG14669.1"
FT                   /translation="MSTDSAPARSEFATTLQIIPVVFFTFLCYLAIGIPLAVLPGYVHG
FT                   DLGYSAVLAGAAISVQYLATLASRPLAGRSADTLGPKRTVSIGLLGCGASGVLLLLAAL
FT                   AGPWPVLSLALLVCSRLVLGFGESLCGTGAILWGIGRVGTSNNARVISWNGIATYGALA
FT                   IGAPLGVMISRSIGFTALGILVIALAGLGYYLARLIAPVPVVHGERMSYRSVLTRVLPH
FT                   GMGLALGSAGFGSIATFITLFYAAKHWPNAALSLTLFGTLFIGARLLFANTIKTYGGFR
FT                   VAIASFSFECAGLLMLWLAPVPHIALAGAALTGFGFALVFPALGVEAVGLVPPASRGAA
FT                   LSAYSVFLDLSLGITGPLAGYIAGEFGYGSVFLFAALAAAAAVVLSTVLYLRNAKVTNL
FT                   STAQ"
FT   gene            629762..629860
FT                   /locus_tag="BC1002_0569"
FT   CDS_pept        629762..629860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14670"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCP1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG14670.1"
FT                   /translation="MEPIPLQGLPKKWDELMAGRDSIKVRFRALAA"
FT   gene            630106..631623
FT                   /locus_tag="BC1002_0570"
FT   CDS_pept        630106..631623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0570"
FT                   /product="xanthine dehydrogenase, small subunit"
FT                   /note="KEGG: bxe:Bxe_A3886 putative xanthine dehydrogenase;
FT                   TIGRFAM: xanthine dehydrogenase, small subunit; PFAM:
FT                   molybdopterin dehydrogenase FAD-binding; [2Fe-2S]-binding
FT                   domain protein; ferredoxin; CO dehydrogenase flavoprotein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14671"
FT                   /db_xref="GOA:D5WCP2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012175"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR014307"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCP2"
FT                   /inference="protein motif:TFAM:TIGR02963"
FT                   /protein_id="ADG14671.1"
FT                   /translation="MTEPIRFYHRNAIREIQDAPVTRTVLQYLREDAHCTGTKEGCAEG
FT                   DCGACTVVIGERNAAGGVEFKAVNACIQFVPTLDGRALFTVEDLRQPDGSLHPVQQAMV
FT                   DCHGSQCGFCTPGFIMSMWALYEKHGHEHGCANRTVPSREAIGNALTGNLCRCTGYRPI
FT                   VDAAERMFDAPAPQAPLDVKALADTLATLERDDTFQYEHAGQRFAAPRTVAALAQIKER
FT                   EPAARILAGSTDIGLWVTKQMRELGNLVYVGQIAELQKLETNDEWIEIGAGVSVERAYA
FT                   EVAKQYPELTEMWQRFASLPIRNAGTLGGNIANGSPIGDSMPGLIALGARVIVRGGDIE
FT                   RELPLEDLYLAYQKKDMAEHEFVVGLKVPARGGARKNLRFRTYKLSKRFDSDISAVCAA
FT                   FSFIADGDVIREPRIAFGGMAATPKRALHAEAVLRDADWHEATAQAAMHALGNDYAPLT
FT                   DMRATSDYRLEAAKNTLYRFWLETRAREPLPKSALDVRAVAPAGARV"
FT   gene            631658..634027
FT                   /locus_tag="BC1002_0571"
FT   CDS_pept        631658..634027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0571"
FT                   /product="xanthine dehydrogenase, molybdopterin binding
FT                   subunit"
FT                   /EC_number="1.17.1.4"
FT                   /note="TIGRFAM: xanthine dehydrogenase, molybdopterin
FT                   binding subunit; KEGG: bxe:Bxe_A3885 xanthine
FT                   dehydrogenase, molybdenum binding subunit apoprotein /
FT                   xanthine oxidase; PFAM: aldehyde oxidase and xanthine
FT                   dehydrogenase molybdopterin binding; aldehyde oxidase and
FT                   xanthine dehydrogenase a/b hammerhead"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14672"
FT                   /db_xref="GOA:D5WCP3"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR014309"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCP3"
FT                   /inference="protein motif:TFAM:TIGR02965"
FT                   /protein_id="ADG14672.1"
FT                   /translation="MNQQAEPFLKELQDLDEFTQVHVSRPHESAHLHVSGRATYTDDIP
FT                   EVAGTLHAALGLSSKAHAKIVSIAFDRVRATPGVVAVFTADDIPGVNDVAPIVHGDDPI
FT                   LADGVVQYVGQPMFIVVASSHEAARLGARRAEVVYEELPAVLTAQQARAANQYVLPPMK
FT                   LACGDAGTKIARAAHREAGEMLLGGQEQFYLEGQISYAVPKDDDGMHVYCSTQHPTEMQ
FT                   HLVAHTLGVASHNVLIECRRMGGGFGGKESQSALFACCAALAAWKLLCPVKLRPDRDDD
FT                   MMVTGKRHDFHYTYEVGYDEEGVIEGVAVDMTSRCGFSADLSGPVMTRALCHFDNAYWL
FT                   SDVSIDGFCGKTNTQSNTAFRGFGGPQGAFAIEYILDNVARSRGLDALDVRRRNLYGKT
FT                   ERNQTPYGQVVEDNVIHELIDELEATSDYRARRKEIDAFNANNEILKKGLALTPVKFGI
FT                   AFNVTHFNQAGALVHIYTDGSVLVNHGGTEMGQGLNTKVAQVVAHELGVGFKRIRVTAT
FT                   DTSKVANTSATAASTGSDLNGKAAQDAARQLRERLAAFAAERYGAGSVTARDVRFAHDR
FT                   VVVGDVAVPFEEVIAKAYLARIQLWSDGFYATPKLYWDQSKLQGRPFYYYSYGAAVSEV
FT                   VIDTLTGEMRVLRADALHDVGASLNPALDVGQVEGAFIQGMGWLTTEELWWNAGGKLMT
FT                   HAPSTYKIPTVNDVPPVFNVKLFKNRNVEDSIHRSKATGEPPLLLPFSVFFAVRDAVSA
FT                   VGGHQVNPPLNAPATSEEILKAVGAVRAATAAARQA"
FT   gene            634057..634668
FT                   /locus_tag="BC1002_0572"
FT   CDS_pept        634057..634668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0572"
FT                   /product="xanthine dehydrogenase accessory protein XdhC"
FT                   /note="TIGRFAM: xanthine dehydrogenase accessory protein
FT                   XdhC; KEGG: bpy:Bphyt_0795 xanthine dehydrogenase accessory
FT                   protein XdhC"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14673"
FT                   /db_xref="InterPro:IPR014308"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCP4"
FT                   /inference="protein motif:TFAM:TIGR02964"
FT                   /protein_id="ADG14673.1"
FT                   /translation="MEARLNNYLNGTGAIDDAAPVRIGRRSVASELAPRPAPMHIVLFG
FT                   AGHVGHALVHLLGGLPCVVQWVDERDELFPDETPPNVQVEATDTPDAIVDAAPPGAWFL
FT                   VMTHNHALDFSLAARIMRRRDFSYFGMIGSKTKRVKFERRLLERGVELERLAEMTCPIG
FT                   VEGIVDKAPAAIAIAVCAQLLRLRTRQAASQIRATEQIMV"
FT   gene            complement(634735..635718)
FT                   /locus_tag="BC1002_0573"
FT   CDS_pept        complement(634735..635718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0573"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bpy:Bphyt_0796 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14674"
FT                   /db_xref="GOA:D5WCP5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCP5"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADG14674.1"
FT                   /translation="MDDTAASLDIWLVRVLRTLLVERSVTQTAMRLNQTQPAISTALRK
FT                   LRETLGDPILVRGKSGMVPTEYGESLLAAAQRVLRDVDFVATPHGDFDPGRSRRTFRVA
FT                   APDYLNDFFMPTVIARFREAAPHARLEIESLGPLLDHSAALDAGELDLVIGNWPKPDPR
FT                   FERSDLFADTVVCMMRADHPLTREPLTRDAYLAAPHLAPTPYSGTRGGAIDTGFARAKA
FT                   SRRIVATLPYFGLVAQTLLQSDLIFTTTRRFAMHYASMLPLAVVDVPIAFPRIRCYQLW
FT                   HPQPDRPSDIGWLRTLMSEVSDELVARKTARVKTPQREPRRATSGK"
FT   gene            complement(635921..636580)
FT                   /locus_tag="BC1002_0574"
FT   CDS_pept        complement(635921..636580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0574"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: bxe:Bxe_A3882
FT                   putative isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14675"
FT                   /db_xref="GOA:D5WCP6"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCP6"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ADG14675.1"
FT                   /translation="MTVGIDAQQPLWFYDFVSPFTYLLLEQHDKWPGMDFAFTPVVLND
FT                   LYRHWGQRSAYSVPAKRTFMYRHALFRAEQLGIPYKMPPAHPFDSMKPLLLATAANGDV
FT                   QFVREIFRFIWRDGRDPSSDEAFAELCERVGRPDGPELIQDEAVKAQLQRNTADAIDLG
FT                   VYGVPTFRLNDQLFWGEDALPMVLYCARTPNWLESREVKRISSLPWGLADKPASAP"
FT   gene            complement(636740..638143)
FT                   /locus_tag="BC1002_0575"
FT   CDS_pept        complement(636740..638143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0575"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14676"
FT                   /db_xref="GOA:D5WCP7"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCP7"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A3881"
FT                   /protein_id="ADG14676.1"
FT                   /translation="MKPDTGRSRPTHLVARFVAISWRDLAVSFGPLVLLVIVAIWAAVR
FT                   LIQPAPPNTLTISAGPIGSTFWIAAQKYKAILARNRITLNVLASQGSQENLKRLLDPQA
FT                   NVDVGFVQSGIAPAAVDKDKSLMSLGSVAYVPLAIFYRGAPVDWLSGFKGERLAIGPEG
FT                   SGTRELALALLKANGIVPGGPTQLLPLTGDAAADALIDGTIDATFLAGDSAQPAVMGKL
FT                   YRTGNVRFYDFSQADAYTRRFPYLTQLKVPMGAFDLGKNLPANSISIVAPTAELIARDS
FT                   LHPALSDLLIEAAREVHGGATTMQRAGEFPAPLAHDFPLSDDAARYYKSGKSFLYRTLP
FT                   FWIASLADRLLVIVVPLIVLLVPALRVVPGLYAWRVKSRIYRWYGALIAIERSALSEHS
FT                   SAERASLIERLDTIEDSVNGMKMPLAYADQFYVLREHIGFVRRRLTESRDTPGRQDEAD
FT                   EQAADKVKG"
FT   gene            638698..639036
FT                   /locus_tag="BC1002_0576"
FT   CDS_pept        638698..639036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0576"
FT                   /product="transport-associated protein"
FT                   /note="KEGG: bpy:Bphyt_0799 transport-associated; PFAM:
FT                   transport-associated; SMART: Transport-associated and
FT                   nodulation region"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14677"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCP8"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ADG14677.1"
FT                   /translation="MKTVGFLKTLGSVVAMVVACSVYAQNAPDTASAAAAVKSGKAANH
FT                   ELGRKVRHALTKTQGLDVSHIAVRARGGAVTLTGTVPDQGQAEKAGEAAKGVEGVTSVT
FT                   NKLTTKEQ"
FT   sig_peptide     638698..638772
FT                   /locus_tag="BC1002_0576"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.830 at
FT                   residue 25"
FT   gene            639385..639633
FT                   /locus_tag="BC1002_0577"
FT   CDS_pept        639385..639633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0801 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14678"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCP9"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0801"
FT                   /protein_id="ADG14678.1"
FT                   /translation="MQTTLFRYIDLPIGDRAAFELVCARHGFAPAHFDISASAAPGEPA
FT                   HERVVTVRRVDWSRSYRDGHGQWVRQFEADLTSRFFK"
FT   gene            complement(639679..640467)
FT                   /locus_tag="BC1002_0578"
FT   CDS_pept        complement(639679..640467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0578"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   bxe:Bxe_A3878 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14679"
FT                   /db_xref="GOA:D5WCQ0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCQ0"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ADG14679.1"
FT                   /translation="MALPHIDLLYSVSGLFVGFLVGLTGVGGGSLMTPILVLLFNVHPA
FT                   TAVGTDLLYAAATKATGTLVHGLKGSVDWQVTLRLAAGSVPAATITLILLHRYGMDTPG
FT                   AGRLIQVVLGAALLVTAIALVFRPQLAALGARKLRAPSQGRTLALTMLTGAILGALVSL
FT                   TSVGAGAIGVTVLLLLYPMLPTTRIVGSDIAHAVPLTLLAGAGHWLLGSIDWSMLLSLL
FT                   VGSLPGIAIGSYLASRAPEVLLRNLLAATLTLVGVRLVLS"
FT   gene            complement(640694..641341)
FT                   /locus_tag="BC1002_0579"
FT   CDS_pept        complement(640694..641341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0579"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bxe:Bxe_A3877 LysE family amino acid efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14680"
FT                   /db_xref="GOA:D5WCQ1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCQ1"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADG14680.1"
FT                   /translation="MSTTSLFFTAAGVGLAIAAPVGPMGMLCIRRTLTGGPRAGLAIGL
FT                   GIASGDAAYGLIAALGLVGISQFMLAYDRPLHLLAGLFLLYLGVRALLQKPPAESADGN
FT                   GNGNGKLAQIGRAGALRAYASALLLTLTNPQTIIMFAALFTTLAPRGAFSPAIALTTVG
FT                   GVFAGSIAWWCCLVTMVSLARHAIGSRLRHAIDRVVGLMLAAFGVVEIRRAL"
FT   sig_peptide     complement(641285..641341)
FT                   /locus_tag="BC1002_0579"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.964 at
FT                   residue 19"
FT   gene            641558..642451
FT                   /locus_tag="BC1002_0580"
FT   CDS_pept        641558..642451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0580"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bpy:Bphyt_0805 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14681"
FT                   /db_xref="GOA:D5WCQ2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCQ2"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADG14681.1"
FT                   /translation="MWQIDQVTLRLFIAVCEEGTIARAAEREFIAPSAVSKRLADLEAL
FT                   VDVALLSRSQRGVRATAAGEALLRHARLIMRGHERLQAELSEYAAGARGHVRVLANVSS
FT                   MVEFLPEALSAFLQANPAIRVDVEERVSADIVRGLEEGVADLGICRDTVPLGSLDTLPY
FT                   RADHLALIVPRAHPLAGETQVGFEQTLGFDHLGLASNASVNALMQRIALEKGSELNYRT
FT                   YVSTFDAAYRFIQAGLAVAILPREALPRHAADEYGIVAVPLREAWAERRFVICMRDRAA
FT                   LTLAAARLLEHLLGAR"
FT   gene            642730..643746
FT                   /locus_tag="BC1002_0581"
FT   CDS_pept        642730..643746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1002_0581"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   bpy:Bphyt_0806 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1002_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADG14682"
FT                   /db_xref="GOA:D5WCQ3"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5WCQ3"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ADG14682.1"
FT                   /translation="MNETRERVVVTEVGLRDGLQSIARIMSTDDKRRWIDAAYAAGVRH
FT                   MEVASFVPAKLLPQMADAADVVAHARSYDDLSITALVPNLKGAQHALEAGVKRIVAPIS
FT                   VSVAHSVANVRKTPAEMIDTFAAMRELIDRASLAGGRRVELIAGLSTVFGCTLQGAVPY
FT                   ADIAAIARAAVQAGADVIALGDTTGEATPRQVGEVIELVRDVVGDKLRSLHFHDTRGLG
FT                   LANTLVALQHGIREFDASLAGLGGCPHAPGASGNVNTEDLVFMLDSMGYDTGIDITRLL
FT                   ASRAVLAQALPGEPLYGYLARAGVPRQFAHAQPAARESAGSSESLCDSHSSVPQVPQ"
FT   gene            643743..644996
FT                   /locus_tag="BC1002_0582"
FT   CDS_