(data stored in ACNUC1104 zone)

EMBL: CP002026

ID   CP002026; SV 1; circular; genomic DNA; STD; PRO; 4765023 BP.
XX
AC   CP002026; ADBQ01000000-ADBQ01000017;
XX
PR   Project:PRJNA37659;
XX
DT   30-MAY-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Starkeya novella DSM 506, complete genome.
XX
KW   .
XX
OS   Starkeya novella DSM 506
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Xanthobacteraceae; Starkeya.
XX
RN   [1]
RP   1-4765023
RX   DOI; 10.4056/sigs.3006378.
RX   PUBMED; 23450099.
RA   Kappler U., Davenport K., Beatson S., Lucas S., Lapidus A., Copeland A.,
RA   Berry K.W., Glavina Del Rio T., Hammon N., Dalin E., Tice H., Pitluck S.,
RA   Richardson P., Bruce D., Goodwin L.A., Han C., Tapia R., Detter J.C.,
RA   Chang Y.J., Jeffries C.D., Land M., Hauser L., Kyrpides N.C., Goker M.,
RA   Ivanova N., Klenk H.P., Woyke T.;
RT   "Complete genome sequence of the facultatively chemolithoautotrophic and
RT   methylotrophic alpha Proteobacterium Starkeya novella type strain (ATCC
RT   8093(T))";
RL   Stand Genomic Sci 7(1):44-58(2012).
XX
RN   [2]
RP   1-4765023
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Davenport K., Brettin T., Detter J.C., Han C., Tapia R.,
RA   Land M., Hauser L., Kyrpides N., Ivanova N., Beatson S., Kappler U.,
RA   Woyke T.;
RT   ;
RL   Submitted (05-MAY-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; c443e0876097e45adc052f8c04d2e9e0.
DR   BioSample; SAMN02598514.
DR   CABRI; DSM 506.
DR   EnsemblGenomes-Gn; EBG00001204521.
DR   EnsemblGenomes-Gn; EBG00001204522.
DR   EnsemblGenomes-Gn; EBG00001204523.
DR   EnsemblGenomes-Gn; EBG00001204524.
DR   EnsemblGenomes-Gn; EBG00001204525.
DR   EnsemblGenomes-Gn; EBG00001204526.
DR   EnsemblGenomes-Gn; EBG00001204527.
DR   EnsemblGenomes-Gn; EBG00001204528.
DR   EnsemblGenomes-Gn; EBG00001204529.
DR   EnsemblGenomes-Gn; EBG00001204530.
DR   EnsemblGenomes-Gn; EBG00001204531.
DR   EnsemblGenomes-Gn; EBG00001204532.
DR   EnsemblGenomes-Gn; EBG00001204533.
DR   EnsemblGenomes-Gn; EBG00001204534.
DR   EnsemblGenomes-Gn; EBG00001204535.
DR   EnsemblGenomes-Gn; EBG00001204536.
DR   EnsemblGenomes-Gn; EBG00001204537.
DR   EnsemblGenomes-Gn; EBG00001204538.
DR   EnsemblGenomes-Gn; EBG00001204539.
DR   EnsemblGenomes-Gn; EBG00001204540.
DR   EnsemblGenomes-Gn; EBG00001204541.
DR   EnsemblGenomes-Gn; EBG00001204542.
DR   EnsemblGenomes-Gn; EBG00001204543.
DR   EnsemblGenomes-Gn; EBG00001204544.
DR   EnsemblGenomes-Gn; EBG00001204545.
DR   EnsemblGenomes-Gn; EBG00001204546.
DR   EnsemblGenomes-Gn; EBG00001204547.
DR   EnsemblGenomes-Gn; EBG00001204548.
DR   EnsemblGenomes-Gn; EBG00001204549.
DR   EnsemblGenomes-Gn; EBG00001204550.
DR   EnsemblGenomes-Gn; EBG00001204551.
DR   EnsemblGenomes-Gn; EBG00001204552.
DR   EnsemblGenomes-Gn; EBG00001204553.
DR   EnsemblGenomes-Gn; EBG00001204554.
DR   EnsemblGenomes-Gn; EBG00001204555.
DR   EnsemblGenomes-Gn; EBG00001204556.
DR   EnsemblGenomes-Gn; EBG00001204557.
DR   EnsemblGenomes-Gn; EBG00001204558.
DR   EnsemblGenomes-Gn; EBG00001204559.
DR   EnsemblGenomes-Gn; EBG00001204560.
DR   EnsemblGenomes-Gn; EBG00001204561.
DR   EnsemblGenomes-Gn; EBG00001204562.
DR   EnsemblGenomes-Gn; EBG00001204563.
DR   EnsemblGenomes-Gn; EBG00001204564.
DR   EnsemblGenomes-Gn; EBG00001204565.
DR   EnsemblGenomes-Gn; EBG00001204566.
DR   EnsemblGenomes-Gn; EBG00001204567.
DR   EnsemblGenomes-Gn; EBG00001204568.
DR   EnsemblGenomes-Gn; EBG00001204569.
DR   EnsemblGenomes-Gn; EBG00001204570.
DR   EnsemblGenomes-Gn; EBG00001204571.
DR   EnsemblGenomes-Gn; EBG00001204572.
DR   EnsemblGenomes-Gn; EBG00001204573.
DR   EnsemblGenomes-Gn; EBG00001204574.
DR   EnsemblGenomes-Gn; EBG00001204575.
DR   EnsemblGenomes-Gn; EBG00001204576.
DR   EnsemblGenomes-Gn; EBG00001204577.
DR   EnsemblGenomes-Gn; EBG00001204578.
DR   EnsemblGenomes-Gn; EBG00001204579.
DR   EnsemblGenomes-Gn; EBG00001204580.
DR   EnsemblGenomes-Gn; EBG00001204581.
DR   EnsemblGenomes-Gn; EBG00001204582.
DR   EnsemblGenomes-Gn; EBG00001204583.
DR   EnsemblGenomes-Gn; EBG00001204584.
DR   EnsemblGenomes-Gn; EBG00001204585.
DR   EnsemblGenomes-Gn; EBG00001204586.
DR   EnsemblGenomes-Gn; EBG00001204587.
DR   EnsemblGenomes-Gn; EBG00001204588.
DR   EnsemblGenomes-Gn; Snov_R0001.
DR   EnsemblGenomes-Gn; Snov_R0002.
DR   EnsemblGenomes-Gn; Snov_R0003.
DR   EnsemblGenomes-Gn; Snov_R0004.
DR   EnsemblGenomes-Gn; Snov_R0005.
DR   EnsemblGenomes-Gn; Snov_R0006.
DR   EnsemblGenomes-Gn; Snov_R0007.
DR   EnsemblGenomes-Gn; Snov_R0008.
DR   EnsemblGenomes-Gn; Snov_R0009.
DR   EnsemblGenomes-Gn; Snov_R0010.
DR   EnsemblGenomes-Gn; Snov_R0011.
DR   EnsemblGenomes-Gn; Snov_R0012.
DR   EnsemblGenomes-Gn; Snov_R0013.
DR   EnsemblGenomes-Gn; Snov_R0014.
DR   EnsemblGenomes-Gn; Snov_R0015.
DR   EnsemblGenomes-Gn; Snov_R0016.
DR   EnsemblGenomes-Gn; Snov_R0017.
DR   EnsemblGenomes-Gn; Snov_R0018.
DR   EnsemblGenomes-Gn; Snov_R0019.
DR   EnsemblGenomes-Gn; Snov_R0020.
DR   EnsemblGenomes-Gn; Snov_R0021.
DR   EnsemblGenomes-Gn; Snov_R0022.
DR   EnsemblGenomes-Gn; Snov_R0023.
DR   EnsemblGenomes-Gn; Snov_R0024.
DR   EnsemblGenomes-Gn; Snov_R0025.
DR   EnsemblGenomes-Gn; Snov_R0026.
DR   EnsemblGenomes-Gn; Snov_R0027.
DR   EnsemblGenomes-Gn; Snov_R0028.
DR   EnsemblGenomes-Gn; Snov_R0029.
DR   EnsemblGenomes-Gn; Snov_R0030.
DR   EnsemblGenomes-Gn; Snov_R0031.
DR   EnsemblGenomes-Gn; Snov_R0032.
DR   EnsemblGenomes-Gn; Snov_R0033.
DR   EnsemblGenomes-Gn; Snov_R0034.
DR   EnsemblGenomes-Gn; Snov_R0035.
DR   EnsemblGenomes-Gn; Snov_R0036.
DR   EnsemblGenomes-Gn; Snov_R0037.
DR   EnsemblGenomes-Gn; Snov_R0038.
DR   EnsemblGenomes-Gn; Snov_R0039.
DR   EnsemblGenomes-Gn; Snov_R0040.
DR   EnsemblGenomes-Gn; Snov_R0041.
DR   EnsemblGenomes-Gn; Snov_R0042.
DR   EnsemblGenomes-Gn; Snov_R0043.
DR   EnsemblGenomes-Gn; Snov_R0044.
DR   EnsemblGenomes-Gn; Snov_R0045.
DR   EnsemblGenomes-Gn; Snov_R0046.
DR   EnsemblGenomes-Gn; Snov_R0047.
DR   EnsemblGenomes-Gn; Snov_R0048.
DR   EnsemblGenomes-Gn; Snov_R0049.
DR   EnsemblGenomes-Gn; Snov_R0050.
DR   EnsemblGenomes-Gn; Snov_R0051.
DR   EnsemblGenomes-Gn; Snov_R0052.
DR   EnsemblGenomes-Tr; EBT00001575404.
DR   EnsemblGenomes-Tr; EBT00001575405.
DR   EnsemblGenomes-Tr; EBT00001575406.
DR   EnsemblGenomes-Tr; EBT00001575407.
DR   EnsemblGenomes-Tr; EBT00001575408.
DR   EnsemblGenomes-Tr; EBT00001575409.
DR   EnsemblGenomes-Tr; EBT00001575410.
DR   EnsemblGenomes-Tr; EBT00001575411.
DR   EnsemblGenomes-Tr; EBT00001575412.
DR   EnsemblGenomes-Tr; EBT00001575413.
DR   EnsemblGenomes-Tr; EBT00001575414.
DR   EnsemblGenomes-Tr; EBT00001575415.
DR   EnsemblGenomes-Tr; EBT00001575416.
DR   EnsemblGenomes-Tr; EBT00001575417.
DR   EnsemblGenomes-Tr; EBT00001575418.
DR   EnsemblGenomes-Tr; EBT00001575419.
DR   EnsemblGenomes-Tr; EBT00001575420.
DR   EnsemblGenomes-Tr; EBT00001575421.
DR   EnsemblGenomes-Tr; EBT00001575422.
DR   EnsemblGenomes-Tr; EBT00001575423.
DR   EnsemblGenomes-Tr; EBT00001575424.
DR   EnsemblGenomes-Tr; EBT00001575425.
DR   EnsemblGenomes-Tr; EBT00001575426.
DR   EnsemblGenomes-Tr; EBT00001575427.
DR   EnsemblGenomes-Tr; EBT00001575428.
DR   EnsemblGenomes-Tr; EBT00001575429.
DR   EnsemblGenomes-Tr; EBT00001575430.
DR   EnsemblGenomes-Tr; EBT00001575431.
DR   EnsemblGenomes-Tr; EBT00001575432.
DR   EnsemblGenomes-Tr; EBT00001575433.
DR   EnsemblGenomes-Tr; EBT00001575434.
DR   EnsemblGenomes-Tr; EBT00001575435.
DR   EnsemblGenomes-Tr; EBT00001575436.
DR   EnsemblGenomes-Tr; EBT00001575437.
DR   EnsemblGenomes-Tr; EBT00001575438.
DR   EnsemblGenomes-Tr; EBT00001575439.
DR   EnsemblGenomes-Tr; EBT00001575440.
DR   EnsemblGenomes-Tr; EBT00001575441.
DR   EnsemblGenomes-Tr; EBT00001575442.
DR   EnsemblGenomes-Tr; EBT00001575443.
DR   EnsemblGenomes-Tr; EBT00001575444.
DR   EnsemblGenomes-Tr; EBT00001575445.
DR   EnsemblGenomes-Tr; EBT00001575446.
DR   EnsemblGenomes-Tr; EBT00001575447.
DR   EnsemblGenomes-Tr; EBT00001575448.
DR   EnsemblGenomes-Tr; EBT00001575449.
DR   EnsemblGenomes-Tr; EBT00001575450.
DR   EnsemblGenomes-Tr; EBT00001575451.
DR   EnsemblGenomes-Tr; EBT00001575452.
DR   EnsemblGenomes-Tr; EBT00001575453.
DR   EnsemblGenomes-Tr; EBT00001575454.
DR   EnsemblGenomes-Tr; EBT00001575455.
DR   EnsemblGenomes-Tr; EBT00001575456.
DR   EnsemblGenomes-Tr; EBT00001575457.
DR   EnsemblGenomes-Tr; EBT00001575458.
DR   EnsemblGenomes-Tr; EBT00001575459.
DR   EnsemblGenomes-Tr; EBT00001575460.
DR   EnsemblGenomes-Tr; EBT00001575461.
DR   EnsemblGenomes-Tr; EBT00001575462.
DR   EnsemblGenomes-Tr; EBT00001575463.
DR   EnsemblGenomes-Tr; EBT00001575464.
DR   EnsemblGenomes-Tr; EBT00001575465.
DR   EnsemblGenomes-Tr; EBT00001575466.
DR   EnsemblGenomes-Tr; EBT00001575467.
DR   EnsemblGenomes-Tr; EBT00001575468.
DR   EnsemblGenomes-Tr; EBT00001575469.
DR   EnsemblGenomes-Tr; EBT00001575470.
DR   EnsemblGenomes-Tr; EBT00001575471.
DR   EnsemblGenomes-Tr; Snov_R0001-1.
DR   EnsemblGenomes-Tr; Snov_R0002-1.
DR   EnsemblGenomes-Tr; Snov_R0003-1.
DR   EnsemblGenomes-Tr; Snov_R0004-1.
DR   EnsemblGenomes-Tr; Snov_R0005-1.
DR   EnsemblGenomes-Tr; Snov_R0006-1.
DR   EnsemblGenomes-Tr; Snov_R0007-1.
DR   EnsemblGenomes-Tr; Snov_R0008-1.
DR   EnsemblGenomes-Tr; Snov_R0009-1.
DR   EnsemblGenomes-Tr; Snov_R0010-1.
DR   EnsemblGenomes-Tr; Snov_R0011-1.
DR   EnsemblGenomes-Tr; Snov_R0012-1.
DR   EnsemblGenomes-Tr; Snov_R0013-1.
DR   EnsemblGenomes-Tr; Snov_R0014-1.
DR   EnsemblGenomes-Tr; Snov_R0015-1.
DR   EnsemblGenomes-Tr; Snov_R0016-1.
DR   EnsemblGenomes-Tr; Snov_R0017-1.
DR   EnsemblGenomes-Tr; Snov_R0018-1.
DR   EnsemblGenomes-Tr; Snov_R0019-1.
DR   EnsemblGenomes-Tr; Snov_R0020-1.
DR   EnsemblGenomes-Tr; Snov_R0021-1.
DR   EnsemblGenomes-Tr; Snov_R0022-1.
DR   EnsemblGenomes-Tr; Snov_R0023-1.
DR   EnsemblGenomes-Tr; Snov_R0024-1.
DR   EnsemblGenomes-Tr; Snov_R0025-1.
DR   EnsemblGenomes-Tr; Snov_R0026-1.
DR   EnsemblGenomes-Tr; Snov_R0027-1.
DR   EnsemblGenomes-Tr; Snov_R0028-1.
DR   EnsemblGenomes-Tr; Snov_R0029-1.
DR   EnsemblGenomes-Tr; Snov_R0030-1.
DR   EnsemblGenomes-Tr; Snov_R0031-1.
DR   EnsemblGenomes-Tr; Snov_R0032-1.
DR   EnsemblGenomes-Tr; Snov_R0033-1.
DR   EnsemblGenomes-Tr; Snov_R0034-1.
DR   EnsemblGenomes-Tr; Snov_R0035-1.
DR   EnsemblGenomes-Tr; Snov_R0036-1.
DR   EnsemblGenomes-Tr; Snov_R0037-1.
DR   EnsemblGenomes-Tr; Snov_R0038-1.
DR   EnsemblGenomes-Tr; Snov_R0039-1.
DR   EnsemblGenomes-Tr; Snov_R0040-1.
DR   EnsemblGenomes-Tr; Snov_R0041-1.
DR   EnsemblGenomes-Tr; Snov_R0042-1.
DR   EnsemblGenomes-Tr; Snov_R0043-1.
DR   EnsemblGenomes-Tr; Snov_R0044-1.
DR   EnsemblGenomes-Tr; Snov_R0045-1.
DR   EnsemblGenomes-Tr; Snov_R0046-1.
DR   EnsemblGenomes-Tr; Snov_R0047-1.
DR   EnsemblGenomes-Tr; Snov_R0048-1.
DR   EnsemblGenomes-Tr; Snov_R0049-1.
DR   EnsemblGenomes-Tr; Snov_R0050-1.
DR   EnsemblGenomes-Tr; Snov_R0051-1.
DR   EnsemblGenomes-Tr; Snov_R0052-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00518; speF.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01867; CC2171.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; CP002026.
DR   SILVA-SSU; CP002026.
DR   StrainInfo; 122187; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4084204
CC   Source DNA available from Ulrike Kappler (u.kappler@uq.edu.au)
CC   Organism available from DSMZ: DSM 506
CC   Contacts: Ulrike Kappler (u.kappler@uq.edu.au)
CC      Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Starkeya novella DSM 506
CC   Culture Collection ID :: DSM 506, ATCC 8093, CCM 1077, IFO 12443,
CC                            NBRC 12443, NCIB 9113
CC   GOLD Stamp ID         :: Gi02557
CC   Greengenes ID         :: 4661
CC   Funding Program       :: DOE-CSP 2008
CC   Sequencing Depth      :: 21x
CC   Isolation Site        :: Soil
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 26 - 30C
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Soil
CC   Energy Source         :: Chemolithotroph, Heterotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4765023
FT                   /organism="Starkeya novella DSM 506"
FT                   /strain="DSM 506"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="soil"
FT                   /db_xref="taxon:639283"
FT   gene            169..450
FT                   /locus_tag="Snov_0001"
FT   CDS_pept        169..450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0001"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bvi:Bcep1808_0172 helix-turn-helix domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87338"
FT                   /db_xref="GOA:D6ZZS4"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZS4"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADH87338.1"
FT                   /translation="MCWATLGAGVRVTRETRGHGVREAAAAAGVSAATVSRCENGRELS
FT                   FDSLARLSAYVGLHPHAYTVKPFPDPGSTGNTHCNSLKTQEAPHDRHG"
FT   gene            434..1672
FT                   /locus_tag="Snov_0002"
FT   CDS_pept        434..1672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0002"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   azc:AZC_1014 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87339"
FT                   /db_xref="GOA:D6ZZS5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZS5"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADH87339.1"
FT                   /translation="MIDMGDALPPGVHTAADLMRHYEEVRRRMKAQTARRRGPPVPPPV
FT                   TAAVVPAVPVAPSVVEPPSFSPRDAALTFARYCVGECNRLAHAAACDVAASAPGLMPRF
FT                   NPLFVHGGTGLGKTHLLQALAQAAEESGRRVAYLTAERFMFGFVAAMKTGTTEDFRARF
FT                   GEIDLLLLDDVQGLHGKSVQQAFSSALNALMDAHRQVVIAADRHPGDLDAFDERLRSRL
FT                   GAGLVIELRSLDDEVRAAIIAAQAERAAVLSPGFALPVDVARFLASDGRMNARDLAGAV
FT                   NRLLAPHQFGGVEITMDMAQAVLRDVIRTGEPRRVRVDDILRVVTKQFGVTLADILSQR
FT                   RTANVVRPRQIAMYLAKTLTLRSLPEIGRRFGGRDHTTVLHAVRKMDGLRSHDAKLRAE
FT                   LDDLEAKIMERVA"
FT   gene            1669..2010
FT                   /locus_tag="Snov_0003"
FT   CDS_pept        1669..2010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0003"
FT                   /product="bacteriophage protein"
FT                   /note="KEGG: avi:Avi_6150 bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87340"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZS6"
FT                   /inference="similar to AA sequence:KEGG:Avi_6150"
FT                   /protein_id="ADH87340.1"
FT                   /translation="MSAYPFSNLPARLAALVLVCPERGCWIWQGATSGRGRGGGYGRVK
FT                   WDGVTQAVHKVVWRIAGRRPLRRGEQLDHECRVRACCNPAHLKPMYQPKNMRLAYARRR
FT                   AAFRAEAVQ"
FT   gene            2010..3509
FT                   /locus_tag="Snov_0004"
FT   CDS_pept        2010..3509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0004"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   bbt:BBta_6611 site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87341"
FT                   /db_xref="GOA:D6ZZS7"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZS7"
FT                   /inference="protein motif:PFAM:PF01555"
FT                   /protein_id="ADH87341.1"
FT                   /translation="MTPETFLDGRVTLYCGDSRDALDLIEPNSVDNCVCDPPYALVSIG
FT                   KRFGKEGAAPAKGGVYQRASGGFMGQSWDTGEVAFDAKFWRKVFRALKPGGHVIAFGGT
FT                   RAYHRLAVAIEDAGFEIRDSIGDLISLDPMVRAFVDSLDEAQLDAFLRIADLIGFEGLL
FT                   AWVYGTGFPKSHDVSKAIDKMAGAERPVVGFDPVAAKRTSKFGTNSYGDFKGQNGDVTA
FT                   PATAAAAAWQGWGTALKPAWEPIVLARKPLIGTVAENVLEHGTGALNVDGCRVGDEVRT
FT                   AAFTSLAPCHGNALGAAGTAEACRGTQGEPKEYVGRHPANIIHDGTDEVVSAFPETESG
FT                   AGAVKRATAAGHQGNALGRESRPAGTPMISHGDSGSASRFFYSAKADADDRLGSKHPTV
FT                   KPVDLMQWLVRLVTAKGGTVLDPFAGTGTTGEAAWREGCNAVLIERNPPYQADIRRRMA
FT                   LCTAGSATRKRAARLARAEAEGKAPEFGPLFGGLTGPEAAE"
FT   gene            3506..3820
FT                   /locus_tag="Snov_0005"
FT   CDS_pept        3506..3820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_2399 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87342"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZS8"
FT                   /inference="similar to AA sequence:KEGG:Nham_2399"
FT                   /protein_id="ADH87342.1"
FT                   /translation="MTREVLPARRFAENVSFFLGKILYSVTLGFYDDGRVGEVFIGGPK
FT                   TGSDAETNARDAAAILSIAMQYGVPPSAFSTAVQRDSSGVPLGPIGAVVDLLAPQDGGA
FT                   "
FT   gene            3820..4539
FT                   /locus_tag="Snov_0006"
FT   CDS_pept        3820..4539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0006"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87343"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZS9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87343.1"
FT                   /translation="MNTHSLERREPLHDGSAVLGHPLYPGGQIEQLHSSARVRPFQVFE
FT                   PEFGREQLQLPPQRSRGLNRGSYPNDVGEWKRFECQLGVARRYLNAIVFLKFNYRRVGR
FT                   RSIIKALGCGELLCSGPDLGGIHQNNCAIADKAIDPIFSILLGEPSALGDITIYCNDRC
FT                   CRRQHREHSADSRARETEPVSCISSGQYTFSCRDNGRTKNHPEEDAGDADGKRVPEASF
FT                   HASTLIKRPLFVERALS"
FT   gene            4536..5234
FT                   /locus_tag="Snov_0007"
FT   CDS_pept        4536..5234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsh:Rsph17029_3297 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87344"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZT0"
FT                   /inference="similar to AA sequence:KEGG:Rsph17029_3297"
FT                   /protein_id="ADH87344.1"
FT                   /translation="MTGIVVDRFAGHNPAPMRILIGCETSGVVRRAFAAYGHDVWSVDL
FT                   LPAEDRSNRHIIGDIRDYLGEGWDLLAVMHPPCTRLCNSGVRWLRKAPPGRTLEEMWAD
FT                   LEEGAALFSDCWNAPIERICVENPVMHRYARERIRNWAKPQTVQPWWFGESAFKATGLY
FT                   LRGLPPLVPTRKLVPPKKGTDEHKSWSKVHRASPGPERWKDRSRTYDGVAEAMAAQWTA
FT                   AWAREREAAE"
FT   gene            5231..6295
FT                   /locus_tag="Snov_0008"
FT   CDS_pept        5231..6295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mno:Mnod_7350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87345"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZT1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87345.1"
FT                   /translation="MSNYAQGWVENLDVVLGSSTRFVLMALANYANDANLAWVSRSTIV
FT                   KYTELSPATVTRALRDLEARGLIEREERFRDNGSRTTDMIRLLVGCTPRPATPPDHSDE
FT                   GGTDHHDEAPSSPRAGPLITVMRPEPSLEPSIEDSPQAPQGAGVGISKSDGEGEGGAPD
FT                   TQFDVFWAQYGADPTASKAKALRSWARLGASERAQALALLPRFLDHCRAKSRRICDPST
FT                   YIAERRWEGLANVPAPAARAEEAPARPVEADPVKRAVLWALNDKADRGEWHFVEQGSDA
FT                   WEAWRQAFGAAGFGHRWMAGRVVREPAPGGGIVQRLGRSFPLRYPPKADGSGTGPPDGT
FT                   VTADEMAEFVNSGG"
FT   gene            6307..6900
FT                   /locus_tag="Snov_0009"
FT   CDS_pept        6307..6900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rle:RL1123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87346"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZT2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87346.1"
FT                   /translation="MGMVGRPRIETRERYACGKAKSKPEVASPAMVRRIINEARRGAAD
FT                   PALGSVIGQLRLRDIIDTRQMSAGLRYAELCADFDRMKGIPRRSAASPSYQAGLRRTGG
FT                   NDAEDEGIVAELLRNGGDVRELAKKNARLRALVRIVTAHEAAQKALLECGQPVWRLVRE
FT                   VAIYDRTIDAWHRPQLIRGLDALLAHFDLTGFRK"
FT   gene            6984..7343
FT                   /locus_tag="Snov_0010"
FT   CDS_pept        6984..7343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0010"
FT                   /product="HNH endonuclease"
FT                   /note="KEGG: rsq:Rsph17025_1748 HNH endonuclease; PFAM: HNH
FT                   endonuclease; SMART: HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87347"
FT                   /db_xref="GOA:D6ZZT3"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZT3"
FT                   /inference="protein motif:PFAM:PF01844"
FT                   /protein_id="ADH87347.1"
FT                   /translation="MARLTTLPPRLSALPPRLAVQTHTGPDRDRVRMAGAPWRAWYKTA
FT                   RWRALRLRVFTRDLFACQMKDCGRVEADTSLLVCDHIHPHRGDEHLFWDEGNLQTLCKP
FT                   CHDSVKQAEERRGGW"
FT   gene            7443..7940
FT                   /locus_tag="Snov_0011"
FT   CDS_pept        7443..7940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_1749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87348"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZT4"
FT                   /inference="similar to AA sequence:KEGG:Rsph17025_1749"
FT                   /protein_id="ADH87348.1"
FT                   /translation="MSDEKSEAPGEVDLFGMPVRPIRDRRGRPCFKKDKENQDFVAVRI
FT                   AAGWSQARIAEDMGIDEKTLRKHFSRELENGRVFVEGLVLDVLLKQTREGKSPAIRQLR
FT                   EMLEAAGPQAPRGRSKPKSDEEEEDEDGKAAPVGKKEQQMQDAQVVPPEYGDIFDRIDR
FT                   RH"
FT   gene            7940..9658
FT                   /locus_tag="Snov_0012"
FT   CDS_pept        7940..9658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0012"
FT                   /product="Terminase"
FT                   /note="PFAM: Terminase; KEGG: rsq:Rsph17025_1750 phage
FT                   terminase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87349"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZT5"
FT                   /inference="protein motif:PFAM:PF03354"
FT                   /protein_id="ADH87349.1"
FT                   /translation="MLPVLFACPDWFEKLQAGATPIPDLPIDPVLAECAVELFNKLRVP
FT                   DVPGMPTMAEAAGEWMRDIVRVAFGSVDRETGQRFVGEIFNLVPKKNGKTTNAATLGLI
FT                   WLMMNRRPNVDGIIVGPTQEVAEKCFEQASLMIAADEYLARRFKVIDHKKTIIDRHIDR
FT                   DTGIRRNAKLKIKSFDPKVVTGSIPAFAILDELHVMAHANFASRVVGQIRGGMITNPES
FT                   LLIIITTQSEVPPFGIFKQELDYARKVRDGEVTEDVRMLPILYEFPEAMQLATDKPWLD
FT                   PKNWPLVLPNLGRSLTIDRLQKEWRTAQQKGEGAAREWASQHLNVQIGTAMHGDRWVGV
FT                   DYWDAAADDRITLDYIKENSDVVVTGGDVGGLDDLWGLAVLGRHKETRHWMLWAKAWAQ
FT                   RIVLERHKEVAERLRDFEREGSLVICDRVTQDAEEAAAIIVSLRDAGLLPETGGVGLDP
FT                   AGVTALLEELALYEVGSPCVAAVSQGYRLSAAIFGTERKLADGTMKHCGSLLLNWCAGN
FT                   LMAEMRGSNVYMQKRTASAKIDPMMAAFNAVEMMSRNPVAANGPSVYEGRGILMV"
FT   gene            9663..10994
FT                   /locus_tag="Snov_0013"
FT   CDS_pept        9663..10994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0013"
FT                   /product="phage portal protein, HK97 family"
FT                   /note="KEGG: bmj:BMULJ_04637 bacteriophage portal protein;
FT                   TIGRFAM: phage portal protein, HK97 family; PFAM: portal
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87350"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZT6"
FT                   /inference="protein motif:TFAM:TIGR01537"
FT                   /protein_id="ADH87350.1"
FT                   /translation="MRILDFFRRSEPAAAAGAHVSPQASGSGFLSLDDPRVIEFLRFGD
FT                   VTATGITVNVERALKNPAMFRAVSIISFAIGMLPLQLIHEETKKKATDHPLYRVLHRRP
FT                   NGWQSAFDFRTLMQLRALVKGNGYALVLRSTDLRNRGAEKVGGLVPLDPDRMEPKQLDD
FT                   WSVVYDYQPKTGARRRYQARDILHLRGLSLDGITGLSTVKQAAEPIALALAAELAAGRV
FT                   FKNGALVSGALKHPGKLSDPAFERLKASLAEKEGAENAGKNLILEEGMDWASVSSSAKD
FT                   AQLIEIRKMQIEEIGRATGVPRPLLMMDDTSWGSGIAELGRFFVQFALTPWFEAWQQAC
FT                   ERTLLSDAEADALTVKFNAGALLRGSVKDQGEFFAKALGAGGQPGFMTQNEVRDMLDMP
FT                   RVEGGDELSKGAMGHNGGPALDDPEDDTAPKPKRSPKKDEGDED"
FT   gene            10984..11865
FT                   /locus_tag="Snov_0014"
FT   CDS_pept        10984..11865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0014"
FT                   /product="peptidase S14 ClpP"
FT                   /note="PFAM: peptidase S14 ClpP; KEGG: dac:Daci_1633
FT                   peptidase S14 ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87351"
FT                   /db_xref="GOA:D6ZZT7"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZT7"
FT                   /inference="protein motif:PFAM:PF00574"
FT                   /protein_id="ADH87351.1"
FT                   /translation="MKTDRPRVMAAARPDAMPLPIRQDVHAFTKPEVFDRWSDTAAGVR
FT                   ALTVGDNVITMFDVIGEDYWSGGGVTAKKVASQLKAIGDRPVEVQINSPGGDMFEGIAI
FT                   FNVLREHPQDITVKVMGMAASAASIIAMAGDHVEMGAASFLMIHNCWVLAIGNRHDMRE
FT                   TAEWLEPFDQAMVDLYAARTSQKPADIAKWMDAETYMSGSQAVERGFADALLASDQITT
FT                   DEKAQSADRNINELRAMELQLVSAGMSRSAARARINKIKGTPGAAPNDPTPGAGEDDWS
FT                   GIADLIATLRTS"
FT   gene            11875..13257
FT                   /locus_tag="Snov_0015"
FT   CDS_pept        11875..13257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0015"
FT                   /product="phage major capsid protein, HK97 family"
FT                   /note="KEGG: bmj:BMULJ_04635 bacteriophage major capsid
FT                   protein; TIGRFAM: phage major capsid protein, HK97 family;
FT                   PFAM: major capsid protein HK97"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87352"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZT8"
FT                   /inference="protein motif:TFAM:TIGR01554"
FT                   /protein_id="ADH87352.1"
FT                   /translation="MRTFLYVALACAAVLALGHILPADASPLTHGVAMAVFAMPAAKPR
FT                   LPRIAVETTMLRPVPRAVKAMPRADVSDPKAMIAALQKAFDDFKAANDEKLKGKADVVL
FT                   DEKVDRINSAVDGFQKAIDDLNAKLAAQAAGGSVIGDLPADPEYVAAFKAHMRKGDVQA
FT                   AISKGVDSEGGYLAPVEWDRTITGKLKEVSPIRDNARVMSITTSGFKKLFTDRAVGSGW
FT                   VGETAARPATSTPAFAILDFVPGEIYANPAITQQALDDAAIDLEQWLAGEVNTEFARQE
FT                   GIAFLSGNGTNKPFGILTYVTGAANAAKHPWGAIEVVNSGAAAALTSDGFISLFYSVPT
FT                   AYRSGAKLYTNRQTMAAARKLKDGQDNYLWQPSYAQGQPATLAGEPIVEIPDMPAVAAD
FT                   AIAALYGNMEETYLVVDRIGIRVLRDPYTNKPFVHFYTTKRVGGGVFNPEPMRALKIAA
FT                   AA"
FT   sig_peptide     11875..11952
FT                   /locus_tag="Snov_0015"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.994 at
FT                   residue 26"
FT   gene            13324..13587
FT                   /locus_tag="Snov_0016"
FT   CDS_pept        13324..13587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0016"
FT                   /product="neurotactin"
FT                   /note="KEGG: similar to neurotactin; K05508 C-X3-C motif
FT                   chemokine 1; K05508 C-X3-C chemokine 1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87353"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZT9"
FT                   /inference="similar to AA sequence:KEGG:100021428"
FT                   /protein_id="ADH87353.1"
FT                   /translation="MAVKKAGTARTVPVTVAAPQQAATIPAATSFAPSGAPEQTVPDVD
FT                   PKHAAIDDNPRANTSVEQNRIDFNDPTLSGSEAVANNLKGEG"
FT   sig_peptide     13324..13392
FT                   /locus_tag="Snov_0016"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.702) with cleavage site probability 0.689 at
FT                   residue 23"
FT   gene            13591..13908
FT                   /locus_tag="Snov_0017"
FT   CDS_pept        13591..13908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0017"
FT                   /product="uncharacterized phage protein (putative DNA
FT                   packaging)"
FT                   /note="TIGRFAM: uncharacterized phage protein (possible DNA
FT                   packaging); KEGG: bcm:Bcenmc03_1290 phage protein DNA
FT                   packaging protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87354"
FT                   /db_xref="InterPro:IPR006450"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZU0"
FT                   /inference="protein motif:TFAM:TIGR01560"
FT                   /protein_id="ADH87354.1"
FT                   /translation="MPNVVVTETGPLLSLEEVKQHLRVDHGDDDALITTYMDAAVLHVL
FT                   MYCNLSLVPLGAEAQFKVAALMTAADFYDNRAEVAPGPVASVPLPASARRLVDPYRHLR
FT                   V"
FT   gene            13911..14261
FT                   /locus_tag="Snov_0018"
FT   CDS_pept        13911..14261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0018"
FT                   /product="phage head-tail adaptor"
FT                   /note="KEGG: ara:Arad_2301 hypothetical protein; TIGRFAM:
FT                   phage head-tail adaptor; PFAM: putative head-tail adaptor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87355"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="InterPro:IPR038666"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZU1"
FT                   /inference="protein motif:TFAM:TIGR01563"
FT                   /protein_id="ADH87355.1"
FT                   /translation="MPAAGDLRERVHFQSREMIDDGYGNEQSGPWTTRFTVAAGFRPLR
FT                   GGEAVMASRLESRQPYIVTVRQSSDTRGVSTDWRIVDARNTGRVFAISAAPTDPDGKRA
FT                   WLEILAIEGMPS"
FT   gene            14261..14455
FT                   /locus_tag="Snov_0019"
FT   CDS_pept        14261..14455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0019"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87356"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZU2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87356.1"
FT                   /translation="MPWVRFIADFDFKPKPAITIAYRAGFVGLVSRSCAAKAKARGLAI
FT                   PVSRPGSRRNDEVAADGKV"
FT   gene            14442..14912
FT                   /locus_tag="Snov_0020"
FT   CDS_pept        14442..14912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0020"
FT                   /product="phage protein, HK97 gp10 family"
FT                   /note="KEGG: avi:Avi_1977 hypothetical protein; TIGRFAM:
FT                   phage protein, HK97 gp10 family; PFAM: TP901-1 ORF40 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87357"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZU3"
FT                   /inference="protein motif:TFAM:TIGR01725"
FT                   /protein_id="ADH87357.1"
FT                   /translation="MARSSIVGLAKLHRKIAKLPEQARTDIRAAMEKVAEQIVDLARSL
FT                   VPTVSGDLRDSIGWTWGRPPRGSISLGTVARAKLGASMTITIYAGNDEAFYARWVEFGT
FT                   AAHVNGGLFAGTRNPGTQARPFFYPAFRAHRRIARREVRKAIRSAARKVAKQ"
FT   gene            14909..15331
FT                   /locus_tag="Snov_0021"
FT   CDS_pept        14909..15331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: avi:Avi_1978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87358"
FT                   /db_xref="InterPro:IPR021508"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZU4"
FT                   /inference="similar to AA sequence:KEGG:Avi_1978"
FT                   /protein_id="ADH87358.1"
FT                   /translation="MIDPVLELQGVITARLKANDDLRALIDRRVYDSVPRDRDGGVTAK
FT                   FPYVSFGPTTELQDDADCIAATEFTLQIDAWSREPGFPEVRRIAKAVKAALHEQEITLA
FT                   ENALATFEWWRADVIRAPDGITSHAAITFRGVIEQS"
FT   gene            15389..15835
FT                   /locus_tag="Snov_0022"
FT   CDS_pept        15389..15835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: avi:Avi_1979 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87359"
FT                   /db_xref="InterPro:IPR011855"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZU5"
FT                   /inference="similar to AA sequence:KEGG:Avi_1979"
FT                   /protein_id="ADH87359.1"
FT                   /translation="MAKPTTMKGGQVRVLIGNDEDPIVYAAPCGFTERSVTLSKNLEEV
FT                   VIPDCDDPDAVDWVGRDASSLSMAISGEGVMAEQSVETWLDAWENPNSVPVKVEWGFPN
FT                   KTITWTGLMHVESIEATGANGQRVRKSISMQSDGEMARVVTPNA"
FT   gene            15828..16394
FT                   /locus_tag="Snov_0023"
FT   CDS_pept        15828..16394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0023"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smd:Smed_1323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87360"
FT                   /db_xref="InterPro:IPR021791"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZU6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87360.1"
FT                   /translation="MRDASLTLDWADGTYAFRLGWAELEKLQEACDAGPYVVLQRLRTG
FT                   TWRVGDVAHVVRLGLIGGGMTPVDALKKARAYVEARPPAENLLPAQAILSAGVVGAPEE
FT                   DDGSDRPAPNDADRVDDLPNGKIRMATVYGLGAAMGFTPQQVGAMSLWQFMAAVKGYAK
FT                   ANNPDDGKSLTAAEEDALWAVVAEG"
FT   gene            16398..18404
FT                   /locus_tag="Snov_0024"
FT   CDS_pept        16398..18404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0024"
FT                   /product="phage tape measure protein"
FT                   /note="TIGRFAM: phage tape measure protein; KEGG:
FT                   avi:Avi_0873 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87361"
FT                   /db_xref="InterPro:IPR013491"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZU7"
FT                   /inference="protein motif:TFAM:TIGR02675"
FT                   /protein_id="ADH87361.1"
FT                   /translation="MATDIEKLVVQMSADIKGFERELRKAQGIGERRATAIERRFQQMN
FT                   KRISASLGSSVSLGGLAGAVGLGISIADFVETTKRIDSLRQSLKAITGSEAEAAREMQF
FT                   VTETAEKLGLELLSTGEAYASLMAATKDTTLEGEATRDIFVAVANAMSTLGKSSADTEA
FT                   ALLAVQQMVSKGKVSAEELRGQLGERLPGAFKAAADALGITTAELDEMLQKGQVTAEVL
FT                   LPRLAKRLEELYSVDRKSTLTAEINRLNNAVTDLYRTLADTGAIGLVTSALKDLANIIK
FT                   EIAAYSQLVGQGRFGEAFAVDPAGAARMKLRLGQGTALTDDQSAAWDQAFGMTGSAPST
FT                   VTVNKPAPPAFAPAAEKQRLDSYQRLTAAIKERTGAIEAETAAQASLNPLMNDYGFAVE
FT                   KARAEYDLLTAAQEAGLSITPELRAQIDTLATAYANASAASEQLRESQGRLQQAAADFN
FT                   EMGRGVLSGFIADFTNAETRADALNNAIGRIVDSLAEMALSSVFKPQGSGSGGLFGAFF
FT                   SALTGGTSGTTSGYAGASALYDEGGYTGDGGKHDVAGAVHRGEYVFSKAAVQRLGADNL
FT                   EMLHLMGKKGYADGGFVGGLSMPRISRRGGASRGAGAVLSFSPVTNIDATGSQVSRQEI
FT                   AGMLAQRDKALMAGVQRAMPGWIVSARKRNVGI"
FT   gene            18407..19057
FT                   /locus_tag="Snov_0025"
FT   CDS_pept        18407..19057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smd:Smed_1878 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87362"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZU8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87362.1"
FT                   /translation="MAITYPRSLPACGARRVALELFDPVVSAASKRGLVINRTQVVDPL
FT                   WRLRAETHMLRQPAEWIAWGASLGGGLRTFLASDSRYRQPLAYPNAGVPGDVAAGWDGT
FT                   ADVTALGSGGALSLALLPSSYQITAGDRIGLEQGSPLRRGYYMALEDVTASAGGVATVT
FT                   VTPFLHTAIFTAAATARLWRPSAEFVLDPSTWPENPGALPRWSSFSFEAWQTI"
FT   gene            19054..19680
FT                   /locus_tag="Snov_0026"
FT   CDS_pept        19054..19680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0026"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_2992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87363"
FT                   /db_xref="InterPro:IPR019228"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZU9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87363.1"
FT                   /translation="MITLPSDVLALLDAGRISIRGMIRFDLGTGTYGFIRSVQPLTWSG
FT                   VTYLPGGLISVSDLSASMDGSAQAFTVKLAASADDGLTPEVLLTIEAEDYRDRPVTIYD
FT                   AYFHPDTGALLHVQALKRGYIDTIDHIDDPEDGYTLEAKCESRALDYTRTNGRRRTVVD
FT                   QARRAPGDLFFEHTAMRGREEIFWGREKAAAPPPQVPRSTTPRRR"
FT   gene            19697..20101
FT                   /locus_tag="Snov_0027"
FT   CDS_pept        19697..20101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_2086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87364"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZV0"
FT                   /inference="similar to AA sequence:KEGG:Rsph17025_2086"
FT                   /protein_id="ADH87364.1"
FT                   /translation="MRIKGWERELRLVVEKHIALPSAYGISDCYIIADDAVEAVTGKRM
FT                   FTGARGYRTAAGAAKKLRKRGFLTVADAFAARFAEIPAMMAQRGDIGVIHQPNGDVTGG
FT                   VFTGLGFFTRDGDRAVFLPCTDVARAFRVD"
FT   gene            20105..22708
FT                   /locus_tag="Snov_0028"
FT   CDS_pept        20105..22708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_2085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87365"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZV1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87365.1"
FT                   /translation="MPFIAPIIGAVGAAIGAVGSFVGSLGIVGQALLGIGASVLSSVIQ
FT                   KETAGKAEKQPGGVQFERQYGGDVPRQVACGLVGIAGHDTYVNTFGPANGILQQIYTLS
FT                   DFPCHGLSRVAINGKWVTLGPVGEDGMRKVTSGEYADLIRVQFVDGTQTAALAGLVNSA
FT                   NPSDRWTANHIGAGVAYVYIALAFTEPLTNFPDFFFEFYGARFYDWRKDSTVGGSGGHR
FT                   WGNYATYEFTENPVVIEYNYRRGIAWNGDMFCGMAMPAADLPLAKWTAAANICDETTDY
FT                   GTRYRCSIMLDCTAMHGENITSLQLSCGAKKVDAVDGSWPLVGHDQAVVATITDDDLIV
FT                   GVRGRWTARRSMSDLVNRVYGTFPNPDNLWSPADYELQGGGALVVLDRRDRDVPLDFPM
FT                   VRVPGQAAQLARIYLEENRYEATGDEVWRPRFQVLEPGDWIRRIGRTHGDRIYQITGLS
FT                   LASHDADGPRNVSVSLQEVDGAIYDGITAPPIVVPMPPGAPVLLNEVQDFDLAPVTVLG
FT                   DDGRLLPAIRASWASITDVTVAYVDLQYWPTAQPTSVFTKRVPATETITVLAEGVVRAT
FT                   EYTVRTRLVTQPPRVTVWSAGETVTTTAIPDTEIDVYLANIKGDAYDALRRMREDLTAN
FT                   VQRMDMFVRDTSVGLGRQVTSTSVATRLGKANATAIQSVQSSVQDLGDQVLAMAEIIDA
FT                   VNASIESINGTLAGQASAMTALTARVTASEGGINALAASTTTLSATVGDLSASGLLRIE
FT                   ARAGSGDVSARLVVLMRATTGSVWREVGTIWETGFTGGNPALPFARIANYADQFVIISP
FT                   IDDGRLPPFVVDTGLGQVIITEALIKRLMVNNFTLTGAGSKLLITSNPARIRATS"
FT   gene            22708..24039
FT                   /locus_tag="Snov_0029"
FT   CDS_pept        22708..24039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0029"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gvi:gll0645 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87366"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZV2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87366.1"
FT                   /translation="MPVSLTVTGGAMRLRTALPGHDPEDENTDERYLTFDSFWGGTLRL
FT                   LANNVVSAASLANLTVTYPAGADGPITRRCKVLPSAGENATRPTLAWARRGAGSVTYRS
FT                   GGVDTPTGYQRGYRQCGVTLRTNSILLSPQLAGVDYVYFVFGNNGTAAEGSGGNGVIIG
FT                   DHDLHGVGLHASRLGFNVDTATLAEMAVSTRKNVFQIFETGTVTLTGTALTDPLADPNV
FT                   NSFALPAAFVDLAGSYPHYPPVIAYSVGNSEQVNCSVFWINASRLLILGTADFSTPVRF
FT                   AVVASDPAYQGGVDSATGIVRLDITGDYVRVSKHNIGIDAAGIADLVFDSDRLTPRLKG
FT                   FSAVGASQGSGFFNLPSPPPVGAGPPFNFFILWDPQIGEWWCGCGNVAYFDVLGFFQTV
FT                   GVWGYSGHAPAGWVANRTQCGWFRPGSWGSAPGFTATMNVSDFS"
FT   gene            24049..25224
FT                   /locus_tag="Snov_0030"
FT   CDS_pept        24049..25224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smd:Smed_1872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87367"
FT                   /db_xref="InterPro:IPR021251"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZV3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87367.1"
FT                   /translation="MPTSPSVFRAGVVAVTAGSPIVLGTGTGFLLNGVTGGMFSLAGHA
FT                   VPVLSADSETQLTLAYDWPGATASGVADYAISLESALAADATFVHNRLVSVLDAIGAIE
FT                   NARPNYEVLSVGSNAPPGSPVVGGLYVVGTVPNGAWVGQANNLAQWTGAAWLFTAPERG
FT                   TTVVSAATGIVSIWNGTTWGAYVAPSSFIATLMDDASASAALSTLGVSDFAKTILDDTT
FT                   AAEARTTLGATAFRALGTLTGAAGSFARFTGAGGADAVMQAIVGTVSQSAGVPTGAIVE
FT                   AGSNGNGNYVKFADGTMVCWATFAVRAINIASSAVIGGFRSAAIIPTFPIAFAAVPAIV
FT                   TFATGGSGASGSAITACDSSAPTTGNFSFYLAASVNTTAAGAGYVAIGRWY"
FT   gene            25243..26691
FT                   /locus_tag="Snov_0031"
FT   CDS_pept        25243..26691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0031"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ach:Achl_0059 agmatine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87368"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZV4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87368.1"
FT                   /translation="MPTPSTVIALGARGTVHEVTEDANFYYFRSDSMGCATLPFKMKKT
FT                   AFTDLAKIVDGHTGTRCYVGYGQSWRTMSGGAIKSWVAGYSAEPESALTFHQTNSAGAR
FT                   SVLGPTVGVYWPGSTFVDDICGMSLNEPITLDRVAAVARARWRRKRVIRQFSDFHFTFG
FT                   YPSSGWDWGGSGGAGLNENSPSWANGIAALNRLRTILTGYGLSVALAPLSWTQGGDPNK
FT                   NLAGNLDDLAQLRHHWGEDAAGGAAQPLFIGIAPGGSSTTEMPVGAKAQIQYCRDNVGS
FT                   GIHLTFPWYMLRLTSTGPGDDGSIHFDSAGMVRYGAVEGYVQAIVEAGVVWTPFWLTRD
FT                   VDPVRVDGQEVVVTFDAPPGGDFDRKAPRVITRDDEPDLPGLAESHGFRVKRAGTFLTL
FT                   GTPTYGLNASGKPEARLPVVETLVSGDALEVSYCAYGTGSVPFGHSGVWGNVILRGPRC
FT                   PVRKDVPDPFVDMPLVPFIAASTA"
FT   gene            complement(26770..26967)
FT                   /locus_tag="Snov_0032"
FT   CDS_pept        complement(26770..26967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfs:PFLU0319 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87369"
FT                   /db_xref="GOA:D6ZZV5"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZV5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87369.1"
FT                   /translation="MRFSAEWWTGFGLVFAALGAITVLFCWWMDRRIARFAAGDAEAHE
FT                   RLSRSAGNNVVEMKKPPEGG"
FT   gene            27003..27236
FT                   /locus_tag="Snov_0033"
FT   CDS_pept        27003..27236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rlt:Rleg2_0750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87370"
FT                   /db_xref="GOA:D6ZZV6"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZV6"
FT                   /inference="similar to AA sequence:KEGG:Rleg2_0750"
FT                   /protein_id="ADH87370.1"
FT                   /translation="MRLIPNWRKVLLRAWSVRLGLIAGLFEGLNVVLQITVDRLPDVSL
FT                   GLRLAAGGCACLALVSRFIAQPKTIGESHADH"
FT   gene            27223..27813
FT                   /locus_tag="Snov_0034"
FT   CDS_pept        27223..27813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0034"
FT                   /product="glycoside hydrolase family 24"
FT                   /note="PFAM: glycoside hydrolase family 24; KEGG:
FT                   rlt:Rleg2_0751 glycoside hydrolase family 24"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87371"
FT                   /db_xref="GOA:D6ZZV7"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZV7"
FT                   /inference="protein motif:PFAM:PF00959"
FT                   /protein_id="ADH87371.1"
FT                   /translation="MPITKLRPTGRARAAIAAVMALAISIGGIWYVPTSSGKQYPAAVV
FT                   LAAEHIIKGWEGLRLIAYRDIVGVWTICYGETKGVRAGMRKTAAECEALLYERVYRDFY
FT                   IPMSACAAPAFVQAPVPVQAAMLGGGYNFGVGGWCGSTTARYIRAKLWRQACDAQTAWN
FT                   RAGGKVVQGLVNRREMGDASRIGEGELCVTGLQ"
FT   sig_peptide     27223..27336
FT                   /locus_tag="Snov_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.712) with cleavage site probability 0.570 at
FT                   residue 38"
FT   gene            27813..28172
FT                   /locus_tag="Snov_0035"
FT   CDS_pept        27813..28172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rlt:Rleg2_0752 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87372"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZV8"
FT                   /inference="similar to AA sequence:KEGG:Rleg2_0752"
FT                   /protein_id="ADH87372.1"
FT                   /translation="MLGLLDTIKIGAGLIAGVSLTWAAQTAYDRLVDDPAVAAAAREGY
FT                   VQIAEKTALQAQLAELSRQRAASDEALRAALARAENAKQEAARAQAQYDDLVVQDSGAD
FT                   GARVDGSDVQWLRDY"
FT   sig_peptide     27813..27884
FT                   /locus_tag="Snov_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.602) with cleavage site probability 0.525 at
FT                   residue 24"
FT   gene            28147..28425
FT                   /locus_tag="Snov_0036"
FT   CDS_pept        28147..28425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0036"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rlt:Rleg2_0753 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87373"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZV9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87373.1"
FT                   /translation="MCSGCATTERRLTVAAGTTGRIAASVDLPDLPAECRAHMARVVPK
FT                   EGEKWRWVQKRWEIVADTEDKRTARCAAFYDDVAEGFEVTGVAGDAE"
FT   gene            28415..28699
FT                   /locus_tag="Snov_0037"
FT   CDS_pept        28415..28699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_5763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87374"
FT                   /db_xref="GOA:D6ZZW0"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZW0"
FT                   /inference="similar to AA sequence:KEGG:BBta_5763"
FT                   /protein_id="ADH87374.1"
FT                   /translation="MRNEPNKSVVLSISRDELREEMEKAVRRGLEDVGLYTEDAEDRRE
FT                   TREDMRFVRRLRRATDGIAAKVGYTVLAIVTGGFLVVIWAGIKVHVLKQ"
FT   gene            28683..28892
FT                   /locus_tag="Snov_0038"
FT   CDS_pept        28683..28892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0038"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87375"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZW1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87375.1"
FT                   /translation="MCSSNERPRRAAFHEPTGRLLINFDHQSGIGTLEEWETYVRFIQR
FT                   EVTRQRERQYQAAHPWHWRPEPEF"
FT   gene            29186..30901
FT                   /locus_tag="Snov_0039"
FT   CDS_pept        29186..30901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0039"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azo:azo0386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87376"
FT                   /db_xref="GOA:D6ZZW2"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZW2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87376.1"
FT                   /translation="MTNRISRIAAAETLLFILIIAVISFKHFVLIVPHGPSVFMDELWY
FT                   KDNIISLLSNAIAYKAHYPPVYSAVLMPAFIFENWYEALVGLNAIYTSLCIAVVYFVAR
FT                   SFVRRLLALVAALAAALLPWQAVYPLYIMSENVAVLLFVLSVFLASRGVTDRPGEALIF
FT                   GALLSTLYLTKYLALPALPMLFLAWMVGPFLQRCRYSLSAYVTSIAACALGMSIILGGW
FT                   AAYCLSRGIPLLKAFGLAFVDKYIDAAPQSSQFMWLIVYAADAALSVAPFILFVALWVT
FT                   SHSFKKQVRELKFTQDSVFIILSACVAAGYCVLSARHSFIVPYNRPNPSHMQGRYMMQI
FT                   GPMFIIAGVISFERLIMDGRLGSGRMRWWMAPPLVVAAVVLSWGILFRDFVWSFPAWFA
FT                   SMAHVSPSVFPYNNQKVAILCIALVVIMALIVMIARASGTIWRIAVPSAIVVAICWQAA
FT                   LFWGGVEYVRALRNTQHGRYIAAEVLSGRVSPNCYEDIVIDVPFLTPTMLKNQLSFWGI
FT                   DGNKYDIKISVLDEKKEEKDDIYMLLGAAGRNAVAVANYSLDGQQYTAYCINPD"
FT   gene            complement(30969..32477)
FT                   /locus_tag="Snov_0040"
FT   CDS_pept        complement(30969..32477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0040"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_06080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87377"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZW3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87377.1"
FT                   /translation="MLNPKYDQQVQSQIGQYSTVENMHNAAAAANWFNSRFLRPRMRQV
FT                   SGTESVAEFYAVHIAEAVARTGLDVAVSLGAGYGSLEIDIINLARSRGLPAFHLKCFEL
FT                   SPVLVDRANRAIREQGLEDFVSAQVVDLNVDLPLAGNVAAFMAHHSLHHLVELERIFDQ
FT                   VNSYLPPEGAFITMDMIGRNGHMRWPETLGIIRELWPALPDRLKWDHQLSRFDRWFENW
FT                   DCSIEGFEGIRSQDILPALLERFKFERFLAYGGLSEIFTDRSFGPNFDPNNPPDANFLS
FT                   QIKALEDDLIRAEQVKPTQLIAVMRPLRSHDCPGEAICFEGLTPTKAVRSADRQDFGAP
FT                   HLGNTSFVSPFPAPDEEPAIPMVACGAPIHFVPGGNGAALTRWGWAEPDPDFTWSVGLA
FT                   SALRFRAAEGAAGILLKFVDVRPPTTERRFLTLRLNDREVASIELDGIEAVREISAAFP
FT                   DSLSPGDEALLEIELTRPLRPDVDDSVDRRPLGIGLISMSLAPA"
FT   gene            complement(32885..33166)
FT                   /locus_tag="Snov_0041"
FT   CDS_pept        complement(32885..33166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0041"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87378"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZW4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87378.1"
FT                   /translation="MGITHTAAMQPYEIIRKNITKVGPDWQIAPDQPPVDMRVWSGFVA
FT                   FVPGDRAEIKKRVDAVRISFTADLLPAEGGVWVLAGYSDLAKILKALR"
FT   gene            33273..33494
FT                   /locus_tag="Snov_0042"
FT   CDS_pept        33273..33494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0042"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_3742 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87379"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZW5"
FT                   /inference="similar to AA sequence:KEGG:Xaut_3742"
FT                   /protein_id="ADH87379.1"
FT                   /translation="MTDKPSPHDPTDLIEITDADVDEAIAVCSGDMRATIRALLIANTF
FT                   TEQMLELARREASPGFLRRRPVKRAQNG"
FT   gene            33487..33882
FT                   /locus_tag="Snov_0043"
FT   CDS_pept        33487..33882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0043"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_0687 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87380"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZW6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87380.1"
FT                   /translation="MDELRVICVECTCGRRWWGRSSEVGFRSIQDLAGRMVCRGCGARN
FT                   VSVAYADHVAVPAPEPNELWASVEIWDDAGIRIQETMARVGNLGVGVAAYERTLLERPN
FT                   RNVTLRDRARIIRSTARDRERRGKRLD"
FT   gene            complement(33874..34557)
FT                   /locus_tag="Snov_0044"
FT   CDS_pept        complement(33874..34557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0044"
FT                   /product="protein of unknown function DUF159"
FT                   /note="PFAM: protein of unknown function DUF159; KEGG:
FT                   bja:blr6107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87381"
FT                   /db_xref="GOA:D6ZZW7"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZW7"
FT                   /inference="protein motif:PFAM:PF02586"
FT                   /protein_id="ADH87381.1"
FT                   /translation="MCNLYSHHSNVEAIRDLVGTLRNLAGNLAPQTGIFPDYPAPIVRT
FT                   GADGERELAMARWGMPSPPQFGGPPVTNIRNVASPHWRRWTGPASRCLVPMTSFSEYAP
FT                   EPNPVTKRKDVVWFALSEERPLTFFAGIWTPWDGVRGTKANPVLGPHDLYGFLTCEPNA
FT                   VVKPIHPKAMPVILTTAEEREVWMRAPWSEACALQRPLADDGLTIVARGAAKEDPPVED
FT                   LRLLV"
FT   gene            complement(34564..34791)
FT                   /locus_tag="Snov_0045"
FT   CDS_pept        complement(34564..34791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0045"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmj:P9211_02281 putative kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87382"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZW8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87382.1"
FT                   /translation="MMGQMMTTKPDHYPLPWTVNMTSDEDGLPLFGVLDAEEGYVCYSH
FT                   DDKVSRAIAAHAEKIKETMAALPPASFGEG"
FT   gene            complement(35168..35593)
FT                   /locus_tag="Snov_0046"
FT   CDS_pept        complement(35168..35593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_3935 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87383"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZW9"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_3935"
FT                   /protein_id="ADH87383.1"
FT                   /translation="MKTTAIILGAALASMSTVAFAGPCTERISALEKSLSTSDAGSGPT
FT                   KSTDAMTAAPNPGVPKAGETPGTGGTAGMNATVGSKATSPADVRSQTSGGATAAQGGAS
FT                   SSQQVSAAMSRAKAADQSGDAAACGRALDEAQQLLKG"
FT   sig_peptide     complement(35528..35593)
FT                   /locus_tag="Snov_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 22"
FT   gene            complement(35683..38481)
FT                   /locus_tag="Snov_0047"
FT   CDS_pept        complement(35683..38481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0047"
FT                   /product="UTP-GlnB uridylyltransferase, GlnD"
FT                   /EC_number="2.7.7.59"
FT                   /note="SMART: metal-dependent phosphohydrolase HD region;
FT                   TIGRFAM: protein-P-II uridylyltransferase; KEGG:
FT                   azc:AZC_0338 PII uridylyl-transferase; PFAM: GlnD
FT                   PII-uridylyltransferase; DNA polymerase beta domain protein
FT                   region; metal-dependent phosphohydrolase HD sub domain;
FT                   amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87384"
FT                   /db_xref="GOA:D6ZZX0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZX0"
FT                   /inference="protein motif:TFAM:TIGR01693"
FT                   /protein_id="ADH87384.1"
FT                   /translation="MTDTRRRRRTDHPFKELFDIDVLREELTALARQVLDNGKAGREIE
FT                   LRGQMARRLKLAYQQGHKTAERWLMEEGSGRRCAERLSRLQDEIIALVHELAVKFLYPS
FT                   DNPSTAERMAIVAVGGYGRGLMAPGSDTDILFLLPYKQTAWGESVAEAILYVLWDMGLK
FT                   VGHATRSVDECIRQARADMTIRTALLEARLLLGEKSLFEELTVRFDKEVVQGTAVEFVA
FT                   AKLAEREDRLKRAGQSRYVVEPNVKDGKGGLRDLHTLFWIAKYVYRVHETRDLVAKGVF
FT                   TPEEAVVFRRCEDFLWSVRCHLHFLAGKAEERLSFDLQREMAERLGYTAHPGLKDVERF
FT                   MKHYFLVAKDVGDLTAIVSAALEERHDKPVPRLNRVIARLRRSPRRALKESTDFIVDND
FT                   RINVADASAFGRDPVNLIRIFHLAGKHGLAFHPDAMRLATRSLKLIDQRVRENPEANKL
FT                   FLEILCSRETPEIVLRRMNETGVLGRFIPEFGRVVAMMQFNMYHSYTVDEHLIRAIGVL
FT                   GQIERGDRPDLGLANELVQQIKNRTLLYVAVFLHDIAKGRPEDHSIAGARVARKLCPRF
FT                   GLSPVDTDTVAWLIEQHLTMSTIAQSRDLSDRKTIENFASVVQNLERMKLLLILTTADI
FT                   RAVGPGVWNNWKSQLLRTLYYETEPVITGGFSESNRNQRVARAQAEFRAAMADWPPEEI
FT                   EAYLSRHYQTYWLQTDREQQAEHARFIRAAEAEGRALATTAHTDAARGVTELTVFAPDH
FT                   PKLLAVIAGACASAGAHIVDAQISTTTDGRALDTISLTRAFEQDSDELRRTERIAAAIQ
FT                   KSLAGEIRLPEIVAKRIPKRPRAFTVEPEVTLNNSWSNRHTVVEVSGLDRPGLLYGLTQ
FT                   TLSRLNLNIASAHIATFGERAVDVFYVTDLMGAKIIGAARHSAIRRALLQVLDADDEAN
FT                   AA"
FT   gene            complement(38689..39270)
FT                   /locus_tag="Snov_0048"
FT   CDS_pept        complement(38689..39270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0048"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG:
FT                   atc:AGR_L_1375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87385"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZX1"
FT                   /inference="protein motif:PFAM:PF05239"
FT                   /protein_id="ADH87385.1"
FT                   /translation="MTSKLATLTAAAALALAPAVAFSQSPAPESTTPPAASPMAPDAGT
FT                   PQAPASEMPNTNTPSATPTTPPSGDTAAAKPAPSTPKFVSTQSSGQWLGSDLIGTAVVT
FT                   STDEKLGSISDLVLERDGSVIAAVIDVGGFLGIGAKPVAVSFDSLTPTPTDDGQKIVVA
FT                   LTKEELNSAPEFKSLEQMRSETSDAGAKTN"
FT   sig_peptide     complement(39199..39270)
FT                   /locus_tag="Snov_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.953 at
FT                   residue 24"
FT   gene            complement(39424..39855)
FT                   /locus_tag="Snov_0049"
FT   CDS_pept        complement(39424..39855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0049"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GI18025 gene product from transcript
FT                   GI18025-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87386"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZX2"
FT                   /inference="similar to AA sequence:KEGG:Dmoj_GI18025"
FT                   /protein_id="ADH87386.1"
FT                   /translation="MAGVVSTAFKGSAYLLGAVTGAALMVPVTAGALSAGAIARITPHP
FT                   VAIEMMGPPANLRAPVVNRAAKGPRLDSGPAGTPAAVAPAGAATRPVVDSATPAPASPP
FT                   RVMRTPKGCLSAMGVTKSNLATEELTVCVADASIVNSLN"
FT   sig_peptide     complement(39763..39855)
FT                   /locus_tag="Snov_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.762) with cleavage site probability 0.429 at
FT                   residue 31"
FT   gene            complement(40077..41405)
FT                   /locus_tag="Snov_0050"
FT   CDS_pept        complement(40077..41405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0050"
FT                   /product="signal transduction histidine kinase"
FT                   /note="KEGG: rru:Rru_A0741 signal transduction histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: HWE histidine
FT                   kinase; PAS fold-4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87387"
FT                   /db_xref="GOA:D6ZZX3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZX3"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADH87387.1"
FT                   /translation="MPPLTLDLIDDAARWVTILSSLAIAVGLVRLLQLRPDFSGRTRLL
FT                   TALLVALVSMFALLMLLAIFNGSRMSPDWLQSAVRIGIAALSAVGATALWINFRALVNM
FT                   PSPGHVASEQRRLTLELATALQRYEMALRGSKVAIFTQDRDLRYTSVSKPLFGYPVEQV
FT                   LGSTDADLLGDAQSQPIALIKRESLAASAARKGETEVNEDGGRFWYDIHIEPLRDLSGA
FT                   TVGLTGAVVDVTERKENEQHLRLLMRELTHRSKNLLAVIQAMARQTARHAGSIDEFVEI
FT                   FSARLQALSRSHDLLVQESWHGAALIDMVRSQLGHHIDRENSQVSVTGPNIFLKPEAAQ
FT                   NIGLALHELSTNAAKYGALSVPSGHVDITWARRMAEAGGGFELSWRESGGPPVTVPSGR
FT                   GFGSLVIERNLARALDGEVDLDFAPAGLVCHVTVPEHHLTAGR"
FT   gene            complement(41413..42216)
FT                   /locus_tag="Snov_0051"
FT   CDS_pept        complement(41413..42216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0051"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: met:M446_2725 two-component response
FT                   regulator; PFAM: response regulator receiver; Sigma-70
FT                   region 4 type 2; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87388"
FT                   /db_xref="GOA:D6ZZX4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014605"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZX4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH87388.1"
FT                   /translation="MSTSQLVAQHLPFLRRYARALSGSQSAGDAYVTAMLETLIADPAI
FT                   LDRDADPRVALYRLLTRLWDSVSLNAKVDQTPAAIQGEHRLGHITPVVRQAFLLVSLEG
FT                   FTEEDAAQVLEIDVPTLRNLVEDAGRELAAEIATDVLIIEDEPFIALDLEGLVESLGHR
FT                   VTGIARTHTEAVELARRKAPGLILADIQLADGSSGLDAVNELIAKVEVPVIFITAYPER
FT                   FLTGVRPEPAFLIAKPFQPSTVAAVISQALFFERRARPREQRATA"
FT   gene            42422..42661
FT                   /locus_tag="Snov_0052"
FT   CDS_pept        42422..42661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0052"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpe:RPE_1750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87389"
FT                   /db_xref="InterPro:IPR041649"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZX5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87389.1"
FT                   /translation="MNDDQSEGQSATADTLSHTPIRGARTTALGSDIQAKIGQHLRAMY
FT                   DDVVRQGVPDRFMDLLSQLDKNAGPKTSEDGGSR"
FT   gene            42658..43209
FT                   /locus_tag="Snov_0053"
FT   CDS_pept        42658..43209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0053"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: nwi:Nwi_2773 RNA polymerase sigma factor;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
FT                   PFAM: Sigma-70 region 4 type 2; sigma-70 region 2 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87390"
FT                   /db_xref="GOA:D6ZZX6"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZX6"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADH87390.1"
FT                   /translation="MSQFDPALRDEIIAAIPNLRAFAISLSGSVDRADDLVQETLLRAF
FT                   ANISSFRPGTNLPAWLFTILRNLFRSEYRKRRREVPDSDGAFAATLTTNPDQATHLDFE
FT                   DFRTALDKLPPDQREALVLVGASGFSYEEAADICQCAVGTIKSRVNRARKRLGELLAIE
FT                   DVEDFGPDKTTRAVLAAERA"
FT   gene            complement(43315..43494)
FT                   /locus_tag="Snov_0054"
FT   CDS_pept        complement(43315..43494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0054"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   mno:Mnod_4397 protein of unknown function DUF1328"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87391"
FT                   /db_xref="GOA:D6ZZX7"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZX7"
FT                   /inference="protein motif:PFAM:PF07043"
FT                   /protein_id="ADH87391.1"
FT                   /translation="MLGWALTFLVIALIAAVLGFGGIAGTAIEIAKIIFFVAIILFLVS
FT                   AVVGLLRGRSGPVP"
FT   sig_peptide     complement(43414..43494)
FT                   /locus_tag="Snov_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.400 at
FT                   residue 27"
FT   gene            complement(43695..44594)
FT                   /locus_tag="Snov_0055"
FT   CDS_pept        complement(43695..44594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0055"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: mno:Mnod_0259 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87392"
FT                   /db_xref="GOA:D6ZZX8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZX8"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH87392.1"
FT                   /translation="MIDRFELLLALAKERHFGRAAESCGVTQPTLSAGLKQLEEQLGVR
FT                   LVERGSRFIGFTPEGERALQWARRVIGDVRAMRQEIAGMRKGLSGHLRIAGIPTAMPML
FT                   SELTTPFHEKHGDVRFTLMSASSNEVLRLIENLEADAGVTYLDNDPLGRVKTVPLYQEG
FT                   YRFLTAVDAPLGDRAKVTWEEIGQVPLCLLTPDMQNRRIVDKQLTEAGHAVVPMLEANS
FT                   TLALLSHVRTGKWASVVANTLADVFAFPENIRSIPIEGPEVLHQMGLVVLDREPLTPIV
FT                   TALMAEARAIAPELAARM"
FT   gene            complement(44858..46054)
FT                   /locus_tag="Snov_0056"
FT   CDS_pept        complement(44858..46054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0056"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   xau:Xaut_3306 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87393"
FT                   /db_xref="GOA:D6ZZX9"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZX9"
FT                   /inference="protein motif:PFAM:PF02646"
FT                   /protein_id="ADH87393.1"
FT                   /translation="MDQVLFVVGTHPVTLAQAIAGAAALGFLLLVLVLRAVSRNARQSA
FT                   LEADEQARRADELETRLVELARTQAETVGRVQSMAEVLAQRQGELARAVAERLDATTHR
FT                   MGESLARSAEATHENLAKLNERLALVDQARLSLGELSGQVMSLRETLANKQARGAFGEG
FT                   RLQALVSDGLPRDSFAFQHTLANGRRADCAIFLPGDKRPLLVDSKFPLEAVTAFREAQT
FT                   DDARKQAQTRLKGDVGKHVKDIAERYLVSGETQDIALMFVPSESVYAELHEHFDEVIQQ
FT                   AFRARVVIVSPSLLMLAVQVVQAICKDARMREQADLIRAECGKLVADVIRLRDRVGNLQ
FT                   KHFGQVNEDVAQALTSADKIAKRGARIEQLEFEGEAIPATEPELPDTLPMLGLRGAAE"
FT   gene            46166..46714
FT                   /locus_tag="Snov_0057"
FT   CDS_pept        46166..46714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0057"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="TIGRFAM: peptide deformylase; KEGG: xau:Xaut_3305
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87394"
FT                   /db_xref="GOA:D6ZZY0"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZY0"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ADH87394.1"
FT                   /translation="MSIRPLVIIPDSRLRLISDPIVRVDARVRAIVEDMFETMYDAPGI
FT                   GLAAVQVGIPERIITVDVVRREEGEEEGAEEKKNPIALINPEIISSSEEISVYSEGCLS
FT                   IPEYYADVERPARVKVRYMDLNGETQEIDADGLLATCVQHEIDHLNGVLFIDHISKLKR
FT                   DRVMKKFTKIAKEKERDGV"
FT   gene            46760..47677
FT                   /locus_tag="Snov_0058"
FT   CDS_pept        46760..47677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0058"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; KEGG:
FT                   xau:Xaut_3304 methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87395"
FT                   /db_xref="GOA:D6ZZY1"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZY1"
FT                   /inference="protein motif:TFAM:TIGR00460"
FT                   /protein_id="ADH87395.1"
FT                   /translation="MRIVFMGTPDFAVSTLAEIVGSGHEVVAAYTRAPAASGRRGLELV
FT                   PSPVHRAAEKLGVPVLTPSTLRTEEAAETFAAHEADVAVVVAYGRILPQMILDAPKLGC
FT                   LNLHASLLPRWRGAAPIQRAIMAGDAESGVAVMKMEAGLDTGPVGLVERVAIGADMTAG
FT                   ELHDRLMIVGADLMGRALAALERGALNFTPQPEAGVTYAAKIDKGETRIDWSKPAKQVH
FT                   DHIRGLSPFPGAWFEFDGVRVKVLRSTLVAGAGRPGEVIDDQLTIACADGAVRLTEVQK
FT                   AGSKAMGAADFLRGNELTRGTVLA"
FT   gene            47674..48123
FT                   /locus_tag="Snov_0059"
FT   CDS_pept        47674..48123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0059"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bbr:BB0221 acetyltransferase (GNAT) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87396"
FT                   /db_xref="GOA:D6ZZY2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032962"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZY2"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH87396.1"
FT                   /translation="MTTIRRVEEADHAVWLPLWQGYLTFYEAELPAAVTRTTWQRLLDP
FT                   AEPVHGALAFDEDGRAVGLAHWLFHRSTWSEGNSCYLNDLFVDPGLRGKGVGRALIDHV
FT                   HADAAAKGSPKVYWLTHETNTTAQRLYNAVAERTGFMQYRKMTGC"
FT   gene            complement(48256..48891)
FT                   /locus_tag="Snov_0060"
FT   CDS_pept        complement(48256..48891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0060"
FT                   /product="Peroxidase"
FT                   /EC_number="1.11.1.7"
FT                   /note="KEGG: xau:Xaut_2363 peroxidase; PFAM: alkyl
FT                   hydroperoxide reductase/ Thiol specific antioxidant/ Mal
FT                   allergen; Peroxiredoxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87397"
FT                   /db_xref="GOA:D6ZZY3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZY3"
FT                   /inference="protein motif:PRIAM:1.11.1.7"
FT                   /protein_id="ADH87397.1"
FT                   /translation="MTIRLGDVVPDFEAETTEGPIRFHEWLGNSWGVLFSHPKNFTPVC
FT                   TTELGQVARLKPEFDRRNVKVIGLSVDPLDAHAKWSEDIAETQGYAPNFPLIADQDRKV
FT                   SDLYDMIHPNASDTMTVRSVFIVGPDKKLKLSLTYPASAGRNFDEILRVIDSLQLTATH
FT                   AVATPANWKNGDDVIIVPSVSDEAAKEKFPEGWKTLKPYLRVVPQPGK"
FT   gene            49112..49369
FT                   /locus_tag="Snov_0061"
FT   CDS_pept        49112..49369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0061"
FT                   /product="17 kDa surface antigen"
FT                   /note="PFAM: 17 kDa surface antigen; KEGG: rlg:Rleg_3913 17
FT                   kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87398"
FT                   /db_xref="InterPro:IPR027367"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZY4"
FT                   /inference="protein motif:PFAM:PF05433"
FT                   /protein_id="ADH87398.1"
FT                   /translation="MLRIVAISAVALSLAACTTTQQRTAGGALIGAGTGAVIGGIAGGG
FT                   TGAAWGAGAGAVAGGVIGAATSPGDCYTYDRYGRRIAVRC"
FT   sig_peptide     49112..49189
FT                   /locus_tag="Snov_0061"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.495 at
FT                   residue 26"
FT   gene            complement(49475..50095)
FT                   /locus_tag="Snov_0062"
FT   CDS_pept        complement(49475..50095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0062"
FT                   /product="putative phage repressor"
FT                   /note="PFAM: Peptidase S24/S26A/S26B, conserved region;
FT                   KEGG: nwi:Nwi_0466 peptidase S24"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87399"
FT                   /db_xref="GOA:D6ZZY5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZY5"
FT                   /inference="protein motif:PFAM:PF00717"
FT                   /protein_id="ADH87399.1"
FT                   /translation="MLTHAQIWRAIDQLAERHGLSASALAKRAGLDPTTFNRSKREQPD
FT                   GRARWPSTESIAKILAATGASLDDFMALIGGGTRRAIPLIGFAQAGRGGYFDDAGFPVG
FT                   GAWDEIEFPNVGDEHAYALEIAGDSMLPLYRDGDVVVVSPAAATRRGDRVIVKTREGEV
FT                   MAKELKRRTAKTVELRSLNPEHADRVFQEGEIAWIARVLWASQ"
FT   gene            50227..51660
FT                   /locus_tag="Snov_0063"
FT   CDS_pept        50227..51660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0063"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase; KEGG:
FT                   smd:Smed_4423 pyridoxal-dependent decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87400"
FT                   /db_xref="GOA:D6ZZY6"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZY6"
FT                   /inference="protein motif:PFAM:PF00282"
FT                   /protein_id="ADH87400.1"
FT                   /translation="MLAKNEEREATRALLASAARHASAFRAADPLRHAPSFTYEEAVVA
FT                   FDGALSEEGEPAGEVLDDLVRRAGPGLSATTGPRFFGWVIGGSHPVGLAADWLTAAWGQ
FT                   NAANHVAAPAAAAAETVAARWLLDVLRLPEEASVGFVTGATMANFVGLAAARGEVLRRV
FT                   GWDVEEDGLAGAPPVRVVIGDDAHASVFSALQYLGFGRSNLIRVATDAQGAMRADAFER
FT                   ALPESGPVIVVTQAGQINTGAFDPHEAIVPLAKARGAWVHVDGAFGLWARACPKKADLA
FT                   AGVELADSWATDGHKWLQTPYDCGYAIVRDAEAHRRAMTIAASYLPPVSGTERDPSHYV
FT                   PELSRRARGFATWALLRHLGRAGVAAMVAANCEQARLMAELLRAEPGIAVLNEVVLNQV
FT                   LLRFGAEADDAAGDALTLATISAIQAEGTCFAGGAKWRGRWAMRISVSNAVTTQEDIRL
FT                   SAEAIIRCWRSVASSAARG"
FT   gene            51701..52054
FT                   /locus_tag="Snov_0064"
FT   CDS_pept        51701..52054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0064"
FT                   /product="protein of unknown function DUF952"
FT                   /note="PFAM: protein of unknown function DUF952; KEGG:
FT                   mrd:Mrad2831_0548 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87401"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZY7"
FT                   /inference="protein motif:PFAM:PF06108"
FT                   /protein_id="ADH87401.1"
FT                   /translation="MTDSLIYKIAPRALWQAAEAAGRFEGAPVDVADGFIHFSTSAQVA
FT                   ETAAKHFAGQDDLLLVAVRTERLDPALLRYEPSRGGDLFPHLYGPLDLQAVAWVRELPL
FT                   GPHGRHLFPAFEG"
FT   gene            52058..53149
FT                   /locus_tag="Snov_0065"
FT   CDS_pept        52058..53149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0065"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.98.1"
FT                   /note="TIGRFAM: dihydroorotate dehydrogenase; KEGG:
FT                   rpb:RPB_4622 dihydroorotate dehydrogenase 2; PFAM:
FT                   dihydroorotate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87402"
FT                   /db_xref="GOA:D6ZZY8"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZY8"
FT                   /inference="protein motif:TFAM:TIGR01036"
FT                   /protein_id="ADH87402.1"
FT                   /translation="MSALFDLALPFARLMDPENAHRLAIRALACLPPRAPEPDDARLKV
FT                   EAFGLRFPNPVGLAAGFDKEAEVPDAMLGAGFGFVEVGTITPRPQSGNPRPRNFRLTED
FT                   RAVINRYGFNSGGHGPAKARLIARKGKSRNSAGIVGVNVGANKETVDRAADYVAGIEAF
FT                   AGLGDYFTVNVSSPNTPGLRDLQEETALDDLLARCVEARDRHAPGVPLLLKIAPDLALP
FT                   HLDGVVEVAHRRRVDGLIVSNTTISRPPGLRSPHKGETGGLSGRPLFALSTRMLAETYV
FT                   RADGAFPIIGVGGIDSAETAFAKIEAGASLIQLYSGLVYEGLGLVPRIKAGLLARLAKE
FT                   HATLAEITGRRARQVVAEPFPGA"
FT   gene            complement(53146..54471)
FT                   /locus_tag="Snov_0066"
FT   CDS_pept        complement(53146..54471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0066"
FT                   /product="MATE efflux family protein"
FT                   /note="KEGG: rpe:RPE_0723 MATE efflux family protein;
FT                   TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87403"
FT                   /db_xref="GOA:D6ZZY9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZY9"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ADH87403.1"
FT                   /translation="MELALPGRVEVTSRRFLAIALPATLAQMTTPLLGLVATGAIGRLG
FT                   DAVLLGAVAVGALLFDFVFWIFGSLRMGTAGLTAQALGRGETVELRAVLIRALLISAAI
FT                   GIALILVHLPLAHVAFLAMGASAGVHEAAALYFSVRILSAPFAIGNFAVLGWLVGIART
FT                   DIGLGLQILIAGVNAAATALLVLYWDFGIAGAAAANVLAEFVGMLFGFGAALRLLGRDW
FT                   HVPWRTVLDRARLIETVAVNSDIMIRTGLLMLVLVFFTAQGARQDDVTLAANAVLYNMV
FT                   MVSAFFLDGFATAAEQICGQSIGAQDRPGFRRAVRMVLFWGFGFAAPASLLLLFGGGGL
FT                   IDLLSANPEVRLVGREFLPLAAATPLLGVAAFAYDGIYSGSTWARDMRNLMVPAVLLFF
FT                   LAWWLTLPLGNTGLWLAYLSFMAGRGIFLALRLPALERRTFA"
FT   gene            complement(54477..54746)
FT                   /locus_tag="Snov_0067"
FT   CDS_pept        complement(54477..54746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_1466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87404"
FT                   /db_xref="GOA:D6ZZZ0"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZZ0"
FT                   /inference="similar to AA sequence:KEGG:Xaut_1466"
FT                   /protein_id="ADH87404.1"
FT                   /translation="MAENQFSRWMGGSPFWVLLRLIALSVVVGVILSALGLDPMNILSS
FT                   LERLVRHLFNFGFDTVERLWRYFLLGAAIVIPLWLITRLANRGR"
FT   gene            complement(54751..56457)
FT                   /locus_tag="Snov_0068"
FT   CDS_pept        complement(54751..56457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0068"
FT                   /product="ATP dependent DNA ligase"
FT                   /note="PFAM: ATP dependent DNA ligase; ATP dependent DNA
FT                   ligase domain protein; KEGG: azc:AZC_0393 putative ATP
FT                   dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87405"
FT                   /db_xref="GOA:D6ZZZ1"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR026333"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZZ1"
FT                   /inference="protein motif:PFAM:PF01068"
FT                   /protein_id="ADH87405.1"
FT                   /translation="MNRFAALLDRLAYEPRRNGKIRLIADYFAHTPNPERGWALAALTG
FT                   ALSFRNAKPGLIRQLISERTDPVLFALSYDYVGDLSETVALMWPAPHGLNDTEPPALSA
FT                   IVHAFTHMGKAELPSVLASLLDRLDETGRWALLKLITGGLRIGVSARLAKTAVAALGER
FT                   TPDEIELVWPGLEPPYEALFAWAEGRGERPETDDPAPFRPVMLSHPLEDTDFESLDPAQ
FT                   FRAEWKWDGIRIQAVRGAGADGRHVTRLYSRTGEDISSAFPDLAEALAFDGAVDGELLI
FT                   LREGRVQSFNVLQQRLNRKVVSPKLILEFPAHIRAYDLLFEAGEDLRDLPFEARRARLE
FT                   ALIAAHPQDGRLDLSPIVPFESWDDLASARADPAAHGAGDDAEAVEGVMLKRVDSFYVP
FT                   GRPKGPWWKWKRDPHSVDAVLMYAQRGHGKRSSFYSDYTFGVWTGEKSGEGELVPVGKA
FT                   YFGFTDAELMEIDRFVRRNTVNRFGPVREVVHTPTEGLVLEVAFEGLARSTRHRSGLAM
FT                   RFPRIARLRWDKPPGEADRLETLERMIGDEGRAPRQPSAVIGKAPSSAEGA"
FT   gene            complement(56454..57512)
FT                   /locus_tag="Snov_0069"
FT   CDS_pept        complement(56454..57512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0069"
FT                   /product="putative mRNA 3-end processing factor"
FT                   /note="KEGG: xau:Xaut_1471 putative mRNA 3-end processing
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87406"
FT                   /db_xref="InterPro:IPR026360"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZZ2"
FT                   /inference="similar to AA sequence:KEGG:Xaut_1471"
FT                   /protein_id="ADH87406.1"
FT                   /translation="MRPEELLHSTPQGLYSPAGDFFIDPTRPVPRALITHGHSDHARAG
FT                   HGAVMATRQTLDIMAIRYGEGFAGTTQAAEYGERVEVNGVGVTFHPAGHILGSAQIALD
FT                   HKGCTIVASGDYKPGADPTAAPFEPIRCTIFISEATFGLPVFRHPDPAEETAKLTASLA
FT                   LFPERAHLVGAYALGKAQRVMALLRAAGHEKPILIHGAMERLTDYYQSQGIDLGDIRLA
FT                   REVKPAELAGSVVICPPSAMTDLWSRRFPDPVTAFASGWMRIRARARQNGVELPLIISD
FT                   HADWDDLQDAILATGCEELWVTHGQEDALVHWALLAGLRARPLHMVGYGEEEAETTAAP
FT                   DTSATESPEAQP"
FT   gene            57591..58526
FT                   /locus_tag="Snov_0070"
FT   CDS_pept        57591..58526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0070"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Tetratricopeptide
FT                   TPR_2 repeat protein; KEGG: azc:AZC_0395 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87407"
FT                   /db_xref="GOA:D6ZZZ3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZZ3"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADH87407.1"
FT                   /translation="MSAGRLILSSGDPTVDRRIEWARALMEEGKAADAAELLGEAMERA
FT                   GAYAPGWFLLGEAREASGDIAGALDAYRQAQALDAGDRLGSGLRLARLGGASDAEAGMS
FT                   EAYVRTLFDQYAGRFDAALARLDYRGPELIDDALAAACVALGRAYAFARGLDLGCGTGL
FT                   VALRLAEHVGALEGVDLSPNMIAEAKKRGVYEVLVAGEMVAFLAGRPSEDADLIFAGDA
FT                   FCYLADLHPILAETRRVLEPGGLIAFTVETHEGEGILLRDTLRYAHAESYVRAALAAAG
FT                   LELVSCVAESTRKEKEQPVPGLVVVGMRAD"
FT   gene            58653..58763
FT                   /locus_tag="Snov_0071"
FT   CDS_pept        58653..58763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0071"
FT                   /product="metallophosphoesterase"
FT                   /note="KEGG: oca:OCAR_5169 metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87408"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZZ4"
FT                   /inference="similar to AA sequence:KEGG:OCAR_5169"
FT                   /protein_id="ADH87408.1"
FT                   /translation="MKQKTVMAGLDPAIHVFLPAPGPKAWMPGSSPGMTV"
FT   gene            58816..61347
FT                   /locus_tag="Snov_0072"
FT   CDS_pept        58816..61347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0072"
FT                   /product="DEAD/H associated domain protein"
FT                   /note="KEGG: azc:AZC_0109 helicase; PFAM: DEAD/H associated
FT                   domain protein; DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87409"
FT                   /db_xref="GOA:D6ZZZ5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZZ5"
FT                   /inference="protein motif:PFAM:PF08494"
FT                   /protein_id="ADH87409.1"
FT                   /translation="MDAARDDHLPEPFRSWFAGRGWAPRAHQLELLAKAREGRSTLLIA
FT                   PTGAGKTLAGFLPSLVELSERPRARNSVRPPGIHTLYISPLKALAVDVARNLERPADEM
FT                   ALPIRIETRTGDTPASRRQRQRRDPPDILLTTPEQIALLLASADAEHLFGDLRRIVLDE
FT                   LHALAGSKRGDLLSLGLARLRCLAPQAQTVGLSATVADPETLRRWLVPQAGDGAMGDVV
FT                   IAEAGAAPDLSMLDSVAQVPWAGHTARHSLKEIYALIEANTTTLVFVNTRMQAELLFQE
FT                   LWRINDANLPIALHHGSLDVSQRRRVEAAMGEGRLKAVVCTSSLDLGIDWGAVDLVINV
FT                   GAPKGSSRLMQRIGRANHRLDEPSRAVLVPANRFEVLECRAALEAVRAGAQDSAVERSG
FT                   ALDVLAQHVLGMACAGPFASDELYAEVTSAEPYAGLLRTDFDDVVAFVATGGYALRAYE
FT                   RFARIRKMKDGRWRVTNPMVAQQYRLNVGTIVEATMLKVRLASAKSRYGGRVLGEVEEY
FT                   FAEQLSPGDTFVFAGEVLEFLSIVEDEVRATRTSASEPKVPSYEGGKFPLSTFLASRVR
FT                   ALLAEPDRWSSLPGQVHEWLDLQKLRSRLPGRADLLVETFPRGGRHYLVAYPFEGRLAH
FT                   QTLGMLLTRRLDRARLRPLGFMANDYALAIYGISDMSRAIQQGRLDLDELFDADMLGDD
FT                   LEDWLAESSLMKRTFRKCAVIAGLIERRFPGKEKNSRQVTMSTDLVYDVLRRHEPGHVL
FT                   LRAARQDAATGLLDIRRLSDMLTRIRGRIDHVALPRVSPLAVPVMLEIGREMVAGEAHE
FT                   ALLAEAEDELVREAMDGADVSWDGAGGDRRG"
FT   gene            61340..62026
FT                   /locus_tag="Snov_0073"
FT   CDS_pept        61340..62026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0073"
FT                   /product="metallophosphoesterase"
FT                   /note="KEGG: azc:AZC_0115 metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87410"
FT                   /db_xref="GOA:D6ZZZ6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZZ6"
FT                   /inference="similar to AA sequence:KEGG:AZC_0115"
FT                   /protein_id="ADH87410.1"
FT                   /translation="MAEDGLVIAGARLVLDPAGALWWPAERMLIVADLHLEKGSSFAAR
FT                   GVPLPPYDTRATLALLTQIVARRNARTIVALGDSFHDRRGADRLGEEERASIAALMRGR
FT                   EMIWVAGNHDPNPMPGLGGVHVDELRAGPLTLRHEPSGDGAGEIAGHFHPVARLVVRGR
FT                   GLRRRCFATDGARLVMPALGAYAGGLNIRDAALARLFPGAYAAHLVGGARIYRIAHHAC
FT                   LPDRAG"
FT   gene            complement(62137..65139)
FT                   /locus_tag="Snov_0074"
FT   CDS_pept        complement(62137..65139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0074"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="KEGG: bja:bll1155 hypothetical protein; PFAM: Sel1
FT                   domain protein repeat-containing protein; SMART: Sel1
FT                   domain protein repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87411"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZZ7"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ADH87411.1"
FT                   /translation="MSEAAQRAGMPLEEWLKSQLFGTMAAAAPAPGAPDPVGSVADLQR
FT                   RIEQLSGQIEQMGGAAAAPAEPPPAPAPVKVDDRLETTIRELNERLEALNLMPPRAEAP
FT                   ATRAADPVEMAVAEIAARQHELDSEITRRRTPPAFEPPPRPASSAAPRESVARDSIRDR
FT                   FIRDPFAGGPFPTRANPVPPSPVPPSHPVAPSIAPSAPSRSPINEALSALQGELGDMRQ
FT                   SLGMLAPRRAVDELQRVVQQLADRVERSGTRDEELRATLLALRDMIGGLKLPEHPALLL
FT                   GRIDSLERKLDIVNAKAVDGATIARLQAQATEIRDLLARTLSADSVRLLAEQVSLLATK
FT                   VSEMAANEDRVIRSAVGSLERRLDTLADRIASQPAPVLPLNDLIGRLDSIQSSLASARH
FT                   EMPPGLEAMLRGLADRMERIERPEENLRLDVLGRQISELTQKIEKAVAGAEIAGQLASI
FT                   ERVVNDLFIQMEETRATFLATGSRPRPPAGGNPNGGATRIKREIAALEAEREAPPAAPV
FT                   ATAIMAPVEAAAPAVPEAVFSPPPASIPKPFEPQLMRAALEELSRSADVAALRGETAPA
FT                   PEAAAAPEQVATTPIDDEFDFRPVDLDAQAAANAAARGNAPTVPNVVHPAAPAAAPGAP
FT                   NRAAFIAQARRATLPAGAGTPELRSHITERNRRPPTRWLARIRAMLLIGLCGSALAYGS
FT                   WHFLAQMREQQLRAAAPAVSNTAKLPPAAKPTPPGSLPAPEDITGSVGKSAPRPQPPAP
FT                   AAAPEATPDAMPPAPAPIGPSSMSLPTELPGGIASQTLRAAALAGDPAAAFEIARRYTD
FT                   GEGVPASPARAAEWLAYAAKNGSMPATYRLGTIYEKGMDGVPRDPAKARQLYEQAANAG
FT                   NVAAMHNLGVMLASGAIGQPDYRTAVTWFTLAAERGVRDSQYNLAVLYARGFGVTANPA
FT                   EAWRWFALAAARGDGEAALKRDEMAVKVDAKTLATLRSTVDSWAPLMVDAKANDMPSVS
FT                   WDEVPRKTASR"
FT   gene            65627..66055
FT                   /locus_tag="Snov_0075"
FT   CDS_pept        65627..66055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0075"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: azc:AZC_0511 regulatory protein; PFAM:
FT                   Transcription regulator MerR DNA binding; regulatory
FT                   protein MerR; SMART: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87412"
FT                   /db_xref="GOA:D6ZZZ8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZZ8"
FT                   /inference="protein motif:PFAM:PF09278"
FT                   /protein_id="ADH87412.1"
FT                   /translation="MDFTSFEAERTADTHAAPSGENAFFTIGDLAREFGVTLRALRFYE
FT                   DKGLLAPRREGLTRLYSPAERSRLAIILKGKKLGFTLAEIKAMVALREGTAPAGGLALT
FT                   REKCVEQLALLETQKTEIEEAIGELRQMVAAFSSRSAA"
FT   gene            66179..66793
FT                   /locus_tag="Snov_0076"
FT   CDS_pept        66179..66793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0076"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: azc:AZC_0543
FT                   2-hydroxychromene-2-carboxylate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87413"
FT                   /db_xref="GOA:D6ZZZ9"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZZ9"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ADH87413.1"
FT                   /translation="MSRSIDYYFSIASPWAFIGHSPFLDVAKRHGARINFRPVFLGELF
FT                   ADTGGLPLARRHPARQRYRLVELKRWREARGLDFHLSPAHWPLDPAAADRLVIAAQIAG
FT                   HDVAPLVSRLTSGVWQRQENMADPAALGVVLAELGLPAELLEASAGDRTAVIYKANHDA
FT                   AVEADVFGSPAYVLDGEVFWGQDRIDMLERALSSGRAPFTP"
FT   gene            66822..67376
FT                   /locus_tag="Snov_0077"
FT   CDS_pept        66822..67376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_0271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87414"
FT                   /db_xref="UniProtKB/TrEMBL:D7A000"
FT                   /inference="similar to AA sequence:KEGG:Nham_0271"
FT                   /protein_id="ADH87414.1"
FT                   /translation="MRLTLIGAGLALAMLHPAQAQAPNIPPNGPPEAARFTMQPVEGGL
FT                   MKLDTSTGAMSFCSAKAGAWVCEAVPEDRAALEAEIARLQARIAVLEKSRAGTGTGGTG
FT                   TGVPDIMAPPSAEAPKDTPKDEPLGPPDAAKPAPKSEQELSEEARKRLDQAMDMVEQVF
FT                   RRFFDMVDQLRREEGAQDQKL"
FT   sig_peptide     66822..66884
FT                   /locus_tag="Snov_0077"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(67381..68373)
FT                   /locus_tag="Snov_0078"
FT   CDS_pept        complement(67381..68373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0078"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: xau:Xaut_1452 alpha/beta hydrolase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87415"
FT                   /db_xref="GOA:D7A001"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7A001"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ADH87415.1"
FT                   /translation="MSSPLPETRASSAAPLVVDPALFEEAAITPETRAINAGIVKALGA
FT                   VPDRWVFPMAMLRKLRLEGKGPFPLAPESSYAQVIEIDGPHGPVPLRILTPPTPPKGVY
FT                   LHIHGGGWCLGSARENDGLNHRFVERTGFAVVSVEYRLAPEEPWPRGPDDCEAAALWLM
FT                   HEGPARFGTDRFAIGGESAGANLSVAVLLRLRDKHGLTPFRAANLTAGAYDLGLTPSAR
FT                   QWGDEPLVLNTRDINVFVGHYLREGGDIALPDISPLQANLKDLPPALFTIGTRDALLDD
FT                   TLFMAPRWLKAGNAAELAIYPGGCHVFIGFPGSLADQALARSHAFVSAC"
FT   gene            68490..68954
FT                   /locus_tag="Snov_0079"
FT   CDS_pept        68490..68954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0079"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   rpb:RPB_4567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87416"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:D7A002"
FT                   /inference="protein motif:PFAM:PF01894"
FT                   /protein_id="ADH87416.1"
FT                   /translation="MARISRGELRESTVTRRFTAMLAVDTPGRGFTDITGAVADFLIAA
FT                   GASEGEVSVFCRHTSASLAIQENADPDVRVDLLTALDRLAPEDAGWAHDMEGPDDMPAH
FT                   VKAMLSGISLSVPVIGGRMALGTWQGLYLIEHRARPHQRELVVAFVGEAY"
FT   gene            69087..69755
FT                   /locus_tag="Snov_0080"
FT   CDS_pept        69087..69755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0080"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: azc:AZC_0572 regulatory protein; PFAM:
FT                   regulatory protein LuxR; response regulator receiver;
FT                   SMART: regulatory protein LuxR; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87417"
FT                   /db_xref="GOA:D7A003"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7A003"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADH87417.1"
FT                   /translation="MDTTTSFRLVIADDHPLFRGALREAVSRQFPQAELFEAGGFEDLQ
FT                   ALLEREGDLDLILLDLTMPGVRGFSGLMYLRAQYPGIPVVVVSANEEAGVIRNCMEFGA
FT                   SGFIPKTSAVETMREAVAAVLEGQTWTPPEVDLSGTSDKETQALVARLATLTPQQVRVL
FT                   MMLSEGLLNKQIAYELGVSEATVKAHVSAILQKLGVESRTQAVIAASKIEGGTWSQTAG
FT                   "
FT   gene            complement(69762..73334)
FT                   /locus_tag="Snov_0081"
FT   CDS_pept        complement(69762..73334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0081"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="KEGG: azc:AZC_3923 response regulator receiver;
FT                   PFAM: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; PAS fold-4 domain protein;
FT                   response regulator receiver; SMART: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87418"
FT                   /db_xref="GOA:D7A004"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7A004"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH87418.1"
FT                   /translation="MLQAWTIIAVALVYIGFLFAVASFGDRRLPRSRRRGRPYIYSLSL
FT                   AVYCTSWTFFGSVGLATTQGVNFLTIYIGPIFVFALGTPFLLRMVRLAKGQNITSIADF
FT                   VAARYGKSQGVAALVACVAIVGSLPYIALQLKAVSASLLAMLGDFDGLGLPYPVVGDLA
FT                   LTIAVAMAVFAVLFGTRHIDATEHQEGLMLAVATESIVKLVSFLAVGLFVVFGMFSGPF
FT                   DLLDQAAEKGVLPVLTQGISVGSWAAMTLLSALAILLLPRQFHVAVVENTSEQEIRTAS
FT                   WLFPLYLVLINLFVIPIAIAGLVAFPPGFIDGDMYVVTLPLSAGSHVMSLVAFVGGLSA
FT                   ATAMVIVETVALAVMVSNDIFMPLMVRGRRLRDAAEANRAAADGPPDTGADGQTDGHAD
FT                   MGRRLLTVRRIAIFAILLLAYLYYRVTGEAQLAQIGLLSFAAVAQFGPALLLGLVWRRG
FT                   TALGALAGIAAGIALWAYTLLLPSLVDAGLFTHALLQEGPFGLSMLRPQTLLGVQASPL
FT                   VHGVLWSLTINVLVFLAVSLMRKPTPIERLQASVFVESDHAPSAPSFRLWRSPVTVGEL
FT                   VSTVARYLGEERTRASFESISAMRGISLEPSREADFQLIRYAEHLLASAIGAASSRLVL
FT                   SLMLRKRTVSTKAALKLLDDASAAIQYNREILQTALDHVRQGIAVFDRDLRLITWNRQF
FT                   GEMLELPPEILRIGVSIDQIIRFNATGGQFGPGPVEEIVREKLDRYARRNVVFQERLTP
FT                   RGVVMEVRVNTMPDGGVVVTFTDITPSVEAAEALERANETLERRVRERTKALEKLNTQL
FT                   AQAKSEAEEANISKTRFLAAASHDILQPLNAARLYATSLVERSVAGEETRLARNVDASL
FT                   EAVEEILAALLDISRLDAGALKPDIAPFRLDEIFQQLELEFAPMAKEKGLELTFVPSAA
FT                   AVRSDRRLLRRLLQNLVSNAIKYTHKGRVLIGVRPRRGKLRVQVLDTGVGVPPGKQKLI
FT                   FKEFQRLDEGAKAARGLGLGLSIVERIARVLDHPISLSSTSGKGSVFTVELPAAPAMPA
FT                   RGQPSPRPAAPVATLQGLSVLCIDNDPAILDGMETLLTGWGCEVLKAPGLTEALAMLRE
FT                   HRAPPDVLLIDYHLDKGDGIDAAKQLRWKLGHSLPAVLITADRSKRVRDTARATEMEVL
FT                   NKPVRPAALRALLAACRATRAAAE"
FT   gene            73483..73911
FT                   /locus_tag="Snov_0082"
FT   CDS_pept        73483..73911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0082"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="KEGG: xau:Xaut_0055 large conductance
FT                   mechanosensitive channel protein; TIGRFAM: large
FT                   conductance mechanosensitive channel protein; PFAM:
FT                   large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87419"
FT                   /db_xref="GOA:D7A005"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:D7A005"
FT                   /inference="protein motif:TFAM:TIGR00220"
FT                   /protein_id="ADH87419.1"
FT                   /translation="MSKVLTEFREFAVKGNVVDLAIGVIIGAAFGQIVTSVVSDLFMPV
FT                   VGAIFGGLDFSNYFVGLSSQVTANNLTAAREQGAVFAYGHFLTVVINFLIVAWILFLVV
FT                   KGINRLRRNAANEPPPPAPPTKEEVLLTEIRDLLAKKV"
FT   gene            74140..74721
FT                   /locus_tag="Snov_0083"
FT   CDS_pept        74140..74721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0083"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="TIGRFAM: dTDP-4-dehydrorhamnose 3,5-epimerase; KEGG:
FT                   xau:Xaut_3548 dTDP-4-dehydrorhamnose 3,5-epimerase; PFAM:
FT                   dTDP-4-dehydrorhamnose 35-epimerase related"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87420"
FT                   /db_xref="GOA:D7A006"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7A006"
FT                   /inference="protein motif:TFAM:TIGR01221"
FT                   /protein_id="ADH87420.1"
FT                   /translation="MVAFTRLAIPDVVLVQPVRHGDGRGYFCETYKKPAFDAFGIDLAF
FT                   VQDNESLSRPVGVVRGLHFQTPPMAQAKLVRVLRGAIFDVAVDIRRGSPSYGKWVAATL
FT                   TAEEGNQLFMPHGFAHGFCTLEPDTLIAYKVDAPYSRPNDAGIAWDDPDLAIDWPVTTE
FT                   TAVLSDKDRVQPRLRDYASPFAYAPETVRA"
FT   gene            74724..75788
FT                   /locus_tag="Snov_0084"
FT   CDS_pept        74724..75788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0084"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="KEGG: azc:AZC_1833 dTDP-D-glucose-4,6-dehydratase;
FT                   TIGRFAM: dTDP-glucose 4,6-dehydratase; PFAM: NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87421"
FT                   /db_xref="GOA:D7A007"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A007"
FT                   /inference="protein motif:TFAM:TIGR01181"
FT                   /protein_id="ADH87421.1"
FT                   /translation="MTSIAQRVLVTGGAGFIGSAVVRRLVRQGRQVLTYDKLTYAGNLA
FT                   SLAEVHNLPGHSFLQADICDGRAFREALESFRPDLVMHLAAESHVDRSIDGPGDFIATN
FT                   IVGTYTLLDEALRYWRGLDAAAQKRFRFHHISTDEVFGTLGEDGLFREDTPYQPNSPYS
FT                   ASKAASDHLVRAWFHTYGLPVVMSNCSNNYGPYHFPEKLIPLTILNALEGAPLPVYGKG
FT                   ENVRDWLYVEDHAAALELIATRGRLGESYNVGGSNERRNIDVVRTICAIMDRVVPDAKI
FT                   GPRDALIRFVTDRPGHDARYAIDASKLKTELGWVPEHDFESGIEKTVRWYLDNAAWWEP
FT                   LKARYNRARLGVAK"
FT   gene            75785..76678
FT                   /locus_tag="Snov_0085"
FT   CDS_pept        75785..76678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0085"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="TIGRFAM: dTDP-4-dehydrorhamnose reductase; KEGG:
FT                   azc:AZC_1832 dTDP-4-dehydrorhamnose reductase; PFAM:
FT                   dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87422"
FT                   /db_xref="GOA:D7A008"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A008"
FT                   /inference="protein motif:TFAM:TIGR01214"
FT                   /protein_id="ADH87422.1"
FT                   /translation="MTRVLLLGAGGQVGREIAALAPGRVESLTALDHAGLDITDASALK
FT                   AALEQYRPQVVINAAAYTAVDKAESEPEKANLINAVAPGLIAQACASHGAGLIHISTDY
FT                   VFDGTKAGAYVESDPVAPLGVYGASKEAGERAVRDSLDRHLIVRTSWVYGVHGANFLKT
FT                   MLRLAETRDRLTVVADQTGCPTATRDIAEGLLTAAMQLATADVTPGTYHLAGTGVTTWH
FT                   GFASVIVAHAARHTGRHVEVAPITTADYPTPARRPANSELSSALFARTVGYEAAPWQLR
FT                   AAEVVDALFAAKQEAP"
FT   gene            76675..77547
FT                   /locus_tag="Snov_0086"
FT   CDS_pept        76675..77547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0086"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="KEGG: azc:AZC_1831 glucose-1-phosphate
FT                   thymidylyltransferase; TIGRFAM: glucose-1-phosphate
FT                   thymidylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87423"
FT                   /db_xref="GOA:D7A009"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7A009"
FT                   /inference="protein motif:TFAM:TIGR01207"
FT                   /protein_id="ADH87423.1"
FT                   /translation="MKGIILAGGSGTRLHPITLVVSKQLLPVYDKPMIYYPLTTLMMAG
FT                   IREILIITTPHDSALFRKLLGDGSQFGLSLSYAVQESPRGLADAFIVGRDFVGDERVAL
FT                   VLGDNLFFGHGLPELLGAAVARETGATVFGYPVKDPERYGVVEMTAAGRVTSIEEKPAK
FT                   PKSNLAVTGLYFYDNRVVDIAANLKPSPRGEIEITDVNRAYMEWGELNVSLMGRGFAWL
FT                   DTGTPDSLLEAAQFVQILETRQGLRIAAPEEVAFRAGFIDAAQLTKLGEAQSKSNYGAY
FT                   LMKLAEDGF"
FT   gene            77672..78880
FT                   /locus_tag="Snov_0087"
FT   CDS_pept        77672..78880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0087"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   xau:Xaut_0300 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87424"
FT                   /db_xref="GOA:D7A010"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7A010"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADH87424.1"
FT                   /translation="MPASLAPSFTPSPLVDHVRPQALALPESGIVEVFNYGRTREGLIP
FT                   LWAGEGDLPTPSFIAEAATRSLAAGETFYTWQRGIPDLRAAIASYMTRLYGVAEDPERY
FT                   FVTGSGMHAVQVALALTVSAGEEVIIPSPEWPNIAAAAEAAGARPVYVPFSFDAGRGFR
FT                   LDLDRLESAVTPRTRAIFINTPANPTGYVASLDELRGVLDIARRHGLWIIADEIYGRFY
FT                   YAAGEGGLAPSFHSIMEPEERILFVQTFSKNWAMTGWRVGWLEAHPSLGDVIENLIQYS
FT                   NSGVAAFMQRAGVAALERGESFVAHQIERAKRGRDIVAEGLASSNRVRFAQPEGAFYMF
FT                   FGVEGEDDTRQLALKLVDEANIGLAPGTAFGPGGEEYIRLCFARGEAQVAEATDRLVRW
FT                   LKR"
FT   gene            78943..80094
FT                   /locus_tag="Snov_0088"
FT   CDS_pept        78943..80094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0088"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold domain protein;
FT                   histidine kinase A domain protein; KEGG: mea:Mex_1p1833
FT                   PAS/PAC sensor signal transduction histidine kinase
FT                   (fragment); SMART: ATP-binding region ATPase domain
FT                   protein; PAS domain containing protein; histidine kinase A
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87425"
FT                   /db_xref="GOA:D7A011"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7A011"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADH87425.1"
FT                   /translation="MREFSSPPGPLPPPTVSEARLLSVLDTAADGIIVIDEHARILIFN
FT                   KACEKMFGIAAAEAIGQNVRIVMPIEYAREHDEYLGSYIRTGVKKIIGIGREVRGRHID
FT                   GTIFPLELSVGEAATPDGRQFIGILRDLRPRKESEQRLADLQSELVHLARVSAIDEMGA
FT                   AIAHELNQPLTALMLYLQAIRRAHAKGVDIVKVVGEILDKAAGEAERAGHIIQRMRQFV
FT                   EKREPERHVRELDPLIDEAIDLTLLGQRHRIRIDRKQGTNLPPVSVDPVQVQQIVVNLV
FT                   RNAIEAAAGMTDPAIHIRTRSADGTVVLEVQDNGPGIAPEALSKLFEAFASSKRRGMGL
FT                   GLAISRTIAQNHGGDLLVDPGGNGRGACFSLVLPAAAAPAEVG"
FT   gene            80106..80723
FT                   /locus_tag="Snov_0089"
FT   CDS_pept        80106..80723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0089"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: bbt:BBta_0530 two component LuxR family
FT                   transcriptional regulator; PFAM: response regulator
FT                   receiver; regulatory protein LuxR; SMART: response
FT                   regulator receiver; regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87426"
FT                   /db_xref="GOA:D7A012"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7A012"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH87426.1"
FT                   /translation="MAQLGEVFIVDDDSAVRDALSLVLSLEGYHVRSFSDGAAFLSVAR
FT                   THVPACIVLDVHMPGRSGLDILKELEADRYPAPIFIISGQGDIPMAVDAIRHGALDFIE
FT                   KPFDADTVVERVRDAIEAHSRRGSSEPGDLLTAHFPGHEMLTPREREVLVQIASGASNK
FT                   EAGRKLGISPRTIEVHRARIMEKLGAKNAADLVRIVLKDMRA"
FT   gene            80824..81171
FT                   /locus_tag="Snov_0090"
FT   CDS_pept        80824..81171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0090"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: met:M446_6109 two component LuxR family
FT                   transcriptional regulator; PFAM: response regulator
FT                   receiver; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87427"
FT                   /db_xref="GOA:D7A013"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D7A013"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH87427.1"
FT                   /translation="MRVHVVEDDAGVSDSLSLILGNVGHKVIAYPDAESLFKAPPPEGR
FT                   DAVIVDLSLPGIPGAQLVRWLLNLATPPRVMVITGQSQSFIDHQLRGLKPTWLVRKPLD
FT                   ADTITRVLPAE"
FT   gene            81267..81908
FT                   /locus_tag="Snov_0091"
FT   CDS_pept        81267..81908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0091"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="KEGG: oan:Oant_2634 CRP/FNR family transcriptional
FT                   regulator; PFAM: regulatory protein Crp; cyclic
FT                   nucleotide-binding; SMART: regulatory protein Crp; cyclic
FT                   nucleotide-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87428"
FT                   /db_xref="GOA:D7A014"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A014"
FT                   /inference="protein motif:PFAM:PF00325"
FT                   /protein_id="ADH87428.1"
FT                   /translation="MRQIVEERTGSPTRQPSYAEPHHPGLRVATHVTVLHEGDPARRIM
FT                   EVVEGAVMLTKLLPDGRRQVVELLGPGDVFGLAHDDAYACSAETLTPATIATHERSALE
FT                   RDPVLASRLLRRFEAQLCVMHSHALVLGRMSALERVAFFLLRLMPEGMVGGTLHLSMTR
FT                   QEIADFLGLTLETVSRAFSELKRRGFVALQRADEVRIQDRGSMRRLAGAL"
FT   gene            complement(82017..83336)
FT                   /locus_tag="Snov_0092"
FT   CDS_pept        complement(82017..83336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0092"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /note="SMART: Elongator protein 3/MiaB/NifB; TIGRFAM:
FT                   oxygen-independent coproporphyrinogen III oxidase; KEGG:
FT                   mno:Mnod_2110 oxygen-independent coproporphyrinogen III
FT                   oxidase; PFAM: HemN domain protein; Radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87429"
FT                   /db_xref="GOA:D7A015"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:D7A015"
FT                   /inference="protein motif:TFAM:TIGR00538"
FT                   /protein_id="ADH87429.1"
FT                   /translation="MHSSTLLHAERAVPRYTSYPTAPHFTGDVGPQNHAAWLSTLDTGA
FT                   NLSLYLHVPFCPALCFYCGCTTKATRRPEPVAAYVARLEREIEFVAAHAGGRTVTHIAW
FT                   GGGTPSLVGGKALRRLYDRISEAFDLDRLTEHAFELDPREVDEEIADALAAIGVDRVSL
FT                   GVQDFSAHVQRAIGRVQPFGTVERAVRLLREAGVSSVNLDLMYGLPHQSERDVRRTARL
FT                   ATLLGPERLALFGYAHVPWMRPNQKMIDEKDLPGAAERLQQAEAAREVLLANGYAAVGL
FT                   DHFARPNDPLARAAAAGHLHRNFQGYTVDAADALIGLGASSISRFPQGFTQNAPDAASY
FT                   MRAVDAGRFATARGIAFTPEDVARGAYIERLMCDLQVDLDTPTFDEAAPRLASLAADGL
FT                   VTIEGHHVAMTATGRPFVRLAAAALDARLQQTTARHSAAV"
FT   gene            83438..84550
FT                   /locus_tag="Snov_0093"
FT   CDS_pept        83438..84550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0093"
FT                   /product="membrane protein AbrB duplication"
FT                   /note="KEGG: xau:Xaut_0301 putative ammonia monooxygenase;
FT                   TIGRFAM: membrane protein AbrB duplication; PFAM: putative
FT                   ammonia monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87430"
FT                   /db_xref="GOA:D7A016"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:D7A016"
FT                   /inference="protein motif:TFAM:TIGR03082"
FT                   /protein_id="ADH87430.1"
FT                   /translation="MLLPPFLTRLTPTRRLVWLAATLVIAFAGGGFFAWLAMPAGWLSG
FT                   ALVATGIAALAGAPVGVERNIRLATYILLGTSMGSAVTPDTLHGITTWPVTMLVLIVSV
FT                   PVMMVAVVFYLERIAGWDRRSAFFAAAPGALSTVLVMAETSGADTRRVVFGQSIRLFIL
FT                   VTLLPPTLGGFGHEPAGTLPINPVVPDLATALLSIGVGIAGAFIAERIRFPGGAMVGAM
FT                   LASALVHGFGLIEGRLPDIFLIIGFVVLGANTGSRFAGTKIRTLRHFLVDSMVALAIAT
FT                   LVALAFAFLGSWLAGEPFTKVLLAYVPGALEAMTIMAFVLGLDPAFVAAHHLTRFLGLA
FT                   LAIPLVTRMFFGRAAIPSENVEIDQTEPKD"
FT   sig_peptide     83438..83548
FT                   /locus_tag="Snov_0093"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.935) with cleavage site probability 0.417 at
FT                   residue 37"
FT   gene            complement(84554..85780)
FT                   /locus_tag="Snov_0094"
FT   CDS_pept        complement(84554..85780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0094"
FT                   /product="5-aminolevulinic acid synthase"
FT                   /EC_number="2.3.1.37"
FT                   /note="TIGRFAM: 5-aminolevulinic acid synthase; KEGG:
FT                   xau:Xaut_2126 5-aminolevulinate synthase; PFAM:
FT                   aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87431"
FT                   /db_xref="GOA:D7A017"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7A017"
FT                   /inference="protein motif:TFAM:TIGR01821"
FT                   /protein_id="ADH87431.1"
FT                   /translation="MDYARFFQNAVDTLKQERRYRTFAEIERDSARFPHAVWHSPQGAR
FT                   DIVIWCSNDYLGMGCHETVVEAMCATARQAGAGAGGTRNISGNSHAIVELEAELADLHG
FT                   KDAALVFTSGYVSNQTGISTLAKLIPDCLVLSDALNHNSMIEGVRQAGRDKQIFRHNDL
FT                   AHLEELLKAAGDRPKLVVFESVYSMDGDVAPIGAICDLAERYNAMTYLDEVHAVGMYGP
FT                   RGAGVAERDGVMHRVDVIEGTLGKAFGVVGGYITASRAIVDAVRSYAPGFIFTTALPPA
FT                   VAAAAAASVRHLKASGTERTRQQAQVAKVKRALDLAGLPQIVTDTHIVPVMVGDAEACK
FT                   AASDMLLADHGIYIQPINYPTVPRGSERLRITPGPFHDDALVAQLAHALVDVWSRLGLP
FT                   FVTRAEAAE"
FT   gene            complement(85930..86433)
FT                   /locus_tag="Snov_0095"
FT   CDS_pept        complement(85930..86433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rhi:NGR_b03860 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87432"
FT                   /db_xref="UniProtKB/TrEMBL:D7A018"
FT                   /inference="similar to AA sequence:KEGG:NGR_b03860"
FT                   /protein_id="ADH87432.1"
FT                   /translation="MHRGHDHHHHDHGAGGHSHSHSHSHAHHAAPNHGHSPRPAAQWQT
FT                   PHLPEPPEDSDHAHVETDIDLVEKAFVEGFAGASDPTSFLRLANVPFDAITTDGTRVSL
FT                   LRVETDEVTDVGAVMPHLGGGSFRYDPLPAQMVSRRKRLRFVYFDGRQTLPLTLAEVRT
FT                   LAQT"
FT   gene            complement(86575..87795)
FT                   /locus_tag="Snov_0096"
FT   CDS_pept        complement(86575..87795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0096"
FT                   /product="Arginase/agmatinase/formiminoglutamase"
FT                   /note="PFAM: Arginase/agmatinase/formiminoglutamase; KEGG:
FT                   rhi:NGR_b03870 putative SpeB,
FT                   arginase/agmatinase/formimionoglutamate hydrolase, arginase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87433"
FT                   /db_xref="GOA:D7A019"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:D7A019"
FT                   /inference="protein motif:PFAM:PF00491"
FT                   /protein_id="ADH87433.1"
FT                   /translation="MRHFPEPTAPQRSTRVAGLRPAPSRLRRHHPNFEIREMQGWRSLE
FT                   AEEKLSENGWRKEQQWALDMGLPGADSITDKSIPTFARGELPHFAGINTFLKAPYVENV
FT                   RDVGKYDAAVLGIPFDSGTTYRPGTRFGPQGIRRISALYTPYNYELGIDLREQMTLCDA
FT                   GDVFTIPANLEKSFDQISKGVSHVFSSGALPIMLGGDHSIGFPCVRGIAECTSKRIGII
FT                   HFDRHIDIQEKDLDERMHTTPWYWATNLPNVSPKNLVQLGIGGWQVPRYGVQEARKRGT
FT                   NVLTIDDIEKIGLEKTAEIALELAWKDADAVYISFDVDSIDCGFVPGTGWPEPGGFLPR
FT                   EALKILGLVAAEGLCGLEVVEVSPPYDTSDITALFGLRVVVEALGSMVAHGKLGSHRHM
FT                   IDKPVSF"
FT   gene            complement(88095..88718)
FT                   /locus_tag="Snov_0097"
FT   CDS_pept        complement(88095..88718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0097"
FT                   /product="HupE/UreJ protein"
FT                   /note="PFAM: HupE/UreJ protein; KEGG: msl:Msil_3747
FT                   HupE/UreJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87434"
FT                   /db_xref="GOA:D7A020"
FT                   /db_xref="InterPro:IPR007038"
FT                   /db_xref="UniProtKB/TrEMBL:D7A020"
FT                   /inference="protein motif:PFAM:PF04955"
FT                   /protein_id="ADH87434.1"
FT                   /translation="MSNFVPSGVRRHATRGALAALLALSPSLAFAHPGHGGAVGFSHGF
FT                   LHPIGGLDHVLAMVAVGIFAANLGGRALWAVPATFVALMATGGALGMYGVAVPFVEISI
FT                   AASVIVLGSAVALGWKNWPLGAAMALVGFFAVFHGHAHGAEMPADASALTYAAGFMLAT
FT                   ALLHVAGIGAGIAIGKAGANAPRLTQALGAVVAVAGVGLLTGVI"
FT   sig_peptide     complement(88623..88718)
FT                   /locus_tag="Snov_0097"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 32"
FT   gene            complement(88875..89540)
FT                   /locus_tag="Snov_0098"
FT   CDS_pept        complement(88875..89540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0098"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="TIGRFAM: uracil phosphoribosyltransferase; KEGG:
FT                   hna:Hneap_0843 uracil phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87435"
FT                   /db_xref="GOA:D7A021"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:D7A021"
FT                   /inference="protein motif:TFAM:TIGR01091"
FT                   /protein_id="ADH87435.1"
FT                   /translation="MNAPTVLTDVALPPTTIVVDHPLIQHKLTLMRRSRTPANEFRLLL
FT                   REISMLLAYEVTRDMPTELIEIETPLATMQAPILSGKKLCLVSVLRAGGGILEGMLEIL
FT                   PAARVGHVGLYRDPVSLQAVEYYLKLPRDISERTAIVLDPMLATGNSAVAAVSEVKAAG
FT                   CQSIKFVCLIAAPEGLKVMHEAHPDVTVYAAAVDSHLNDHGYIVPGIGDAGDRIFGTK"
FT   gene            89756..91024
FT                   /locus_tag="Snov_0099"
FT   CDS_pept        89756..91024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0099"
FT                   /product="GTP cyclohydrolase II"
FT                   /note="PFAM: GTP cyclohydrolase II; KEGG: reh:H16_B1597
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87436"
FT                   /db_xref="GOA:D7A0S6"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR022163"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0S6"
FT                   /inference="protein motif:PFAM:PF00925"
FT                   /protein_id="ADH87436.1"
FT                   /translation="MSVNANAGGRSRNHIVLTSHGAPTGVAADAPSLNWGAPTPAERGP
FT                   VVATLTDPKRRNAIGAHAGGYSVYRALAIAAGALPADFRADLTNTAPSDAIGPHPQWGD
FT                   PKAIVSLDPYGHMVGEAFAGEIAAGLDVRPTIAITRAHIDMPEIRDAIRAGRLAIDGDI
FT                   IGPKGDVRVTKAAIEPVWYLPGIAERFGVSEGALRRALFEHTGGMFPELVTRGDLKVFL
FT                   PPIGGMTLYMFGDPSKIGDGITPLACRVHDECNGSDVFSSDICTCRPYLAHGIEICVEM
FT                   AQKGGVGLVVYNRKEGRALGEVTKFLVYNARKRQEGGDLPETYFKRTECVAGVQDMRFQ
FT                   ELMPDVFHWLGIKRIDRFASMSDMKFNALARAGIEVVERVPIPDELIPSDARVEMEAKV
FT                   SAGYYGVGFQSQFDATQGRALEE"
FT   gene            91184..92413
FT                   /locus_tag="Snov_0100"
FT   CDS_pept        91184..92413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0100"
FT                   /product="protein of unknown function DUF1688"
FT                   /note="PFAM: protein of unknown function DUF1688; KEGG:
FT                   bja:blr7238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87437"
FT                   /db_xref="InterPro:IPR012469"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0S7"
FT                   /inference="protein motif:PFAM:PF07958"
FT                   /protein_id="ADH87437.1"
FT                   /translation="MTPPELVALRSPAAVRARCHQVLDYVRVGHSPHFTVDEAALDGVA
FT                   DYVAQVTRQAYPTLDIPYHSRWRHFDAGGVDRWAALEGRLEGADKAERARVMIDLAVVS
FT                   VLLDAGAGDAWRYREEATGLTVTRSEGLAVASLRMFEVGGFSSDPKVPLRADAKALIGL
FT                   DAATLAKQFQVSDDNPLVGVSGRVALINRLGNALAARPDLFGTEVPRPGGLYDALLPKA
FT                   KIGRLPAPAILGALLDGLSSIWPSGLDVEGVALGDVGRHPAVRVADLSDQLVPFHKLSQ
FT                   WLTYSLLEPFEAAGLAVTELDELTALPEYRNGGLLVDLEVIVPRQPIDPAQKHPVSSEL
FT                   VVEWRALTVALMDLLAGRVRERLGLDASQFPLAKLLQGGTWSAGRRIAAERRPPAGPPP
FT                   IAIDADGTVF"
FT   gene            complement(92417..93379)
FT                   /locus_tag="Snov_0101"
FT   CDS_pept        complement(92417..93379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ret:RHE_CH03508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87438"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0S8"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ADH87438.1"
FT                   /translation="MHRVLFAAAAAVLLSLSSAGAQDFPNRPVTLDIPFPAGGSTDLVG
FT                   RLIGEGMSADLGQPVIIENRGGGGGSLGTAHLAKQPPDGYAVMMGTVSTHALNPALYRN
FT                   LPFDPVKSFAPVSLLVIVPNALVVHPSFPANTVEEFIALLKANPGKYSYASAGNGTPGH
FT                   LSGELFKTMAGVDMQHIPYQGAGPALVDVISGQVPIMFDNLPTASGYIKSGKLKTLGVT
FT                   TLKRAPSFPDLPAVAETLPGYETYSWNALFAPAGTPPAIVAKLNQAANKALATPKVQAR
FT                   LADFSAVSVGSTPQELEAHVKAELAKWAPIVKASGAQLD"
FT   sig_peptide     complement(93314..93379)
FT                   /locus_tag="Snov_0101"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.974 at
FT                   residue 22"
FT   gene            complement(93631..94593)
FT                   /locus_tag="Snov_0102"
FT   CDS_pept        complement(93631..94593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ret:RHE_CH03508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87439"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0S9"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ADH87439.1"
FT                   /translation="MLRSLFAAAVTAVLAAGGAAAQDFPTRPITMVIPFPAGGSTDLVG
FT                   RLIAERMTAELGQPVVVENKGGAGGNLGAAQVAKASPDGYTILMGTVATHALNPALYKK
FT                   MPYDPVKSFAPVSLLAIVPNVLVVNPEFPAKTTEELIALLKANPGKYSYASSGNGTPLH
FT                   LSGELFKSLAGVDMQHIPYQGAGPALIDVISGQVPIMFDNLPSSSGHIKSGKLRALGVT
FT                   TAKRAPSFPDLPAIAEVVPGYETYTWNALFAPAGTPPEVVAKLNAAANKALTDPKVQAR
FT                   FNDFSATPVGSTPEELGEHVKKEIAKWAPIVKATGAQLD"
FT   sig_peptide     complement(94528..94593)
FT                   /locus_tag="Snov_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            94956..96062
FT                   /locus_tag="Snov_0103"
FT   CDS_pept        94956..96062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0103"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: mlo:mll8445 ABC-transporter ATP-binding
FT                   protein; PFAM: ABC transporter related;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87440"
FT                   /db_xref="GOA:D7A0T0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0T0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87440.1"
FT                   /translation="MSKGADIELIQVTKRYGTALAVDAVSLKVPAGTYCCLLGPSGCGK
FT                   TTTLRMIAGHESITEGDIRLGASVVSDLPPAKRGTAMMFQSYALFPHLDIVDNVAFSLK
FT                   MKGVDKATRRAKALEMLKLVQMDHLAERRPAQLSGGQQQRVALARALITDPQALLLDEP
FT                   LSALDPFLKVKVRQELKKLQLQLGISFIHVTHSQEEAMALSDLVVVMNGGRIEQAATPR
FT                   EVFNRPATAFVARFMGDHNVIAGRVTEAGSETVTFEVPGGASFKAPRTSQFAPGLEPGA
FT                   PVEIAVRTDRVKLGAGLEPGCGLTGLVQNIEYHGQKVQVALAAPGIDEFSVQVPETAFF
FT                   AAPLSVGDAVPLTWTPQDVHILEASPSA"
FT   gene            96119..97426
FT                   /locus_tag="Snov_0104"
FT   CDS_pept        96119..97426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0104"
FT                   /product="ABC transporter, binding protein"
FT                   /note="KEGG: rhi:NGR_b12830 ABC transporter, binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87441"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0T1"
FT                   /inference="similar to AA sequence:KEGG:NGR_b12830"
FT                   /protein_id="ADH87441.1"
FT                   /translation="MSKNTSDRIGASGAKGISRRNVLKGAAAFSGVAAGSGAITGFPTI
FT                   WAQNPITLRQFGTGVSNLNAIAEKCKADLGITLQMTALDSDAVSQRVVTQANSFDIADI
FT                   EYWICKKVFAAGTLQPMDVKKIKYYDQIVPIFTTGKLTPESKIAQGTAPSTVGFVEGPD
FT                   SKKFAKEPTQWMTLIPTIYNADTLGIRPDLVGRPIKNWKDILDPAFKGKTSILNIPSIG
FT                   IMDAAMICESAGLIKYADKGNMTKKEIDFTIDFLIKTKKAGQFRAFWKTFDESVNLMAS
FT                   GEVVIQSMWSPAVAAVRSKGIPCVYQPLEEGYRAWGGGLGMAKHLKGAQLDAAYEYINW
FT                   YLSGWVGAYLNRQGYYSAVLSTAEKNMTPDEWAFWMLGQPAKADILSPEGKVMYTAGAV
FT                   RDGGSFEQRMGAVACWNSVMDEDRYMVRRWNEFIAA"
FT   gene            97580..98431
FT                   /locus_tag="Snov_0105"
FT   CDS_pept        97580..98431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0105"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: avi:Avi_6277 ABC
FT                   transporter membrane spanning protein
FT                   (spermidine/putrescine)"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87442"
FT                   /db_xref="GOA:D7A0T2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0T2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87442.1"
FT                   /translation="MTLSRIAPYLQAAPLTLILTAFLVLPIATIVMVSFWDYDSIQIFP
FT                   AFVFTNYEETITSPVTWNTYLNTLKYTGIVWAVTLFIGFWVAYYLAFHIRSATTQMVLF
FT                   LVCTIPFLTSNIIRMISWIPFLGRNGLLNQTLMTMGVIDQPLEFLLFSDFAVVLAMVHL
FT                   YTLFMVTPIFNTLMRIDRALIEAARDAGANALQILTNVIIPLAKPGIAIGSIFVVTLVM
FT                   GDFITVRFMSGGQSASVGLMMANQIALLQYPAAAANAVILLVLVLLLVGGILRIVNIRR
FT                   EL"
FT   gene            98435..99265
FT                   /locus_tag="Snov_0106"
FT   CDS_pept        98435..99265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0106"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: atc:AGR_L_3448 hypothetical
FT                   ABC transporter permease protein YdcV"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87443"
FT                   /db_xref="GOA:D7A0T3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0T3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87443.1"
FT                   /translation="MNSEKRGPGFYVLTAFFVLFVLFLYGPLTTIFILSFQGPNGGLTF
FT                   PMNGVSLRWFNNLLFEQQAVGDFGGAFTRSLVLGIMTMLTTVVVSLLAGLAFRRRFLGS
FT                   GPLFYLTIASLIVPSILISLGIGLAFNVLGLETAWYSSAFGAHLTWTLPFGLLIMFAVF
FT                   NRFNPAYEEAARDLGASPWQTFAHVVLPIILPSLIGVGLFGFTLSYDEFARTLMTSGTF
FT                   NTLPLEIYGMTTNVTTPVLYALGTVTTVFSMGVIILALVTIAVLRKRRARRVAG"
FT   gene            99431..99652
FT                   /locus_tag="Snov_0107"
FT   CDS_pept        99431..99652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0107"
FT                   /product="magnesium transporter"
FT                   /note="KEGG: sil:SPO2955 magnesium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87444"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0T4"
FT                   /inference="similar to AA sequence:KEGG:SPO2955"
FT                   /protein_id="ADH87444.1"
FT                   /translation="MNICTTDRTICDLLKEVAKDDRKHALTIKLRSGDLVTAYGPIEVA
FT                   DRFMLCRLHDNNYDGSQLIALDTIEFIR"
FT   gene            99700..100014
FT                   /locus_tag="Snov_0108"
FT   CDS_pept        99700..100014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0108"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87445"
FT                   /db_xref="GOA:D7A0T5"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0T5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87445.1"
FT                   /translation="MRPTVSVPQNGGIRWLGMSTRDTPEARRKIVRLYLLLALPAFAFC
FT                   YVLAAIQGANGRLSALLGTIALAGCLVCAAAYHLLGPSSKQLLYVAAGVLALVTFFVAR
FT                   "
FT   gene            100172..101230
FT                   /locus_tag="Snov_0109"
FT   CDS_pept        100172..101230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0109"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: rpf:Rpic12D_4103 transcriptional regulator,
FT                   AraC family; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87446"
FT                   /db_xref="GOA:D7A0T6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0T6"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADH87446.1"
FT                   /translation="MTETANSELLAPIAADPRVQHIVMDSGTLPQKEAIALWQESLGVF
FT                   YDVRLRNKADRFSFRADAYHLGEILLTGYSCVAQSFDRTRARIGRDGLDHITLQVCLRG
FT                   SHGRRDGGAADQANAGDLIIADLAQAQATATTDHDSLSLTIPRRLLAPLLKTPDEHNLR
FT                   RIPGNAPLAALLRNHLTGLYAGAGAMTADEAEAIVRPTIELAAAALNASISEESAASVQ
FT                   LVLTRQISRHIDQHVLDPALSGESIAAAFGISTRKLYYLFEAHGGVAAYVTRGRLQLAR
FT                   AMLADPTQQGRSIADVAELHGFAYRTNFVRAFRREFGVTPREVRAHAAEGRRLFERPGD
FT                   DTTMWHWVRQLK"
FT   gene            101478..104981
FT                   /locus_tag="Snov_0110"
FT   CDS_pept        101478..104981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0110"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="KEGG: rlg:Rleg_0480 outer membrane autotransporter
FT                   barrel domain protein; TIGRFAM: outer membrane
FT                   autotransporter barrel domain protein; PFAM:
FT                   Autotransporter beta- domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87447"
FT                   /db_xref="GOA:D7A0T7"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR030895"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0T7"
FT                   /inference="protein motif:TFAM:TIGR01414"
FT                   /protein_id="ADH87447.1"
FT                   /translation="MTRVKLGISSGRAAEAGNGRSGRTRHAALLATTAVIALAYASPVS
FT                   AQTLWTGTNSNNWFDPGNWSAGLPNNVTDAEVDNIAVNAPAVFAIGANARDLTIGNSAV
FT                   GSLTVQGAGVLLTTNGYIGRGLGSTGTVVVTGTDSVWANTGDFYVGDQGSGSLTIANGG
FT                   QVISNDSFVGNVGSGLVTVTGTDSTWTVTDPLIVGNFGSGMVNVDTGGTVETERVTVGA
FT                   ANGSEGFLDISGGTTSWIASSEFIVGEEGSGTVTVSDGATVESQTLAVGFGPTGFGQVT
FT                   ITGVGTTWTTTASTGIGSDGVGHLLIEAGAAFNTVGVSLGTGSGTVTGAGSSLTASGQI
FT                   FVGAGGESTFTVSDGASVTSVGANIALGGTGTATVTSGANWTSSSTFIVGHSGLGTLNV
FT                   TDGGTVNTLDSVLGRFAAGVGILNVEGEGASFVNTGNMGIGNEGTGALSVTAGGTAEAQ
FT                   SVLLGMEANSGGSASISGAGSSLTSNEFLFVGLEGNGVMFVEDGAQVNSVVAGIGASTG
FT                   GIGEATVSGATWLNSSDLFIGADGTGVLTIADGGRVEVGGAVEIAAGAGSSGTLNIGAG
FT                   EGLAAAAPGTLAAGEIVFGPGTGAIVFNHTSTNYQFSAGMTGTGTIDLFSGTTVLTGNS
FT                   SGFTGATTLHGGTLAVNGTLGGTLDVLAGRLQGTGTVGSTTIAGGAVIAPGNSIGTLNI
FT                   AGNATFAAGSAYELELDPNSSNGDLIHATGTVAIEGGTVEHIGLAGAYSPLRTYTIVTA
FT                   DGGVDGEFAAVTSDFAFLDPTLSYDPNNVYLTLIRNDVDFGAVGLTPNQIATGNGTESL
FT                   GLGNPLYDAVLGLSAAQARGAFDLLSGEIHASAKSVLIDDSRFVREAAIDRVRAALGGV
FT                   GASVSPVMAYGEGGPQSAAPTTDRFAIWGQGFGSWGQIDGDGNAAQINSSTGGFFLGAD
FT                   APIFETWRLGVIAGYSRTNFDVDARASSGSSDNYPLGIYTGTQWGNLGFRSGLAYTWHE
FT                   IDTSRSVAFPGFSESLTSSYDASTFQAFGELGYRIDVQAVAFEPFANVAYVSFDSDGFT
FT                   EQWGAAALYAGGQTTDTTFTTLGLRVAAGLGLAGADVTLRGTLGWRHAFGDVTPLSTQA
FT                   FAGGDPFTIAGVPIAENAAVVEAGLDWNLTPQATLGVAYNGQLASDAQQNGFTARLTVE
FT                   F"
FT   gene            complement(105011..106201)
FT                   /locus_tag="Snov_0111"
FT   CDS_pept        complement(105011..106201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0111"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bid:Bind_3072 monosaccharide-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87448"
FT                   /db_xref="GOA:D7A0T8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0T8"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADH87448.1"
FT                   /translation="MSDTALKDKPRHAGFVKNNLREYGMLISLFAIMIFFQVVTDGTLL
FT                   RPLNLTNLVLQNSYIVIMALGMLLVIVTGHIDLSVGSVAGFIGAVAAVLMVKFGMPSIL
FT                   AVLICLALGGLIGAAQGYWVAYFKIPSFIVTLAGMLVFKGLALAILAGQSVGPFPPAFQ
FT                   KLSSGFIPELVPGAGTLYPTSLAIGAVLALVLVWQNFRSRARQEAHHIETEPYGFFLVK
FT                   NLLFFAVIVYFAYLIASHRGLPNVLVIMTALIALYAFVTTRTTIGRQIYAVGGNEKAAK
FT                   LSGIKTERLTFLTFVNMGVLAALAGLVFAARLNTATPKAGLGFELDVIAACFIGGASAY
FT                   GGVGRVGGAVIGALIMGVMNNGMSILGIGIDYQQVIKGLVLLGAVCLDVYNQKRSA"
FT   gene            complement(106198..107730)
FT                   /locus_tag="Snov_0112"
FT   CDS_pept        complement(106198..107730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0112"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bid:Bind_3073 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87449"
FT                   /db_xref="GOA:D7A0T9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0T9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87449.1"
FT                   /translation="MSALLEMRGISKHFTGVKALNDVSFEVEPGEIHALVGENGAGKST
FT                   LMKVLSGVYPHGSYDGSIMFDGEERRFRDIIDSEALGIIIIHQELALIPLMSIAENIFI
FT                   ANPPARFGVIDRGAVHRRTRELLAKVGLNEEPDTLVTDIGVGKQQLVEIAKALSKKVRL
FT                   LILDEPTASLSEKDSAALLDLLREFRAQGISSILISHKLNEVSKVADRITVLRDGRTVD
FT                   TMDCHEGAVEEDRIIRKMVDRDLEHRFPKREPKIGETIFRVADWSVHHPLHADRQVIKD
FT                   VDFEVRRGEIVGIAGLMGAGRTEFAMSIFGRSWGQKIGGRAEIEGREADLSTVRRAIDA
FT                   GLAYVTEDRKELGLLLNEDVRKNVTLANLAAVSSAQVIDDVRELAVASDYRGRMRIRSH
FT                   SVYQEAGKLSGGNQQKVVLSKWLFTDPKVLILDEPTRGIDVGAKYEIYCIINELADAGK
FT                   GVVVISSEMPELLGICDRICVMNEGAFVGEFPAAEATQEKIMRAIMRKGDRS"
FT   gene            complement(107802..108872)
FT                   /locus_tag="Snov_0113"
FT   CDS_pept        complement(107802..108872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0113"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bid:Bind_3074 multiple
FT                   sugar-binding periplasmic receptor ChvE precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87450"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0U0"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADH87450.1"
FT                   /translation="MKRLTTTLSAFALGALALSFAVPASAQDKGTVGIAMPTKSSARWI
FT                   ADGDNMVKVLKERGYDTDLQYAEDDIPNQLSQIENMVTKGAKVLVIASIDGTTLSDVLK
FT                   QAQAQGIKVIAYDRLIRDTPNVDYYATFDNFQVGVLQAQSLLKGLGYPENKGPFNIELF
FT                   GGSPDDNNAYFFYDGAMSVLKPLIDNGTLKVASGQMGMDKVSTLRWDGATAQARMDNLL
FT                   SAYYNDKRIDGVLSPYDGLSIGILSSLKGVGYGSGGMKMPVVTGQDAEVPSMKSILAGE
FT                   QYSTIFKDTRDLAKVTADMVDASLSGKEVTVNDTKTYNNGVKVVPSYLLKPVVVDKGNW
FT                   EKVLVGSGYYKADQIN"
FT   sig_peptide     complement(108792..108872)
FT                   /locus_tag="Snov_0113"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(108969..109898)
FT                   /locus_tag="Snov_0114"
FT   CDS_pept        complement(108969..109898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0114"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: bid:Bind_3075 SMP-30/gluconolaconase/LRE
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87451"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0U1"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ADH87451.1"
FT                   /translation="MTITSAQAPATTEPTLETLPVAVLCEERCHLGEGPSYDAARDTAW
FT                   WFDILEKRLCEARLAGGAVTVHSLPFMASALAMVDDRRQLLLTENGLVLRDIAGGRLEP
FT                   VADIEAGNPATRSNDGRVHPSGTFWISTMGRHAEREAGTIYAYRDGAVAPLFPGITIPN
FT                   AICFSPDGTLGYFADTKANRLHRVRLDPATGLPLESPSVLRVHTGAGGFDGAVTDAEDL
FT                   VWCAIWGGGRLEAYTPAGDLVRSVAVPARQTSCPVFVGPAFDRVLVTSAFENMDEAARA
FT                   ADPHHGKTFLLDIGVRGHAEPRVRLGGA"
FT   gene            complement(109885..111690)
FT                   /locus_tag="Snov_0115"
FT   CDS_pept        complement(109885..111690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0115"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: atc:AGR_L_3190 putative dihydroxy-acid
FT                   dehydratase; PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87452"
FT                   /db_xref="GOA:D7A0U2"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0U2"
FT                   /inference="protein motif:PRIAM:4.2.1.9"
FT                   /protein_id="ADH87452.1"
FT                   /translation="MHGKTQKTDRTLRSRAWFDNPANADMTALYLERYLNYGLSQEELQ
FT                   SGRPIIGIAQTGSDLSPCNRHHLELAKRVREGIREAGGIAIEFPVHPIQETGKRPTAGL
FT                   DRNLAYLGLVEVLYGYPLDGVVLTIGCDKTTPACLMAAATVNIPAIALSVGPMLNGWYK
FT                   GERTGSGTIVWKARELLATGEIDYQGFVKLVASSAPSTGYCNTMGTATTMNSLAEALGM
FT                   QLPGAAAIPAPYRDRQEAAYRTGLRIVEMVHEDLKPSDILTREAFLNAIRVCSAIGGST
FT                   NAPVHLNALARHVGVELSIDDWQAHGEDVPLLVNLQPAGAYLGEDYYRAGGVPAVVNQL
FT                   MAQGLVHEDAVTANGRSIGENCRDSAIADEDVIRPYDRPLKEKAGFRVLRGNLFSSAIM
FT                   KMSVISPEFRARYLSNPDDPEAFEGRAVVFDGPEDYHARIDDPALAVDEMTVLFMRGAG
FT                   PVGYPGAAEVVNMRAPDYLIKAGIHSLPCIGDGRQSGTSGSPSILNASPEAAAGGGLAV
FT                   LRTGDRVRIDLKRNSADMLVPEEELERRRQELVAQGGYHYPAHQTPWQEIQRGLVGQLE
FT                   TGAVLEPAVRYQRIAQTKGVPRDNH"
FT   gene            complement(111706..112791)
FT                   /locus_tag="Snov_0116"
FT   CDS_pept        complement(111706..112791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0116"
FT                   /product="Aldose 1-epimerase"
FT                   /EC_number="5.1.3.3"
FT                   /note="KEGG: bid:Bind_3076 aldose 1-epimerase; PFAM: Aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87453"
FT                   /db_xref="GOA:D7A0U3"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0U3"
FT                   /inference="protein motif:PRIAM:5.1.3.3"
FT                   /protein_id="ADH87453.1"
FT                   /translation="MHAAAHASPLLREPFGTLSDGRAVERIRLAGEGGFEVAIITHGAA
FT                   VQALHVPDRDGRLADIVLGHDDLAPYEAHRRYFGAAVGRYANRIAGGRFPLDGTTCQVP
FT                   ANNGANALHGGPDGFDRRLWSVEALADGSVPSVTLGLTSPDGDQGFPGELDVRVTYALT
FT                   GPRELSIAFEATTSRPTIVNLTHHGFFNLAGVEAGGDVLGHELTLHADAYLPIDAAAIP
FT                   VGGPTPVAGTPFDFRIPRLIGGRIREAHEQLRLGRGYDHNFCVAGGRTAEPRLAARVEH
FT                   PASGRVLELLTDQPGLQFYSGNFLDGTTEGKFRRLHRQSDAFCLEPQAWPDTPNRPNFP
FT                   SARLDPGETYRHVSLYRFSTV"
FT   gene            complement(112794..113720)
FT                   /locus_tag="Snov_0117"
FT   CDS_pept        complement(112794..113720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0117"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   bid:Bind_3077 galactose 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87454"
FT                   /db_xref="GOA:D7A0U4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0U4"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADH87454.1"
FT                   /translation="MAPIRLAIVGLGKIARDQHIPAIAATEGIELAAVASRNAALDGVA
FT                   HFATLDDLLADSADIDAVALCTPPQVRRAQAEAALAAGKHVLLEKPPGATVSELGPLVA
FT                   AAEASGRTLFATWHSRFAPAVEPARTFLAERAIRSVIIEWKEDVRVWHPGQEWIWEPGG
FT                   LGVFDPAINALSILTQILPRPVFVTKAHLAFPTNRDAPIAAELGLSDVAGIPIRAELDF
FT                   LQTGPQTWDIRIETEAGQIVLSSGGARLVHDGAVLVDEKEAEYRGIYARFVELVRGGRS
FT                   DVDLAPLALVADAFLLGRRSIAEPFEY"
FT   gene            complement(113723..114655)
FT                   /locus_tag="Snov_0118"
FT   CDS_pept        complement(113723..114655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0118"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   xau:Xaut_1021 dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87455"
FT                   /db_xref="GOA:D7A0U5"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0U5"
FT                   /inference="protein motif:PFAM:PF00701"
FT                   /protein_id="ADH87455.1"
FT                   /translation="MTTSSAAGPYKGVFPVAPTVFDADGRLDLDGQKRAIDFMIDAGSH
FT                   GLCILANFSEQFVLTDEERDLVMETVLEHVGGRVPVIVTTTHFATHVCAERSRRAQEMG
FT                   AAMVMIMPPYHGATFRVPEGAIYDFYRAVCDAIDIPIMVQDAPIAGTPLSVPFLARMAK
FT                   EIEHLAYFKIEVPQAAAKLRALIEAGGDAIVGPWDGEEAITLMADLDAGATGAMTGGGY
FT                   PDGIRQIIDPYVAGDREAAVDAYMRWLPLINYENRQCGLAACKALMQEGGVIAHETLRA
FT                   PLPTLHPATRAGLIEIARRLDPLVLSWGR"
FT   gene            complement(114665..116425)
FT                   /locus_tag="Snov_0119"
FT   CDS_pept        complement(114665..116425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0119"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: xau:Xaut_1022 dihydroxy-acid dehydratase;
FT                   PFAM: dihydroxy-acid and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87456"
FT                   /db_xref="GOA:D7A0U6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0U6"
FT                   /inference="protein motif:PRIAM:4.2.1.9"
FT                   /protein_id="ADH87456.1"
FT                   /translation="MSDDSDHGSKKPGSGRPLRSQAWFGRQDKMGFYYRSFLKNSGQPQ
FT                   DRFDGRPVIGICNTWSELTPCNGHFRDLAEHVRYGVLDAGGYPLEFPVSSLGEVTMRPT
FT                   AMLFRNLASMDVEEAIRAHPLDGVVLLMGCDKTTPALLMGAASADLPAIGVSGGPQLRG
FT                   VYRGQIIGSGTNIISMSEQLRAGEITLAEFHEAEAAMNRSAGSCMTMGTASTMASMVEA
FT                   LGIGLPENAAIPAADARRNLLARMAGRRIVEMVKEDLKPSDILTREAFENAIRTLAAIG
FT                   GSTNAVVHLLAIAGRVGVELTLADFDRLGRNIHCLVDLMPSGRFLMEDFYYAGGLPAVL
FT                   RALGERGLLHKDALTVNGSSIWENVAAAQCWNAEVITPFDAPFKAEAGIAILTGNLAPN
FT                   GAVIKPSAASPELMQHTGRAVVFESVEEMHHAVNDEALDIDADCIMVLKNCGPKGYPGM
FT                   AEVGNMPLPAKLLRAGVRDMIRISDARMSGTAYGTVVLHVAPEATAGGPLALVQNGDLI
FT                   TLDVPARSLHLHVDEAELAARRAAWVAPEPHAARGYQRLYVNHVLQADRGADFDFLVGR
FT                   SGSPVARDNH"
FT   gene            complement(116437..117159)
FT                   /locus_tag="Snov_0120"
FT   CDS_pept        complement(116437..117159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0120"
FT                   /product="GntR domain protein"
FT                   /note="KEGG: bra:BRADO1811 GntR family transcriptional
FT                   regulator; PFAM: GntR domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87457"
FT                   /db_xref="GOA:D7A0U7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0U7"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADH87457.1"
FT                   /translation="MTSQIIVIPARRAHSNHAEVARTIGIDIIAGRYGEGAKLPGDAEL
FT                   TLIFGVSRPVLRESVKTLVAKGLLSTKARVGTVVRERAAWNMFDPDVLAWHLDAGINKQ
FT                   FLRDLAEIRLAVEPRAAALAAERRTENDLEVMRRAVARMADEPGASSGFAEADLALHVA
FT                   VAAASGNPFMRSIGAVIEAALRASFVLSAPVDAREHGIAVAAHERIVETIADKDAEAAA
FT                   AAMTNVIFNGLRRQGATG"
FT   gene            complement(117156..118151)
FT                   /locus_tag="Snov_0121"
FT   CDS_pept        complement(117156..118151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0121"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bbt:BBta_2130 inner membrane ABC transporter permease
FT                   protein YjfF"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87458"
FT                   /db_xref="GOA:D7A0U8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0U8"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADH87458.1"
FT                   /translation="MTRSLNRLMPVFATTAVFLAGFLICSLAYPNFASLRVVMNLLTDN
FT                   AFLGIVAVGMTFVIISGGIDLSVGSVIGFTTVFLALAIERWGVPPFAAFVVILLLCAAF
FT                   GAAMGATIQYFELPPFIVTLAGMFLARGLSFLMSTDSIPITADLYANLSDHAIRLAGGA
FT                   RLTVPAMIMLAIVAAGMALLHLTRFGANVYALGGSRAATGLMGINVARTTVLIYTLSSV
FT                   LAGLSGIVFSLYTSSGYSLSAVGVELDAIAAVVIGGTLLSGGYGFVFGSFLGVLIQGLI
FT                   QTYISFDGSLSSWWAKIATGLLLFAFIAFQQITLHMARRSRLRPAGVAKP"
FT   sig_peptide     complement(118065..118151)
FT                   /locus_tag="Snov_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.761) with cleavage site probability 0.655 at
FT                   residue 29"
FT   gene            complement(118162..119160)
FT                   /locus_tag="Snov_0122"
FT   CDS_pept        complement(118162..119160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0122"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: bja:blr3202
FT                   sugar ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87459"
FT                   /db_xref="GOA:D7A0U9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0U9"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADH87459.1"
FT                   /translation="MAIRLPRIGTSQVAALILILLANWMVSPQFFDFHIRDGRVFGSVI
FT                   DVLNRGAPVALLSIGMVLVIAMRGIDLSVGAVMAICGAIAASLADSHALPVVLAAALGA
FT                   GLLCGLWNGLLVAMLGIQPIVATLILMVAGRGIAQLITEGRIVTFSSPDLALLGGGGSV
FT                   LGLPTPVVLTFGMLALTLLIVRGTALGLMIEATGGNPRASALAGIGTKLITVAVYMWSG
FT                   LCAALAGIVAAADILGADANNAGLWLELDAILAVVIGGTSLFGGRFSVVLAVVGALIIQ
FT                   AMNTGILLSGFPPETNLVVKAVVVLAVLLAQSPRVAGHFAGLGVLLNRSRS"
FT   gene            complement(119172..120704)
FT                   /locus_tag="Snov_0123"
FT   CDS_pept        complement(119172..120704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0123"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bbt:BBta_2128 putative ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87460"
FT                   /db_xref="GOA:D7A0V0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0V0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87460.1"
FT                   /translation="MHPTDGSLLELTGFSKSFTGLMALDKVDFTLRRGEIHALLGENGA
FT                   GKSTLIKTMTGVVTRDAGTMRLEGAEIAPRSAGEATKLGIATVYQEVNLAPNLSVAQNL
FT                   FLGRQPTRLGFVREGEMRRRAQALLAEFGLSIDVAAPLETYSVAIRHIVAIARAVDQSA
FT                   RVLILDEPTASLDAHEVEVLFTVMRQLKARGIGIVFVTHFLDQVYAICDRITVLRNGRL
FT                   AGTAPIAELPRIDLVRMMLGRELSAATAQRPPRTAAAEAEPVAAFEDFGKAGYVAPFDL
FT                   TLRAGHVVGLAGLLGSGRTETVRLVFGAERADSGTAEVGGARVVLSSPHEAMRLGFGYC
FT                   PEERKTEGIVADLTVRENIVLALQAKRGPLKPLPRREQDDIAAKFIRLLDIRPPDPERP
FT                   VGLLSGGNQQKVLLARWLATAPRLLILDEPTRGIDVGAHAEIIGLIRDLCAEGMALLVV
FT                   SSELEEIVTYADEVVVLRDRAHVARLTGDEVDVPAILAAIAADAPASVAAPM"
FT   gene            complement(120812..121777)
FT                   /locus_tag="Snov_0124"
FT   CDS_pept        complement(120812..121777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0124"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bja:blr3200 ABC
FT                   transporter sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87461"
FT                   /db_xref="GOA:D7A0V1"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR033893"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0V1"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADH87461.1"
FT                   /translation="MNFKALLLATAFSGALVSAGAQAADLTIGFSQIGSESGWRAAETT
FT                   VSKAEAKKRNINFKIADAQQKQENQIKAIRSFIAQGVDAIFLAPVVSTGWDSVLKEAKE
FT                   ANIPVVLLDRDIDPSGKDLYLTAVTSDSVHEGRVAGQWLVKTVGAKPCNVVELQGTVGA
FT                   SVAANRKKGFEEGIASAPNVKIVRSQTGDFTRAKGKEVMESFIKAEGGGKNICAVYAHN
FT                   DDMMVGAIQAMKEAGLKPGSDVLTVSIDAVPDIFKAMAAGEANTTVELTPNMAGPAFDA
FT                   IIAYKAKGTVPPKWIQTESKLYTAADNPQAVYDSKKGLGY"
FT   sig_peptide     complement(121706..121777)
FT                   /locus_tag="Snov_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            complement(122154..122229)
FT                   /locus_tag="Snov_R0001"
FT                   /note="tRNA-Phe1"
FT   tRNA            complement(122154..122229)
FT                   /locus_tag="Snov_R0001"
FT                   /product="tRNA-Phe"
FT   gene            complement(122403..122624)
FT                   /locus_tag="Snov_0125"
FT   CDS_pept        complement(122403..122624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0125"
FT                   /product="protein of unknown function DUF329"
FT                   /note="PFAM: protein of unknown function DUF329; KEGG:
FT                   azc:AZC_3144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87462"
FT                   /db_xref="GOA:D7A0V2"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0V2"
FT                   /inference="protein motif:PFAM:PF03884"
FT                   /protein_id="ADH87462.1"
FT                   /translation="MSADAPSSADKNTGTCPICGKPSVEKYKPFCSSRCADVDLHRWLT
FT                   GAYAIPVTEDDDEDGEEPSLAPKPPRKA"
FT   gene            complement(122646..123269)
FT                   /locus_tag="Snov_0126"
FT   CDS_pept        complement(122646..123269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0126"
FT                   /product="maf protein"
FT                   /note="KEGG: rpd:RPD_4276 Maf-like protein; TIGRFAM: maf
FT                   protein; PFAM: Maf family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87463"
FT                   /db_xref="GOA:D7A0V3"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0V3"
FT                   /inference="protein motif:TFAM:TIGR00172"
FT                   /protein_id="ADH87463.1"
FT                   /translation="MSARPTLVLASGSPRRLALLAQAGIEPDALLPADIDEAPERGELP
FT                   RRLALRLAQQKLAAADARRKAGNEHEGAYLLAADTVVAVGRRILPKPDLSEEAADCLRL
FT                   LSGRAHRVYTGLALMTPKGGVRTRLVETRVRFKRLSREEMDGYVASREWLGKAGGYAIQ
FT                   GLAGVFVVKLVGSYTNVVGLPLAETVALLAGERFPVYQRWGNPE"
FT   gene            complement(123386..123877)
FT                   /locus_tag="Snov_0127"
FT   CDS_pept        complement(123386..123877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0127"
FT                   /product="Protein-tyrosine phosphatase, low molecular
FT                   weight"
FT                   /note="KEGG: xau:Xaut_1233 protein tyrosine phosphatase;
FT                   PFAM: Protein-tyrosine phosphatase, low molecular weight;
FT                   SMART: Protein-tyrosine phosphatase, low molecular weight"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87464"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0V4"
FT                   /inference="protein motif:PFAM:PF01451"
FT                   /protein_id="ADH87464.1"
FT                   /translation="MATSAQSSLLVGPAVPGRKERPQSVLFMCGQNSVRSPMAAVLAKH
FT                   LFGRSLYVGSAGVAKGEPDPFVTAAIDEVGLDLHRHRPQTLEELEENEGLAFDLVITLS
FT                   PDAHHRALELTRTNAIDVEYWPTPDPTLVAGNREQQLDAYRAVRDELEARIRARFQRHV
FT                   "
FT   gene            complement(123880..124389)
FT                   /locus_tag="Snov_0128"
FT   CDS_pept        complement(123880..124389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   azc:AZC_3148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87465"
FT                   /db_xref="InterPro:IPR008321"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0V5"
FT                   /inference="protein motif:PFAM:PF06793"
FT                   /protein_id="ADH87465.1"
FT                   /translation="MAEGQDPDKDPHAASRRLCAVTLDGASIGRSNIDVEHERAVAIYD
FT                   LIEENTFAPLGDAAPGPYCLAISLAEGRLVLDVTRKDGAPVVQHLLSLSPLRRVVRDYF
FT                   LVCESYYSAIRTASPSQIEAIDMGRRGLHNEGSELLRERLKDKIALDFGTARRLFTLVC
FT                   ALHWKG"
FT   gene            complement(124399..125691)
FT                   /locus_tag="Snov_0129"
FT   CDS_pept        complement(124399..125691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0129"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="TIGRFAM: histidinol dehydrogenase; KEGG:
FT                   rpb:RPB_4350 histidinol dehydrogenase; PFAM: Histidinol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87466"
FT                   /db_xref="GOA:D7A0V6"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0V6"
FT                   /inference="protein motif:TFAM:TIGR00069"
FT                   /protein_id="ADH87466.1"
FT                   /translation="MPLRLDTASPEFKARFTAFLGTKREVSQDVAQAVARIIDDVRARG
FT                   DDALIDFSRQFDRVDLGALGIRVTDTEIDAAEKAADPAAREALAFAHERIRSHHQRQLP
FT                   ESGRYVDAAGVELGHRWTAVDAVGLYVPGGTAAYPSSVLMNAVPAKVAGVKRVVMVVPA
FT                   PDGQINPLVLAAAKLAGVDEVYRVGGAQAVAALAYGTQTIAPVAKIVGPGNAYVAAAKR
FT                   HVFGTVGIDMVAGPSEVLVIADGAQNPDWIAADLLAQAEHDTAAQSILMTDDAALADAV
FT                   VYAVERQLTMLPRRDIAAASWAEFGAVIKLKSLDEAPALADRIAPEHLEIMAADAEALA
FT                   ERIHHAGAIFLGAHTPEAIGDYVGGSNHVLPTARSARFSSGLSVLDFMKRTSILKCGPE
FT                   QLRALGPAAIALGEAEGLSAHARSVAIRLNL"
FT   gene            complement(125805..126311)
FT                   /locus_tag="Snov_0130"
FT   CDS_pept        complement(125805..126311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azc:AZC_3150 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87467"
FT                   /db_xref="InterPro:IPR021335"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0V7"
FT                   /inference="similar to AA sequence:KEGG:AZC_3150"
FT                   /protein_id="ADH87467.1"
FT                   /translation="MAGLKLIALDAEDLAVLSVHLQDAVVSVGEMTFLPKEHRFVLLAN
FT                   RFDWEKAIQAEAMADIDTFPAGPGLAFAAAPVAAATPCVRRRSGLRFERVLNARVRGID
FT                   LTKKQGVLNLLALKFDEIDAPSGTVTFLFSGGGEVQLDVECMEAGLEDLGPAWDAKGTP
FT                   CHDVE"
FT   gene            complement(126458..127747)
FT                   /locus_tag="Snov_0131"
FT   CDS_pept        complement(126458..127747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0131"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="KEGG: azc:AZC_3151 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87468"
FT                   /db_xref="GOA:D7A0V8"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0V8"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ADH87468.1"
FT                   /translation="MDRIRIVGGNPLTGSIPISGAKNAALPLMIAGLLTDEKLVLHNVP
FT                   RLADVSQLQRILGNHGIDITVNGKRRGDDPYSGQTMEIDARVIVDTTAPYELVSKMRAS
FT                   FWVIGPLVARMGEAKVSLPGGCAIGTRPVDFHLDALRALGAEIEIDAGYVLARAPKGLK
FT                   GAHILFPKVSVGATHTAMMAASLAEGETILENAAREPEIVDVADCINAMGGRIEGQGTS
FT                   TIRITGVPRLKGAHHSVLPDRIETGTYAMAVAMTGGDVMLSGARADLLDSALDTLRECG
FT                   AEVTVSNEGLRVKRNGAGISPVEVTTAPFPGFPTDLQAQLMALTTRARGTSKITETIFE
FT                   NRFMHVQELARLGARIHLDGEIATIEGVEKLKGAPVMATDLRASVSLVIGALAAEGESM
FT                   IHRVYHLDRGFERLEEKLSACGAEIERLAG"
FT   gene            complement(127955..128173)
FT                   /locus_tag="Snov_0132"
FT   CDS_pept        complement(127955..128173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpo:Mpop_1943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87469"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0V9"
FT                   /inference="similar to AA sequence:KEGG:Mpop_1943"
FT                   /protein_id="ADH87469.1"
FT                   /translation="MSSADDAARAERLAAALRENLKRRKAQMRGRQAESMEPARPNEAP
FT                   VPDAGSANKDAPDAAPQASAPKPNRSG"
FT   gene            128392..128466
FT                   /locus_tag="Snov_R0002"
FT                   /note="tRNA-Thr1"
FT   tRNA            128392..128466
FT                   /locus_tag="Snov_R0002"
FT                   /product="tRNA-Thr"
FT   gene            complement(128515..129408)
FT                   /locus_tag="Snov_0133"
FT   CDS_pept        complement(128515..129408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0133"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="KEGG: rlt:Rleg2_5789 transcriptional regulator, LysR
FT                   family; TIGRFAM: choline sulfate-utilization transcription
FT                   factor; PFAM: regulatory protein LysR; LysR
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87470"
FT                   /db_xref="GOA:D7A0W0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017786"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0W0"
FT                   /inference="protein motif:TFAM:TIGR03418"
FT                   /protein_id="ADH87470.1"
FT                   /translation="MAERLLDLGWVRIFEAVGRLGSLTAAAHELGLSQPAVSYTVRNLE
FT                   RQLGTPLLERGHRGSTLSPAGERLHRAASAAVAELDAGARAIRRMSRRPVVRLFTDYGF
FT                   ASFWMMPRVAQFRLVHPDTEVHIIASAAADPGTDEAEDVAVLFGTQSDFGAGATQLFEE
FT                   CVYPVCSPHFAARHGLTDDPRAIVGLPLLHLDSTPHPRWFVWSDWFAAMHVAREPGPGD
FT                   LSLNTYGLVVQAAIADQGVALGWAGLIDGAIADGTLVAAGPALSRAESGYWMRPGREPS
FT                   APALDLIEWIIGDVRR"
FT   gene            129558..130499
FT                   /locus_tag="Snov_0134"
FT   CDS_pept        129558..130499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0134"
FT                   /product="choline ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="KEGG: oan:Oant_3324 substrate-binding region of
FT                   ABC-type glycine betaine transport system; TIGRFAM: choline
FT                   ABC transporter, periplasmic binding protein; PFAM:
FT                   Substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87471"
FT                   /db_xref="GOA:D7A0W1"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0W1"
FT                   /inference="protein motif:TFAM:TIGR03414"
FT                   /protein_id="ADH87471.1"
FT                   /translation="MNRFVRAACALSLFLSAGAAVAADAPACKTIRMSDPGWTDITSTN
FT                   AIAGVLLSGLGYTQDVKTLSVPIGYESMKNGNLDVFLGNWMPAQRKFMDALNEAKAVEV
FT                   LATNLTGAKFTLAVPNYVAEAGVKDFKDLVANADKFGSQIYGIEPGAPANANIQKMIDA
FT                   NDFGLKGWKVVESGEQAMLAQVKRSGNGKGWIVFLAWAPHPMNETFDITYLSGGDAYFG
FT                   PNFGGADVRTLARVGWAAQCPNAATFFKNLKFDLPLENAMMGKILDEGLEPAAAAKAWL
FT                   KAHPAALEPWLAGVTTFDGKPGLPAVKASLGL"
FT   sig_peptide     129558..129626
FT                   /locus_tag="Snov_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            130569..132083
FT                   /locus_tag="Snov_0135"
FT   CDS_pept        130569..132083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0135"
FT                   /product="choline-sulfatase"
FT                   /note="KEGG: rle:pRL110429 putative choline-sulfatase;
FT                   TIGRFAM: choline-sulfatase; PFAM: sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87472"
FT                   /db_xref="GOA:D7A0W2"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017785"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR025863"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0W2"
FT                   /inference="protein motif:TFAM:TIGR03417"
FT                   /protein_id="ADH87472.1"
FT                   /translation="MMRPNILVLMVDQLNGTLFPDGPADFLHAPHLKALAARSARFANA
FT                   YTASPLCAPARASFMSGQLPSRTRVYDNAAEFTSDIPTYAHHLRRAGYHTALSGKMHFV
FT                   GPDQLHGFEERLTTDIYPADFGWTPDYTKPGERIDWWYHNLGSVTGAGVAEITNQLEYD
FT                   DEVAYHAGRKLYDLARGHDERPWCLTVSFTHPHDPYVARKRFWDLYEDCPALDPVVAPI
FT                   PFEAQDPHSQRLMLASDHAASHVTDEDVRRSRRAYFANISYIDEKIGELIDIVERCRMA
FT                   DDTVIVFVSDHGDMLGERGLWFKMNFLEGSARVPLMVAAPGLPAGQIDRPVSTLDVLPT
FT                   LAHLAALDLSGIMPWTDGESLVPLARGDGSRSAVPMEYAAEGSYAPLVALRDGPWKLSL
FT                   CELDPPMLTNLDEDPHELANRAQDPACADIMARMTTAMRSRWDLARFDAEVRSSQARRH
FT                   VVYEALRNGAYYPWDFQPLQKASERYMRNHMDLNILEESQRYPRGE"
FT   gene            complement(132101..132790)
FT                   /locus_tag="Snov_0136"
FT   CDS_pept        complement(132101..132790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0136"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: xau:Xaut_0380 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87473"
FT                   /db_xref="GOA:D7A0W3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0W3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87473.1"
FT                   /translation="MSGAPVLSVRELSRHYATGGGMVRALDGVSLDVAAGELVGVFGPS
FT                   GSGKSTFLMLAGLLENPTSGEVWLAGERVSHAGADLDALRETRRKRIGFVFQKANLIPF
FT                   LSAVENVALSLELADVAPADARAHGRRLLATLDLAHRADNLPAKLSGGEQQRVAVARAL
FT                   ANAPPLILADEPTAALDSVRGRQVMEIFRRIAGTRGAAVLVITHDPRSTDLFDRIVHFE
FT                   DGRMVPD"
FT   gene            complement(132787..133950)
FT                   /locus_tag="Snov_0137"
FT   CDS_pept        complement(132787..133950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0137"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   rle:RL3603 putative transmembrane transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87474"
FT                   /db_xref="GOA:D7A0W4"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0W4"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADH87474.1"
FT                   /translation="MNLALKDTLHAPTRFALTALGVAFLVMAVIGMTGLYRGIVEDALL
FT                   ILDRIDADLWVVQGERAGPFAEGSAVASDMDRRVEGVPGVADVRRFTQFSQQFSFAGAS
FT                   RRATVTGVDVPRDDGRWLPLAEGRWLGGSRYDAVADASTGLKVGDRIQLARDVYTVVGL
FT                   TRQMVDSAGDGLLFVGINDAAVIARRRTSEEVHLARAAGSGGGAVSADASSVAQESKIS
FT                   AVLVRLDPAADAARVIATMQRWGDVRVMTMGEQRDLMLNARLWKLRLQILTFTGMILVI
FT                   TAIVVSLIVYTMTIEKLHEIALLKLMGARESVVVGLIGQQAALIGIAGYVLAIGLSGLI
FT                   FPLFPRRVVMLPADLAQVALALTLVCAAAAWVGIARASRVGAREVLS"
FT   gene            complement(133947..135149)
FT                   /locus_tag="Snov_0138"
FT   CDS_pept        complement(133947..135149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0138"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: rle:RL3602 putative efflux RND transporter
FT                   protein; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87475"
FT                   /db_xref="GOA:D7A0W5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0W5"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADH87475.1"
FT                   /translation="MNVQPGLDQFLSLEAPLPRPRRRRGLRLAALAAAVLAIGFVGVRY
FT                   FYPHAVEGEVLRPGMLDVELQGPGTLSALTEASVGSRIQARIEELAVDRNDVVAKGETL
FT                   ARLAFDDLSGEFDAAEASAHAAERTVSVAQAERDRAVATLEKARATHERQVALLAKGVA
FT                   SEAGLEDALATRRQAEADLARAGRAVEQAEAERDAATARIAVARAQLDDSVLRAPISGV
FT                   VVSRTHHVGEVLTPGSEVLHLVDPASLVLTARLDESVISAVLPGQAARVTFTRAEDPIS
FT                   GHVLRLRREVDEETREFEIDITLDTLPANWALGQRAMARIMIERRGPVLTVPTSFLVWC
FT                   DGRPGVWVATRARARWREVTLGEAGAKRVEIRRGLDAGQKILKPGDLYPFMRVRLAGPA
FT                   T"
FT   gene            complement(135204..135476)
FT                   /locus_tag="Snov_0139"
FT   CDS_pept        complement(135204..135476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_3450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87476"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0W6"
FT                   /inference="similar to AA sequence:KEGG:Xaut_3450"
FT                   /protein_id="ADH87476.1"
FT                   /translation="MDRAFFLRAGLVLAFATLLGAAFARAASAQNMSRAQAQAVRSACE
FT                   ADIRATCPGVQPGGGRLLQCIKANPDGISQPCKDALVAARAAPAQ"
FT   sig_peptide     complement(135396..135476)
FT                   /locus_tag="Snov_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.522 at
FT                   residue 27"
FT   gene            135737..136456
FT                   /locus_tag="Snov_0140"
FT   CDS_pept        135737..136456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0140"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: ara:Arad_0228 two-component response regulator
FT                   protein; PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87477"
FT                   /db_xref="GOA:D7A0W7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0W7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH87477.1"
FT                   /translation="MTAARVLLVEDDRDIRSLLVDFLGGEGYDVEAVGSGALMDRALMR
FT                   GMPDLVILDIMLPGEDGLSICRRLRTKSRVPILMLTAKHDDIDRIVGLEIGADDYLGKP
FT                   FNPRELLARIRALLRRASGPLSAGVPERRRRRFAGLVADLDARTVVDDGGQRVNLTTAE
FT                   FDLLTCFLERPGRVLSRDQLLDWTRGRAGGDPFDRTIDVTVSRLRGKLSRCIGEAEQPI
FT                   TTVRNVGYLFSADVREA"
FT   gene            136468..137793
FT                   /locus_tag="Snov_0141"
FT   CDS_pept        136468..137793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0141"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: ara:Arad_0229 two-component sensor histidine
FT                   kinase protein; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87478"
FT                   /db_xref="GOA:D7A0W8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0W8"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH87478.1"
FT                   /translation="MRLGLLARIILIVAVALFAIQLLALFFYFGAGEGRRTLGEGSPSL
FT                   SRQVASLVLLVDKVPADLRPALLEAFSENGRTATIVPALPDDFTRTNGLIRIERSIRAA
FT                   LALRGAEGRQVWARLEGRSESGRGDTLSVYVELADGGYLWLDVEDRVTVRLLGVPIGFF
FT                   AGLFGVIVALAALVAVAREMRPITRLAREVDRVGEGIDPVAIPERGAPELRKLIRAVNA
FT                   MQKRIAALVRNRTLTLGAISHDLRTYLTRLRLRVEMMPESRHRAGAIADVEAMQALVAD
FT                   TLDFAQDSFVPTEPVRADLATALRRYAAEQNDARIVLDVPDGPVHVAMGDKALGRVVAN
FT                   LVGNALRYGERAFAGIKTGGARVVLVIEDEGPGIPAEERERVFEPFHRLEASRNRDSGG
FT                   TGLGLTIVRRLVERHGGSIELGTSRRGGLAVRVMLPRTEPPA"
FT   gene            137877..138461
FT                   /locus_tag="Snov_0142"
FT   CDS_pept        137877..138461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pde:Pden_3440 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87479"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0W9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87479.1"
FT                   /translation="MRKIFPSTLSTRIAGGAVVLALVAAGAVPTLGIAQDLAGPLAAPA
FT                   GAAGPWACEVPPFAAGPGPAIDPAAARLIAGMLLSAQETALGIRTDQMDAWRGYTTALI
FT                   ALLPSGERLGRWTDEKKRAEAQAFDLAQDIAGAAIERAEKARALQDAVSKLKTVLTPEQ
FT                   MSMAKQMQEKLVERIVRFVQWRRGEGSGVPL"
FT   sig_peptide     137877..137981
FT                   /locus_tag="Snov_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.567 at
FT                   residue 35"
FT   gene            complement(138523..139197)
FT                   /locus_tag="Snov_0143"
FT   CDS_pept        complement(138523..139197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0143"
FT                   /product="SH3 type 3 domain protein"
FT                   /note="KEGG: rle:RL3605 putative transmembrane protein;
FT                   PFAM: SH3 type 3 domain protein; SMART: SH3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87480"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0X0"
FT                   /inference="protein motif:PFAM:PF08239"
FT                   /protein_id="ADH87480.1"
FT                   /translation="MLRKMIFAAALTLAAAPAASAATTAVAVTNVNLRAGPSTVYPAVT
FT                   VVPTGAAITTFGCVSGYSWCDIGFGPYRGWVAASYIQVVYRGAPVVLTAPLAPTIGITV
FT                   VSFNRAYWDRYYVAYPWYGRWAAYPSYAAPRVTSANRSVTCAGSACVGVRGATGVYGGS
FT                   TAQTRVCTGGACTSTRITEGPNAGMAARTRNCAAGQGCTTNRAVIGPGGGVHTGSRSFQ
FT                   RW"
FT   sig_peptide     complement(139132..139197)
FT                   /locus_tag="Snov_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.863 at
FT                   residue 22"
FT   gene            complement(139464..140150)
FT                   /locus_tag="Snov_0144"
FT   CDS_pept        complement(139464..140150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0144"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="KEGG: nha:Nham_1933 CBS domain-containing protein;
FT                   PFAM: CBS domain containing protein; transport-associated;
FT                   SMART: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87481"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR017080"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0X1"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADH87481.1"
FT                   /translation="MKARDVMTSPVITAKATDLVVQIAKTLLERRISGMPIVDDKGKMV
FT                   GIISEGDLIRRAEAGTERRRSWWLQAFVDDGTLAAEYVKAHGRTAADVMHRDPVTAGPD
FT                   TPLHEIAALMESHGVKRIPIVEKGHLVGIVSRSNLIQAVAGTKMGLEIPLSDSAIREKV
FT                   MERLNQQPWANTWRLNVTVDDGVVNLWGIANADTERQALRVVAETTPGVRAVNDHLMKE
FT                   PMGSWA"
FT   gene            140430..140528
FT                   /pseudo
FT                   /locus_tag="Snov_0145"
FT                   /product="hypothetical protein"
FT   gene            140730..141770
FT                   /locus_tag="Snov_0146"
FT   CDS_pept        140730..141770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0146"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   azc:AZC_4415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87482"
FT                   /db_xref="GOA:D7A0X2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0X2"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ADH87482.1"
FT                   /translation="MSARTNRILLGICTVVLAGGAIFLARPVIAPVAFALFVMALVWPL
FT                   QDRLQRRLPGLAAMAITLAVTILAVFVVGYATVWGLSQTGRWLVTNAGRFQALYAETAA
FT                   WLEGHGLYSAGTLADTFSASWLIGTFQGLAGRVNGMLGFAVVTMIYVMLGLLEADIVRD
FT                   KLLAAGEAGGRLVRASAATAAKFRTYMMVRTVMSVLTGLFVWAVTAALGLDLALAFGVM
FT                   AFALNYIPFIGPLVATLLPTFFALAQFGSWEAAVLVFVAMNVIQFFSGSYIEPRVAGRA
FT                   LAMSPFLVLLSVFFWAFMWGIAGAFIGVPLVIAALTFCEEREETRWIAQLLSGREEKPP
FT                   VPAGVS"
FT   gene            141865..143082
FT                   /locus_tag="Snov_0147"
FT   CDS_pept        141865..143082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0147"
FT                   /product="protein of unknown function DUF900 hydrolase
FT                   family protein"
FT                   /note="PFAM: protein of unknown function DUF900 hydrolase
FT                   family protein; KEGG: bms:BR0328 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87483"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0X3"
FT                   /inference="protein motif:PFAM:PF05990"
FT                   /protein_id="ADH87483.1"
FT                   /translation="MRLVVLLLASLLTAGCAGRPVGVLTPVEAAVPEATKVDLLVATTR
FT                   APSPDAGIRYTGERGQGVSLSAFTVSIPPDSRREVGQVQWPRSLPPNPETDFATLNVQP
FT                   LPSVKAAKGWLDSHLPPSRRVLIFVHGYNNRFEDSVYRFAQIVHDSRSEVAPVLFTWPS
FT                   RARVFDYLFDRESTIFSRDAFEEAVWQVASDPRVEDVTVMAHSMGAWLAMEGLRQMAIR
FT                   RGKLPAKISNVILASPDVDVDVFASQWRALNGPKARFTLFVSQDDRALQVSRRIAGGVD
FT                   RLGLIDTQKYYAELEKSGIVVIDLTKMRGGDALNHDRFASSPEVVQLIGTRLVNGQTVT
FT                   DSEVSIGDRIAAGAMGVGQTVGSAAGLAISAPIAVVDPATRRTYQGQMESFGRTMSGTV
FT                   EDPGAD"
FT   gene            complement(143105..143437)
FT                   /locus_tag="Snov_0148"
FT   CDS_pept        complement(143105..143437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0148"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="KEGG: cti:RALTA_B0044 conserved hypothetical
FT                   protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87484"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR024447"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0X4"
FT                   /inference="similar to AA sequence:KEGG:RALTA_B0044"
FT                   /protein_id="ADH87484.1"
FT                   /translation="MLSRRSLFKGLLAAALAAPAGAALTSTADAQWGVPGPRMAPPPPR
FT                   REPRPRPRRGYTWVPGHWNWSARRGWVWAPGHWEENRRGFTYVGPRWVFRRGQWVFEPG
FT                   RWVRSW"
FT   sig_peptide     complement(143345..143437)
FT                   /locus_tag="Snov_0148"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.504 at
FT                   residue 31"
FT   gene            complement(143459..144664)
FT                   /locus_tag="Snov_0149"
FT   CDS_pept        complement(143459..144664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0149"
FT                   /product="sodium/glutamate symporter"
FT                   /note="KEGG: msl:Msil_1050 sodium/glutamate symporter;
FT                   TIGRFAM: sodium/glutamate symporter; PFAM: sodium/glutamate
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87485"
FT                   /db_xref="GOA:D7A0X5"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0X5"
FT                   /inference="protein motif:TFAM:TIGR00210"
FT                   /protein_id="ADH87485.1"
FT                   /translation="MASIQVSGLLTFTVAILVFFAGSGLNRLIAPLRAWNIPEAVTGGL
FT                   LAATVTLLAYRLLGAEISFALQARDMLLLYFFTGIGLNARLDDLISGGRPLIILLALTV
FT                   VFLVIQNFIAIGAVAALGLPEGLTVFLGSASLIGGHGTTIAWAPLISQRFGVPNAMEIG
FT                   IASATLGLVLASLAGGPIARHLIGRYKLHGPAYGDAAVGLPAKAENSPADDIGHVSLLR
FT                   TVLVLNVAILIGFGLEGVVEETGIKLPMFVVCLLVGIVLTNTVPRLFSRLLWPTRTRAL
FT                   ALVSDLSLNIFLAMSLMSMQLWTIGGLGLALVIVLAVQTVAAVAYIIFVVFPLMGRDYQ
FT                   AAVIAAGFTGISLGATPTAIANMTAITKTHGAAPRAFIILPLVSAFFIDIINAAAIGFL
FT                   AR"
FT   gene            complement(144696..146147)
FT                   /locus_tag="Snov_0150"
FT   CDS_pept        complement(144696..146147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0150"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Citrate transporter; KEGG: msl:Msil_2569
FT                   citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87486"
FT                   /db_xref="GOA:D7A0X6"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0X6"
FT                   /inference="protein motif:PFAM:PF03600"
FT                   /protein_id="ADH87486.1"
FT                   /translation="MGLIGILLGLGLLIWFAYRGWSVLLLAPLSALIAALLSNEPLLAN
FT                   WTQTFMGSAASFVGQFFPLFLLGALFGKLMEDSGSVTAIAEFMTEKLGAERAILAVVLA
FT                   GAIVTYGGVSLFVALFVLAPMAEALFRVADIPRRLMPPAIALGTFTFTMMALPGTPAIQ
FT                   NAIPMPFFGTTPFAAPGLGIIASLIMLGFGLWWLSRAEASARRAGEGFDGIGPDLHAVV
FT                   TDPVLRERATVTREFDPAEIEHGHLSVERPSIALAALPLVLVIVVNLLMSFVILPRLDF
FT                   SFLAEPRWGGVTFSGVSGVWSVAVALIVAILATIAINRRRLPKLRETMDAGANASVLPI
FT                   FSVASLVGFGAVVAALPAFALVRDWVLSIGGGPLVSLAVATNILAALTGSASGGLTIAL
FT                   DALGATYLQRAGELGIDPALLHRVAVMSAGTLDSLPHSGAVVTLLAVCGVTPKQSYLDI
FT                   VMVAIVGAIVALVAVIALGSVAGSF"
FT   gene            complement(146151..147257)
FT                   /locus_tag="Snov_0151"
FT   CDS_pept        complement(146151..147257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0151"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: azc:AZC_1304 putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87487"
FT                   /db_xref="GOA:D7A0X7"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0X7"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ADH87487.1"
FT                   /translation="MPRPTSATRARRPSGADNAPSPNAEPATDARRAPVLIDLALQGGG
FT                   SHGAFTWGVLDRLLEEEWLRIDGVSGTSAGAMNAAVMADGYAAGGAAGARAALDAYWRH
FT                   VAEAARFSPFQRGPLDVLFGRWTLDHSPMFIAMDLMSRLYSPYDLNPAGTNPLRDILEK
FT                   AIDFDRLKTSPIKVFITATNVRTGRGRVFRNAEITPDVLLASACLPTLFQAVEIDGESY
FT                   WDGGYAGNPTMTPLVRELDSDDTILIPINPIERPGTPRSAAEILNRLNEVSFNSALLKE
FT                   LRMIALLRQVADPGHSEGAQWAKMRIHLVRNEIMATLGYSSKLNAGWDFLSMLREEGRK
FT                   AAQAFLDADADNIGKRSSVDLDVLLEGV"
FT   gene            147567..149000
FT                   /locus_tag="Snov_0152"
FT   CDS_pept        147567..149000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0152"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   mlo:mll6735 arginine/ornithine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87488"
FT                   /db_xref="GOA:D7A0X8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0X8"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ADH87488.1"
FT                   /translation="MADPQAGKLPLPTLTAMVVGSMVGAGIFNLPGRFATATGPFGAII
FT                   AWLIAGTGMYMLARVFQALAEKRPDIDAGVFAYAKAGFGDYMGFLSAFGYWLGSCLGNV
FT                   FYWVLIGSTLGRFFPDIFGDGSSATAIIVSLVGIWAFHFMILRGVEQATFINTIVTIAK
FT                   IVPILVAVLAFVFFFNYTQFSENFFGGVGMPEKTLVAQVRDTMLITVFVFIGIEGASVY
FT                   SRYAKKRSDVGAATILGFVAVTGLMVAVTLLPYATAPRAAIAGVQNPSLAGALELVVGH
FT                   WGAVFISVGVLISVLGAYLAWSLICAEVLFAAAKSSDMPRLFAAQNANRVPANALWLTN
FT                   IVVSLFVISTYWSRDAFNFMLDMTSVTSLLPYLLVAGYGVLLARSGVGYEATPGERGRD
FT                   QIFAWIAIVYTLFMFVAAGLKYVLLVTVLFVPGTILYFWARREQQARLFTPVELVVFII
FT                   TLVGGAVGAYGLATGLITP"
FT   gene            149028..150263
FT                   /locus_tag="Snov_0153"
FT   CDS_pept        149028..150263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0153"
FT                   /product="arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="TIGRFAM: arginine deiminase; KEGG: mlo:mll6733
FT                   arginine deiminase; PFAM: amidinotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87489"
FT                   /db_xref="GOA:D7A0X9"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0X9"
FT                   /inference="protein motif:TFAM:TIGR01078"
FT                   /protein_id="ADH87489.1"
FT                   /translation="METSFGVHSEVGQLRKVLVCAPGRAHQRLTPSNCDALLFDDVLWV
FT                   DVAKRDHFDFITKMRDRGIEVVEMHNLLTETLAVPEAKKWILDNQVAPNQIGLGFVEEV
FT                   RSYLEGLPNRQLAETLIGGLSTYEFPETIGGETLALIRDAAGVNEYLLPPLPNTLYTRD
FT                   TTCWIYGGVTLNPLYWPARHEETILTSSIYKFHPDFAGKVNVWWGDPTKDWGLATLEGG
FT                   DVMPIGKGNVLIGMSERTSRQAISQAAAALFEKGGAERVIVAAMPKLRAAMHLDTVFTF
FT                   ADRDCVLIYPDIVDKIECFSYRPDGKGGVELSRDKGLIETVKEALGLKEIRVVETGGND
FT                   YMRERTQWDSGANLVCASPGVVFAYDRNTYANTLLRKAGIEVITIDGSELGRGRGGGHC
FT                   MTCPIIRDAVDF"
FT   gene            complement(150280..151305)
FT                   /locus_tag="Snov_0154"
FT   CDS_pept        complement(150280..151305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0154"
FT                   /product="Malate/L-lactate dehydrogenase"
FT                   /note="PFAM: Malate/L-lactate dehydrogenase; KEGG:
FT                   pde:Pden_4855 malate/L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87490"
FT                   /db_xref="GOA:D7A0Y0"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/Swiss-Prot:D7A0Y0"
FT                   /inference="protein motif:PFAM:PF02615"
FT                   /protein_id="ADH87490.1"
FT                   /translation="MDEPVRLSLAEVHVLCRDTLVAAGLGEEHAQAIARSITRAEADEC
FT                   HSHGLYRLIGYVASVRSGKAERHALPALARATPAVLRVDAKHGFAPLAVETGVPALIAA
FT                   AKEIGIAALAIHDCYHFSALWADIEPAVEAGLAAWCFTVGQCCVAPAGGTTPLLGTNPF
FT                   AFGWPGPSGRPFIFDFATSAAARGEIELKRRGGEKIPPGWAVGPDGAPTTDPAAALAGA
FT                   LLPFGGHKGSALSMMVELIAGPLIGDLTSRQSKAVENGDGGPPLGGELFIAIDPAVFGT
FT                   GNLSSRLADADELFALAKAQPGVRLPSERRYQARERSRTNGIAVPAALFAELQALGPRG
FT                   S"
FT   gene            complement(151308..152345)
FT                   /locus_tag="Snov_0155"
FT   CDS_pept        complement(151308..152345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0155"
FT                   /product="Proline racemase"
FT                   /EC_number="5.1.1.4"
FT                   /note="KEGG: rlt:Rleg2_2641 proline racemase; PFAM: proline
FT                   racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87491"
FT                   /db_xref="GOA:D7A0Y1"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/Swiss-Prot:D7A0Y1"
FT                   /inference="protein motif:PRIAM:5.1.1.4"
FT                   /protein_id="ADH87491.1"
FT                   /translation="MRSSKVIHVVGCHAEGEVGDVIVGGVAPPPGETVWAQSRFVASDN
FT                   TLRNFVLQEPRGGVFRHVNLLVPPKNKEAVAAWIIMEPEDTPPMSGSNSICVSTVLLDT
FT                   GIVPMVEPETHMVLEAPGGLIEATAYCKNGKAERIRVKNHPSFADKLDAKLELEGYGTL
FT                   TVDTAYGGDSFCIVDAHALGFSIKPDEAKDFADLGMKIVKAANQQLGFQHPTNKDWSHI
FT                   SFCQFAAPLTDDNGTPSGANAVAIRPGKIDRSPCGTGCSARMAVLHAKGILKVGDAFVG
FT                   RSIIGSRFDCRVEAETSIGGRPAIVPSIMGRAFITHTAQLMVDPDDPWQTGYRLSDTWP
FT                   VWKQD"
FT   gene            complement(152482..153585)
FT                   /locus_tag="Snov_0156"
FT   CDS_pept        complement(152482..153585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0156"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: mlo:mll7353 muconate lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87492"
FT                   /db_xref="GOA:D7A0Y2"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034620"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:D7A0Y2"
FT                   /inference="protein motif:PFAM:PF02746"
FT                   /protein_id="ADH87492.1"
FT                   /translation="MKITGIKAWKVGLPLKEGRYNWSNGNFVEVFDSTVVAVETDAGIT
FT                   GYAECCPLGSAYLPAYAHGVRAGLEEIGPKVIGLDPTDLNVLNRHMDSVLRGHPYVKAP
FT                   IDIACWDILGKVSGLPVYKLLGGAAQEKVALYRAISQEAPEAMARKIAGYKAEGYTKFQ
FT                   LKVGGDADQDIDRIRVTREILDATDTLVADANTGWTRAEAARIAAEVGDLDVYIEQPCP
FT                   TYEECLSVRARTARPFVLDEVIDGVGTLMKALADDAMDIINLKISKVGGLTKARLMRDI
FT                   CVASGTPMTIEDTWGGDIVTATIAHLARSTPEEFSFSATDFNSYGTVDIAKGAPKRVNG
FT                   FMTASDAPGLGIEPIFEVLGEPVVVIG"
FT   gene            complement(153692..154693)
FT                   /locus_tag="Snov_0157"
FT   CDS_pept        complement(153692..154693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0157"
FT                   /product="4-hydroxyproline epimerase"
FT                   /EC_number="5.1.1.8"
FT                   /note="KEGG: sme:SM_b20268 hydroxyproline-2-epimerase;
FT                   PFAM: proline racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87493"
FT                   /db_xref="GOA:D7A0Y3"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/Swiss-Prot:D7A0Y3"
FT                   /inference="protein motif:PRIAM:5.1.1.8"
FT                   /protein_id="ADH87493.1"
FT                   /translation="MARHSFFCIDGHTCGNPVRLVAGGGPNLQGANMIEKRAHFLAEYD
FT                   WIRTGLMFEPRGHDMMSGSILYPPTRPDCDVAILFIETSGCLPMCGHGTIGTVTMAIEH
FT                   GLVTPKIPGVLMLDTPAGVVKAEYRQEGQYVEEVRITNVPAFLYARGLTAECPGLGEVM
FT                   VDVAYGGNFYAIVEPQEHFRDMADFTAGELIGMSGALRKALNAKYEFVHPEKPEIRGLS
FT                   HILWTGAPKHAEAHARNAVFYGDKAIDRSPCGTGTSARIAHWAANGKLKVGDDFVHESI
FT                   IGSLFKGRVEATARVGNVDAIIPSIGGWARMTGYNTIFIDDRDPFAHGFVVV"
FT   gene            complement(154706..155959)
FT                   /locus_tag="Snov_0158"
FT   CDS_pept        complement(154706..155959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0158"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bmc:BAbS19_I16830 TrkA potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87494"
FT                   /db_xref="GOA:D7A0Y4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Y4"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADH87494.1"
FT                   /translation="MSDRADSGEIAVIGAGIVGLACAFHLLGEGHRVRLVERGGVAEGA
FT                   SFGNAGAFAFTDILPLASPGMLLKAPKWLFDPLGPLSIPPRYLPQITPWLIRFWRASLP
FT                   DRYRHSLVAQGSLMRFAAQAMESMVAAAGLSSHVRRDGNLQLYESEAELAASQPGWDAR
FT                   AKEGVEFEHVRGSRLAELQPGVAPRFVAGTFTPRWQTVDDPHHFALALFQAVMARGAAI
FT                   THGEVKAVEPAESGVRLRLADGSQLAVGRAILAGGAWSRPLARELGDAIPLETERGYNT
FT                   TLPPGAFALHRQLTFGGHGFVVTPLSTGIRVGGAVELGGLKAAPNFRRSEVMLRKAAAF
FT                   LPGLNTEGGTQWMGFRPSLPDSLPVIGTSRASNRVLYAFGHGHLGLTQSAATGRLVADM
FT                   VAGRTPSITLDPFRPDRF"
FT   gene            complement(156098..156994)
FT                   /locus_tag="Snov_0159"
FT   CDS_pept        complement(156098..156994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0159"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   mlo:mll3981 dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87495"
FT                   /db_xref="GOA:D7A0Y5"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Y5"
FT                   /inference="protein motif:PFAM:PF00701"
FT                   /protein_id="ADH87495.1"
FT                   /translation="MWQGIYPAVTAKFNEDDSLDHKEMEKSFAFQIEAGVDGLIVNGSL
FT                   GEGPMLSHDERLAVLKTAKSVAGKKPVLMTIADSSTRDCASLAKRAAAAGADGLMTVPS
FT                   LVYHTNPKETVAALSAVAQAADLPVMIYSNRLAYRVDVTVEIMAELAKDKRFVAVKESS
FT                   DDIRRTIDIFNAFGDRYDVFTGVDNLAYEALAVGAVGWVAGLVVAFPHETVAIYKLMKA
FT                   KRYDEALAIYRWFRPLLDLDVSTYLVQNLKLVEALVTGTTERVRSPRLMLEGEQRAKVE
FT                   KIVAEALATRPALAKAA"
FT   gene            complement(157031..157756)
FT                   /locus_tag="Snov_0160"
FT   CDS_pept        complement(157031..157756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0160"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: pae:PA1256 amino acid ABC transporter ATP
FT                   binding protein; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87496"
FT                   /db_xref="GOA:D7A0Y6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Y6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87496.1"
FT                   /translation="MSILIDDVHKSFGSLEVIKGVTMTVEKGEVVSVIGGSGSGKSTLL
FT                   MCINGLEPINSGRILVDGTDVHARGTDLNKLRRKIGIVFQQWNAFPHLTVLENVMLAPR
FT                   KVLGKSKAEAQAVAVEKLTHVGLAEKLNVYPSKLSGGQQQRMAIARALAMSPDYMLFDE
FT                   VTSALDPQLVGEVLDTMRLLSKEGMTMIVVTHEIAFAREVSDRVAFFHKGRIHEIGPPS
FT                   QVIGNPQQPETVAFLKSVL"
FT   gene            complement(157766..158431)
FT                   /locus_tag="Snov_0161"
FT   CDS_pept        complement(157766..158431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0161"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: atc:AGR_L_403 probable permease of ABC
FT                   transporter; TIGRFAM: polar amino acid ABC transporter,
FT                   inner membrane subunit; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87497"
FT                   /db_xref="GOA:D7A0Y7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Y7"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADH87497.1"
FT                   /translation="MFSSLLDTSFSLGDLWFMLKGAGVTLALTAWAVLGGTLLGVLFGV
FT                   IRAISPWWINAPIGAVLDVFRSVPLLIQLVLANSFKTIVGINWAPFTVSCVVLALYMSA
FT                   YCTEIVRSGFLAVPSTTRRAARSLGMTWRQDLTDIVFPIALRVALPSWIGLTLGVMKDT
FT                   AMVWWIGVVELLRSSQVIVTRIQEPLFVLSIAGLIYFLMSFPIARLGARLEARWREND"
FT   gene            complement(158444..159106)
FT                   /locus_tag="Snov_0162"
FT   CDS_pept        complement(158444..159106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0162"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: pap:PSPA7_4134 ABC transporter permease;
FT                   TIGRFAM: polar amino acid ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87498"
FT                   /db_xref="GOA:D7A0Y8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Y8"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADH87498.1"
FT                   /translation="MHYTFHWLPAFRALPDMLWGALVTLEIAVLSMLLGVFFAVLLAVA
FT                   SGSQYRALRALASTWVELARNTPALFQIYMAYFGLGSLGIHLDSFPALLAGITFNNAGY
FT                   LAETFRGGLRAVPPTQVRAARSLGMGQIQAFRLIVMPQMFRVVFYPMTNQMVWAILMTS
FT                   LGVIVGLNNDLTGVTQELNVRSFRTFEYFALAAVIYYLLAKLVTLSARLMAWRLFRY"
FT   gene            complement(159399..160211)
FT                   /locus_tag="Snov_0163"
FT   CDS_pept        complement(159399..160211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0163"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: atc:AGR_L_407 probable binding protein
FT                   component of ABC transporter; PFAM: extracellular
FT                   solute-binding protein family 3; SMART: extracellular
FT                   solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87499"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Y9"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADH87499.1"
FT                   /translation="MAKGIGILAAAALTLAAAMPAQADKLDDIIASGTLRCAVVLDFPP
FT                   MGSRDASNNPIGFDVDYCNDLAKVLGVKAEIVETPFPDRIPALVSGRVDVGVASTSDTL
FT                   ERAKTAGFTIPYFAFKMVVLTKDGLGIKDYDSLKGKKTGSVSGTFEALALEKDVKAWGT
FT                   GSFRGYQTQADVFLALAQGQIEATVVTSTVAAAIVKEGKYKGLMMGGDAPYDIDYVALI
FT                   ALRNEQGLINYLNLFINQQVRTGRYKALYEKWVGLGEAPNLTVPGVYR"
FT   sig_peptide     complement(160140..160211)
FT                   /locus_tag="Snov_0163"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            complement(160351..161160)
FT                   /locus_tag="Snov_0164"
FT   CDS_pept        complement(160351..161160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87500"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Z0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87500.1"
FT                   /translation="MRLSPRRLLRPRALKEADQRDTGAENVLAGEPGGLVGVAGDAGFQ
FT                   YALVLAARARHAVGQHELGTQVAVDAVQRGADGLQVVGPRGRLVERIVEAAVELAPVRG
FT                   IRLRGECIGEALGVLEPLVRDALHRIAQDFRLQQGAEFEDLADLVGRERGDHGAAVALR
FT                   RHQALLLETRQRLAHRDAADVEQAGDVVLPKGLAFGNVALGDGLAQRVENDVRRGCHLR
FT                   DVRCLNLHLVSPPGFAADRLKSPIRCRQVLCAACGFGGRRARGATAQ"
FT   gene            complement(161157..162602)
FT                   /locus_tag="Snov_0165"
FT   CDS_pept        complement(161157..162602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0165"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: ccs:CCNA_01239 two-component sensor histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87501"
FT                   /db_xref="GOA:D7A0Z1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Z1"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH87501.1"
FT                   /translation="MMGARFPVLRRAPLAARMSILLIIVVAAVQLINLALVVLVPPPSE
FT                   ETYSAAQFAAALKGEDAGTDFSLRRFQDSEMRPQHPALVPIRDQLATYFGVPPEQVRVE
FT                   VAGAAPDTPRQDKGLLDGSVILKFASLEASSFDGQKALFQGLFKVGLRQGDGSWLVARP
FT                   TGALHALWKQRALLWLLSTIVVAIPCAYLVAHKLAEPIRRFGAAAEELGRNPGAPPIDT
FT                   SGPKEIAAAASAFNDMQRRLNRYVDDRVMMMGAIAHDLRTPLMRLAFRLEEAPPTLAGK
FT                   AREDIDEMKAMLAAVLSYVRSVQSERPRERHDLRSLVLSIADELADLGHDVSVEDGDDV
FT                   VVTGDGLGLKSLFANVIGNAAKYGGSARVRLAAEDGHVTIIVDDDGPGLPSDELERVFE
FT                   PFYRHETSRNRATGGVGLGLATARSVAIAHGGSIRLDNRAHGGLRATVVLPLVPAAEPA
FT                   PAEACGCSISSLLPRPGREPHTA"
FT   gene            complement(162599..163297)
FT                   /locus_tag="Snov_0166"
FT   CDS_pept        complement(162599..163297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0166"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: pzu:PHZ_c1903 response regulator(with
FT                   CheY-like receiver domain and winged-helix DNA-binding
FT                   domain); PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87502"
FT                   /db_xref="GOA:D7A0Z2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Z2"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH87502.1"
FT                   /translation="MATPTILVVDDDAGIRSLVSESLSLHGFSVLEARDTRAMDRALAA
FT                   NAIDLIILDVLMPGEDGISACRRLAGRAGPPVVMLSAMDQPTDRVVGLELGADYYLGKP
FT                   CDPRELLAVVRATLRRRGADEDTDSRARYRFLGWTVDFAAYELRDGAGALVHLTDGEFA
FT                   VLRSFVQRPRRVLTRDQLLEAARGPDSEALDRAVDVQVSRLRRKLRADSDLIRTIRNEG
FT                   YMFVPAVQKL"
FT   gene            complement(163391..163993)
FT                   /locus_tag="Snov_0167"
FT   CDS_pept        complement(163391..163993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0167"
FT                   /product="ribosomal RNA adenine methylase transferase"
FT                   /note="PFAM: ribosomal RNA adenine methylase transferase;
FT                   KEGG: mes:Meso_0915 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87503"
FT                   /db_xref="GOA:D7A0Z3"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Z3"
FT                   /inference="protein motif:PFAM:PF00398"
FT                   /protein_id="ADH87503.1"
FT                   /translation="MSRTATSFVDQISFLANWAGDPLRVGAIAPSGRSLADIITRGISP
FT                   ADAPVIELGAGTGAFTRALIARGVPEDRLVLIELGADFARMLKRRHPEASVLQINAAEL
FT                   ANMELFGSERAGAVVSGLPLLSFPQIAVVRILKGAFAHLREEGGFYQFTYGPVCPVPRP
FT                   ILERFGLRATKVGRTLANLPPATVYRISRRPGEALRF"
FT   gene            complement(164015..164575)
FT                   /locus_tag="Snov_0168"
FT   CDS_pept        complement(164015..164575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azc:AZC_2752 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87504"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Z4"
FT                   /inference="similar to AA sequence:KEGG:AZC_2752"
FT                   /protein_id="ADH87504.1"
FT                   /translation="MRITPALIAAALFGVLAATAVPAAESGKPENHRAGEARKDDRPRE
FT                   PAETKLAICLAPRLPGPLELASRLDAYETFVGIRPAQIDAWRDYTDALQAMTVGAEAER
FT                   RELPATGLTDGDALSQSATLAGAVIATGERATRLLASVDALRAVLSEAQKARLDEAGPL
FT                   FPPKCAGTLAEAGTPADAAAAPH"
FT   sig_peptide     complement(164513..164575)
FT                   /locus_tag="Snov_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.738 at
FT                   residue 21"
FT   gene            complement(164820..165488)
FT                   /locus_tag="Snov_0169"
FT   CDS_pept        complement(164820..165488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0169"
FT                   /product="isoprenylcysteine carboxyl methyltransferase
FT                   protein"
FT                   /note="KEGG: ara:Arad_8431 isoprenylcysteine carboxyl
FT                   methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87505"
FT                   /db_xref="GOA:D7A0Z5"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Z5"
FT                   /inference="similar to AA sequence:KEGG:Arad_8431"
FT                   /protein_id="ADH87505.1"
FT                   /translation="MVSYLLQCMAWTVFMAALVLLPAGTLDYPGGWAFIVLFAVGGLAM
FT                   VLWLGKYSPSLLRERMSAPWQREQKGWDKVWLTAFMLAFLAWLVFMAWDAGRTRFIAMP
FT                   AWLQVVGFLIALAYMAGVWWTFRENAFAAPVVKIQEGQKVIDTGPYAYVRHPMYTSALL
FT                   FFISLPLILGSWWGLLLAVPFVLGVAWRAVHEEEALRVGLPGYDAYAARVRYRFVPMVW
FT                   "
FT   gene            complement(165497..165925)
FT                   /locus_tag="Snov_0170"
FT   CDS_pept        complement(165497..165925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_4730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87506"
FT                   /db_xref="GOA:D7A0Z6"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Z6"
FT                   /inference="similar to AA sequence:KEGG:Mvan_4730"
FT                   /protein_id="ADH87506.1"
FT                   /translation="MSTTSSDTAAARTRAFSRVIGPWLVIIPGLVMLREPEMGTIAAAF
FT                   FANPALVWLAGGLMLFGGLLIIAFHPYWSGLAAVIISALGWLLVLRAVAVLAAPTLFEQ
FT                   AAMASAGAAMTVRLIFGLLVVAGLYLTYVGWLARPVTD"
FT   gene            165987..166451
FT                   /locus_tag="Snov_0171"
FT   CDS_pept        165987..166451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll3994 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87507"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Z7"
FT                   /inference="similar to AA sequence:KEGG:bll3994"
FT                   /protein_id="ADH87507.1"
FT                   /translation="MQNKANHEPTTAERRFIEDTARLLVPWGVPQTAARLYGFLLIHAK
FT                   PVSLDAIAEGLEISKSSASVAARLLEKYTLAHRHGVRGSKRALYGVSDNYAAMLAEQNR
FT                   LLDALAALMRSGARGVRSEGARDRLTEMADFYAAIRQGMEATLARLRAKE"
FT   gene            complement(166481..167734)
FT                   /locus_tag="Snov_0172"
FT   CDS_pept        complement(166481..167734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0172"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="TIGRFAM: amidase, hydantoinase/carbamoylase family;
FT                   KEGG: mrd:Mrad2831_5813 allantoate amidohydrolase; PFAM:
FT                   peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87508"
FT                   /db_xref="GOA:D7A0Z8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Z8"
FT                   /inference="protein motif:TFAM:TIGR01879"
FT                   /protein_id="ADH87508.1"
FT                   /translation="MSPLAKAIALTEQLFEELRAHTTDEPGITRAAYGEGEEFAHAVVR
FT                   RVGRELGLNEAVDAAGNLYLTLEGEDPTLPSWIIGSHIDSVPHGGNYDGAAGVFAGLAL
FT                   VHALRTEGRRLTRNLTIMVIRAEESTWFPVSYLGSRAAFGLLPADALETRRADTGLTLR
FT                   EHMAALGLNPDAVARGETYLDPASIHGFVEVHIEQGPVLEREDAPIGLVTGIAGSFRYR
FT                   KGRVLGQYGHSGAVPRAYRQDAVIGFADLVAALETTWDGLERDGERATITFGEVGTDPT
FT                   QHAFSKVPGEVGFCLDVRSESPMVLERIHAELFAHAAIIEQRRGVRFDFGEQSGSTPAV
FT                   LDAGQRAGLKAAAACEGIRAIEMPSGAGHDTATFAGRGVPASLIFVRNQNGSHNPFEAM
FT                   RIEDFACAVRTLLSFLKV"
FT   gene            complement(167731..168720)
FT                   /locus_tag="Snov_0173"
FT   CDS_pept        complement(167731..168720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0173"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: mrd:Mrad2831_4405 D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87509"
FT                   /db_xref="GOA:D7A0Z9"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Z9"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADH87509.1"
FT                   /translation="MSSLCLILQRIHDAGVEHLLAAGHEVRLATSLEPGALLAEIAPAR
FT                   AVLTRDARVDGPLMDAAPDLKVIGVHGAGVDNVDIAAATARGIPVVNTPGANARSVAEH
FT                   ALALAFHLAKALGPGERAARASDGSFKYRARMIELDGAVFGLVGFGAIGRETGRLARAL
FT                   GMEVIVWTRRPDDPAVAAAGFTHVADLNELLARADIVSLHLPGGAQTRHLIGAPELARM
FT                   KDTAYLINTARGTIIDEAALVEALREGRIAGAGLDVFETEPMPPSSPLIGFDNVVLSPH
FT                   VGGSTQAALRRTAVALAEQVNDVLAGRRPAHLVNPEVWPIAAIAEAGA"
FT   gene            complement(168734..169513)
FT                   /locus_tag="Snov_0174"
FT   CDS_pept        complement(168734..169513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0174"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rsp:RSP_3440 putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87510"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A100"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH87510.1"
FT                   /translation="MDLGLKGRTALVLGANRGLGNAIARTLAKEGAAVILAGRNEAALE
FT                   EEAAAIRKDGGEARIQKLDLGDRASVLAALDVLEGETIDILVNNSGGPPPGPVAAVTPD
FT                   VWSAQFETMVSAIFLVTSRLLPGMRARKFGRIVNIASSGVTQPIPNLGISNALRASIIG
FT                   WAKTLAAEVAADGVTVNSVLPGRIHTQRTDQIDAANAARSGQSVDQVSAASRATIPMGR
FT                   YGTPQEFADVVAFLASERASYVTGSTLRVDGGAIRSI"
FT   gene            complement(169529..170458)
FT                   /locus_tag="Snov_0175"
FT   CDS_pept        complement(169529..170458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0175"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   bbr:BB4720 putative dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87511"
FT                   /db_xref="GOA:D7A101"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7A101"
FT                   /inference="protein motif:PFAM:PF00701"
FT                   /protein_id="ADH87511.1"
FT                   /translation="MAEKINETTRGVYIIAPTPFTQTGEVDFASTDSLIDFYFETGVTG
FT                   MTILGVLGEASKLAPTESRAFLEHVMKRVDGRKPVVVGASNPGTDNLVRFARQAMDLGA
FT                   AGLMIAPQPFLKTDDQVFGYWAEVLTRLGPDIPVCYQDYPQTSNTVSSVSVLHRLIDAF
FT                   PNFVMLKHEEGSGLPKITKMRERSDKGEGRRVSILVGNGGLYLPQELRRGVDGAMTGFA
FT                   YPEMLVGVVEKFHAGDLEGAEDLFDTYLPILRHEQQLGFGLAIRKEVLKRRGIIACSDT
FT                   RHPGPKLTARDHQELGELMSRLTAKLHG"
FT   gene            complement(170468..171148)
FT                   /locus_tag="Snov_0176"
FT   CDS_pept        complement(170468..171148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0176"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: mrd:Mrad2831_5808 GntR family transcriptional
FT                   regulator; PFAM: GntR domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87512"
FT                   /db_xref="GOA:D7A102"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A102"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADH87512.1"
FT                   /translation="MSVPVRRKAVADPLEEREESLSQMAYNALLDQLIKREIPVGSVLQ
FT                   ERRLAEALAISRTPVRDALNRLESEGFITRKPGGVLVVKEFSTRELIETLHVRQILETE
FT                   GARLATGRIPVAELDEVEAEIRALLAAPAPNAEKDWEVDCRFHSMIAARSGNAVLAKHI
FT                   HDLRLKTHMFNMDRVPERFEIGHREHLSIIDALRREDREAARAGLYAHIENVKLSIIEK
FT                   LRAI"
FT   gene            complement(171223..172023)
FT                   /locus_tag="Snov_0177"
FT   CDS_pept        complement(171223..172023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0177"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: ara:Arad_7980 amino acid ABC transporter;
FT                   PFAM: extracellular solute-binding protein family 3; SMART:
FT                   extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87513"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D7A103"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADH87513.1"
FT                   /translation="MRLNLLPVLAAALVGGLVTGGLSAPANAQQLELVKPGALLVATEG
FT                   TYPPFSMRTPDGQLDGLEIRVAKEIARRLNLTYEPVVIKWEALLVGLAADQYDFASAAM
FT                   DITAERQKQVMFADGWLESGGRVVTQKGSPIKTPADIKGKTVGVLVSSTWQKLAEERGA
FT                   TVKAYKAESDAIQDLVNGQIDAVITDSIAAAYAIEASKLPLVMVDDYLSHIQKGFPFKK
FT                   GKPNLVKAVNKALADMIADGTYAKLTTPLIGYSPAPKDPIKTIF"
FT   sig_peptide     complement(171937..172023)
FT                   /locus_tag="Snov_0177"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            complement(172122..173066)
FT                   /locus_tag="Snov_0178"
FT   CDS_pept        complement(172122..173066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0178"
FT                   /product="agmatinase"
FT                   /note="KEGG: rsp:RSP_3743 agmatinase; TIGRFAM: agmatinase;
FT                   PFAM: Arginase/agmatinase/formiminoglutamase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87514"
FT                   /db_xref="GOA:D7A104"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:D7A104"
FT                   /inference="protein motif:TFAM:TIGR01230"
FT                   /protein_id="ADH87514.1"
FT                   /translation="MSVLPIDSLETPRFCGVPTFMRLPQATTLKGLDAAIIGLPSDSGA
FT                   PFRTGARFAPNAVRAMSIMLRPINPYRNINVFERLACADAGDAAVVPGYEIESLERLEL
FT                   AVRAVVDAGVTPFGIGGDHSVTLAGLRAVAAKHGPLALIQFDSHSDTWDKYFAGQRYSA
FT                   GTPFRRAVEEGIVDPARSIQIGLRGSLFKPDDVSQSVELGFEVVTTDGMFEMGIPALAA
FT                   RIAERTGSHPAYLTFDLDFVDPAYAPAVETPEAGGPSAREALDLLRRIEGVNLVGADVV
FT                   ELCPPYDGSSQISALLAATVMAELLALKASTES"
FT   gene            complement(173079..173747)
FT                   /locus_tag="Snov_0179"
FT   CDS_pept        complement(173079..173747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0179"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: rsh:Rsph17029_3475 polar amino acid ABC
FT                   transporter, inner membrane subunit; TIGRFAM: polar amino
FT                   acid ABC transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87515"
FT                   /db_xref="GOA:D7A105"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A105"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADH87515.1"
FT                   /translation="MIEKIAVWWEGFAPYVPGFLAASWLVLVLSLLAILVSWGCGLIAA
FT                   LGKVSRFAALRKASEFYIWFIRGTPTLIQIFIIYFGLPQLGLRLSPFVAGVVALGFNGG
FT                   AYVAEIVRAGLSAIPKGQTESAQALGMGRWQMMTRIILPQVFRVILPPVTNEAITMVKN
FT                   TSLLSTITVVELTLYSQTIIATTFRPFEFYIATALIYLVMTSLISQAAAHAERHYARSL
FT                   "
FT   gene            complement(173744..174553)
FT                   /locus_tag="Snov_0180"
FT   CDS_pept        complement(173744..174553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0180"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: mrd:Mrad2831_5811 ABC transporter related;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87516"
FT                   /db_xref="GOA:D7A106"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D7A106"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87516.1"
FT                   /translation="MDGEPLIRIRDLRKSFGAHEVLKGVSLDVHAGEVVSIIGASGSGK
FT                   STFLRCINVLEKPTGGTMDFGGFHFDYEQGARLQPTAAQLRELRARIGMVFQSYNLWPH
FT                   MTVLENVIEAPIRVKGETPAEARDKAEALLARIGLAEKRHAYPSKLSGGQQQRVAIVRA
FT                   LAMQPKLMLFDEVTSALDPELVGEVLSLMASLAAEGMTMLLVTHEIGFAREVSNRVIFF
FT                   DQGVIAEDGHPREVLRQPRSERLQQFLRRVLHEDAYHAAPLTEGAAS"
FT   gene            complement(174553..175182)
FT                   /locus_tag="Snov_0181"
FT   CDS_pept        complement(174553..175182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0181"
FT                   /product="Domain of unknown function DUF1989"
FT                   /note="PFAM: Domain of unknown function DUF1989; KEGG:
FT                   rsp:RSP_3746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87517"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:D7A107"
FT                   /inference="protein motif:PFAM:PF09347"
FT                   /protein_id="ADH87517.1"
FT                   /translation="MDYRLDDSLVLPAGRGWAVKMKAGQRLKLTNPHGTQAVDFWAFAE
FT                   RDIYEFTSMDHFRSFHSTIHVTKDTPVVSTKRRPLASIVEDTSSGKHDTLLCPCNAALY
FT                   RQLGAEGHHRSCADNLHEGLAELGINLPFTPASVNLFMCVAVRADGSLDRLLPASAPGS
FT                   YVVIEAEDNIVMAFSCCPQDITPINGEDRTPRDCLIDIYSPIREAA"
FT   gene            175542..176282
FT                   /locus_tag="Snov_0182"
FT   CDS_pept        175542..176282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0182"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="KEGG: mrd:Mrad2831_5815 allophanate hydrolase
FT                   subunit 1; PFAM: Allophanate hydrolase subunit 1; SMART:
FT                   Allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87518"
FT                   /db_xref="GOA:D7A108"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D7A108"
FT                   /inference="protein motif:PFAM:PF02682"
FT                   /protein_id="ADH87518.1"
FT                   /translation="MKTGPAPAPRLLDAGESGLVVEFGDAIDETINRQVIALADALAAR
FT                   ELAGVREVVPTYRSLLVLFDPLVLAREDLREEVLALWPPPADAGEAHGIWRVPVLYGGE
FT                   HGVDLEHVAHVHGLTTQEVIDLHSGADYRVYMIGFAPGFAYLGGLPEAVHTSRRTGPRM
FT                   GTPPRSVSIGGKQTAVSPPLSIPSAWHLLGQTPVRSYDPARAERPFLFAAGDTIRFVPI
FT                   KAGEYERLCRAAEAGEIVAEWEPA"
FT   gene            176282..177319
FT                   /locus_tag="Snov_0183"
FT   CDS_pept        176282..177319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0183"
FT                   /product="urea amidolyase related protein"
FT                   /EC_number="6.3.4.6"
FT                   /note="SMART: Allophanate hydrolase subunit 2; TIGRFAM:
FT                   urea amidolyase related protein; KEGG: mrd:Mrad2831_5816
FT                   UreA amidolyase related protein; PFAM: Allophanate
FT                   hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87519"
FT                   /db_xref="GOA:D7A109"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D7A109"
FT                   /inference="protein motif:TFAM:TIGR00724"
FT                   /protein_id="ADH87519.1"
FT                   /translation="MAAHLVIDRPGLFSSLQDFGRFGYQRFGISASGAMDSLALLAANL
FT                   LVGNARGEAAIELTMLGLSATVEGGPLRMALAGADMPFSINGAAAEGWRAYELTPGDRI
FT                   DIGAARAGMRGYLAIAGGFDIAPTFGSLSTHSRSAIGGLEGRALRTGDRLPVRGAAAGP
FT                   LLTLARAHRPRGEGAVRVVLGPQDDLFTAKGIETFLSSDYRVTDKADRMGAQFDGPEIE
FT                   HADDFNIVSDGIMNGSVQVPGNGRPLVLLADRQTTGGYPKIATVIGPDLWRLGQARPGD
FT                   ILRFAAISPEAAQAAALAHEKAIMTMAGQMTEVIRPGAALTSEWLLTHNLIDGICSATD
FT                   PELSF"
FT   gene            177333..178103
FT                   /locus_tag="Snov_0184"
FT   CDS_pept        177333..178103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0184"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG:
FT                   mrd:Mrad2831_5814 LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87520"
FT                   /db_xref="GOA:D7A110"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D7A110"
FT                   /inference="protein motif:PFAM:PF03746"
FT                   /protein_id="ADH87520.1"
FT                   /translation="MKTIDLNCDMGEGFGVYSLGDDKAMLDIVTSANIACGFHAGDPLV
FT                   MADTLASAKARGVGCGAHPSFMDLWGFGRRPILGQSVGEIEKQLIYQIGALQALAHAQG
FT                   FKLAHVKTHGSLGNMANEDIELARAVARAIKAVDPGFIFIVMPGLPTERAGEEMGLKVA
FT                   REIYADRAYADNGNLASRKLPGAVLHDAEAAAERVLRIVESGEVVSISGARIPVRADTV
FT                   CVHGDTADAVAMARAVRTRLEGAGYGVRPMAEWL"
FT   gene            178254..179339
FT                   /locus_tag="Snov_0185"
FT   CDS_pept        178254..179339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0185"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   lin:lin2932 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87521"
FT                   /db_xref="GOA:D7A111"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A111"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADH87521.1"
FT                   /translation="MRQVEVAVIGTGWCGGIRAETLSRSALVDRLHICEIRPERLEEVR
FT                   ALTNPATATLDYQDIVHNDAIQVVYISTTPESTHFPIARDCLRAGKHVLLEKPIAMELW
FT                   EANELIELSRRNGVKFTIGYSQRFNPKIAYARKSIAEGTLGRVVNVMVSRHLSRNLGKK
FT                   IASRVKLSPAAMESTHDLDFVFWLLEPAKPVRVYSQGAYGYMQEINGSYDCMWSTVTMD
FT                   NGALVVVGGGWNLPPAYPNYCGTWIEITGTEGALILDDTQRDNWLSTVSEGTRFPMSTM
FT                   PGEQVDHVFAGQMGPETIHFLESVLRDRPVMVEPEHARMVMQTYMAADLSAAINEPVDL
FT                   PLSNQSIARIGDLNAAAIAAS"
FT   gene            179360..180115
FT                   /locus_tag="Snov_0186"
FT   CDS_pept        179360..180115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0186"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: bxe:Bxe_A4083 GntR family transcriptional
FT                   regulator; PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87522"
FT                   /db_xref="GOA:D7A112"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A112"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADH87522.1"
FT                   /translation="MSDADPAVPEKPGRAARYSEIEAALRAEINAGTHPVGAHLPTEHE
FT                   LCARFAASRFTIRQALAGLREEGLIDARAGVGTIVLASRRRETFVHRLSSIEELLQYPS
FT                   ETRRQHIRTDALAASPELAMLLKCRVGQPWVRLKALRLTQASLAPIAYFDIYVLPEHAG
FT                   VFDLPNPEGVSVLRQLEEMLNVRAAHAQVEIFVGHVTAELAEPLMARQDDPALVIIRRY
FT                   RGQDGAVFLVTYSVHPENRFTLNIEFERR"
FT   gene            180301..181437
FT                   /locus_tag="Snov_0187"
FT   CDS_pept        180301..181437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0187"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: ypg:YpAngola_A2081 oxidoreductase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87523"
FT                   /db_xref="GOA:D7A113"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A113"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADH87523.1"
FT                   /translation="MPRKSPRGIGLAIVGAGRVGLFRGAVAARHPAVEWIGLAEIDAEK
FT                   GRRIGAEIGADFVTTSHRELLKRPEVTAVIVATDEHLHVDPVMAALERDLPMLIEKPLA
FT                   THLDDSARVLREIEASGVDAVVGYTQRFRRRWLAAKEKVRTGALGDVTMVTSRAFMNRL
FT                   VAIDNYRRSNAPETISPMVISGTHALDIVMWYLEAKTPVEVYARSVDKVLGPDWRGIDG
FT                   TAGMIMMSDGSLYHLNISWALPVTWPGAVYSLEVGIVGTTGVLTIDDTHRDIVLAVSAP
FT                   QEEGYLPDKTRLVDFMGSYPPGDMALGELRGPMRTETESWLNRIALDLPTQHATAAEAH
FT                   NRLMLTKALDLSAKLKRPVKLPLEVEGERELMREAAMA"
FT   gene            181505..182503
FT                   /locus_tag="Snov_0188"
FT   CDS_pept        181505..182503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   dia:Dtpsy_2869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87524"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D7A114"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ADH87524.1"
FT                   /translation="MNAAVTFTRRAGLALLAGATLAAAVPAHAQSDYPNQPITVIVPFA
FT                   PGGASDFAARLLQPKLSEILGQQIVVENRDGAAGNVGMDLAARAKPDGYTLFLGNVGTV
FT                   SINPYIFSSLRVKPLQDFAPISIVADTPGLMIANPKFPPNNVKELVEYVKARPGQVNFA
FT                   SPGTGSVNRLEMEAFRREAGLDMIHVPYKGGAGPAAADVMGGHVSLMFVTISSGINHVK
FT                   GGRLKALGVTTKERVAQLPDVPTMTEQGFPKSVSSSWQGLLAPAGTPQPIIDKLHAAVV
FT                   EAMKDPTIRARMAESGVIAVSSPSPAEFKAYIKADADKWSGIIKEIGAKAD"
FT   sig_peptide     181505..181594
FT                   /locus_tag="Snov_0188"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            182626..183072
FT                   /locus_tag="Snov_0189"
FT   CDS_pept        182626..183072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0189"
FT                   /product="protein of unknown function DUF1468"
FT                   /note="PFAM: protein of unknown function DUF1468; KEGG:
FT                   mms:mma_0471 small permease component of tripartite
FT                   tricarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87525"
FT                   /db_xref="GOA:D7A115"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:D7A115"
FT                   /inference="protein motif:PFAM:PF07331"
FT                   /protein_id="ADH87525.1"
FT                   /translation="MDIRISSDFLTGLLFCGLGAVAIIIGSDYPIGTAARMGAGYFPLL
FT                   VSSGLILLGGVLIIRSFVTETEEVGSIDIRPLALLIGSILLFGLLIEDWGFPVAGLAVV
FT                   IGARIAGRQYKPLETILLAVGLVGFCLVLFSYGLGLHLPATHLW"
FT   gene            183083..184591
FT                   /locus_tag="Snov_0190"
FT   CDS_pept        183083..184591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0190"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112
FT                   transmembrane; KEGG: xau:Xaut_1332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87526"
FT                   /db_xref="GOA:D7A116"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:D7A116"
FT                   /inference="protein motif:PFAM:PF01970"
FT                   /protein_id="ADH87526.1"
FT                   /translation="MELFNELMLGFSVALTPANLLYGFLGVLLGTVIGVLPGLGPVATI
FT                   SILLPVTFALPAPAALIMLAGIYYGAQYGGSTTAILVNLPGESSSVVTAIDGYQMARKG
FT                   QAGLALATAALCSFIAGTLATLVIAVAAPALAEVALDFGPADYFSLMLFGLVAAVILAH
FT                   GSIVKAIGMILVGILLGTIGIDANTSVERFTFGVPAFGDGIDFAVIAMGMFGIGETISN
FT                   LEHKDSGRSFVKEVRGLWPGWADIKRFIGPALRGTALGGCLGLLPGGGPVLASFSTYAL
FT                   EKKLSKTPGEFGHGAIQGVAGPEAANNAAAQTAFIPMLTLGLPSSAVMALMIGALMMQG
FT                   LSPGPQLMNQRPDLFWGLIASMWLGNLMLVVLNLPLIGIWVKLLSVPYRMLYPAIMLFC
FT                   CIGVYSINNNALDVVMAAVFGGFGYMMRRLHCEPAPLLLGFILGPMIEETLRRALLISH
FT                   GDPMVFIERPISLSFLVLTFLLLIVLVAPMIRVTRQRAFEESTD"
FT   gene            complement(184670..185629)
FT                   /locus_tag="Snov_0191"
FT   CDS_pept        complement(184670..185629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0191"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: dac:Daci_4360 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87527"
FT                   /db_xref="GOA:D7A117"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A117"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH87527.1"
FT                   /translation="MELRSIEAFVRVAELGSITRASRDLGIVQPALSRHIQRIETEIGT
FT                   PLLVRLPRGVQLTLAGRRFLQHSRRILQEVARAAEEMNIGGDCLSGRVVVGISPTLSSL
FT                   LTPGLIERCASTYPAINLTIVEEFTRRLQTDLVNGQVDLALLTNPPPNRALRFTAVLTE
FT                   PIVVVMPRHSRGVSPVVTLDELASTPMLVTRGIRAMVDEQLAPHGVCIEVDCEIDAVEA
FT                   IRRMLLRGRGASIMPISAFRKEIDDGLLTGLAVGGVNLSRTIMLSHVGDKVSAAAHAVM
FT                   GLLRAEIDSLAQRGLFSALPDTSSHWAQPQQRGLAGAA"
FT   gene            complement(185693..186238)
FT                   /locus_tag="Snov_0192"
FT   CDS_pept        complement(185693..186238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0192"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bpy:Bphyt_5467 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87528"
FT                   /db_xref="GOA:D7A118"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D7A118"
FT                   /inference="protein motif:PFAM:PF02627"
FT                   /protein_id="ADH87528.1"
FT                   /translation="MDDLTAAPRYRELDPAHLDPAQRRIFEEIGRPRAGAVPAPFHIYV
FT                   ESPELAETAQALGAFCRYRTGLPPRLSELAILTTAAHWGAEYEFGVHAREARKAGVPEA
FT                   EIEALAAGRRPHFTDPDAALVHDFAGAVYREKDVPDELFAAAVERFGRRTVIELTGLLG
FT                   YYSMIAIALRVFRVPPPA"
FT   gene            complement(186248..187270)
FT                   /locus_tag="Snov_0193"
FT   CDS_pept        complement(186248..187270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0193"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: jan:Jann_2956 oxidoreductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87529"
FT                   /db_xref="GOA:D7A119"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A119"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADH87529.1"
FT                   /translation="MIRAAIAGLGWWGKHMIRRMADSDELRIVAAIDTSDAQGAFAAEH
FT                   GIPLTTDWDDVLNDPSIDAVILCTPHSLHTAQVAMAARAGKHVFCEKPLALTRADAERS
FT                   VAACRAAGVKLGIGHERRYEPAMLEIKRLVQSGALGTIMHVEANFSHDKLAAVPKTDWR
FT                   ASTVDAPAAGMTAMGIHLTDGFIELFGPIDEVYASTATRATDRPNGDVVSVHTRFASGA
FT                   TGYLNAILVTPLYIGITVFGTDAWVEARNHTHPDTPGPTTLTLQHKDGRREVRDYEWTD
FT                   TVRANLEAFARSIESGTPYVFTDEQKVGNIAVLEAICRSVATNAPVKVEADRPALAASA
FT                   "
FT   gene            complement(187317..188417)
FT                   /locus_tag="Snov_0194"
FT   CDS_pept        complement(187317..188417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0194"
FT                   /product="Luciferase-like, subgroup"
FT                   /note="PFAM: Luciferase-like, subgroup; KEGG: jan:Jann_2939
FT                   luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87530"
FT                   /db_xref="GOA:D7A120"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D7A120"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ADH87530.1"
FT                   /translation="MKLGFFTMPIHPLHRPLAETLQEDREFCLIAEKLGFCEGFFGEHI
FT                   TDGAETITSSLIFIAWLLNETSTIKLGSGTINLPNQHPARVAGEVAMLDHMAEGRYLMG
FT                   ISPGGLLSDAEVFGNLDKDRTEMFVEAIDHVLAIWSEEPPYKRVGKHWTITTERTNIPA
FT                   LGQGAIHKPYQRPHPPIVVTAVAPFSKGVTEAAIRGWDPISANFLLPVWVKTHWPKYVE
FT                   GCEKGGRPADPANWRVAKSIFVADDLATARRYATEPGSPYYAYYNSLATKLVGNGRANL
FT                   FKRDQSAPDSSVTVESVLADLVIWGTPDKVADELAAFEDEIGEFGTLLYAGHDWADRGL
FT                   AIRSLELMAEKVMPAVNAGRRSAAAE"
FT   gene            complement(188414..188971)
FT                   /locus_tag="Snov_0195"
FT   CDS_pept        complement(188414..188971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0195"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: nfa:nfa12490 putative oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87531"
FT                   /db_xref="GOA:D7A121"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D7A121"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ADH87531.1"
FT                   /translation="MSEHVIDFRSSDDHGHFRRALGRFATGVTVVTTRTADGKLEGLTA
FT                   NSFSSVSLDPPLVLWSLRRQAPSLSSFTAAGHFAVNVLGTHQKHLCRHFATPHADKFDV
FT                   VPHRIGDHGAPLIEDAIARFECRTEQVIEAGDHLIFLGRVLRATHRDGEPLIFATGALC
FT                   SPALLPSDPPINDHSANRERAS"
FT   gene            189042..190016
FT                   /locus_tag="Snov_0196"
FT   CDS_pept        189042..190016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0196"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: jan:Jann_2940 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87532"
FT                   /db_xref="GOA:D7A122"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A122"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ADH87532.1"
FT                   /translation="MAMSTTLRDVRLFVAAYEERSFTAAAERENATQSGVSQHIRKIED
FT                   RFGVKLFARGGGSVQPTPAGESYYRHCIELLRLNEMANRSVGRFGAGLDGEMVVGLMPT
FT                   MTRSVLAPALARFVALHPNVGVRIWEAYSANLTQQVRAGELAFAIVPASTGTVGVKTTR
FT                   FAYTPEVLVSGAAAGREHMKALRLVDLGPLKVVVPSAQNARRASIETYLASNGVAVERR
FT                   LELDAMMGTLDFVASTDWVAILPGLMMAEEAARPVSPGTLRRFTVNPIADPPLGMDLVR
FT                   IEPARRPLSPAAAAFLDVLADETARVGGVWGERAGLYEEAGVS"
FT   gene            complement(189992..190450)
FT                   /locus_tag="Snov_0197"
FT   CDS_pept        complement(189992..190450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0197"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   mms:mma_0820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87533"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7A123"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADH87533.1"
FT                   /translation="MSAPAATERGTINEGAFKAGDGAYLFQLDALSAIEGGPGYSTAIG
FT                   SVVEGIRTQCGLMRKARGTGARPHSHPNEQWNYVVQGRLRVNIEGEPERIAGPGTLIYF
FT                   PPNVTHYTIALPEEDVVFFVVKDTTHGIAGKAADGTMSGGHYDTPASS"
FT   gene            complement(190469..191563)
FT                   /locus_tag="Snov_0198"
FT   CDS_pept        complement(190469..191563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0198"
FT                   /product="Malate/L-lactate dehydrogenase"
FT                   /note="PFAM: Malate/L-lactate dehydrogenase; KEGG:
FT                   dsh:Dshi_2546 malate/L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87534"
FT                   /db_xref="GOA:D7A124"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:D7A124"
FT                   /inference="protein motif:PFAM:PF02615"
FT                   /protein_id="ADH87534.1"
FT                   /translation="MNAAVKPEPGAAASLPSAALEGLIADAMRACDLPPEDARGVARLM
FT                   VEADLTGADGHGIFRLPQYVRRLKGGGVNPTPRIEVERAAPGVALVDGDNGMGHLVMSV
FT                   AVEHAVALAREIGVAWVGVRRSNHAGPAALYVDMLARRGMVGIYSVVASSNHMAIWGGT
FT                   SSLLGTNPLAIAIPAGEDAPPVLLDIATTVVSYGTVKKHVLNDIPLPEGWLVSKQDGSA
FT                   ITDPKRSGEGLLLPIGGHKGSGLALMLGLLAGTLNGAAFGSEVVDFNADSSTETNTGHF
FT                   LLALDVARFMRPEAFAALLAQQLNGLRADAPLPGTEGVRIPGDRRAALRETRARDGVPI
FT                   APPLRRQLDELATSLAIPPLDDRL"
FT   gene            complement(191560..191970)
FT                   /locus_tag="Snov_0199"
FT   CDS_pept        complement(191560..191970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0199"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   rhi:NGR_c25840 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87535"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7A125"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADH87535.1"
FT                   /translation="MSNAAILRPDQLPVTERGGGARTVRLVTAELGSQKLLNGITRFGP
FT                   GASIPLHSHNCEESVIILEGDAVFEIDGVTHELKTHDTTWIPPDVPHRFRNASDSAPLA
FT                   IFWTYADVAATRTMAATGETRSIASEHAGNGR"
FT   gene            complement(191967..192992)
FT                   /locus_tag="Snov_0200"
FT   CDS_pept        complement(191967..192992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0200"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: swi:Swit_1683
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87536"
FT                   /db_xref="GOA:D7A126"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7A126"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ADH87536.1"
FT                   /translation="MNAPVIDVHAHILTEEMMARMRREAPEIGPTLSEVDAEGGVLKVG
FT                   DIVQRPFPRGGWDLDRRFADLDHAGFDLQVLSNCPQTFLYEREAALTAALCQIQNEAIA
FT                   DLVRRHPSRFLGIATLPMQDPARAANELRRAVTRLGLKGAQIGSHIEGRNLDDPALEPL
FT                   WATAEELGAFILIHPQKTAAGERTKEFYLKNLIGNPLETTIAAASLVFGGVLERYPDLR
FT                   ICLVHGGGFLPFQTGRMIHGWKERPECRRLIKESPEVSIRRLYFDTLTHFGPALRYLTD
FT                   TFGAGHVLLGSDYPFDMGTLEGARQVRAAGLAPAEEAAILGGTAAGWFGLSAAERKAVR
FT                   A"
FT   gene            complement(193002..194531)
FT                   /locus_tag="Snov_0201"
FT   CDS_pept        complement(193002..194531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0201"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112
FT                   transmembrane; KEGG: ach:Achl_0355 protein of unknown
FT                   function DUF112 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87537"
FT                   /db_xref="GOA:D7A127"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:D7A127"
FT                   /inference="protein motif:PFAM:PF01970"
FT                   /protein_id="ADH87537.1"
FT                   /translation="MDALASLAHGFSVAMTPTNLLFVLIGVTLGQLIGALPGIGPSAGM
FT                   ALLLPVTFGLEPVTALVMLSGIMYGGMYGGTLTSVLVNVPGEAASVMTAVDGNQLARQG
FT                   RAGQALAAAAIGSFLAGIGAVTALAFLTPILSAFALGFSAPEYFLLALLGITATASLGT
FT                   GSAVKAMIGATLGLMIALVGTDPIQGTSRLTFGSLELLEGIDFLPVAIGVFGIAEILVS
FT                   MEQTQASRAVRTRLRDMWLTGKDWAECRMAMLRGGLVGFVIGLMPGAGPTVAALLAYIV
FT                   EKKVSPHPEKFGHGALDGVAAAESANNSAAHGAMVPMLALGIPGSASTAVLLAALVLLG
FT                   IRPGPMLLTEQADLVWGLIASMFVGNVILLVMNLPLAPLFASVLRIPYSYLAPGILVVS
FT                   LVGAYAISLSLFNVGLTLFFGMVGYLMIRADIPRAPLVLAVVLAPLMESSLRQSLMLSE
FT                   GSPAIFVERPLSAVLALLVLVSLALPLFNFLLARRAARRAGVEEALSHSSD"
FT   gene            complement(194547..194999)
FT                   /locus_tag="Snov_0202"
FT   CDS_pept        complement(194547..194999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0202"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddr:Deide_3p01370 hypothetical protein;
FT                   putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87538"
FT                   /db_xref="GOA:D7A128"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:D7A128"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87538.1"
FT                   /translation="MRVTNFIVALALFALSAGVLLGTWDLPYWADFAPGSAFAPFWVAT
FT                   IGIILAIALFVATLAEDGSEPHQFPDRRGIARVTALVAGLWLMVLLIPLIGFLSASALL
FT                   CLLLLLGIERRPVVPSLFATAVVISLVYGVFIAWLGIALPAGPFGI"
FT   sig_peptide     complement(194931..194999)
FT                   /locus_tag="Snov_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.629 at
FT                   residue 23"
FT   gene            complement(195082..196104)
FT                   /locus_tag="Snov_0203"
FT   CDS_pept        complement(195082..196104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   mms:mma_1291 tricarboxylate binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87539"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D7A129"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ADH87539.1"
FT                   /translation="MIQPCAARPFHLQLKHSVLAAALGIALAAAPAALHAQTAPTGPIE
FT                   ITTGTSPGGTPDVLMRRAAKILNEQKIVTNPLVVQNRTGGSWMVAANFVMGKKGDRNVV
FT                   LCIAQPILTTPITQGLPTLYDKLTPISMFIQGDLVLVVQPDSPVKDLKQLIEQAAKRER
FT                   SVKVAGAQSGSTDHMVAGLVEKAGKVKLNYVPFDGGGAAQAAFLGGNVELMTLTPSEAL
FT                   PLVKSGKARILAILSSERSTAPELKDIPTAKEQGYDIVWGQAWGIAGPPGLDADTVKFW
FT                   DDAIAKLVANPEWQASLKENFLRSRLIPAAEVKPYMQKLHDEHLALLRDLGLAKQPAVQ
FT                   "
FT   sig_peptide     complement(195994..196104)
FT                   /locus_tag="Snov_0203"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.993 at
FT                   residue 37"
FT   gene            196199..196372
FT                   /locus_tag="Snov_0204"
FT   CDS_pept        196199..196372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87540"
FT                   /db_xref="UniProtKB/TrEMBL:D7A130"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87540.1"
FT                   /translation="MKGIIETYIYRNGIPIIHIGMDKVFVSLYTEKYAARGAPARHVSH
FT                   WEVHVIGVYVLK"
FT   gene            196500..196619
FT                   /locus_tag="Snov_0205"
FT   CDS_pept        196500..196619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87541"
FT                   /db_xref="UniProtKB/TrEMBL:D7A131"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87541.1"
FT                   /translation="MSYILTYIRRYIRICFTQSGYVYCIHNPDNLDQMRGDER"
FT   gene            complement(196629..197636)
FT                   /locus_tag="Snov_0206"
FT   CDS_pept        complement(196629..197636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0206"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: rce:RC1_0589 cobalamin
FT                   synthesis protein CobW, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87542"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:D7A132"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ADH87542.1"
FT                   /translation="MAIPVVLITGFLGSGKTTLLNHLLWDPEMGDTAVIINEFGDVAID
FT                   HLLVESAIENAVVLQSGCICCTVRGDLVDTLDDLCAKVARGELPPFSRIAIETTGLADP
FT                   ASLVRTFLTERLLADRFTLRAVVTTVDAVNGAVQLDEFEEARHQAALADVIVLTKSDLA
FT                   SPEAVASLTARLKEANPSAAIVPVVHGAIAPDTLFALVPAHPSRADDEVLAWLNSEAFE
FT                   ETDGHAHSHHDSSIKPFAVTLDRPVTREALRSWLRSILSLRGADLLRMKGIVALKGEAA
FT                   PIVVHAVQNALYPPVQLAAWPSDDHTTRIVFITRDIAPEALRNSLEVLASRSAA"
FT   gene            complement(197658..198896)
FT                   /locus_tag="Snov_0207"
FT   CDS_pept        complement(197658..198896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: avi:Avi_5158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87543"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="UniProtKB/TrEMBL:D7A133"
FT                   /inference="similar to AA sequence:KEGG:Avi_5158"
FT                   /protein_id="ADH87543.1"
FT                   /translation="MLDHTKAADVKIDLISGMKLIAHDPLAGFGGVGEGMSLQKAPDGR
FT                   RILWLAHEGPPKNFTGVDVTDPSRPKVIVQTDLPHNKVRSNSLETTGDVMAVAYQTYQP
FT                   GLQPAGIELFDISVPENPRSISFFDCSGPHSRGVHQVWFVDGEFIHCAAGAADFTPRNP
FT                   LDDQAYRIVDVRNPSKPVEAGRWWMPGTAEGDDAPPPERLKIDSGFRCHNTNVYPARPD
FT                   RAYVGYIDGGFYVMDISDKSRPTVISRFNPNPPFPGFAHTLLPLFGRDLAVATHECIHD
FT                   DGFDWPKLTWLLDIRREDNPVPLSTLPMPSFEEYSRKGGRFGCHNVHENPPRDTALQSE
FT                   ALIFSTLFNGGLRVHDISDPLAPREVAAFVPSAPPGARVPAIQINEVYVDENGIVYCAD
FT                   RHAGGLYILELDI"
FT   gene            complement(199037..199780)
FT                   /locus_tag="Snov_0208"
FT   CDS_pept        complement(199037..199780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0208"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: azo:azo2437 transcriptional regulator; PFAM:
FT                   GntR domain protein; regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87544"
FT                   /db_xref="GOA:D7A134"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A134"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADH87544.1"
FT                   /translation="MSLQPVVTNDDDATTLGIEIYARLRRDLIAGHHKPGERLRFRQLS
FT                   AAYSVGIAPLREALSRLVSDQLVRFEGHRGYTVAPLSLSDLNDLCALRTELSCNALRRS
FT                   IAQGDEDWEAEILAALHRLERAPLPHSVEDRKTVDEWEQRHDRFHYSLIAACGSPWLLH
FT                   FCGALSDHFQRYRRAVIVVTSSSEALLKRVREQHRTVAEAAIARDAERATTVLAEHFRG
FT                   SVEVVIRNYEEVSRSLSAGNGDDGR"
FT   gene            complement(199880..200572)
FT                   /locus_tag="Snov_0209"
FT   CDS_pept        complement(199880..200572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0209"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: jan:Jann_2950
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87545"
FT                   /db_xref="GOA:D7A135"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7A135"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADH87545.1"
FT                   /translation="MAGRSSTSLAAGAKPPAPRRTRNKPEERHREFVRKAVELFAEVGF
FT                   EAGTRELAQRLGVTQPLLYRYFPSKDDLIAAVYQEIYVNRWKPEWREGLIDESRPIRDR
FT                   LIAFYEDYTETIFTPEWLRIYLFAGLRGVDINRRYAATVEAEILRPITVATRKSFGLGD
FT                   DDPPTPEEVELSWTLQGGIFYYGVREIVYRFPRTVDRATMIRNAVDTFLAGVGSVMKRL
FT                   AERESDPA"
FT   gene            complement(200607..201827)
FT                   /locus_tag="Snov_0210"
FT   CDS_pept        complement(200607..201827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0210"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain protein"
FT                   /note="PFAM: Acyl-CoA dehydrogenase type 2 domain; KEGG:
FT                   bja:bll6096 putative pigment protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87546"
FT                   /db_xref="GOA:D7A136"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D7A136"
FT                   /inference="protein motif:PFAM:PF08028"
FT                   /protein_id="ADH87546.1"
FT                   /translation="MSHTIPLAAPRTIRSAAEQRHDELLQRATDLATAFAERAPRAEEL
FT                   SRLPPENERDLHESGLYRMLQPEAVGGSEVGYESLITIGAALAAGCASTAWNLTNLASH
FT                   HWMLAMFAPAAQDRIWREDPDALIASSFVFPAAKVTKAPGGYVLSGRWPFSSGVDVCSW
FT                   NMLAGIVRAEGEAPDHRVFLVPRSDYRILDTWHVTGLKGTGSNDVQCEEVFVPEEMSVS
FT                   VEHLKGGLTPGSERHPAPLYRLPVFALFPAILSGVGLGNGEGALTAYVAATRKRSANYT
FT                   GARLAELQSIQIHIGNAATRLAHARRVMLAICEEAMRDAERGHVPDMVTKFAYRRDLAY
FT                   ATKLTTKAVDEINAGSGAQALYLSGSQQRRFRDAHAISAHIAFSTDVANAAFGRLALGL
FT                   EVDNPVV"
FT   gene            complement(201840..202319)
FT                   /locus_tag="Snov_0211"
FT   CDS_pept        complement(201840..202319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0211"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87547"
FT                   /db_xref="GOA:D7A137"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D7A137"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADH87547.1"
FT                   /translation="MRATGLNHLSIGAKDVDASVRFYVEMFGMEVIPTYNFGFRTQYLR
FT                   CGDQQLHIFGLPDATPHYQHFAINVDDFMGVYERARDAGLIDHATFGNGVNEMPDGTVQ
FT                   LYLRDPGGNLVEVDWPDVSSLDTGRIPELKRLADRFEQVGENLEATLFLDRRRRA"
FT   gene            202488..203804
FT                   /locus_tag="Snov_0212"
FT   CDS_pept        202488..203804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0212"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="TIGRFAM: histidinol dehydrogenase; KEGG:
FT                   mno:Mnod_4267 histidinol dehydrogenase; PFAM: Histidinol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87548"
FT                   /db_xref="GOA:D7A138"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:D7A138"
FT                   /inference="protein motif:TFAM:TIGR00069"
FT                   /protein_id="ADH87548.1"
FT                   /translation="MARHLKTARSVEERADADAQVRATVETILAEIEAGGDAAVRAYSE
FT                   RFDTWSPASFRLSEREIEKALSQVSKSDLDDIRFAQAQVRNFAEKQRACLTDLEVETLP
FT                   GVILGHKNVPVERVGCYVPGGKYPMVASAHMSVVTAKVAGVKSVVAAAPPFRNGPHPAI
FT                   VAAMHFAGADEILVLGGVQAVAAMALGTETIAPVDMLVGPGNAYVAEAKRQLYGRVGID
FT                   LFAGPTETLVIADETVDAEICATDLLGQAEHGPTSPAILLTNSEKLARETMAEVERLLA
FT                   ILPTGEIASVAWRDFGEVIVCDDVEEMVREADRIASEHVQVMTADPDYFLANMRNYGAL
FT                   FLGPRTNVAYGDKVIGTNHTLPTRRAARYTGGLWVGKFLKTCTYQKVTSDAASAEVGEY
FT                   CSRLCVLEGFLGHAEQANVRVRRYGGGNVDYATAARRAG"
FT   gene            204067..204711
FT                   /locus_tag="Snov_0213"
FT   CDS_pept        204067..204711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0213"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: met:M446_0530 GntR family transcriptional
FT                   regulator; PFAM: GntR domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87549"
FT                   /db_xref="GOA:D7A139"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A139"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADH87549.1"
FT                   /translation="MKLVRNRVYEMVRREILSCAIVPGAELREADLAERFGVSKSPIRD
FT                   AMQKLELEGLVEIEPRRGHRVMPVSISDAADMLELRLILETAGVRKVALVATDAELAGL
FT                   DNFRDADTSSIPVFTEYNRRFHHHLAALARNRRLAEEMSRVMDLYERLCMVSLSAVTAH
FT                   GRNEGPLREHNDIIDALQARNGNAAARMLKRHIGRSQSQILRALESRPIVA"
FT   gene            204887..205687
FT                   /locus_tag="Snov_0214"
FT   CDS_pept        204887..205687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0214"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ABC transporter related protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87550"
FT                   /db_xref="GOA:D7A140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A140"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87550.1"
FT                   /translation="MNAIASQLVAASTSHIDPDIVISARDLVKAFNSEVVALDRASFDI
FT                   KRGSFVSLVGPSGCGKSTLLRLVAGLIGKSAGELSVLGHGVTGPSHDVGMMFQRPTLLE
FT                   WRTAVENVLLPTEVQGATTDADRRRAIELLQLVGLRDFEFSFPRQLSGGMQQRVALARL
FT                   LQTGANILLLDEPFGALDEFTRERLNLELLRIVDDVEATVLFVTHNISEAIFLADQVMV
FT                   MTPRPGRLAKIVDVSFERPREIALMQTPEFNRLVGEVRSILGGH"
FT   gene            205689..206564
FT                   /locus_tag="Snov_0215"
FT   CDS_pept        205689..206564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0215"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mno:Mnod_2985
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87551"
FT                   /db_xref="GOA:D7A141"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A141"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87551.1"
FT                   /translation="MSLATDGNLSMTDVARERGGLAGRVMRHVALFLGVMLVWELASYY
FT                   QFVDPLILPRPTAIAAALVNMVLYQGTVWFHLGVTLWEAVAGFVIGSAIGIGLAVAAGL
FT                   NESFRRYISPYIIALQVTPRIALAPIVIAWLGFGMMPKIAIGALICFFPPFINTLTGLL
FT                   NVDEDANEMFRSLGARKRQIFFSLMLPNAMPIIMAGLKTAISLALIGAIVGEFISASEG
FT                   MGVLMQRYTFALNMASSFAVLVILTAMGYVLFLLMEWADNWLVYWRHDARMTAISRKKA
FT                   RAWGGVTGRR"
FT   gene            206673..207749
FT                   /locus_tag="Snov_0216"
FT   CDS_pept        206673..207749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0216"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   dsh:Dshi_2543 NMT1/THI5-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87552"
FT                   /db_xref="GOA:D7A142"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:D7A142"
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /protein_id="ADH87552.1"
FT                   /translation="MLTDNIAFSRRNCLGLMAGTAAGLALGPFATRAARAQGLRAINVI
FT                   MPLPRSANFYPLIAGEALGYFEKEGVKVNLLPSSTTVPYVAFVQNGQAELAMLDAPQTF
FT                   QSVQAGIPIKVVYEGMQRAPEGIAVSADSPITSVEQLKGTTVGLVSDRDRTTLAIALDT
FT                   KGISIDDVKTVVVGEAGPTLANAFRKQTVSAISGAVPDWLSLQANGMKIRLITPSEVAD
FT                   TPANSFVVNAARIDELRQPLIGFFRAWSKGMVVGKIDVETLAVMCRKAVPEEWENPTFG
FT                   REFLDASIPMNYSVTPKLGDLQPEVWKRVQAPMVKLGELQKEIDPATFLDRSLIDPAND
FT                   FSREQVAADVAAWKAKSM"
FT   sig_peptide     206673..206783
FT                   /locus_tag="Snov_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.600 at
FT                   residue 37"
FT   gene            207812..208903
FT                   /locus_tag="Snov_0217"
FT   CDS_pept        207812..208903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0217"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: pat:Patl_0847
FT                   aminocarboxymuconate-semialdehyde decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87553"
FT                   /db_xref="GOA:D7A143"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7A143"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ADH87553.1"
FT                   /translation="MDHSIIDTRTLGGSVNRYGPTSARAPAATPARLDTVTVDIHAHIA
FT                   VPEAHAYVAPHLDVGQIAMVKYSSDETRMVNQRQDQDRASTMVDMDDRLKVLDKLGIDI
FT                   QVVAPPPFQCYYTVDAEHGVKANRMVNDGIAAFVARRPDRFAGLGTLAMQDPASAPAEL
FT                   ERCVRVLGLKGVELLTNVNGRELSSPEYEPVFAKAEELGALLMIHPNGFTGGERFTRFY
FT                   FSNVIGNPLETTVALHYLIFDGVLERHPKLKLLAVHGGGFLPAYSGRIDHAWGARKDSN
FT                   GGLPKPPTEYLRRVYFDSVVFTPHQLEYLVNTYGADHIVMGTDYPYDMADYDPVQHVLS
FT                   VESFDDETRAKVAGGTAAALLGL"
FT   gene            208906..209820
FT                   /locus_tag="Snov_0218"
FT   CDS_pept        208906..209820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0218"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   jan:Jann_2944 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87554"
FT                   /db_xref="GOA:D7A144"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D7A144"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADH87554.1"
FT                   /translation="MGLLSERAPYLAFPDRPRLHLPGEARVAVWVIVNVEEWSIARAMP
FT                   RTVLPPPMGQPLMPDLPNWAWHEYGMRVGFWRLLKAIEQRGLRATFAVNGHVCRSYERV
FT                   ARAARDAGWEFMGHGYVQQPMHNTEDQRAAIFDTVAAIRDFTGRPPPGWESPGLTENNE
FT                   TLDLLKEAGIGYVANWVIDDLPLELDTPHGPILSVPYSVETNDIVVHAVQHQPSDAFNR
FT                   RCVDQFDRLWEEGGDNAKVMAISTHPYLTGVPHRIGYFEQLLDYVCSRDQVALMTGEEI
FT                   AGWYRGEQARLGSERREARAARG"
FT   gene            complement(209785..210456)
FT                   /locus_tag="Snov_0219"
FT   CDS_pept        complement(209785..210456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0219"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aav:Aave_0904 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87555"
FT                   /db_xref="UniProtKB/TrEMBL:D7A145"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87555.1"
FT                   /translation="MIALAGPAPWPVPYGIDKMPTGPTSLDRFPRVLLHPGKVLRLNDE
FT                   AFELPPPAIGQETVATDIRLADHLKRLSGTWNRPATLFIDGYFEHLRQVIAAHRTAIVE
FT                   HLAPVAGLFAPEDVLYSAPLPLPRALPPLPDGESVMVDMLFWLGGRAEAVLFAPSPLLP
FT                   AAERRRREGLAAVGIGVTVLTAGELVEPDTFAALLGEQGRAFWQDERLPSAPGGPRLPP
FT                   F"
FT   gene            complement(210453..211307)
FT                   /locus_tag="Snov_0220"
FT   CDS_pept        complement(210453..211307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0220"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: aha:AHA_2938 taurine
FT                   transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87556"
FT                   /db_xref="GOA:D7A146"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A146"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87556.1"
FT                   /translation="MMNMAGAQPLARAPTSPTQKAPVPPAPRTLSPRMVDIGVQVAVVA
FT                   ALAGLWEFGARFGALNPFLLPPLSVVLGRIWEDLIAGTVLVDLGLTLYRALAGFAIGAV
FT                   IGIPLGILMARSALVRWFFDPLVSIGFPMPKIAFLPIFILWFDIYDTSKIIMVAFSCFF
FT                   PIVAATYAGCSSLDKWPIWSARSFGAKERDLLWEVYLPMAMPQIITGLQVALPVGMITT
FT                   IVTEMLMGGRGVGGAMIMAGRFADSVGVFAGIVQIIILGFVVVKSLEIVRRRILVWHPE
FT                   SRR"
FT   gene            complement(211304..212101)
FT                   /locus_tag="Snov_0221"
FT   CDS_pept        complement(211304..212101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0221"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bja:bll6090 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87557"
FT                   /db_xref="GOA:D7A147"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A147"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87557.1"
FT                   /translation="MSDILAGRRRPAGLAYAAVDLAVRFSPVLVLAVFWEFLGLSGIVS
FT                   QQMLPGLMEIFAAFVDMLVNGDLLYNTARSVSRAAAGLGAAVVVGVVVGLMMAQFRAAR
FT                   LLVNPIVQIFYPMPKSALIPVVMIWLGLGDSSKILLIFLGCLLPVVVGTYNGARGVNPF
FT                   LLWSASSLGASRLDVLHEVVLPAAMPDILNGCRTALAFSFILMVSSEFVIATDGVGFMI
FT                   SSLGDGGQYPAMFAAIFFVAGIGFAADRIYAMLARHMLRWREA"
FT   gene            complement(212101..212931)
FT                   /locus_tag="Snov_0222"
FT   CDS_pept        complement(212101..212931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0222"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: rci:RCIX444 putative ABC-type sulfonate import
FT                   system, ATPase component; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87558"
FT                   /db_xref="GOA:D7A148"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A148"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87558.1"
FT                   /translation="MSVTTHAAASRQHAHTARGISIRDVSHTYGARTGGMLALDGIDLD
FT                   IGDGEFHCLLGPSGCGKSTLLYLIGGFIPVQAGTISTSSGTVVAPGPDRSIVFQNFALF
FT                   PWKTVKDNVLYGLKKAGVAGAERERRAQRYIDMVHLTGFEDAYPSQLSGGMQQRAAIAR
FT                   TLAVDPGILLMDEPFGALDAQTRRVMQEELRAIWRDSRKTVVFVTHDVQEAVFLADRIS
FT                   IMSARPGRIQHVINVDLPKDRGEEILENRDFIGLSEHIWRLVREQAVAATRGAH"
FT   gene            complement(212928..213956)
FT                   /locus_tag="Snov_0223"
FT   CDS_pept        complement(212928..213956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0223"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   bja:bll6093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87559"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D7A149"
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /protein_id="ADH87559.1"
FT                   /translation="MATRRGALALAAALAALIAVPGAMPAAHADPVKIRIGWSTMPGHL
FT                   IPVLYSKPDILKHYGKSYTVEPIRFRGSSPQITAMAAGEIDMAAFGPLVLALAVTNARL
FT                   DVKVVADIIQDGVDDYHSETFLVRSDSGISKVTDMKGKRVGTNAIGSASDTAIRAMFRK
FT                   NGMRDKRDYTMVEVAFPNIPAMLDEHKIDLGTVLQPMSKQLLATGKYKVLFTSEDAMGP
FT                   SQLVFLAANGKFLEANRQAVLDFFEDHVRAVRWFTDPKNRAEAVKIIANFMQQPPETLS
FT                   HLFTREDYFRDPFMVPNVKSIQESIDIAVDLGLAPAGIKVEPDHVDLSFVKEAQKRIEA
FT                   SQ"
FT   sig_peptide     complement(213867..213956)
FT                   /locus_tag="Snov_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 30"
FT   gene            complement(214224..214982)
FT                   /locus_tag="Snov_0224"
FT   CDS_pept        complement(214224..214982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0224"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mrd:Mrad2831_0925 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87560"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A150"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH87560.1"
FT                   /translation="MSTSTQRTMIVTGGSKGIGAAIARAAGGAGFRVAFSYKGDAAGAE
FT                   QVARDIAAAGGEALTIKADVAREEDVLALFEQVDARFGPPDVLVNNAGGVGPLGRVEAI
FT                   SASALTEVMAVNVVGSFLCCREAVRRMSTRHGGRGGIIVNISSRAAGLGGAGEWVHYAA
FT                   SKGAVDSLTIGLAREVAAEGIRVNAVAPGLIATNLHAVAGAPDRLERLAPSIPMRRPGT
FT                   AEEVADVVMWLASPASAYVTGAVIPVAGGR"
FT   gene            complement(215042..215974)
FT                   /locus_tag="Snov_0225"
FT   CDS_pept        complement(215042..215974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0225"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   mlo:mll1033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87561"
FT                   /db_xref="GOA:D7A1U5"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1U5"
FT                   /inference="protein motif:PFAM:PF05853"
FT                   /protein_id="ADH87561.1"
FT                   /translation="MAAARKVIITCACTGAIHTPSMSPHLPITPDEIIADAIGAAEAGA
FT                   AILHLHARNPENGRPDQTPEAFGRFLPQIRQQTNAAINITTGGSPYMKVEERVLPAARF
FT                   KPEVASLNMGSINFGLYHLLDRYKEFKFDWERQHLEATRDLVFRNSFKDIEYILETCYD
FT                   NGTRFEFECYDIAHLYNLKHFLDRGLVKPPLFVQSVFGILGGIGTHPEDIIHMKRTADR
FT                   LFGDQYRWSVLGAGASQLRVAAMAASMGANVRVGLEDSLWIGPGELAPSSGAQVRKARQ
FT                   ILEGMGLELASPDEAREILQLKGADRVDF"
FT   gene            complement(216055..217008)
FT                   /locus_tag="Snov_0226"
FT   CDS_pept        complement(216055..217008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rle:pRL80036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87562"
FT                   /db_xref="GOA:D7A1U6"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1U6"
FT                   /inference="similar to AA sequence:KEGG:pRL80036"
FT                   /protein_id="ADH87562.1"
FT                   /translation="MEINVGLAAIEEASRKLSNWGRWGKDDHSGTLNHVTPEHVVEAAK
FT                   LIRQGKVFALGIPLDREGPQNGLFGGRFNPIHQMLATGTDAVAGQQDWNKIRYADDTLN
FT                   LCVQGATHWDALGHIFYDDKAYNGHDPRLINSRGLNVLGIEHSKSKMNGRGVLLDIARF
FT                   RGVDWLQDGESISNDELDACAKKQGVEIRKADFVIIRTGQMERCLAEGQWGGYAGGDAP
FT                   GVKFENCYWCAEKEVAAICSDTWGVEVRPNETTEANQPWHWVVIPAMGLCMGEIFYVKE
FT                   LAEDCARDGVYEFFFCGPPLIITGGTGSPINPQAIK"
FT   gene            217371..218204
FT                   /locus_tag="Snov_0227"
FT   CDS_pept        217371..218204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0227"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: jan:Jann_2938
FT                   alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87563"
FT                   /db_xref="GOA:D7A1U7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1U7"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADH87563.1"
FT                   /translation="MTVTPKLDVTDIVVSRDAELAVRVDGADHLPWIVLSNSLAADLTM
FT                   WDDQIPFLTRSYRVLRYDTRGHGRSSAPNGPYSFDMLVADFIAVMDRFDVRQADVLGLS
FT                   MGGMTALGVGLAYPERVNRLICADARADAPPPFVAGWDQRIAAVAAGGMGAVLAGTMER
FT                   WFTAQTRQERPEIVDRAARMVLDTSPVGYAGCAEALKGLDYLRHLPRLEPETLYIVGAE
FT                   DGGAPPDAMRAMAAATPGAQFEILPRVAHISNMEDVAGFNARVAEFLDISRQAAE"
FT   gene            218208..219101
FT                   /locus_tag="Snov_0228"
FT   CDS_pept        218208..219101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0228"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: sme:SM_b20668 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87564"
FT                   /db_xref="GOA:D7A1U8"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1U8"
FT                   /inference="protein motif:PFAM:PF03446"
FT                   /protein_id="ADH87564.1"
FT                   /translation="MTSETKRTVGIVGLGIMGSAYARNLLERGYEVVGTDVAEAAMAEL
FT                   AGQGGRRVGSARAVAEAADIVLLALPSVKALEAVTAEIAGAVRPGAVVCEMGTLPIDAK
FT                   EACRRALEARGAQLLDCPVSGTGAQAAKRDLSIYASGDEAAFRKVEAAFADFARDVRYC
FT                   GGFGTGMKLKYIANLLVTIHNLSTAEALLLAERAGLDLNLVYDAIRPGAGGSRMFDVRA
FT                   PMMIEERYEPATMKMDIYIKDLQLIMDFAREMRAPTPLMAASLPFYFAALAQGRGKEDT
FT                   ASLFAVLKGMTGPAED"
FT   sig_peptide     218208..218276
FT                   /locus_tag="Snov_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.884) with cleavage site probability 0.884 at
FT                   residue 23"
FT   gene            219107..219544
FT                   /locus_tag="Snov_0229"
FT   CDS_pept        219107..219544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0229"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   pnu:Pnuc_0551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87565"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1U9"
FT                   /inference="protein motif:PFAM:PF03928"
FT                   /protein_id="ADH87565.1"
FT                   /translation="MSAVSLDQADIAARVALETARARSAQPLTVVVLDAGGHVVVARRE
FT                   DGSGIARFEIAFGKAWGALGMGISTRGLAARAAKMGTFFNALAAVTDGRMVPVPGGVLI
FT                   RDGANRIIGAVGISGDTSDVDEACAVAGVEAAGLVADIEER"
FT   gene            219546..220268
FT                   /locus_tag="Snov_0230"
FT   CDS_pept        219546..220268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0230"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ara:Arad_12307 short-chain alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87566"
FT                   /db_xref="GOA:D7A1V0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1V0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH87566.1"
FT                   /translation="MTRLDGKTAVVTGAGRGIGRATALALAQAGAHVVAVARTQADLDQ
FT                   LAREGEGRIEPLAADVRDEDFLARIEAMGDLDILVNNAGGNRPKMMVDVDDETLDWMID
FT                   LNIRSVYRVARAAARAMGEGGVIVNMSSQMGHVGSPRRTVYCMTKHAVEGLTKAMAVEL
FT                   APRGIRVVSIAPTFVVTPMTQGMFEDAEFKRFVYDMVPMNDLPVPEDIAQSILFLVSPG
FT                   ARFITGDSLRVDGGWTAR"
FT   gene            221025..221750
FT                   /locus_tag="Snov_0231"
FT   CDS_pept        221025..221750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0231"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bbt:BBta_3436 putative ABC transporter,
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87567"
FT                   /db_xref="GOA:D7A1V1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1V1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87567.1"
FT                   /translation="MSDVSPPPAPVFHARGLSKTYVMGDVEVHALRSVDLDIFEREFVV
FT                   LLGPSGSGKSTLLNILGGLDAPTSGEANWRDHNLVGADDAELTRYRREHVGFVFQFYNL
FT                   IPSLTVLENVALVTEIASHPLNARDALALVGLEHRLDHFPSQLSGGEQQRVAVARAIVK
FT                   SPDVLLCDEPTGALDYETGKVVLAAIVRANQQLGTTTVIITHNAAISGMADRVLRLGGG
FT                   RIVGEERNPRRLSPDEVHW"
FT   gene            221747..224110
FT                   /locus_tag="Snov_0232"
FT   CDS_pept        221747..224110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0232"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bbt:BBta_5376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87568"
FT                   /db_xref="GOA:D7A1V2"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1V2"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADH87568.1"
FT                   /translation="MSLLDRKLLRDISTMRGQVVTISLVIAAGIAVFVASISTYDSLLS
FT                   ARDRFYLNARFPQVFVTLKRAPLSLLSQINEIAGIVTAEPRIVRELIVDSPASVLPISA
FT                   RMVSIQNGGDESLVRLHMRRGTAPLPGDAKSVAINEAYADASGIVPGDDIRILLNGRVQ
FT                   TFRISGTALSAEYVYSVKPGLPIPDDRLYATIWVDRSAVEAAFDLKGAFNDLVVFVAPG
FT                   TDPQAVIAELDRLLEPYGSVGAIERRDQPSNRFLDDELNQQRVMSITIPFIFFGVAAFL
FT                   LNVVLGRLVAAQREQIAALKALGFSAVPIGMHYIKLVAVIVLIGSLLGIACSVAFGEAM
FT                   IAAYRGFFRLPVFTFELTPWSLVAGTAVSFAMASLGVLSAVRNVLVLPPAVAMRPVAPL
FT                   RFRRLRLEGLMTAFGYTPQRMMIVRNLAGRPVRTALTVIGIAFAVPMVVLGLFWRDAID
FT                   HMIDVQFNLVERGNVAVTFPHPFDRGIIYDLARQPGVLAAEGQRIVPVRLRASQRSYLT
FT                   SVIGLPTGSELRRPHDASLRPIDVSAEGITLTRRLAERLDVDLGQVVTIEVMEGRRLRR
FT                   DLPVGAIVDELIGMASYMQMDAINQLTGEGDVVSAAALFVDPAALSDLLRRFKDLPVIE
FT                   SVAVKSYTLSSFMAKIAGLVFVSAGILTAFGIIIAVGVVYNSARIGLQERAWELASLRV
FT                   LGFSGAEVSRILFSEFAFEIALGVPLGLLTSRAIISLIAQFHSNESFQIPGVIGPRTYA
FT                   AAGLVVVLAALASAYVVRRQIDRLDLVAALKTRD"
FT   gene            224113..225312
FT                   /locus_tag="Snov_0233"
FT   CDS_pept        224113..225312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0233"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: bbt:BBta_3438 putative secretion protein
FT                   HlyD precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87569"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1V3"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADH87569.1"
FT                   /translation="MRITVGRGIGLLLLLIAVAGVVWAVLPRPIPVETSKVTKGHFVAT
FT                   VDDDGNTRIRERYVVAAPLAGRLTRVQLKAGDRASTGDVLASILPSPAPFLDPRSRRES
FT                   QERLGAAEAALERAKAMVERARAQAVQAEQELTRTRTLVERGASTMQALERAELAKRVA
FT                   DRDLRAAAFQLHAAEHELDQARALLAQYSDGAKEIPETWSVTAPITGIVLKVNQESETI
FT                   VQPGTPLLELGDPRDIEIVVDVLSTDAVEIRPGARVTIEHWGGPNALEGRVRRVEPAAF
FT                   TKISTLGVEEQRVNVLIDIVSPPDRWSGLGEAYQVDAKIAVFGLEDATIVPAGALFRRD
FT                   DTWHVFTVENGRAQLTPVVVLRRSARSAAIGSGLVLGQSVIVYPSDRIEAGVSVKTSSK
FT                   "
FT   sig_peptide     224113..224187
FT                   /locus_tag="Snov_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.969 at
FT                   residue 25"
FT   gene            225515..226117
FT                   /locus_tag="Snov_0234"
FT   CDS_pept        225515..226117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0234"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: mrd:Mrad2831_5929 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; Cupin 2
FT                   conserved barrel domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87570"
FT                   /db_xref="GOA:D7A1V4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1V4"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADH87570.1"
FT                   /translation="MQAEPVEIEDSVADQLRILAAELRRHRKDRQLSLEALSLLSGVSR
FT                   SMISKIERGETVPSTGTLSRLAEALGTTFSQLMAHPVESEIIVIPADRQPILSDTASGY
FT                   HRRCISPVLPGRGVDWVINTLPALGTSGEFVAHRRGVEEYIYVLKGRLEARVGARRVTL
FT                   ETGDALYFQAHETHQFTNLEAGECEYFLIINSSGLRG"
FT   gene            226180..226566
FT                   /locus_tag="Snov_0235"
FT   CDS_pept        226180..226566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0235"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="KEGG: mrd:Mrad2831_5927 endoribonuclease L-PSP;
FT                   TIGRFAM: endoribonuclease L-PSP; PFAM: Endoribonuclease
FT                   L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87571"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1V5"
FT                   /inference="protein motif:TFAM:TIGR00004"
FT                   /protein_id="ADH87571.1"
FT                   /translation="MTERRLISTPAAPPAAGPYSQAVTAGNLVFVAGQLPLDLSGAVPE
FT                   GVEAQTRQSLANVTAVLDAAGASAASVLKTTVFLKNMNDFAAMNAVYAEVFGTSLPARS
FT                   TIEVARLPRDVLVEIECIALSGQA"
FT   sig_peptide     226180..226248
FT                   /locus_tag="Snov_0235"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.864) with cleavage site probability 0.672 at
FT                   residue 23"
FT   gene            226577..227071
FT                   /locus_tag="Snov_0236"
FT   CDS_pept        226577..227071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mms:mma_0888 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87572"
FT                   /db_xref="GOA:D7A1V6"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1V6"
FT                   /inference="similar to AA sequence:KEGG:mma_0888"
FT                   /protein_id="ADH87572.1"
FT                   /translation="MTDWKGGVLLHIHIAPAASYEMEELAEANLVAGRGIEGDRYFLGT
FT                   GTYSPKPDIREVTLIEIEALEALAKNDPPLQQSPITLDPADHRRNLTTRGVPLNHLVGK
FT                   RFRVGETVLRGGRLNFPCKYLEELLGMPVFLPLYNRSGLNCSIETGGIIRPGDPIEPLD
FT                   D"
FT   gene            227078..228031
FT                   /locus_tag="Snov_0237"
FT   CDS_pept        227078..228031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0237"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; Oxidoreductase FAD-binding domain
FT                   protein; oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   KEGG: mrd:Mrad2831_5925 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87573"
FT                   /db_xref="GOA:D7A1V7"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1V7"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ADH87573.1"
FT                   /translation="MTARMIMKLDVAERVDDATDVILVSLRHPRRPALPAWKAGAHIDV
FT                   HLPDGRIRQYSLCGDPADRTRYRIAVKREMAGRGGSAWIHETLAVGDAVHCSAPRNNFA
FT                   LAPQAGRHLFIAGGIGVTPLAALAYEALQRGDAFELHLRARSRRHAPLLAELERAFAGH
FT                   LHLHLDDEAPASLDDILAWFGVTADAHLYFCGPAGLNAAIAAAAERQSWAAERCHTEVF
FT                   QPTLDENFKPEPFDITIASTGQTLRVPADRSALDILRANGFVMPSSCELGVCGACICGY
FT                   RDGTVIHRDSVLSLADRQDKLTPCVSRARVGVTLEL"
FT   gene            228082..229425
FT                   /locus_tag="Snov_0238"
FT   CDS_pept        228082..229425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0238"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mrd:Mrad2831_5928 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87574"
FT                   /db_xref="GOA:D7A1V8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1V8"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADH87574.1"
FT                   /translation="MEDLTVSLSTMDAGADVPAVPTGSLSPGERRKVVWSSVIGTTVEW
FT                   YDFLIYGTAAALVFNKLFFPSFDPVVGTIAAFGSYAVGFLARPLGGAVFGHFGDKLGRK
FT                   AMLSLTIIIMGAGTFLIGCLPSYDQIGIWAPILLVALRLVQGLGIGGEWGGAVLMVVES
FT                   VPDNRRGFFGSIVQLGYPLGVLASIGVFAMATKLPEAEFLSWGWRIPFLASALLVVVGL
FT                   FIRLRLHETPAFQRVKKQNTVSKLPLVEILTRHPRTFLTAVGLKVSEIAYVSVVTVFSI
FT                   SYVTVQLGLPRSVILNGLLIAAFIELFTIPLFGWMADRFGRRVMFVFACLFSIVFAFPL
FT                   FWLFDTADPTVIAITVAIALSLGQGVMFAIGAAWMSELFDARLRYSGASLGFQVGAALS
FT                   GGFTPIIAAALLAWSGATWPISIYLVILALITLWATFCAPETAGKKID"
FT   gene            229523..229819
FT                   /pseudo
FT                   /locus_tag="Snov_0239"
FT                   /product="hypothetical protein"
FT   gene            complement(229982..230058)
FT                   /locus_tag="Snov_R0003"
FT                   /note="tRNA-Arg4"
FT   tRNA            complement(229982..230058)
FT                   /locus_tag="Snov_R0003"
FT                   /product="tRNA-Arg"
FT   gene            230297..231139
FT                   /locus_tag="Snov_0240"
FT   CDS_pept        230297..231139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0240"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: xau:Xaut_4128 UBA/ThiF-type
FT                   NAD/FAD binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87575"
FT                   /db_xref="GOA:D7A1V9"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1V9"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ADH87575.1"
FT                   /translation="MTTTDAPAPARASVFSADEVERYARHLVLAEIGGPGQQKLKKASM
FT                   LVVGAGGLGAPALLYLAAAGVGRLVVIDDDIVSLSNLQRQVIHTTERIGQPKTESAGAL
FT                   VAALNPHVVFEGVDARITADNAMELVSSVDVVIDGSDNFSTRYLVSDACALAGRPLVTA
FT                   ALGRFDATVTTLRPHEKNADGTPNPTYRCLFPEPPPAGTVPTCAEAGILGALAGVAGSL
FT                   VALEAVRAVVGFGEGLVGRLLMIDTMSMRFETLSYGWDPDNPLTGESPTITDLSAHRR"
FT   gene            complement(231200..232201)
FT                   /locus_tag="Snov_0241"
FT   CDS_pept        complement(231200..232201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0241"
FT                   /product="Glyoxylate reductase"
FT                   /EC_number="1.1.1.26"
FT                   /note="KEGG: xau:Xaut_4126 glyoxylate reductase; PFAM:
FT                   D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase catalytic
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87576"
FT                   /db_xref="GOA:D7A1W0"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1W0"
FT                   /inference="protein motif:PRIAM:1.1.1.26"
FT                   /protein_id="ADH87576.1"
FT                   /translation="MARKKPLVVVTRRLPDKIETRMRELFDARLNVDDVPMSQEQLAEA
FT                   MATADVLVPAICDRIDAKVIEAAGPNLKLIANFGNGVDHIDVAAANARGITVTNTPGVL
FT                   TEDTADMTMALILAVPRRLTEGAALITSDDGTWPGWSPMWMLGHRIWGKRLGIIGMGRI
FT                   GQAVARRAKAFGLQIHYHNRRPLPAHIEEDLEATYWDSLDQMLARMDILSVNCPHTPAT
FT                   FHLLSARRLKLIRPDAYIVNTARGEVIDEHALIRMIENGEIAGAGLDVFEREPAVSPKL
FT                   LKLARAGKVVLLPHMGSATVEARVDTGEKVIVNIKAFMDGHRPPDRVLPAML"
FT   gene            232410..233045
FT                   /locus_tag="Snov_0242"
FT   CDS_pept        232410..233045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0242"
FT                   /product="protein of unknown function DUF1058"
FT                   /note="PFAM: protein of unknown function DUF1058; KEGG:
FT                   azc:AZC_0237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87577"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1W1"
FT                   /inference="protein motif:PFAM:PF06347"
FT                   /protein_id="ADH87577.1"
FT                   /translation="MDGLRGRAKLRNWAFGLAAGLLVAGLAAGTLGHAQEEPASGESPG
FT                   ASSGASSGDSSGEAPGAANGPTGRASGLPVPRFVSLKADKVNVRSGPTRDHAVAWVFTR
FT                   AGLPVEITAEFETWRRIRDSDGAEGWVYHSMLSGRRTALVSPWKAGEPTPLYADPDKSS
FT                   AVKAKLEPGVLGKVEHCDGKWCRFFENGFDGFVAQERLWGVYPGEKIE"
FT   sig_peptide     232410..232514
FT                   /locus_tag="Snov_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.971 at
FT                   residue 35"
FT   gene            complement(233052..233462)
FT                   /locus_tag="Snov_0243"
FT   CDS_pept        complement(233052..233462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0243"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   bja:bll5259 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87578"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1W2"
FT                   /inference="protein motif:PFAM:PF01361"
FT                   /protein_id="ADH87578.1"
FT                   /translation="MPMIQIKFSSPSPTPRMEAALAGRAAQLAEEWLGKDPAVTAVLVE
FT                   RADPSCWFCGGRSLAEARLAAFWLDIRVTEGTNTKDEKAAFVAACFEAFAALLGPLHAE
FT                   SYVHVVEARGDAYGYGGVTQERRYIAARPAAA"
FT   gene            233557..234402
FT                   /locus_tag="Snov_0244"
FT   CDS_pept        233557..234402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0244"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bja:blr5260 transcriptional
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87579"
FT                   /db_xref="GOA:D7A1W3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1W3"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ADH87579.1"
FT                   /translation="MTDRPLDLELVRAFVHVAELSSFTRAAEALGSTQAGVSLRLRKLE
FT                   DRLGRTLLERTPRLVRLTPDGAQFLERARRLLAADRDARLWGAPSVQRLRLGISDHTTG
FT                   DTLPGLLSRLAAVSPEVVFDIRMGFSRVLLDAFDAGELDAIVVRREGDRRAGEMVRQDR
FT                   YGWFAAGEARRGSAPLPLALLAAPCGVRAAATGALDAAGIAWREAFTGGSVSSVAAAVA
FT                   AGLAVAPMAAHLAPAGSVDVGPALGLPALPSAKVMLIARAADAPTRAALCELAAFLRAG
FT                   "
FT   gene            complement(234513..235037)
FT                   /locus_tag="Snov_0245"
FT   CDS_pept        complement(234513..235037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0245"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: xau:Xaut_3845
FT                   ferric uptake regulator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87580"
FT                   /db_xref="GOA:D7A1W4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1W4"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADH87580.1"
FT                   /translation="MNEGFRPHNVAISRVVVEEEPVLPVARLRDSSAARTGCPFHDVRH
FT                   MLRDVGLRPTRQRLALGWLLFAKGDRHVSAEILHEEAIKARFPVSLATVYNTLHQFTEV
FT                   GLLRELAVDGSKTYFDTNPSDHHHFFLEGENNLVDIPSAAVEVERIPEPPEGFEVARID
FT                   VVVRLRPKRRS"
FT   gene            235481..235990
FT                   /locus_tag="Snov_0246"
FT   CDS_pept        235481..235990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0246"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA"
FT                   /EC_number="4.2.1.59"
FT                   /note="TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA; KEGG: azc:AZC_4642
FT                   3-hydroxydecanoyl-(acyl carrier protein) dehydratase; PFAM:
FT                   Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87581"
FT                   /db_xref="GOA:D7A1W5"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1W5"
FT                   /inference="protein motif:TFAM:TIGR01749"
FT                   /protein_id="ADH87581.1"
FT                   /translation="MVERQTSFNYEELLACGRGELFGPGNAQLPAPPMLMFDRITEISD
FT                   DGGPNGKGHVRAELDVKPDLWFFACHFLGDPVMPGCLGLDAMWQLVGFHLGWLGAPGRG
FT                   RALGAGEIKFSGQVLPTVRKVVYGIDFKRVMRSKLVLGIADGWLEADGEVIYRASDLKV
FT                   GLFQTA"
FT   gene            236052..237272
FT                   /locus_tag="Snov_0247"
FT   CDS_pept        236052..237272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0247"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: azc:AZC_4643
FT                   3-oxoacyl-(acyl-carrier-protein) synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87582"
FT                   /db_xref="GOA:D7A1W6"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1W6"
FT                   /inference="protein motif:PFAM:PF00109"
FT                   /protein_id="ADH87582.1"
FT                   /translation="MRRVVVTGMGIVSSIGNSTQEVLASLREGKSGIVRADSYAELGFR
FT                   SQVHGAPQLDASAIVDRRAMRFHGGGTAWNHVAMDQAIRDAGLEENEISNERTGIVMGS
FT                   GGTSTRTIVEAADITRKNNSPKRVGPFAVPKAMGSTASATLSTWFKIKGINHSISAACA
FT                   TTNICIGSAAEQIQWGKQDIVFAGGCEDLDWTLSCLFDAMGAMSSDYNDTPAVASRPYD
FT                   KNRDGFVISGGAGVLVLEELEHAKARGARIYAEIIGYGSTSDGADMVAPSGEGAARAMQ
FT                   LAMKGVKGGIDYINPHATSTPIGDLKEIEAIRAVFGAHAPPISATKSLTGHSQGATGVH
FT                   EAIYSILMMQNGFIAASAHIDELDPAFADMPIVRERVDNARLERVLSNGFGFGGANAVL
FT                   VFQHPDA"
FT   gene            237304..238155
FT                   /locus_tag="Snov_0248"
FT   CDS_pept        237304..238155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0248"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   xau:Xaut_0052 enoyl-(acyl carrier protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87583"
FT                   /db_xref="GOA:D7A1W7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1W7"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH87583.1"
FT                   /translation="MGLMQGNLMNGKRGLIMGVANDHSIAWGIAKTLAAQGAELAFTYQ
FT                   GEALGRRVRPLAESLGSDTLISCDVEDLDSVDAVFAALKEKWGSIDFLVHAIGFSDKNE
FT                   LKGRYADTTRANFTRTMVISCFSFTELAKRAAAIMPNGGSVITLTYGGSTRVMPNYNVM
FT                   GVAKAALEASVRYLAADYGPQGIRVNAISAGPIRTLAGAGIADARLMFNYQKRNAPLRR
FT                   TVTIDEVGGSALYLLSDLSSGVTGEVHFVDSGYNIISMPHPDALKTIEDAEERAAGEVA
FT                   AE"
FT   gene            complement(238185..239666)
FT                   /locus_tag="Snov_0249"
FT   CDS_pept        complement(238185..239666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0249"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: rhi:NGR_c28580 putative
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87584"
FT                   /db_xref="GOA:D7A1W8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1W8"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ADH87584.1"
FT                   /translation="MFSRSPPTPASFTCIDATAAPLDHAGCLCHRPEIGALSRRLGAGL
FT                   SRRGFVAGMAASLAAASLGVPGPARAQAGPNRVLFTNVRLFDGTSGTLREGVSLLVEDK
FT                   IVKAIASGTPAAPEGAQVIDGGGRVLMPGLIDMHWHAMFAALPIHVIATADIGYIFLAA
FT                   AAEAERTLMRGFTTIRDLGGPSFALKQAIDEGLIAGPRIYPCGAMITATGGHADLRPTS
FT                   ELPRAAGTPGATEQSGANAIADGEAEVLLRVREQLLQGASQIKMVGGGGVSSPRSPLDA
FT                   STFTESEMRAAVQAAGDWNTYVASHAYAPQTIRRSLDAGVTCIEHGHLMDEEIAAQMAE
FT                   KGIWLSTQPFLSAEDATPLTGPSRERMLQVFAATRTVYPLAKKHGIKTAFGSDLLFSAV
FT                   LARRQGTMLTHLAEWYSAAEALTMATATNAELLTLSGPRNPYPGTLGVLREGAFADMIL
FT                   VDGNPLEDLSLMADPEAKFLVIMKDGRIHKDTLGR"
FT   gene            complement(240511..241359)
FT                   /locus_tag="Snov_0250"
FT   CDS_pept        complement(240511..241359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0250"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="KEGG: azc:AZC_0138 prephenate dehydratase; PFAM:
FT                   prephenate dehydratase; amino acid-binding ACT domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87585"
FT                   /db_xref="GOA:D7A1W9"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1W9"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ADH87585.1"
FT                   /translation="MTTRRIVFQGEPGANSHIACREVYPDHEAVPCPTFEDAFAALQNG
FT                   EADLGMIPIENSVAGRVADIHHLMPTSGLTIVGEFFLPLSHQLMAVKGATLATVKTVES
FT                   HVMALGQCRNIIRKLGLKPIVDADTAGAARLVAEAGDPTRAAVASRLAAEIYGLDIIAE
FT                   NIEDEAHNTTRFVILAKEGEWAPANNGPTVTTFVFRVRNVPAALYKALGGFATNGVNMT
FT                   KLESYQLDGEFFATQFYADVDGHPDDRALKLALEELSFFSKEVRILGVYPAHPYRIALR
FT                   A"
FT   gene            complement(241370..242125)
FT                   /locus_tag="Snov_0251"
FT   CDS_pept        complement(241370..242125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0251"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="TIGRFAM: 3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase; KEGG: azc:AZC_0137
FT                   3-deoxy-D-manno-octulosonate cytidylyltransferase; PFAM:
FT                   acylneuraminate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87586"
FT                   /db_xref="GOA:D7A1X0"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1X0"
FT                   /inference="protein motif:TFAM:TIGR00466"
FT                   /protein_id="ADH87586.1"
FT                   /translation="MSSQDTLILIPARMASTRLPGKPLADLGGRPMIVEVARRSAAANI
FT                   GRVVVATDDEGVRKAVENAGFAVVMTRADHTTGSDRIFEALGHVDPERRVSRIVNVQGD
FT                   LPTIDPALIRSAVDLLDDPAVDIGTLAAQITVEAERTNPNVVKAVGSPLSPSRLRALYF
FT                   TRATAPYGEGPLFHHIGLYAYRRAALERFVALPPSPLESREKLEQLRALEAGMRIDVAI
FT                   VDTVPLGVDTPEDLERARELLAREAKTAK"
FT   gene            242343..242984
FT                   /locus_tag="Snov_0252"
FT   CDS_pept        242343..242984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0252"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: azc:AZC_0136
FT                   cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87587"
FT                   /db_xref="GOA:D7A1X1"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1X1"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ADH87587.1"
FT                   /translation="MDGFELNKIAGAVLGVLTFTVGLNVFSDILFTTHAPEKPGFEIAV
FT                   QEASSGSAQAAAPADVPIAQLLATASVEKGAAQAKKCAACHNFQEGAGAKVGPDLYAVV
FT                   GRAVASAPGFAYSAAMKAHGGEWTFEQLNNFIKNPKADIPGTAMGFAGIAKESERADLL
FT                   VYLNTLSHNPLPLPKPEEAAPAAAPAAAPAGEKPAEPAPAAPAPAAPAHP"
FT   gene            243159..245066
FT                   /locus_tag="Snov_0253"
FT   CDS_pept        243159..245066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0253"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: azc:AZC_0135 ABC transporter substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87588"
FT                   /db_xref="GOA:D7A1X2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1X2"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADH87588.1"
FT                   /translation="MPSLLRRLDLASRGLPALSAALLAFGLLAGPVAAQEGAAPGAAQG
FT                   AAGEWRHGLSLLGTPKYPADFKHFDYVNPDAPKAGLLRLSVDGTFDSLNDIIPRGTPAS
FT                   GLQLIYDTLMSPAYDEVATEYGLLAESVRYPADFSTVTYRLRPEAKWHDGQPVTAEDVV
FT                   WSFEQLTKNNPRQAYYYSHVKKAEVTGEREVTFTFDQAGNRELPQIVGQIRVMPKHWWT
FT                   GKDASGKQRDISQGTLEVPLGSGPYKVKQVVPGRSISFERVPDYWGAGLPVNIGTNNFA
FT                   EQRYEYFRDNVVELEAFKGDQYDFRVETSAKDWATAYDFPAVKQGKVILEEFPDRASGS
FT                   MQAFIPNLRRTKFQDQRVRRALNYALDFDGMNRTLFFGQYKRTSSYFQNTELASSGLPT
FT                   GLELEILNSVKDKVPPSVFTTPYANPPDGGEDVRRANLREAAKLLREAGYQVKGGKLVD
FT                   PQGQPFTIEILLASPAFERVALFYKPTLERLGITVNIRQVDVSQYINRIRARDFDMIVT
FT                   GWGQSLSPGNEQRDFWGSAAADREGSSNYAGIKDSGIDALIERVIYAKDRAELVAATHA
FT                   LDRVLLAHDYVVPTWNYPNTRTARWNRFGRPDKLPEYSFGFPDIWWWDAQKAAQTGGTQ
FT                   "
FT   sig_peptide     243159..243263
FT                   /locus_tag="Snov_0253"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.988 at
FT                   residue 35"
FT   gene            245227..247116
FT                   /locus_tag="Snov_0254"
FT   CDS_pept        245227..247116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0254"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: azc:AZC_0134 putative ABC transporter solute-binding
FT                   protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87589"
FT                   /db_xref="GOA:D7A1X3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1X3"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADH87589.1"
FT                   /translation="MQGGVSRRALLTLTTAAGAALAFPRGAFAQEAAPPPAAGANGERH
FT                   GLSAFGDLKYPADFKHFAYVDPNAVKGGTFSQVGPTAAFNQSFQTFNSLNGYILKGDGA
FT                   QGIALIFDPLMVRALDEPDAIYGLVAKSVTVSPDGTVYRFRLRPEARFHDGSKLTAHDV
FT                   AFSLNILKEKGHPIIGQSLRDMEAAEADGDEFAVVRFKPERARDVPLLAASLPIFSRAY
FT                   YGKKPFDESTLEPPLGSGPYKVGRFEPGRFIEYERVADYWGSGLPVNVGTANFDVQRYE
FT                   YFRDREVGFEAFKARAYLFRQEFTARTWATGYNFPALKDGRVKQEILPDHTPSGAQGWF
FT                   LNLRRPQFSDPRVREALSYAFDFEWTNKNLMFDAYKRTTSFFENSDLKAEGPAGPDELA
FT                   LIAALGDRITPEEVAVLKAPPWLPPVSDGSGQDRALLRKGAQLLREAGWVIKDGRLTNA
FT                   EGKTFTIEFLDDENGLERHTSPFIKNLKLLGIEANFRLVDPPQYQRRLNDFDFDTTVRR
FT                   YSMSTVPGDSLRNYFGSRAAKIPGSNNLSGISDPLVDLLIEKVIAAATRDELRTACRVL
FT                   DRRLRAGRYWVPQWYSAEFRIAYWDEFAWPSVPRPDYDRAIPTIWSARGRSAG"
FT   sig_peptide     245227..245316
FT                   /locus_tag="Snov_0254"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.993 at
FT                   residue 30"
FT   gene            247380..248486
FT                   /locus_tag="Snov_0255"
FT   CDS_pept        247380..248486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0255"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: azc:AZC_0133 peptide ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87590"
FT                   /db_xref="GOA:D7A1X4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1X4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87590.1"
FT                   /translation="MLAYIVRRLALMVPTVIGIMLISFAVVQFAPGGPVEKVIAELTGQ
FT                   GASATSRITGGGGDFGGMQQNAPAGDPVSSKYRGAQGLDPAFIKQLEKQFGFDKPAYER
FT                   FGKMLWDYARFDFGRSYFRDISVIDLIAEKMPVSISLGLWMTLITYAISIPLGIAKAVR
FT                   DGSRFDVWTSAVIIVGYAIPSFLFAILLIILFAGGSFFSWFPLRGLTSDNWDQLSLGAK
FT                   ILDYFWHLALPITSMVLGAFATMALLTKNSFLDEIRKQYVITARMKGLSERAVLYRHVF
FT                   RNAMLIIIAGFPGAFVAAFFSGSLLIETIFSLDGLGLLGFESVLNRDYPVVFANLYIFS
FT                   LVGLLINLLSDLTYTWVDPRIDFETRDV"
FT   gene            248488..249666
FT                   /locus_tag="Snov_0256"
FT   CDS_pept        248488..249666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0256"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: xau:Xaut_2635
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87591"
FT                   /db_xref="GOA:D7A1X5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1X5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87591.1"
FT                   /translation="MDAANTTLPSTAPTGASATPAETPRRSRLSPLNQRRLANFRRNRR
FT                   GWWSFWIFSVLFVLSLGAEFIANDKPFLVEYDNAYYFPGLVAYPETTFGGDFETEADYR
FT                   DPYLQKLISEKGGWMVWPPIRYSYSTHNLDLPTPAPSPPTWMLTEAQCAPVVEKLGRTG
FT                   GCDALEWNWLGTDDQGRDVLARLIYGFRLSVLFGLILTIISSIIGVAAGAVQGYFGGWT
FT                   DLIFQRFIEIWTSIPALYLLLIISSILAPGFWVLLGILLLFSWVSLVGLVRAEFLRARN
FT                   FEYVQAARALGVSNLTIMWRHMLPNAMVATLTMLPFIVSSSVMTLTALDFLGFGLPPGS
FT                   PSLGELLAQGKSNVQAPWLGLTGFFTVAIMLSLLIFIGEAVRDAFDPRKTFQ"
FT   gene            249701..249961
FT                   /locus_tag="Snov_0257"
FT   CDS_pept        249701..249961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpe:RPE_3763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87592"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1X6"
FT                   /inference="similar to AA sequence:KEGG:RPE_3763"
FT                   /protein_id="ADH87592.1"
FT                   /translation="MNKIVREHYPVDRLPEDLREGIEGPYVSVTVVTEEAPAGVDERIE
FT                   AILRNPKPMTIEEARARVGERGTTTEEAVARIRALRDEWDE"
FT   gene            249965..250401
FT                   /pseudo
FT                   /locus_tag="Snov_0258"
FT                   /product="hypothetical protein"
FT   gene            250398..252029
FT                   /locus_tag="Snov_0259"
FT   CDS_pept        250398..252029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0259"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bra:BRADO1006 oligopeptide ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87593"
FT                   /db_xref="GOA:D7A1X7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1X7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87593.1"
FT                   /translation="MTSTSPLLSVQDLSVAFAQGARTTLAVDHVSFDLKRGETVALVGE
FT                   SGSGKSVTALSILKLLQYPAASHPSGKVLFKGADLLAMSEREIRGVRGNDITMVFQEPM
FT                   TSLNPLHTVEQQIAEILFLHRGMRGAGARARVIELLTEVGIPEPETRLGSYPHQLSGGQ
FT                   RQRVMIAMALANEPQLLIADEPTTALDVTVQAQILKLLKDLQRRLGMAMLFITHDLGIV
FT                   RKIADHVCVMNKGRIVEAGPVADIFAKPQHPYTRALIAAQPRGNPEPPHPEAPVVLEAK
FT                   DLKVWFPIKAGLMRKTVGHIKAVDGISVEIRRGETLGVVGESGSGKTTLGLALLRLISS
FT                   DGPIVFMGESIDTLGFKQMRSHRHAMQVVFQDPFGSLSPRMSIADIVGEGLRVHQPKLS
FT                   AEEREQRVIDALKDVGLEPESRHRYPHEFSGGQRQRVAIARAIVLEPSFVVLDEPTSAL
FT                   DMIVQAQIVDLLRDLQHKRGLTYLFISHDLRVVAALASRVMVMKGGVVVEEGPAADLFA
FT                   HPKTDYTRALFAAAFNIETAGTAADA"
FT   gene            252039..252686
FT                   /locus_tag="Snov_0260"
FT   CDS_pept        252039..252686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0260"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: xau:Xaut_2637 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87594"
FT                   /db_xref="GOA:D7A1X8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1X8"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADH87594.1"
FT                   /translation="MTDRAGIGELADRSIDVALTEPVSVGSGFRAYHRVIATLDGAGGA
FT                   PLRQQRDILRVGPVVAVLAYDPVAACFVMIRQFRLGAQLATGVGELVEIAAGLIDPGEK
FT                   PEDAARRECREEIGVEPRALLPATQFLPTPGVTDEFATLYIGLVDSREVPAEAGEPGET
FT                   EHTRPFLVPVDEAMASLHAPFPGAFANGFVMLALQWFALNRGRVDAFAWPNG"
FT   gene            complement(252881..253747)
FT                   /locus_tag="Snov_0261"
FT   CDS_pept        complement(252881..253747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0261"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: xau:Xaut_0280 NLP/P60
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87595"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR041382"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1X9"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADH87595.1"
FT                   /translation="MNAHSPAALDPRLTPARPDLAAAHLKDVVAAPRYVEGTAQIVVRA
FT                   SAPMRKEPDPSAPLVTEALFGESVTVYEMTIEGWAWGQIDADGYVGWLPAEALAAPGAP
FT                   ATHRVRALRTPLFPGPSIKLPPMELLSFGSRLTITGTRERFAVTETGGFVFADHLTPLD
FT                   SYEDDFVAVAARFLGAAYLWGGRSSLGLDCSGLVQVALNACGIPSPRDTDMQEAALGNP
FT                   VAFSGDLAELRRGDLVYWPGHVGIVEDADTLLHATAYFMSVVREPLKDALARIEALGTP
FT                   VRSVKRL"
FT   gene            complement(253753..254103)
FT                   /locus_tag="Snov_0262"
FT   CDS_pept        complement(253753..254103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0262"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: oan:Oant_0731 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87596"
FT                   /db_xref="GOA:D7A1Y0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y0"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADH87596.1"
FT                   /translation="MAVELRPSQALRLLHELSLAQVRDDAPDLSPRQLAILLGVYLEAP
FT                   PHTVRGLAARLGVTKPVITRALDTMGELGLVSRRRDDADRRNVIIQRTVEGALYVERLG
FT                   DLVVTVARSLPR"
FT   gene            complement(254373..255749)
FT                   /locus_tag="Snov_0263"
FT   CDS_pept        complement(254373..255749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0263"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="KEGG: azc:AZC_0280 leucine aminopeptidase; PFAM:
FT                   peptidase M17 leucyl aminopeptidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87597"
FT                   /db_xref="GOA:D7A1Y1"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y1"
FT                   /inference="protein motif:PRIAM:3.4.11.1"
FT                   /protein_id="ADH87597.1"
FT                   /translation="MGAQLIRAEEASQPRPIWCVTPQNWREVAGGLPVPALSFAEATGF
FT                   KAEAGALLILPAADGSIAGAIFGCEEVPRDPLAFGKLATALPAGDYRIAHAPADPRLAA
FT                   LGFLLGGYRFTRYGKRNGADVRLVVPEGVDAAYVLRTAEAVALTRDLVNTPANDLGPAE
FT                   IEAAVRALASRFGAEVRVTTGEDLLAENFPLIHAVGRASPRAPRLIDMSWGDPNARKVT
FT                   LVGKGVAFDTGGLDIKPSSGMLLMKKDMGGAANAIGLAQMIMGRGLNVRLRLIIPAVEN
FT                   AIDGSAFRPGDIFPSRKGLTVEIGNTDAEGRLILADALSLADEEAPELLIDFATLTGAA
FT                   RVALGPQLPPAYTDDEALAADLARFGAAEADPSWRLPLWQPYASMLDSKIADLNNAPGG
FT                   GFAGSITAALFLQRFVERAGAWLHLDIFAWNPSPRPGRPEGGEAQTIRALDALIAERFG
FT                   "
FT   gene            complement(255884..256474)
FT                   /locus_tag="Snov_0264"
FT   CDS_pept        complement(255884..256474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0264"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: xau:Xaut_4141
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87598"
FT                   /db_xref="GOA:D7A1Y2"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y2"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADH87598.1"
FT                   /translation="MIKRRIFLVRHGETDWNLAGRLQGYHDIPLNDLGREQAAETARVV
FT                   ERLSGGTVGLDYVASPLSRASQTMAILRAELGLPPDGFRRDPRLREIGFGRWEGATWPE
FT                   LRRRDPVNLAARDADPWNFVPPGGESYADLSARVLAAIGELTHDAVVVTHGGVVRAILH
FT                   ALTGMPAAQAVELPVRQGAVYLIEDGAFELAVA"
FT   gene            complement(256471..257088)
FT                   /locus_tag="Snov_0265"
FT   CDS_pept        complement(256471..257088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0265"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azc:AZC_1753 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87599"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87599.1"
FT                   /translation="MSKARLPQLFRTLLPIALVAAGLAAAAPASAQNGPIIVGPPPGSG
FT                   LGGSGLPYIPPPGSQDRGVPPDFQTYPLLNRIFGTGGAIFPGYVSPSGGRNDADRLAYL
FT                   TGGGQGRMIFAAGTADQLCQMGQAPRIRVVTAPATVKIKFDIGSFTATGTDAGSKRCVG
FT                   GQAGGARVFASGSAPLGSTVTLRVSYPLNGPSYTHVVALPAK"
FT   sig_peptide     complement(256993..257088)
FT                   /locus_tag="Snov_0265"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 32"
FT   gene            complement(257118..257933)
FT                   /locus_tag="Snov_0266"
FT   CDS_pept        complement(257118..257933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0266"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   azc:AZC_1754 enoyl-acyl carrier protein reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87600"
FT                   /db_xref="GOA:D7A1Y4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH87600.1"
FT                   /translation="MASGGLMSGKRGLVMGVANNRSIAWGIAKAAHAQGAKLAFTYQGE
FT                   PLKKRVEPLAAELDATLVGHCDVTDPATIDAVFAETERQLGGLDFLVHAIAFSDKNELD
FT                   GRYVDTTAENFSKTMLISCYSFTAVAQRAEKLMTDGGSMLTLTYYGAEKWMPHYNVMGV
FT                   AKAALEASVRYLAADLGPKNIRVNAISAGPIKTLAASGIGDFRYILKWNELNAPLRRTV
FT                   TIDEVGDTGMYLLSDLGRAVTGEIHHVDAGYHIVGMKNPEAPDLTLERD"
FT   gene            complement(258057..259028)
FT                   /locus_tag="Snov_0267"
FT   CDS_pept        complement(258057..259028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0267"
FT                   /product="chaperone DnaJ domain protein"
FT                   /note="KEGG: azc:AZC_1199 heat shock protein; PFAM:
FT                   chaperone DnaJ domain protein; heat shock protein DnaJ
FT                   domain protein; SMART: heat shock protein DnaJ domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87601"
FT                   /db_xref="GOA:D7A1Y5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y5"
FT                   /inference="protein motif:PFAM:PF01556"
FT                   /protein_id="ADH87601.1"
FT                   /translation="MRDPYDILGVARNADQNEIKRAFRKHAKKLHPDANKDDPKAQERF
FT                   AELNSAHEILSDPEKRGQYDRGEIDAEGKPRGFEGFPGGGAGGFNRGGFQRGPHGETIF
FT                   ESFSFGPEGARRSGHGPHDAGGFDDVIADILGGLGGRGRGRARAGGQQEMPRGGDVDIS
FT                   VPVPLERVVEGGPVKVHLPNGRTVEVKIPPKVTEGHRMRLKGQGEPSPFGGAPGDAYVV
FT                   VAYAPHRHFKVEGADLRTDVSLPLADAVLGGKLRVPTLSGEVELSVPAWTQSGRTFRLR
FT                   GKGLPKGDDAAGDLFATVRITLPETPDAELEELMRRRRDGAA"
FT   gene            complement(259125..259628)
FT                   /locus_tag="Snov_0268"
FT   CDS_pept        complement(259125..259628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azc:AZC_1198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87602"
FT                   /db_xref="InterPro:IPR032635"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87602.1"
FT                   /translation="MDTFHRRRATAAQVASRGGSSYKRDTSFRTAALWTTLVGALAMAG
FT                   CSSAPPLDMQATGSISPRRAAAYQREPVPQGVAPDDWAAARLALAEALREDSKAPSVPW
FT                   ENYASATRGTVTPLASSASGRGACRDFLMSFVRAAGEEWLQGEACRNERGWWKVDEARL
FT                   LARG"
FT   gene            259664..260290
FT                   /locus_tag="Snov_0269"
FT   CDS_pept        259664..260290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0269"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="TIGRFAM: pyridoxamine 5'-phosphate oxidase; KEGG:
FT                   azc:AZC_1197 pyridoxamine 5'-phosphate oxidase; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN-binding;
FT                   Pyridoxine 5'-phosphate oxidase, dimerisation-like"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87603"
FT                   /db_xref="GOA:D7A1Y7"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y7"
FT                   /inference="protein motif:TFAM:TIGR00558"
FT                   /protein_id="ADH87603.1"
FT                   /translation="MEASEELISGDFTAATEPFRLFEEWFAEAKEKEPRDPNAMALATV
FT                   DADGLPDVRMVLLNQRDERGFVFFTNTGSAKGCELAAVPKAAVVFHWKSMNRQIRVRGP
FT                   VEVVSDEEADAYFLTRPRLSQIGAWASVQSRPLEGRFALEAAVAKYTAQYALGSVPRPP
FT                   HWTGFRIRPVQIEFWHDRPFRLHDRIVFRRDSAEATVWNKTRLYP"
FT   gene            260340..261089
FT                   /locus_tag="Snov_0270"
FT   CDS_pept        260340..261089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0270"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mno:Mnod_1067 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87604"
FT                   /db_xref="GOA:D7A1Y8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH87604.1"
FT                   /translation="MTKGTNQPRRTMLLTGASRGIGHATVKRFSAAGWRVITCSRHAFP
FT                   ENCPWEMGPEDHIQVDLSDPADTLRAVDEIKSRLPDGELHALVNNAGISPKGPGGSRLG
FT                   TLNTPEEDWRRVFQVNFFAPILLARGLLEELKRTHGAVVNVTSIAGSRVHPFAGAAYAT
FT                   SKAALAGLTREMAADFGPLGVRVNAIAPGEIDTSILSPGTEKIVEQIPMQRLGTPDEVA
FT                   KIIYVLCTDTSSYLNGAEIHINGGQHV"
FT   gene            complement(261299..262276)
FT                   /locus_tag="Snov_0271"
FT   CDS_pept        complement(261299..262276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0271"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: oca:OCAR_6914 Mg2+ transporter protein, CorA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87605"
FT                   /db_xref="GOA:D7A1Y9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y9"
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /protein_id="ADH87605.1"
FT                   /translation="MITAHCVRGGTLVSVHLGAGEALPPDAVWIDLNQPADGEDRLVEA
FT                   AIGISVPTRAEMLEIEPSSRLRVENGARYMTGSIVCNSDSDRPTLAQVSFILAKGKLTT
FT                   VRYDEPKPFRLVLAKLDRDCPQTMKGDRLLLELLDTIVDRAADIIETLSEDIDGLSRRI
FT                   FERESSSNGGSQRFRVILKLLGRRADLASKVRESLVSMGRLVTFLSTEGEAERFDKEQR
FT                   TWLKSMQRDTASLNDHVSYLGNKIIFLLDATLGMVSIEQNNIIKIFAVLSVVLMPPTLI
FT                   ASIYGMNFQHMPELGERFGYPVALIAMLAAAVVPYWFFKWKKWL"
FT   gene            complement(262468..262692)
FT                   /locus_tag="Snov_0272"
FT   CDS_pept        complement(262468..262692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sru:SRU_0693 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87606"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Z0"
FT                   /inference="similar to AA sequence:KEGG:SRU_0693"
FT                   /protein_id="ADH87606.1"
FT                   /translation="MSSEDQPAPEAQPSQRWEASQQNAHWREIGLPALAAAAPYNAAKQ
FT                   TVSDAPGTGAARTDEAKIVTIRDVEYFAA"
FT   gene            262985..263587
FT                   /locus_tag="Snov_0273"
FT   CDS_pept        262985..263587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0273"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   azc:AZC_1194 ErfK/YbiS/YcfS/YnhG precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87607"
FT                   /db_xref="GOA:D7A1Z1"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Z1"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADH87607.1"
FT                   /translation="MILRGAGVVLLAVLLGACSNAQRQPAPTASLTPRDKQLLANAPYQ
FT                   KVLPPDMYQRAIVDYSGREKPGTIVVDTDKKWLYFVQDGGKAIRYGVTVGEEGLAFKGN
FT                   AKVGRKTEWPTWTPTPEIKQRIAGVPDFVGPGPHNPMGARALYLFQGNKDTLFRIHGTN
FT                   QPEYIGQAISSGCIRMLNEDVIDLYTRVPQGTNVVVL"
FT   sig_peptide     262985..263050
FT                   /locus_tag="Snov_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.967 at
FT                   residue 22"
FT   gene            complement(263787..265169)
FT                   /locus_tag="Snov_0274"
FT   CDS_pept        complement(263787..265169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0274"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   mno:Mnod_5513 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87608"
FT                   /db_xref="GOA:D7A1Z2"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Z2"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ADH87608.1"
FT                   /translation="MLTNLQARDVETLVHPYTNLVAVRETGPLILERGKGVWVHDVDGK
FT                   PYLEGMAGLWCTALGYGNEELVEAAATQMRKLPFTHIFGGKSHDPAIELAEKLKEMAPV
FT                   PISKVFFTCSGSEANDTQMKLVWYMNNALGRPKKKKIISRMRAYHGVTIAAASLTGLAG
FT                   NHNDFDLPIAGVRHTTCPHYYRLAEAGESEEDFATRLAADLEALIIAEGPETVAAFIAE
FT                   PVLGAGGVIVPPKTYYPKIQAVLEKYDVFFIADEVITGFGRLGTAFGCEAMEMKPHSIS
FT                   VAKALSSAYQPIGGVMIPEDMYQAMLEESRKLGSFGHGYTYSAHPVAAAVAVKTLEIYE
FT                   RESIFERVRAKIPHFGARRAALEDHPLVGEARGAGLVAGIELVADKKSKHQFDPKLGVA
FT                   AKCVAFAQEEGLIVRNVFGDAVTICPPLVISPAEIDELFDRLTRALDKTLDWAVRENLL
FT                   AA"
FT   gene            complement(265258..266610)
FT                   /locus_tag="Snov_0275"
FT   CDS_pept        complement(265258..266610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0275"
FT                   /product="Extensin family protein"
FT                   /note="PFAM: Extensin family protein; KEGG: xau:Xaut_2474
FT                   extensin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87609"
FT                   /db_xref="InterPro:IPR009683"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Z3"
FT                   /inference="protein motif:PFAM:PF06904"
FT                   /protein_id="ADH87609.1"
FT                   /translation="MDFRSLPFIRLPFPRRVAPILAVGLLLAGASPLAADDLTRSIDRA
FT                   GNAINRQLGDFFGVTPERPAKRRPATKSTATAKPVDGKVPLPPSRPGEADQQAALTSQP
FT                   EEASAPKPEAKPAVAEPDMPKPDIKAASDPGEAKPDTPTPSGERAATSDPGEAKPDTPA
FT                   PSGEREVVVPPPAAPEPPAAASAPLPPPAPERLAALPPPAAGPTAEPAETARAAPVPTI
FT                   CPELSNEDIGVFTPTEVKTTEPACTLDRGVVLSAVRMKDGRLVQLQPAAELRCEMAASV
FT                   ARWLREKVEPAVATLGSPLDKVLVAGSLQCRSRNHVAGAKISEHGRGNALDTHGYELKD
FT                   GRRFVIGPPSMGSGEHAMPVDFQEKLKASACADFTTILGPGSDGYHEQHLHVDRAERRS
FT                   GAVLCQWATARVEAVPPKPPVKPAEAKAGEPAASDAPPEEGATPDSAGKSQ"
FT   sig_peptide     complement(266503..266610)
FT                   /locus_tag="Snov_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.936 at
FT                   residue 36"
FT   gene            266670..267395
FT                   /locus_tag="Snov_0276"
FT   CDS_pept        266670..267395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0276"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: xau:Xaut_2473 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87610"
FT                   /db_xref="GOA:D7A1Z4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Z4"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ADH87610.1"
FT                   /translation="MNAPRAILFDKDGTLVDFDRTWGPAAGAVMRRLAGADEAALTQLY
FT                   AASHFLPAEDRFLQSSPLIAGSSRQYGPLWAQILDVPATMDFFGEIDRLFREEGGRYLT
FT                   PIGSPAQTLGRLHALGLPLGIATNDAEPNARLQATQLGLDGLLSAVYGYDSGYGSKPAP
FT                   GMVEAFSRLTGLAPADIALVGDTRHDLHTARNAGAIAVLVRCGPGPVDDFAHEADLVVD
FT                   TVEDLADMILRAAPAEAAR"
FT   gene            267392..268177
FT                   /locus_tag="Snov_0277"
FT   CDS_pept        267392..268177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0277"
FT                   /product="protein of unknown function DUF1499"
FT                   /note="PFAM: protein of unknown function DUF1499; KEGG:
FT                   azc:AZC_1485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87611"
FT                   /db_xref="GOA:D7A1Z5"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Z5"
FT                   /inference="protein motif:PFAM:PF07386"
FT                   /protein_id="ADH87611.1"
FT                   /translation="MIRRRLYIEERMSRLAVWSLRTAIFAFPVTLIGAALYATETLDFR
FT                   SAAYTVLAGVGVAVLALLLAFAGFVVIWNEGLKGLGRVIGAAALALLLITPTATLAALA
FT                   VGLKTLPDVTSDTEDPPEFVTLGTVRSRASTGLAYPGGKLADDQLDIYPGIKPITFDAP
FT                   PDEIFRVLMNMVTRHKWLVVDSVPPRGERDGRIEAVARSLPFGLRDDMVIRVRRTPTGS
FT                   IVDMRSVARSGNRDFGSNARRIDQLFDELADQQGRPRRQ"
FT   gene            complement(268180..269091)
FT                   /locus_tag="Snov_0278"
FT   CDS_pept        complement(268180..269091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0278"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /note="KEGG: azc:AZC_1482 metallo-beta-lactamase
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87612"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Z6"
FT                   /inference="similar to AA sequence:KEGG:AZC_1482"
FT                   /protein_id="ADH87612.1"
FT                   /translation="MAEDIPFERRFDAVPGVADEVAPGVRRVLAPNPGPFTFTGTCSYI
FT                   VGRGEVAIIDPGPDDASHVSALLAAIHGEKVTHIFLTHTHRDHSGALDALKEATGAPAY
FT                   AEGPHRPARELHAGETNVLDAAGDRSFLPDVALADGARVEGAGWTIDALATPGHAANHM
FT                   AYVLEGAGLIFVGDHVMGWSTTIVAPPDGSMSDYMDSLRRLGERPEQLYLPGHGGAIPQ
FT                   GPAFVERYLRHRQAREAAIVRALERGPLAIPEIVRAIYIGLDPRLAGAAGLSTLAHLED
FT                   LVGRGEALTEGPAALEGVFRLP"
FT   gene            269211..269843
FT                   /locus_tag="Snov_0279"
FT   CDS_pept        269211..269843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0279"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="KEGG: xau:Xaut_4148 carbonate dehydratase; PFAM:
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87613"
FT                   /db_xref="GOA:D7A1Z7"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Z7"
FT                   /inference="protein motif:PRIAM:4.2.1.1"
FT                   /protein_id="ADH87613.1"
FT                   /translation="MDKLLDGYRRFRATSWPERKALFERLAARGQKPQTLVIACSDSRV
FT                   DPTMIFDAGPGELFVVRNVANLVPPYTAPDAHAEPEQDHHGTSAAIEFAVKVLEVQEIM
FT                   VLGHALCGGAGALIDGAPAQAQDFLPDWIRIARPARDIALNLSSDPAEQRTILEHQCVK
FT                   LSLRNLATFPWIKERVEDGRLALHGAYFAVATGVLERLRADGTFGPV"
FT   gene            270050..270595
FT                   /locus_tag="Snov_0280"
FT   CDS_pept        270050..270595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0280"
FT                   /product="protein of unknown function DUF892"
FT                   /note="PFAM: protein of unknown function DUF892; KEGG:
FT                   gdj:Gdia_1370 protein of unknown function DUF892"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87614"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010287"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Z8"
FT                   /inference="protein motif:PFAM:PF05974"
FT                   /protein_id="ADH87614.1"
FT                   /translation="MGLFSKDIKSLDDLLRQSLGELLYTERRIAKALPGLAAKVSDPLL
FT                   RRELERARMASEDHLARIEEVFLRHDAAPRSIECPAIDGIFISAEELNEEIDDFYVLDT
FT                   AIAAAMQAVATYSAARYMTAAAWLRQLGQPECARLLHANLVARQRAADALCALAEQRLN
FT                   ARARGRSDDRPSGVALAG"
FT   gene            complement(270592..271512)
FT                   /locus_tag="Snov_0281"
FT   CDS_pept        complement(270592..271512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rce:RC1_2166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87615"
FT                   /db_xref="InterPro:IPR022025"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Z9"
FT                   /inference="similar to AA sequence:KEGG:RC1_2166"
FT                   /protein_id="ADH87615.1"
FT                   /translation="MAVRVSTLLPATAFLPLPVPLAVSGQPRRVGVEVEFTRLSERRAA
FT                   ERIAREMGGTLREEDPHAFHIIGSRLGDLCVELDMRHAHPHRDGHPMPRLRPHAGLIGA
FT                   ALRPFVPRELVTGPILPGDLGEMDDLVRALREEGAGGDGATVLGSLGLHFNIVPASLEP
FT                   SALLAMLRAFLLSEPRLRAQGLTGLSRLHAPPPYPQDYVDKVLGPGYRPDLEALCDDYV
FT                   GANPTRSRALDLLPLFLELFPERVAPRISGKVKPRAALHYRLPVARVGRPGWSLAEDWN
FT                   RWVEVERLAADPSRLAAAVARHRPV"
FT   gene            complement(271654..271730)
FT                   /locus_tag="Snov_R0004"
FT                   /note="tRNA-Pro3"
FT   tRNA            complement(271654..271730)
FT                   /locus_tag="Snov_R0004"
FT                   /product="tRNA-Pro"
FT   gene            271936..272010
FT                   /locus_tag="Snov_R0005"
FT                   /note="tRNA-Gln1"
FT   tRNA            271936..272010
FT                   /locus_tag="Snov_R0005"
FT                   /product="tRNA-Gln"
FT   gene            272061..272798
FT                   /locus_tag="Snov_0282"
FT   CDS_pept        272061..272798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0282"
FT                   /product="Asp/Glu/hydantoin racemase"
FT                   /note="PFAM: Asp/Glu/hydantoin racemase; KEGG: bja:blr5577
FT                   hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87616"
FT                   /db_xref="GOA:D7A200"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:D7A200"
FT                   /inference="protein motif:PFAM:PF01177"
FT                   /protein_id="ADH87616.1"
FT                   /translation="MRIHLVNPNTTRSMTETIAAAARVVAAPGTQIMAATSAMGPASIE
FT                   GHYDDALALPGLLAAIAEAEAAGVDAHIIACFDDTGLEAARTLARAPVVGIGEAGFHMA
FT                   SLLAHRFAVVTTLSRSIPVIEGNLLRYGLDRRCAAVRASEVAVLELEDPASGARARISE
FT                   EIGRALREDRAEAIVLGCAGMADLARALGEEHGVPVIDGVASAVALAEGLVRAGLTTSK
FT                   TGAYAPPRPKPYAGRLADFAPKG"
FT   gene            complement(272805..273305)
FT                   /locus_tag="Snov_0283"
FT   CDS_pept        complement(272805..273305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0283"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: azc:AZC_2790 transcriptional regulator; PFAM:
FT                   regulatory protein MarR; SMART: regulatory protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87617"
FT                   /db_xref="GOA:D7A201"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A201"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADH87617.1"
FT                   /translation="MVAMTDVRESDGLMSAGGPDDPADAKALAIETYRLDQQVGFLMRV
FT                   ANQRHTALFAARMIENLTPPQFATLAKLREVGPCSQNRLGRLVYLDAATIKGVVDRLRA
FT                   RGFVLTADDPLDRRRRAVGLSERGRAVADEAILVAREITEATLEPLDEAERAEALRLLR
FT                   KLG"
FT   gene            complement(273367..274101)
FT                   /locus_tag="Snov_0284"
FT   CDS_pept        complement(273367..274101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0284"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bbr:BB1775 putative ATP-binding component of
FT                   ABC transporter; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87618"
FT                   /db_xref="GOA:D7A202"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A202"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87618.1"
FT                   /translation="MNPPADTPMLEVDGLEAWYGEAKILFGLSLTVAPGEAVALVGRNG
FT                   AGKSTTMKAVMGLVRRRARRLALHGQDIAALPTYAIARLGIGYVPEDRRIFTDLTVTEN
FT                   LDLGRRAVRPGGGSLMGPDWPREALFELFPNLAALRDRLGGQMSGGEQQMLAVARALVG
FT                   RPALLLLDEPSEGIAPIIVEQMINALGALKASGLSLLISEQNTALCSAVCNRAYVIEQG
FT                   ELRWQGAMSDLDSAVEPMRIFG"
FT   gene            complement(274098..274871)
FT                   /locus_tag="Snov_0285"
FT   CDS_pept        complement(274098..274871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0285"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bpy:Bphyt_4328 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87619"
FT                   /db_xref="GOA:D7A203"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:D7A203"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87619.1"
FT                   /translation="MTQNPAGTVLEVRELTKHYGGVRAVDGVSFSIAPGELLALIGPNG
FT                   AGKSTCFNIVNGQLKPDSGTVRILGRDVTGVPSRRIAHLGVGRTFQVAAVFGSMTALEN
FT                   VQAALIAARGSVFGFWRPATTIARDEAMALLEQTGMAGEAERPAAALAYGDVKRLELAM
FT                   ALAGDPRLLLMDEPTAGMAAAKRGEMIALVQKLTRSRGLAVLFTEHSMDVVFGHADRVI
FT                   VLARGRLIADGTVDEVRADPRVREVYLGGTAEAAR"
FT   gene            complement(274868..276766)
FT                   /locus_tag="Snov_0286"
FT   CDS_pept        complement(274868..276766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0286"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: bbr:BB1773
FT                   putative permease component of branched-chain amino acid
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87620"
FT                   /db_xref="GOA:D7A204"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D7A204"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADH87620.1"
FT                   /translation="MSLDALLFQAVNGLASASGLFLVAAGLSIIFGVTRIVNMAHGSFY
FT                   MLGLYLAVTLAPKLGTWIGGPLGFWAGILAAALVVAALGALIEMTLLRRLYGAPELYQL
FT                   LATFALLLVINDAALFLWGPEDILGPRAPGLSGSVMLLGRRLPQYDIFLALIGPAVLIG
FT                   LHLLLARTRFGRLIRAATQDREMVAALGINEALLFTAVFALGAGIAGLGGALQMAREPA
FT                   SLTLDLSVLGDAFVVVVVGGMGSIRGAYLAAVLVAEAKALCTALGVVDIFGFTFNMSRL
FT                   TLVAEFLVMALVLIVRPHGLFGRPQPPAARGGPAEPPLRPFSAPARVFALAAIALFAAM
FT                   PLIGTLVSYAPVLALDMLVAALFAASLHFIMGPGGMASFGHAAYFGLGAYGTAYAVTAL
FT                   DLPTPLAFATGIGVAAFGAVLFGWFCVRLEGVYFAMLTLAFAQIVWSVAFQWEEVTGGS
FT                   NGLFDVWPEWPFDSRTGLYLAAFVVTLAGLMLLRRLVFAPFGMALRAARDSRLRAEASG
FT                   IPVARVRWLAFALAGAVCGAAGGLFAFAKGSISPEAISVGRSIDGLVMVLIGGVQSLVG
FT                   PVVGAGAFTLLQDSVMRETDYWRALLGVLILAIVLLFPFGIAGGLSRGLRRPGGAR"
FT   gene            complement(276797..278026)
FT                   /locus_tag="Snov_0287"
FT   CDS_pept        complement(276797..278026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0287"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   dia:Dtpsy_0172 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87621"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7A205"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADH87621.1"
FT                   /translation="MRYSSCLRAALTGAAMSVAALALPAFTLPAFAAEPIRIGELNSYK
FT                   AQPAFLDPYRKGMQLAVKEINDAGGVNGRPLELISRDDGGNPGDAIRVAEDLVTREKVD
FT                   LLAGTFLSHIGLAVSGFAGKRKVFFLAAEPLTDKLTWTDGNRYTFRLRPSTYMQVAMLL
FT                   PAAKAAQRKRWAIVYPNYEYGQSAAATFKKLLKDAQPDVEFVEEQATPLGKIDAGPVAQ
FT                   AIADAKPDAVFNVLFGPDLAKFVREANTRGALEGTHVVSLLSGEPEYLDPLKDETPVGW
FT                   VVTGYPWYAITTPEHMAFLSAYQKAYGDYPRLGSVVGYTTIKSIAAGLNKAGSTDSEKL
FT                   VDAFRGLQVTGPFGPFSYRASDHQATMGAYVGILALKDGQGIMVQPSYVDGASVLPSDA
FT                   EVKALRPATD"
FT   sig_peptide     complement(277928..278026)
FT                   /locus_tag="Snov_0287"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 33"
FT   gene            complement(278129..279025)
FT                   /locus_tag="Snov_0288"
FT   CDS_pept        complement(278129..279025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0288"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: met:M446_1767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87622"
FT                   /db_xref="GOA:D7A206"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D7A206"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADH87622.1"
FT                   /translation="MPRFNTGPALAAVTGIGLLSVMDGMIKYVATEHGIGQIGVMRYAF
FT                   GALAAYLVFRAARTPWPDAATVRPHAWRSVVVAATALLFFYSLAVLPLAVALALSFTSP
FT                   IFIALFAAAILGERPGRPILIALVLGFAGVLVVLWSELTHTGGEEANALGLAAAIGAAI
FT                   TYALSMVVLKSRAARDPLPTIVLLQNSFAGLLLAPLGIWQWTAPAGGEILVFVGIGVLG
FT                   TAGHLCMAWAYGRADASRLGVFEYTAFVWALAIGLLAFGEVPAVSTLLGATLIVGGALV
FT                   ASGRTKAPPEPEIEIGP"
FT   gene            complement(279030..279563)
FT                   /locus_tag="Snov_0289"
FT   CDS_pept        complement(279030..279563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0289"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cyb:CYB_1709 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87623"
FT                   /db_xref="GOA:D7A207"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7A207"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH87623.1"
FT                   /translation="MTDFLIRPADDADGDAIAVLIAAAFAEYEGCVFDRAAEFPELDAI
FT                   ASHFAARGGTIWVAEADGEVIGSFALAPTRDADAPAGGMEIFKVYVARTARRRGVARAL
FT                   FERALTQAQAAGAPEIRLWTDTRFTDAHRFYERCGFHRHGEARECHDLSATWEYSYRLS
FT                   LNPAAPSRLARIES"
FT   gene            279769..280245
FT                   /locus_tag="Snov_0290"
FT   CDS_pept        279769..280245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_1164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87624"
FT                   /db_xref="UniProtKB/TrEMBL:D7A208"
FT                   /inference="similar to AA sequence:KEGG:Xaut_1164"
FT                   /protein_id="ADH87624.1"
FT                   /translation="MNLFHRVLRLALAGMFAAALAACATQAPQPAAPAMPQYTSPITAQ
FT                   QLVGKWGLAAYHRPEDAARTEAQARQGCRQPYVINAGPGGGFMMYLADDSSPSEMVSKQ
FT                   VGTGPIFIGLPTEPAGAKSDREVVRFDGQILVLKWLDPEVAGRYGTMVYVRCPA"
FT   sig_peptide     279769..279843
FT                   /locus_tag="Snov_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.786 at
FT                   residue 25"
FT   gene            280676..281674
FT                   /locus_tag="Snov_0291"
FT   CDS_pept        280676..281674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0291"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   rpb:RPB_1841 ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87625"
FT                   /db_xref="GOA:D7A209"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D7A209"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADH87625.1"
FT                   /translation="MRGDSGLLSARQRAAVQAAAVAVALTALAAAGPAQAQSGVYGYQS
FT                   SYQLYSRSAASNPSAWRPGNAPVYPSGSVYQPPRPSADVGAARGVYGYAPPARRTTTAP
FT                   ASSYAASANPSGYDADVELPPAPVQAAAPTTRQTKAASRSTRGTATRTAAVPASYTVED
FT                   DIYDDPDTPLPLYRPSTGAKGVDRKFDRHVVRYSSSDPAGTIIVDTGARYLYLIQGDGT
FT                   AVRYGIGVGKEGFQWAGSERISRKAEWPEWRPPSEMLDRRPDLPRVMPGGEDNPLGARA
FT                   LYLGKSLYRIHGSNEPETIGQAVSSGCIRMRNEDVIDLYGRVQVGTLVRVI"
FT   sig_peptide     280676..280786
FT                   /locus_tag="Snov_0291"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.980 at
FT                   residue 37"
FT   gene            282044..282832
FT                   /locus_tag="Snov_0292"
FT   CDS_pept        282044..282832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0292"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="KEGG: azc:AZC_3919 ubiquinone/menaquinone
FT                   biosynthesis methyltransferase; TIGRFAM:
FT                   ubiquinone/menaquinone biosynthesis methyltransferase;
FT                   PFAM: UbiE/COQ5 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87626"
FT                   /db_xref="GOA:D7A210"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7A210"
FT                   /inference="protein motif:TFAM:TIGR01934"
FT                   /protein_id="ADH87626.1"
FT                   /translation="MAADTRTDGTTSEAADTHFGFRTVPLGEKQRMVDEVFHSVARRYD
FT                   LMNDLMSLGLHRAWKDLLVSRLRPPKTDRSFRLLDVAGGTGDVSFRTVEAGGAGTSATV
FT                   ADINGGMLGVGRERAASLGLSDRVEFVEANAEELPFADKSFDATTIAFGIRNVPRMDKA
FT                   LAEMRRVLKPGGRCFVLEFSRVDVPGLDAIYDAYSFKLIPPMGKLVTGDAESYQYLVES
FT                   IRKFPSPEAFAEMMRAAGFSRVDVTPLTGGIVCLHSGVRI"
FT   gene            282837..284405
FT                   /locus_tag="Snov_0293"
FT   CDS_pept        282837..284405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0293"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /note="KEGG: xau:Xaut_2017 2-polyprenylphenol
FT                   6-hydroxylase; TIGRFAM: 2-polyprenylphenol 6-hydroxylase;
FT                   PFAM: ABC-1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87627"
FT                   /db_xref="GOA:D7A211"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7A211"
FT                   /inference="protein motif:TFAM:TIGR01982"
FT                   /protein_id="ADH87627.1"
FT                   /translation="MATPLGDYLRLARAGFVLAREGVASRIDPAMRPPGSEPLFAIAKL
FT                   IERRGPASSAARLGAALSRLGPSYVKLGQFLATRPDVVGAQMARDLELLQDRMPAFPQE
FT                   VAEATIERNFDRPASVVYSRLSPALAAASIAQVHQGEVTEADGTVQRVAVKVLRPDVQR
FT                   RFRIDLSSFYRAARLGEQASPEGRRLRLVAVVDTLARSVSMEMDLRLEAAALSELAQNT
FT                   GEDEDFRVPAVDWDRTGREVLTTEWIDGIKLNDLDALRAAGHDLPKLGRVVMQSFLRHA
FT                   LRDGFFHADMHPGNLFVDAQGRLVAVDFGIMGRLGHKERRFLAEILFGFITRNWLRTAQ
FT                   VHFEAGYVPPHHSVEDFAQAIRAIGEPIYSRRADQISMAKLLTLLFEVTALFDMKTRPE
FT                   LLLLQKTMVVVEGVARTLDPQLDMWKTAEPVVRAWIERNLGPVGRIEEVAGGFSAIGRS
FT                   LQNLPDLVAQGQRIANQLDAATRDGLVLSPETMEAIGRAEGRGNRWGTVALWVIAALLA
FT                   GHLLF"
FT   gene            284700..284828
FT                   /locus_tag="Snov_0294"
FT   CDS_pept        284700..284828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87628"
FT                   /db_xref="GOA:D7A212"
FT                   /db_xref="UniProtKB/TrEMBL:D7A212"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87628.1"
FT                   /translation="MTLLQWYILVGVPFILLAGAFAADRLSAYDSRHADRHTGPAE"
FT   sig_peptide     284700..284768
FT                   /locus_tag="Snov_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.975 at
FT                   residue 23"
FT   gene            284841..284960
FT                   /locus_tag="Snov_0295"
FT   CDS_pept        284841..284960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0295"
FT                   /product="transmembrane efflux pump"
FT                   /note="KEGG: lxx:Lxx08160 transmembrane efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87629"
FT                   /db_xref="GOA:D7A213"
FT                   /db_xref="UniProtKB/TrEMBL:D7A213"
FT                   /inference="similar to AA sequence:KEGG:Lxx08160"
FT                   /protein_id="ADH87629.1"
FT                   /translation="MTTANFLLLLIMPVGALVVGGIVYLVASRDHHPHAGPAE"
FT   sig_peptide     284841..284924
FT                   /locus_tag="Snov_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.802) with cleavage site probability 0.210 at
FT                   residue 28"
FT   gene            285080..286309
FT                   /locus_tag="Snov_0296"
FT   CDS_pept        285080..286309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0296"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase"
FT                   /EC_number="6.3.2.5"
FT                   /note="TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase; KEGG:
FT                   azc:AZC_3913 DNA/pantothenate metabolism flavoprotein;
FT                   PFAM: flavoprotein; DNA/pantothenate metabolism
FT                   flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87630"
FT                   /db_xref="GOA:D7A214"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D7A214"
FT                   /inference="protein motif:TFAM:TIGR00521"
FT                   /protein_id="ADH87630.1"
FT                   /translation="MLATKRILLIIGGGIAAYKSLDLIRRLKERGASVRVIMTAAAQHF
FT                   VTPLAAGALSHERVFTELFDREAEHDIGHIRLSREADLIIVAPATADLMAKMAHGLADD
FT                   LASAVLLASDKPVLVAPAMNPLMWSHAATRRNAAQLAADGVAFIGPNAGAMAERGEDGP
FT                   GRMAEPMEIVEAAERLLAASGPLKGRHVLVTSGPTHEPIDPVRYIANRSSGKQGHAIAA
FT                   AAARAGAQVTLVSGPVNLPDPAGVDVRHVESARDMLAAVEAALPADAAIFAAAVADWRA
FT                   ASEAGEKLKKDGNAIPPLMLTENPDILATVAHLSNRRPRLVVGFAAETQNVVAYAQAKR
FT                   ARKGCDWIVANDVSQHSGIAGGVMGGDSNAVHLITAEGVEHWPEASKAAVAEKLIARVA
FT                   ASLGPLGAAE"
FT   gene            286306..286791
FT                   /locus_tag="Snov_0297"
FT   CDS_pept        286306..286791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0297"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   Dut"
FT                   /note="KEGG: azc:AZC_0707 deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase; TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; PFAM: deoxyUTP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87631"
FT                   /db_xref="GOA:D7A215"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D7A215"
FT                   /inference="protein motif:TFAM:TIGR00576"
FT                   /protein_id="ADH87631.1"
FT                   /translation="MSFEASLDVAVLVLPHGEGLPLPEYATAGSAGLDLLAALPGDEPL
FT                   TLAPLARAAVPTGLSIALPEGYEAQVRPRSGLALKQGLTVLNAPGTIDSDYRGEVKVLL
FT                   VNLSDQPVVLERGQRIAQMVVAPVTRIKLVETGDLNETTRGSGGFGSTGLDGRHISR"
FT   gene            286801..287244
FT                   /locus_tag="Snov_0298"
FT   CDS_pept        286801..287244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0298"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="KEGG: xau:Xaut_0076 BadM/Rrf2 family transcriptional
FT                   regulator; TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87632"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A216"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ADH87632.1"
FT                   /translation="MPRLSDKSLLAIAAVVDVALHARGMPVAAKALAARHDLPPRHLEP
FT                   VLQALVHAGVLKGVRGPRGGYELARERRRITVAEVVRVVEAESEEALDGFPPLVRDIVQ
FT                   PAVAEAERAFEAALDGVTVEDLCRSAAQNTLRKGLPEGIDFTI"
FT   gene            287364..288341
FT                   /locus_tag="Snov_0299"
FT   CDS_pept        287364..288341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0299"
FT                   /product="cysteine synthase A"
FT                   /note="KEGG: azc:AZC_0709 cysteine synthase K/M; TIGRFAM:
FT                   cysteine synthase A; cysteine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87633"
FT                   /db_xref="GOA:D7A217"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D7A217"
FT                   /inference="protein motif:TFAM:TIGR01139"
FT                   /protein_id="ADH87633.1"
FT                   /translation="MAETALKTPAAQVGRGRIYNSITETIGDTPLVQLNRLPAQRDVKA
FT                   RILVKLEFFNPIGSVKDRIGVSMIQSLEEAGLIKQGTVLVEPTSGNTGIALAFVAAAHG
FT                   YRLILVMPESMSVERRKMLALLGAELVLTPAAQGMRGAVARAEELVKELPDAIIPQQFR
FT                   NPANPAIHRRTTAEEIWNDTHGEVDIVVSGVGTGGTITGIGQVLKPRKPSLRMVAVEPE
FT                   DSPVLSGGQPGPHKIQGIGAGFVPEVLDRSVIDEVVTVGNQTAFETARAVARLEGIPVG
FT                   ISSGAAIAAALEVGVRPENEGKTIVVIIPSFAERYLSTPLFEGL"
FT   gene            288476..290995
FT                   /locus_tag="Snov_0300"
FT   CDS_pept        288476..290995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0300"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: met:M446_0500 multi-sensor signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87634"
FT                   /db_xref="GOA:D7A218"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7A218"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH87634.1"
FT                   /translation="MAHPAGMGGERNQGGRVPQVRPGRRLLRPLFTGLAFAAPIAPASA
FT                   APASDVFAVLAVQDPSVLIGLALVVGLIVFATTTAIVHLRYRRQSLRREMAAFGEISRL
FT                   EAQIDEARALLMAEPQIVVVWRDPAADPEIIGNTPAFTGVAAPARILAFGSWLTPASAR
FT                   EIEAAVDRLRGRGTPLAATLATQDGRFVEADGRPVGAAVVLRLRDITGVRLDQAQLEAA
FT                   YRALDAESSALRTLLDALPAPAWVDGEDGRLRWSNAAYAHAVEARDASDAASRGLMLLD
FT                   QQSRTQAEKAHAASLPFKARLPVVVAGTRRVLDVLEVPAGGGAAGIALDATEAEVVRAE
FT                   LAQVVGAHRRTLDQLATAVAIFGADQRLVFHNAAYARLFDLDAAFLDDRPTDGAVLDRL
FT                   RAARRLPEQADFRLWREELHAAYRAIEPREHWWHLPGGRTLRVVTAPNPEGGITYLFDE
FT                   VTERLALESRFNSLTRIQSETLDALAEAVAVFGSDGRLGLVNSAFRRLWQLDAAMLDAH
FT                   PHIDAVAAACRPLTADAAVWARLTATVTGIEARMPTEFRMERNDRTILDGSTQPLPDGA
FT                   TLVTLRDVTDSVNVERALVERNDALVAADHLKSTFVSHVSYELRSPLTTIIGFAQLLDD
FT                   TGIGPLNVKQRAYVNHITESSAALLAIINDILDLATIDAGSMALELTEVDVRAAMDAAA
FT                   EGVRDRLAEGGIRLSIELQNAAGSFRADAKRVRQILYNLLSNAVGFAPEGSTVTLSAER
FT                   REDGVIFRVRDMGPGVPPEIGARAFDRFESHTAGSRHRGVGLGLSIVRSLVALHGGTVS
FT                   LAPAQGGGTLVTCIFPLEAGASRDAAE"
FT   gene            291017..292846
FT                   /locus_tag="Snov_0301"
FT   CDS_pept        291017..292846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0301"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079;
FT                   aminoglycoside phosphotransferase; KEGG: xau:Xaut_3297
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87635"
FT                   /db_xref="GOA:D7A219"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A219"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ADH87635.1"
FT                   /translation="MIDGRTTGAVPTMPVAHWDVVLPDEVATGRLAMDLAAMLRPGDLV
FT                   ALDGDLGAGKTTLARALIRELAGDPELEVPSPTFTLMQTYDLPRHRVVHADLYRLSDAS
FT                   ELDELGWQEQTDGAVTLVEWPERAEGAVLKTDRLEVHISMPQDRPETARRVRLLGYGRL
FT                   AGALYRMRAIRSLIDSTGFGPARRRHLQGDASTRSYERLVGAKRNAILMNAPRRPDGPP
FT                   VRAGRSYSAVAHLAEDVKPFVAMARGLRARGFSAPAIYGGDLDAGLLVIEDLGEEGVLA
FT                   GTPPAPVPERYEASVDVLAALHALDLPATLAVASGIDHQIPPYDLEALTIEAELLLDWY
FT                   LPHCGVALPADARQSFRQLWAAALAPSLAQKPVWTLRDFHSPNLMWLPQREGIAKVGLL
FT                   DFQDAVMGPPAYDVVSLAQDARVDVPEALELHLLGRYVKARREADADFDMRGFAASYAV
FT                   MGAQRATKILGIFARLNHRDRKPGYLRHMPRIWNYLQRCLAFTDLEALAGWYKDHVPPP
FT                   RLHGRPEGAVGMPAPAPVPAAPLAPPRPAEAAPKAPPAAPPAEAPPPTEAAAVTETPSA
FT                   PATVAEAPAAETPPDAVPSEAASTQTPNDPATT"
FT   gene            292843..293562
FT                   /locus_tag="Snov_0302"
FT   CDS_pept        292843..293562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0302"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: xau:Xaut_3298
FT                   nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87636"
FT                   /db_xref="GOA:D7A220"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7A220"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ADH87636.1"
FT                   /translation="MTAIKTAMVLAAGLGQRMRPLTDHMPKPMVAVNGRPLIDHVLDRL
FT                   AEAGVEKAVVNLHWHADVLERHLLGRTRPRIVLSDERGALLETGGGIRKALPELGPDPF
FT                   FVINADTIWIEGIRPNLAALAEGFDPEAMDIALLVAPIATSIGYDGHGDFLMDGEGRLT
FT                   PRPERILAPFVYAGAAVVAPRIFAGTPQGPFSLSRLFRQAAEAGRLHGERMEGVWMHVG
FT                   TPEAVALAEEAIERSKD"
FT   gene            293599..296640
FT                   /locus_tag="Snov_0303"
FT   CDS_pept        293599..296640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0303"
FT                   /product="double-strand break repair protein AddB"
FT                   /note="TIGRFAM: double-strand break repair protein AddB;
FT                   KEGG: azc:AZC_0713 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87637"
FT                   /db_xref="GOA:D7A221"
FT                   /db_xref="InterPro:IPR014153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D7A221"
FT                   /inference="protein motif:TFAM:TIGR02786"
FT                   /protein_id="ADH87637.1"
FT                   /translation="MSRPDPNLLTIPASAPFLAVLADALLDGRLVEGFAPRHDPFALAS
FT                   ATVFLPTRRAGRLLAEALRARMESGVTLLPRIVPLGDVDEDSLAFAESFTDPPRAVPGM
FT                   TRRLALASLVRRWRRLLAGDDGRVAVAAGPGAEFALADALAHLIDEMAAQQVPWEKLDT
FT                   LVPGQHDLYWDMALDFLKIAREFWPALLDELGAVDASVRRDRLIAAEAERLRAAPAGPV
FT                   IAAGSTGSMPATARLLAAVAHLTDGCVVLPGLDTDLDARSWDHLTDDEAPAPSHPQYGL
FT                   ALLLKAHMRVGRDAVRSLAPPAPHGRERLLSEALRPVASTEAWASLAERLGAAEIDAAL
FT                   AEVSVIEADDAREEALAIAVALREALEEPGRSAALVTPDRDLARRVAAELLRFEVAIDD
FT                   SAGEPLSESAPGRFARLVADACDAELAPVPLSALLRHPLARFGLERGALDQAADALELM
FT                   VLRGPRPEAGADGLVRAVAGFSPGLHHSSDPRAAIDTDRQALAAGLAERIARAFGPLLA
FT                   LGAGEHPFATLLEAHRAAVAAAWSAEDGGAAEDAIALAELSKTFEAMAEGASEAPVMRL
FT                   ADYAAALPLLLADRPVRPPLLPGARLRILGPLEARLVSVDRMVLAGLVEGTWPSAVRTD
FT                   PWLSRPMRAALGLEAPERRIGLSAHDFAQGCGAPELILSHPRKLGGAPTVPSRFLQRLE
FT                   AVSGEARWKMAKLRGDRFRRLAALIEEAPAASRIARPEPAPPVELRPKRLSVTEIETWL
FT                   RDPYTIYARHVLRLRPLDMLDEAPGAAERGSAIHDALGAFAQAFPEALPAEPEAGLLAF
FT                   GREAFRELEAFPAEYALWWARFERLVPRYIGWERARRADTRRVFAELGGRMALAGGRFA
FT                   LTGRADRIEQLREGGLAIIDFKTGAVPTAKQTAAHYSPQLPLEAAMAAAGGFRDLPAEG
FT                   AAALTYVRLGTSELKEVGAVDRDETAFGLAASTLERLEQLIATFEDPSRGYASLARPMF
FT                   RGRFGDYDHLARVKEWSTGGEGEE"
FT   gene            296637..300071
FT                   /locus_tag="Snov_0304"
FT   CDS_pept        296637..300071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0304"
FT                   /product="double-strand break repair helicase AddA"
FT                   /note="KEGG: azc:AZC_0714 putative exonuclease V; TIGRFAM:
FT                   double-strand break repair helicase AddA; PFAM: UvrD/REP
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87638"
FT                   /db_xref="GOA:D7A222"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D7A222"
FT                   /inference="protein motif:TFAM:TIGR02784"
FT                   /protein_id="ADH87638.1"
FT                   /translation="MSELTDLAPGPLRAATALQTTASDPLLSAWVSANAGSGKTHVLAR
FT                   RVIRLLMRGVPPGRILCLTYTKAAAANMANRVLDELRRWATLDDETLDKEIVRTDGGRP
FT                   DALRRAHARRLFAQALETPGGLKIQTIHAFCGALLHAFPFEAGVPAGFGELEEAARLEL
FT                   LARVRADVVLEAAGRPESALGQALGLIVGTTSDDGIDEIIGAMVADPAALEASDDDLAA
FT                   AVGLDRPIASRDIEHRIIAEALIARGAWLGLGQALIEEGGNCARRGRSLLEAAAAPDEG
FT                   TADTYARVFLKEDGEPYGDSQFGAAPIRAKYPLLLAERDRLAPLAQLLSAARALERSRG
FT                   VLILGREAARRYERAKAARGVLDFSDLVDAARRLLASGASAWVHYKLDQGIDHVLLDEA
FT                   QDTSPEQWEVIRPLVAEFFAGEGARAEARYGAASLPRTLFVVGDEKQSIFSFQGADPRR
FT                   FDTVRRELMRLTGGVGFEHIELRHSFRSAPGILAAVDTVFHAETAYQGLSALAEPPVHE
FT                   AIHAALPSLVELWEPEAPSEKVDIDAWQRPLDAPAADDPKGRLARKIAGHIAARIREGF
FT                   PVTGRHGTRPARPGDFLILVRRRDSLFEAIIRELKEARVAVAGADRLTVAQHIAVMDLM
FT                   ALGDALLARDDELALACALKSPLFGLDDSDLMKLAPERAGLLEDALFARAGENPHWRAA
FT                   AERLRRLRPEARRLRPFDFYARVLGRERGRAAMIARLGPEAADALDEMLALARSYENVE
FT                   APSLAGFLAFLRRGGAEAKRDMEAGRDEVRVMTVHGAKGLEAPYVILADTTSGPMTRRA
FT                   AGLLRVELPDGRRAALHAPSKKGDTPAMARARAQGDAAQQDEYRRLLYVALTRAESALV
FT                   LAGADGGRKRPADCWYDLVRGALEPEAVEQPAAGFAGTVRRWRSAVHEEIIAAPAVAAI
FT                   AAAPDEAERALARALSRPIEEPAARAALRPSASSLLSAAPEGPEALALHRGELLHRLMA
FT                   ALASLPPEERAAPGRRLLAAAGDFEEAAREELLTEALGVLAVPGLADLFGPGSLAEVPL
FT                   VGELEDGTPVSGRIDRLAVLGDRILIADFKTDRRVPREASSLPPAHVRQVALYARLLRR
FT                   LYPGRPIEARLVYTAGPLAHALGADVLERIVESVTSQ"
FT   gene            300154..300474
FT                   /locus_tag="Snov_0305"
FT   CDS_pept        300154..300474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0305"
FT                   /product="thioredoxin"
FT                   /note="KEGG: xau:Xaut_3301 thioredoxin; TIGRFAM:
FT                   thioredoxin; PFAM: Thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87639"
FT                   /db_xref="GOA:D7A223"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7A223"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ADH87639.1"
FT                   /translation="MGVEKVSDQSFESDVIKSDGPVLVDFWAEWCGPCRMVAPVLDEVA
FT                   GELGDKLKIVKLNVDENPATASKYGIMSIPTLLLFKDGQLASRQVGAAPKAKMLQWINS
FT                   AI"
FT   gene            300627..301133
FT                   /locus_tag="Snov_0306"
FT   CDS_pept        300627..301133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0306"
FT                   /product="Domain of unknown function DUF1993"
FT                   /note="PFAM: Domain of unknown function DUF1993; KEGG:
FT                   vap:Vapar_2424 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87640"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D7A224"
FT                   /inference="protein motif:PFAM:PF09351"
FT                   /protein_id="ADH87640.1"
FT                   /translation="MPLSIYDASIPVFERALRNLDAILTKAEEHAAANGIDLSELAAAR
FT                   LAPDMFPLTGQIQSASDSAKFAAARLTGTTGPSFADTETTFEELHARIAKTLDYLASVD
FT                   RAGFEGAETREIVQKSRRGERHFVGQAYLLTFALPNFFFHVTTAYDILRHKGVPVGKSD
FT                   YLGAF"
FT   gene            301435..303363
FT                   /locus_tag="Snov_0307"
FT   CDS_pept        301435..303363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0307"
FT                   /product="Gluconate 2-dehydrogenase (acceptor)"
FT                   /EC_number="1.1.99.3"
FT                   /note="KEGG: azc:AZC_0150 hypothetical protein; PFAM:
FT                   cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87641"
FT                   /db_xref="GOA:D7A225"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D7A225"
FT                   /inference="protein motif:PRIAM:1.1.99.3"
FT                   /protein_id="ADH87641.1"
FT                   /translation="MSGARKRGIVFGLAAAFWGLGLAPAPAQTPAAPDDSALVARGEYL
FT                   ARAADCMPCHTGDKAKPFAGGLGLNTPFGTLYSVNITSDVATGIGSWSFDDFRRALHDG
FT                   IRKDGAYLYPAMPFDAYTGITEDDLKALWAYVRRIPAVNAPNPENGLSFPFNIRLGMLA
FT                   WRELFFQPAFFKPTPGKSDEWNRGAYLVEALGHCSDCHSPRNIMGAIKGKEAFTGAEVD
FT                   GFYAPDIASGALGKTWRKDMLIQFLKTGSAPQKTVVFGPMAEVVHDSLSHLTDADLAAM
FT                   ATYLLESPPPLDAPAPQKASPLPADVYARASKLFIDNCAVCHQQQGTGLLGAIPSLAGN
FT                   PAVTAAEPYNVIAATLHGLPSDGHYGTMPSFAGRLSDQQIADVVNYVRTAWGNQGTPNA
FT                   TPRMVAAWRETVKVPDYGTQAASAFDCAQVGGAPGAPGPDPKAVAALTAAIAGGNREVS
FT                   SLVESYEAAAPNASPAQVVDALMAAYCPVVAAGAGEDYQKYARLKGFTLQAAADVSFRG
FT                   TPDSLPDVPVVTAVVAGKSLVARQPESLAGPLACPAAGKIPADLVTAAAGLIGKPQLPV
FT                   PGGAGGGYARELVTKNPKARPADIANALILSYCGLVAADKGIEPATQHAYVEDFGQQVI
FT                   QTLQVQP"
FT   gene            303590..304453
FT                   /locus_tag="Snov_0308"
FT   CDS_pept        303590..304453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0308"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: oan:Oant_2567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87642"
FT                   /db_xref="GOA:D7A226"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D7A226"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADH87642.1"
FT                   /translation="MSLRSLGSMLLLAVMWGLSIPVTKMGLETLPPLTLTALRFAVAVP
FT                   LLFALLAGRWRLPWRAVPKVAALGFLAIGIGQVTQTLGVVGTSASVGTVITATIPLFIV
FT                   VIAALRLRQPVTLLQTAGLIAAFAGIALVAFGDRDPAALAQTTASGAILMLLSAAAIAF
FT                   YYVWSVEVADAYGTVTVVAWSTLCGFISLAPWAAWEASNTPFVIGVTAIGAAIYLGVVV
FT                   TVAGLFLWLNMLRTVPARVAASVQFLQPVVGVMASAALFGDHLGLAFFVGVALVLTGLA
FT                   TTLANR"
FT   gene            complement(304606..304690)
FT                   /locus_tag="Snov_R0006"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(304606..304690)
FT                   /locus_tag="Snov_R0006"
FT                   /product="tRNA-Leu"
FT   gene            304913..305935
FT                   /locus_tag="Snov_0309"
FT   CDS_pept        304913..305935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0309"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   azc:AZC_1016 NAD dependent epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87643"
FT                   /db_xref="GOA:D7A227"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A227"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADH87643.1"
FT                   /translation="MVDVAAELPLESEAELEARAAPMERLVTIYGGSGFIGRHVVRALA
FT                   KRGWRVRVAVRRPDLAGHLQPLGAVGQINPVQANLRYPASVLRAAEGAEVVINLVGVLH
FT                   ESGRQSFEAVHAFGAKQVALAAREVGARLIHGSAIGANAESTAFYGKSKAAGEAAAFEA
FT                   VPEAVIMRPSIVFGPEDDFFNRFASMSRLSPVLPLIGGGETRFQPVFVGDVAEAYARAV
FT                   DNLARPGTVYELGGPEILSFKQLMELMLAEIDRKRLLVPVPSAVAAFKARFLELLPNPL
FT                   LTRDQVRMLGYDNVVSEAAKAEGRTLEGLGIKPTALGAILPSYLWRYRKAGQFTRPEAA
FT                   "
FT   gene            complement(306099..306905)
FT                   /locus_tag="Snov_0310"
FT   CDS_pept        complement(306099..306905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0310"
FT                   /product="undecaprenol kinase"
FT                   /EC_number="3.6.1.27"
FT                   /note="TIGRFAM: undecaprenol kinase; KEGG: xau:Xaut_1807
FT                   putative undecaprenol kinase; PFAM: Bacitracin resistance
FT                   protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87644"
FT                   /db_xref="GOA:D7A228"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:D7A228"
FT                   /inference="protein motif:TFAM:TIGR00753"
FT                   /protein_id="ADH87644.1"
FT                   /translation="MSFGTLLEAFLLGLLEGFTEFLPVSSTGHILLAGHFLGFESQGKV
FT                   FEVVIQLGAILAIVVAYFQRFLHVLVTLPTSERSRNFVIGILIAFLPAAVIGAFAHGFI
FT                   KNVLFETPALICIMLILGGGVLLWVDTLKLRPIHDDAMAFPKALALKIGFIQCLAMIPG
FT                   VSRSGSTIVGGLLLGASKPAAAEFSFFLALPTMAGAFAYDLYKNRDALNADDATLIAVG
FT                   FVAAFIAALAVVRGLIAFVSRHGYTPFGWWRIAVGGVGLVALALVG"
FT   gene            307140..308102
FT                   /locus_tag="Snov_0311"
FT   CDS_pept        307140..308102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0311"
FT                   /product="SH3 type 3 domain protein"
FT                   /note="PFAM: SH3 type 3 domain protein; KEGG: bxe:Bxe_A1493
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87645"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:D7A229"
FT                   /inference="protein motif:PFAM:PF08239"
FT                   /protein_id="ADH87645.1"
FT                   /translation="MRILVAGAMLLMALGGSAFAQGRGFVTTDVNLRAGPSVEYPVVLV
FT                   LAEGSPLDIFGCLEDYSWCDVAVDDYRGWVAAQYVESVYQGRRVEFYDYAPVIGVPIIG
FT                   FTFGDYWGRYYQGRPWYSTYDRWGPPRRPPVWGPPGWAPPPKPGWGKPGWGGPGWGGPP
FT                   PPKPGWGGKPPNGGWNGNPPHGGWNGNPPHGGWGGKPGNNPGWNGNPGWNGNPGWNGGK
FT                   PPQGGKPPQGGKPPQQGGPPPQGKPPQWQRPPQQGQKPPQSPPQQQWLQRPPQGPVPYD
FT                   TSRWRNNQSAPPSQQPQRPGYGGRPNCVPNTPGCPAPQR"
FT   sig_peptide     307140..307202
FT                   /locus_tag="Snov_0311"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 21"
FT   gene            308305..308505
FT                   /locus_tag="Snov_0312"
FT   CDS_pept        308305..308505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0312"
FT                   /product="ribosomal protein L35"
FT                   /note="KEGG: mno:Mnod_5554 ribosomal protein L35; TIGRFAM:
FT                   ribosomal protein L35; PFAM: ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87646"
FT                   /db_xref="GOA:D7A230"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:D7A230"
FT                   /inference="protein motif:TFAM:TIGR00001"
FT                   /protein_id="ADH87646.1"
FT                   /translation="MPKMKTKSGAKKRFKLSGTGKVVMAQAGKRHGMIKRTNKQIRDQR
FT                   GTTVMSERDAFNVRKFYLPNG"
FT   gene            308537..308905
FT                   /locus_tag="Snov_0313"
FT   CDS_pept        308537..308905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0313"
FT                   /product="ribosomal protein L20"
FT                   /note="KEGG: mes:Meso_0674 50S ribosomal protein L20;
FT                   TIGRFAM: ribosomal protein L20; PFAM: ribosomal protein
FT                   L20"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87647"
FT                   /db_xref="GOA:D7A231"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:D7A231"
FT                   /inference="protein motif:TFAM:TIGR01032"
FT                   /protein_id="ADH87647.1"
FT                   /translation="MARVKRGVTSHAKHKKVLKAAKGYFGRRKNTIRVAKQAVEKAQQY
FT                   AYRDRKVKKRNFRALWIQRINAATRELGFTYGRFIDGLGKAGIEVDRKVLSDIAIHEPA
FT                   AFAALVEQAKAALEKQAA"
FT   gene            309159..310262
FT                   /locus_tag="Snov_0314"
FT   CDS_pept        309159..310262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0314"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, alpha
FT                   subunit; KEGG: azc:AZC_4449 phenylalanyl-tRNA synthetase
FT                   alpha subunit; PFAM: phenylalanyl-tRNA synthetase class
FT                   IIc; aminoacyl tRNA synthetase class II domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87648"
FT                   /db_xref="GOA:D7A232"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:D7A232"
FT                   /inference="protein motif:TFAM:TIGR00468"
FT                   /protein_id="ADH87648.1"
FT                   /translation="MSVAAALPDLDALERELSSAITAAADEAGLEAVRVSALGKKGSVS
FT                   ELLKSLGGMSPEERKTAGPAINGLRDRLNEALGARRTELKAAALTKRLETERVDVTLPV
FT                   RETPAELGRVHPISQVIDELTAIFADMGFSVAEGPDIEDDFHNFTALNFPEGHPAREMH
FT                   DTFYLPTKEDGSRLVLRTHTSPVQVRTMLSKKPPIRVICPGRTYRSDSDQTHTPMFHQV
FT                   EGLVIDKGSNLGHLKWILEEFCKAFFEVDNVKMRFRPSFFPFTEPSMEVDIQCDRSRPG
FT                   EIRFGEGSDWLEILGCGMVHPNVLKNCGLDPDEYQGFAWGMGIDRIAMLKYGMPDLRAF
FT                   FEADVRWLSHYGFRPLDFPTLAGGLSN"
FT   gene            310282..312687
FT                   /locus_tag="Snov_0315"
FT   CDS_pept        310282..312687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0315"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit;
FT                   KEGG: azc:AZC_4450 phenylalanyl-tRNA synthetase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87649"
FT                   /db_xref="GOA:D7A233"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:D7A233"
FT                   /inference="protein motif:TFAM:TIGR00472"
FT                   /protein_id="ADH87649.1"
FT                   /translation="MKFTLSWLREHLSGDYSLDDVTGTLNRIGFEVEGVEDKAAKLKGF
FT                   SIAYVVSAVQHPNADKLRVCMVDTGQGEPVQVVCGAPNARTGMKSVFSPPGTYIPGKDI
FT                   TLGIGTIRGVESRGMLCSAAELELSEDHDGIIDLPADAPVGATYVDWAGLGDPVVEIAV
FT                   TPNRADGLGIHGIARDLAAAGVGTLIEKPIEAVKGAYPCPVSVIIAEGAPCPAFALRLV
FT                   RGVKNGPSPDWLQAKLRAIGLRPINTLVDITNFLTFDQNRPLHVFDAAKVHGNLVVRRA
FT                   KEGESLPALDGKTYALDESMCVIADDRAVESLAGVMGGEESGCDETTVDVLVESALWEP
FT                   INIAQTGRKLGLNSDARFRFERGIDPAFTLPGLEMATKLILDLCGGEASEVVLAGAIPD
FT                   TTRVIEFPLSLTEKLTGLVASDSEQVETLGKLGFKVEGTSGTARVTPPSWRGDIEGKAD
FT                   LVEEVVRIAGLDRVPSIPFPRDETARKPVLTTLQLRTRKAKRALAARGLVEAVTWSFVA
FT                   KEQAELFGGGAPELALANPIASDLSDMRPSLLPGLIGSAQANADRGHGDSALFEVGQVF
FT                   KGDRPQDQFIAATGIRRATARPMGAGRHWSAKAGAVDAFDAKADALAVLAAAGAPVANL
FT                   QISTDAPAWFHPGRSGTFRLGPNVIGHFGELHPSVLEALDADGPLVGFEVLIDRIPEPK
FT                   AKATRVKPLLELAAFQPVERDFAFVVPRSVAAGDMVKAAAGVDRKLITAVNVFDLYEGA
FT                   GIDEDKKSVALSVTLQPREKTLTDAEIEAVAGKIVAEVAKKTGAMLRG"
FT   gene            complement(312819..314171)
FT                   /locus_tag="Snov_0316"
FT   CDS_pept        complement(312819..314171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0316"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: azc:AZC_4451 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87650"
FT                   /db_xref="GOA:D7A234"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A234"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ADH87650.1"
FT                   /translation="MNRSPSRPGALSRRRFLAATSAALLPMPALAQAQYAGDVDVAIVG
FT                   GGAAGIAAARKIAEAGRNYVLLEAGSALGGRARTVSAFGQDIDLGASGFARTDSTLAAA
FT                   AQAMGSEITPLPSGRRLFLDGREAHESAYDAFSVALGKARRDMLAVADTNKDPAAATVI
FT                   GPVDGWAATSAQLIGPLSAGRALASLSTLDLVQREAPPDDATSVKGIGALIETLGSRLN
FT                   VQTGAAVSVITNAGRFHTLTLRGQRAPIRARAIIVAVPAPVIAAGALRFNPVLPPRLAA
FT                   AFRGVPAGFLEQVVFRLPRNPLGLQPNETVLARAGTAPPALLRGRINGGDVHVLTFGDA
FT                   QAREIAEKGEAAALNLVRTYLATAFELDADAVSEVVCSRWGADPLFRGALVAASPGQGA
FT                   QRRLFADTVQNRIFLAGDYVPTRGWGTLAAAWSSGEAAAARALRLVGDGPA"
FT   sig_peptide     complement(314076..314171)
FT                   /locus_tag="Snov_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.948 at
FT                   residue 32"
FT   gene            complement(314243..314851)
FT                   /locus_tag="Snov_0317"
FT   CDS_pept        complement(314243..314851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0317"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   rec:RHECIAT_CH0002605 probable amino acid efflux protein,
FT                   LysE family"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87651"
FT                   /db_xref="GOA:D7A235"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D7A235"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADH87651.1"
FT                   /translation="MPLSAYIAGLASGLSLIVAIGAQNAFVLQRGLRGEHVFAVCLACA
FT                   LSDAVLIAAGVAGLQQMLAMAPWLDAALRYAGAAFLVWYGARSLRSALRSQEALVVGAG
FT                   GAAALGPTLAATLALTWLNPHVYLDTMVLLGTLSTRHPGAEAFFAFGAITGSFAFFFGL
FT                   GYGAAWLRPLFARPSSWRVLEGVIAAVMWSIALGLLMDR"
FT   sig_peptide     complement(314774..314851)
FT                   /locus_tag="Snov_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.823) with cleavage site probability 0.595 at
FT                   residue 26"
FT   gene            314941..315837
FT                   /locus_tag="Snov_0318"
FT   CDS_pept        314941..315837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0318"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="KEGG: rhi:NGR_b00130 transcriptional regulator, LysR
FT                   family; TIGRFAM: transcriptional regulator, ArgP family;
FT                   PFAM: regulatory protein LysR; LysR substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87652"
FT                   /db_xref="GOA:D7A236"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A236"
FT                   /inference="protein motif:TFAM:TIGR03298"
FT                   /protein_id="ADH87652.1"
FT                   /translation="MLDYSALRAVAAVVQAGSFEKAARTLNVTPSAVSQRVKQLEERLG
FT                   TVLIARGTPCTATEIGAKLCRHMEHVGMLEGELLAGLPALADASPRQRVTVHIAVNADS
FT                   LGTWFVEAIAAFARRSDYLVGLVVDDQDHTAEWLKAGRVVAAVTSLEKPIQGCRRLSLG
FT                   ALRYHATASPDYRARHFPDGVTPAAIANAPALTFDQKDQLQSRWIRQALGADIAHPTHW
FT                   LPSPQSFIEATLAGMGWGMNPFRSVRDHLAAGRLVELIPDTPVDTPLFWQVNRLVAERL
FT                   ADLTREVTAVARRELAG"
FT   gene            316018..316680
FT                   /locus_tag="Snov_0319"
FT   CDS_pept        316018..316680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0319"
FT                   /product="protein of unknown function DUF540"
FT                   /note="PFAM: protein of unknown function DUF540; KEGG:
FT                   xau:Xaut_1152 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87653"
FT                   /db_xref="GOA:D7A237"
FT                   /db_xref="UniProtKB/TrEMBL:D7A237"
FT                   /inference="protein motif:PFAM:PF04401"
FT                   /protein_id="ADH87653.1"
FT                   /translation="MLRDAFAAFAETFSPDYRRVLLRSVGFAVGLLVALGIGAHYALTY
FT                   FVALDLRWAEITLDIVAAFGIFIAAIFLVPPVTSLIAGLFLDDVAAQVERGFPGEPEGQ
FT                   PLPIGRSLFLTVKFFGVMLAVNLVALLLLLVPGVNLVVFYVANGYLLGREYFQLAAMRY
FT                   RDEDEVALLRRHHAGAIFLAGLIIAAVVSVPILNLVTPVFATIFMVRLHKRLSRREY"
FT   gene            complement(316677..317528)
FT                   /locus_tag="Snov_0320"
FT   CDS_pept        complement(316677..317528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0320"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="SMART: HhH-GPD family protein; TIGRFAM: endonuclease
FT                   III; KEGG: azc:AZC_3684 endonuclease III/Nth precursor;
FT                   PFAM: HhH-GPD family protein; iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87654"
FT                   /db_xref="GOA:D7A238"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D7A238"
FT                   /inference="protein motif:TFAM:TIGR01083"
FT                   /protein_id="ADH87654.1"
FT                   /translation="MADGDRDSGSGPARERAGTRKPAAKPASGKAAAKKIASKAKAVLE
FT                   EQAATRPGRRRAVANAAAAAIGGAFKPWTKKEVETAFSRFEEANPHPEGELNYHDPFTL
FT                   LVAVVLSAQATDAGVNKATKTLFEEAPTPARMVALGEEGVARHIRTLGLYRGKAKNVVE
FT                   LSRLLIAEHDGKVPPDRAALEALPGVGRKTANVVLNIAFHMPTIAVDTHLFRVANRTGL
FT                   APGKTPLEVELGLERVIPDRFKLHAHHWLILHGRYICKALKPECPRCLIADLCRWPEKT
FT                   PA"
FT   gene            317551..318081
FT                   /locus_tag="Snov_0321"
FT   CDS_pept        317551..318081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0321"
FT                   /product="Protein of unknown function DUF2244,
FT                   transmembrane"
FT                   /note="PFAM: Protein of unknown function DUF2244,
FT                   transmembrane; KEGG: azc:AZC_3683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87655"
FT                   /db_xref="GOA:D7A239"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:D7A239"
FT                   /inference="protein motif:PFAM:PF10003"
FT                   /protein_id="ADH87655.1"
FT                   /translation="MNAASTNQALGPTIDDEPTLFAARYQPYRSLGQHGFLVVMIIVAG
FT                   ISFVCGTAFLLMGAWPVFGMFGLDALAIYWAFRLNFRQARACEEIVVTPSLIRLRHVAA
FT                   DGTVYEEELNPLWTRLHRELHEDYGLQRLTLEMRGRPYVIGGFLHTAQREELAEQLSRA
FT                   LAEARRGVVRSTF"
FT   gene            318210..319088
FT                   /locus_tag="Snov_0322"
FT   CDS_pept        318210..319088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0322"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; helix-turn-helix- domain
FT                   containing protein AraC type; KEGG: xau:Xaut_2813
FT                   methylated-DNA--protein-cysteine methyltransferase; SMART:
FT                   Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87656"
FT                   /db_xref="GOA:D7A240"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:D7A240"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ADH87656.1"
FT                   /translation="MLAPNLDAAHPLEIAAHDYEIVRRAVEYVNLRFRDQPEVEEIARA
FT                   AGVNPRALTDLFRRWCGLTPKDFLQAVTIDAARRVLTESDNVLDAAYELGLSGPGRLHD
FT                   LFIVHESMSPGEWKTGGAGLVVRYGFHASQFGMALAMVTPRGLCGLAFADEGEEDKALA
FT                   DMRRRWPNALYIEDPIATAPYAARIFDSQKWSLDDPLRIVFIGTDFEVRVWETLMRIPL
FT                   GKATTYSNIASCVERPSAARAVGAAIGKNPMSFVVPCHRVLGKNGDLTGYHWGLTRKRA
FT                   ILGWEAGQLCK"
FT   gene            complement(319110..319550)
FT                   /locus_tag="Snov_0323"
FT   CDS_pept        complement(319110..319550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0323"
FT                   /product="transmembrane pair domain protein"
FT                   /note="PFAM: transmembrane pair domain protein; KEGG:
FT                   mrd:Mrad2831_5841 transmembrane pair domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87657"
FT                   /db_xref="GOA:D7A241"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:D7A241"
FT                   /inference="protein motif:PFAM:PF05232"
FT                   /protein_id="ADH87657.1"
FT                   /translation="MRTPADRIRHVVIFEIIALSIITPLGAWVFGLPMTEMGVVGAGAA
FT                   LIAASWNYLFNLGFDHALARLRGSVRKTLGLRVVHALLFEAGLLAVLVPFIAWYLRIGL
FT                   VEAFLMDVALAGFFLIYAFLFNWAYDVIFPVRETRRRPVPAE"
FT   gene            complement(319669..320292)
FT                   /locus_tag="Snov_0324"
FT   CDS_pept        complement(319669..320292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0324"
FT                   /product="phosphoglycerate mutase 1 family"
FT                   /note="KEGG: bbt:BBta_0198 phosphoglyceromutase; TIGRFAM:
FT                   phosphoglycerate mutase 1 family; PFAM: Phosphoglycerate
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87658"
FT                   /db_xref="GOA:D7A242"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D7A242"
FT                   /inference="protein motif:TFAM:TIGR01258"
FT                   /protein_id="ADH87658.1"
FT                   /translation="MSERLLVLVRHGQSEWNLKNLFTGWRDPDLTELGVEEAKTAGKRL
FT                   KADGYTFDIAFTSKLSRAQKTLDLALAELGQTGLPTIENLALNERDYGELSGLNKDDAR
FT                   VKWGEEQVHIWRRSYDVPPPGGESLKDTIARTLPYYVTEILPKVLQGNRTLVVAHGNSL
FT                   RALIMVLEKHTPESIMKRELLTGVPVIYRLKPDSTIESVVDLAG"
FT   gene            complement(320311..321126)
FT                   /locus_tag="Snov_0325"
FT   CDS_pept        complement(320311..321126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0325"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="TIGRFAM: dihydrodipicolinate reductase; KEGG:
FT                   mpo:Mpop_2435 dihydrodipicolinate reductase; PFAM:
FT                   dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87659"
FT                   /db_xref="GOA:D7A243"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A243"
FT                   /inference="protein motif:TFAM:TIGR00036"
FT                   /protein_id="ADH87659.1"
FT                   /translation="MTQMRLVVVGASGRMGRVLIRAVDEAPDLLLVGAIDQPGSEFIGR
FT                   DAGELAGLPPLGVKISDDALTHFAAADGVIDFTVPQATVGYAALAAQARIVHVIGTTGF
FT                   SPEDEEKIAAASRHAAIVKSGNMSLGVNLLAALVRRVARTLDEGFDIEVLEMHHNRKID
FT                   APSGTALLLGQAAAQGRGVTLEENGVFTRHGHTGARKAGDIGFATLRGGSVVGEHNVIF
FT                   AGQAERIELAHKAEDRGIFARGALAAARWARGRKPGLYSMADVLGLADF"
FT   gene            321471..323231
FT                   /locus_tag="Snov_0326"
FT   CDS_pept        321471..323231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0326"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="KEGG: azc:AZC_2376 acetolactate synthase large
FT                   subunit; TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein TPP
FT                   binding domain protein; thiamine pyrophosphate protein
FT                   central region; thiamine pyrophosphate protein domain
FT                   protein TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87660"
FT                   /db_xref="GOA:D7A244"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D7A244"
FT                   /inference="protein motif:TFAM:TIGR00118"
FT                   /protein_id="ADH87660.1"
FT                   /translation="MMREMTGAEMVMQALIDQGVEHMFGYPGGAVLPIYDAMFHQNQVR
FT                   HVLVRHEQGAVHMAEGYARSSGKVGVVLVTSGPGATNAVTGLTDALLDSIPLVCITGQV
FT                   PTHLIGTDAFQECDTVGITRPCTKHNYLVRDVNDLARIMHEAFYVAQNGRPGPVVVDIP
FT                   KDVQFAKGMYVGPENIQHKTYQPRLKGDPEKIKAAVELLAKAKRPVLYTGGGVINSGPE
FT                   ASRLLREFARLSGYPVTSTLMGLGAFPASDKQWLGMLGMHGTYEANMSMHDCDVMLCIG
FT                   ARFDDRITGRVDAFSPNSKKIHIDIDPSSINKNVKVDLPIIGDVRHVLEDILTVWRGMK
FT                   VEPDRQAIASWWGQIDRWRARKSLAFQPGDRIIKPQQAVKALYDAVKDKDVYITTEVGQ
FT                   HQMWAAQHFHFEEPNRWMTSGGLGTMGYGLPAAIGVQVAHPNSLVIDIAGEASIQMCLQ
FT                   ELSTALQFNLPVKIFVLNNEYMGMVRQWQDLLHGGRYSHSYSESLPDFVKLAEAYGAVG
FT                   LRCSNPADLDGTIQEMINVDRPVLFDCLVDKMENCLPMIPSGKPHNEMILPDHPEALDE
FT                   AISEEGKMLV"
FT   gene            323392..323907
FT                   /locus_tag="Snov_0327"
FT   CDS_pept        323392..323907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0327"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="KEGG: xau:Xaut_1489 acetolactate synthase, small
FT                   subunit; TIGRFAM: acetolactate synthase, small subunit;
FT                   PFAM: Acetolactate synthase, small subunit-like; amino
FT                   acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87661"
FT                   /db_xref="GOA:D7A245"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:D7A245"
FT                   /inference="protein motif:TFAM:TIGR00119"
FT                   /protein_id="ADH87661.1"
FT                   /translation="MPPVQEPAERHTLSMLVDNEPGVLARIVGLFSGRGYNIDSLTVSE
FT                   VSHASHLSRITVVTTGAPPIIEQIKSQLDRLVPVHKVVDLTVVGKAVERELALIKVRGK
FT                   GEIRQEALLIAESFRARTVDTTLESFVFEITGKPEKIDQFVSLLEPLGLVEVSRTGVAA
FT                   IGRGPDGM"
FT   gene            complement(323940..324485)
FT                   /locus_tag="Snov_0328"
FT   CDS_pept        complement(323940..324485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0328"
FT                   /product="protein of unknown function DUF924"
FT                   /note="PFAM: protein of unknown function DUF924; KEGG:
FT                   vap:Vapar_2217 protein of unknown function DUF924"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87662"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D7A246"
FT                   /inference="protein motif:PFAM:PF06041"
FT                   /protein_id="ADH87662.1"
FT                   /translation="MSLPTAAEIIAFWREAGPDKWFEKDDAFDAAIRARFLAAHEAAAA
FT                   GELDGWAQTAEGSYALLLLLDQFPRNLFRNSPRAFATDEKARAVADHAVAQGFDMEFDT
FT                   LERRFIYMPFMHSEALADQERCIALCEASGDEEGTMYAVIHRDIIRDFGRFPHRNPVLG
FT                   RDTSEEEHAFLKAGGFAG"
FT   gene            324638..325300
FT                   /locus_tag="Snov_0329"
FT   CDS_pept        324638..325300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0329"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mch:Mchl_0328
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87663"
FT                   /db_xref="GOA:D7A247"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:D7A247"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADH87663.1"
FT                   /translation="MTTPPDPAGETFTERQQAVLDTVLALMVEQGGDVTMTAVARRASC
FT                   SKESLYKWFGDRDGLLTATVRWQASKVRAGNYDRTRLDILALRDSLIRFAANWLGVISS
FT                   PTSVALNRFAISQAGTRGSNLGAIMLANGRFAIGERLKPLLDAGREAGLLDFDDTETAF
FT                   RTFIGLVGRDVQIRVLLGDRLSLSPSEIERDAARATDQFLTLCGTEKTGPGRNQTNA"
FT   gene            325315..326334
FT                   /locus_tag="Snov_0330"
FT   CDS_pept        325315..326334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0330"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="TIGRFAM: ketol-acid reductoisomerase; KEGG:
FT                   mlo:mll1405 ketol-acid reductoisomerase; PFAM: Acetohydroxy
FT                   acid isomeroreductase catalytic domain protein;
FT                   acetohydroxy acid isomeroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87664"
FT                   /db_xref="GOA:D7A248"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A248"
FT                   /inference="protein motif:TFAM:TIGR00465"
FT                   /protein_id="ADH87664.1"
FT                   /translation="MRVYYDRDADLNLVKGKKVAIIGYGSQGRAHALNLKDSGVKDIAI
FT                   GLKPGSATAKKVEADGLKVMSVAEAAKWADLMMMATPDELQADIYKNEIAPNIRDGAAI
FT                   AFAHGLNVHFGLIEPKSTVDVLMIAPKGPGHTVRGEYEKGGGVPCLVAVHQDASGNALD
FT                   LGLSYASGVGGGRSGIIETTFKEECETDLFGEQVVLCGGLVELIRAGFETLVEAGYAPE
FT                   MAYFECLHEVKLIVDLIYEGGIANMNYSISNTAEWGEYVSGPRIITAETKAEMKRVLTD
FT                   IQTGKFTSEWMQEYRAGAARFKGIRRINDAHQIEEVGEKLRGMMPWIGKNKLVDKTKN"
FT   gene            complement(326703..327227)
FT                   /locus_tag="Snov_0331"
FT   CDS_pept        complement(326703..327227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0331"
FT                   /product="SNARE associated Golgi protein-like protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   azc:AZC_2367 uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87665"
FT                   /db_xref="GOA:D7A249"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D7A249"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADH87665.1"
FT                   /translation="MIELESYAREMLAFVEAHAHWAPYIAFALAFGESIAVLSLFFPAT
FT                   FVLIGLGPIIEAGGAPFAPVWAAAVAGASLGDALSYWIGRHFKDSARHIWPLRNYPEML
FT                   ARGERFFRSYGSWSVFIGRFFGPLRAVVPLVAGMFGMPHLIFQMANVTSAMVWAFLLLA
FT                   PGAAAVKLLGW"
FT   gene            complement(327235..328518)
FT                   /locus_tag="Snov_0332"
FT   CDS_pept        complement(327235..328518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0332"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   xau:Xaut_1940 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87666"
FT                   /db_xref="GOA:D7A250"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A250"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADH87666.1"
FT                   /translation="MAFDTDHPASWYAATAHHLSPFPPLAGTVRTDVCVIGGGYTGLSA
FT                   ALHLAEAGLSVALLEASRLGSGASGRNGGQIHSGQRRDQDWLEAHVGLDDAKALWRLAE
FT                   DAKALLHRLIARHMIDCDVKPGLIVADHKPSYVAHSHAYARKLNEVYGYPHAAPLTREE
FT                   LRELVGSDAYYGGMIDRGGGHLHPLNLALGLAKAAHTAGARLFEQSRALRINEAGDKVK
FT                   VSTPRGVVEADWVLECGDGLQDGLDKRVDTHVMPIANYIAATEPLGERGREIISNGAAV
FT                   ADSRFVVNYYRLSGDGRLLFGGGESYTRRLRPNPGEFVRPYMLKVFPQLADVRIDYGWG
FT                   GLLGITMTRMPFVRRLSPRVLTAAGYSGQGVMLAPYFGKILAEAVKGQLGRFDLLAGLP
FT                   VPPFPGGPLMRWPLLVAGMSYYALRDRL"
FT   gene            complement(328543..330378)
FT                   /locus_tag="Snov_0333"
FT   CDS_pept        complement(328543..330378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0333"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="KEGG: azc:AZC_2393 DNA mismatch repair protein;
FT                   TIGRFAM: DNA mismatch repair protein MutL; PFAM: MutL
FT                   dimerisation; DNA mismatch repair protein domain protein;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87667"
FT                   /db_xref="GOA:D7A251"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:D7A251"
FT                   /inference="protein motif:TFAM:TIGR00585"
FT                   /protein_id="ADH87667.1"
FT                   /translation="MPLRLLPSTLVDRIAAGEVVERPAAALKEIVENALDAGATRIEVV
FT                   IDGGGRRLMRVTDDGCGMSADELALAVERHATSKLDTEDLLSIATLGFRGEALPSIGAV
FT                   ARLSITSRPRGSDTAHEIRVEGGAKSAVKPAALGFGTRVEVRDLFFATPARLKFLKSER
FT                   AETAAAVDAVKRLALARPDVGFILVTDDRPPVTWPARSADAAGRRARIADVLGHEVGAN
FT                   ALDIDGLREGARLSGLAGLPTYAKANSLSQYLFVNGRPVRDKVLIGAIRAAYADLLPSD
FT                   RHPVTALFLDLDPHEVDVNVHPAKTEVRFRDAGNVRALIVRTLTDALALGVPRTASTAA
FT                   EKLAQFARPEFRQGAGNPPRPGNYDWTRSWAAPDVAPREASPAGFREEAAGFDFGLGLA
FT                   LAPSADARANAAPPAPDLMERPLGAARAQLHETYIIAQTKDGVVVIDQHAAHERIVYEK
FT                   LKAAMERDGLARQMLLVPLVVELDPSDAARLAERAAALEKLGLVLEPFGPGAVLVREVP
FT                   SLLGDADVCALVTELAEHAAEWDDALPLERRLLHIAATMACHGSVRAGRRLRVEEMNAL
FT                   LREMEETPNAAQCNHGRPTFVTLALADIERLFARR"
FT   gene            complement(330466..331283)
FT                   /pseudo
FT                   /locus_tag="Snov_0334"
FT                   /product="hypothetical protein"
FT   gene            complement(331283..332194)
FT                   /locus_tag="Snov_0335"
FT   CDS_pept        complement(331283..332194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0335"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: azc:AZC_3518
FT                   spermidine/putrescine ABC transporter permease component I
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87668"
FT                   /db_xref="GOA:D7A252"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A252"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87668.1"
FT                   /translation="MAVKSSGRWLVLSVPYLWLLALFLVPFLIVFKISLSTDAIAQPPY
FT                   EPIFDLSAGWDAFKEAFAQLSFENYSYVLSWDNEFIEAYGSSLWIAGVSTFLLLLVGYP
FT                   IAYGMARAPKSIRPTLLMLVILPFWTSFLIRVYAWIGILSPEGLLNQLLMALGIISPDA
FT                   PLQILATNTAVYIGIVYSYLPFMILPLYSALEKMDDTLLEAAADLGCPPFAAFWKITWP
FT                   LSLPGVFAGCLLCFIPAVGEFVIPDLLGGSDTLMIGKVLWTEFSVNRSWTVSSAVAVLL
FT                   LMVLVIPIVFYQNLQAREVEGR"
FT   gene            complement(332205..333380)
FT                   /locus_tag="Snov_0336"
FT   CDS_pept        complement(332205..333380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0336"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="TIGRFAM: spermidine/putrescine ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Transport-associated OB domain protein; KEGG: xau:Xaut_2941
FT                   spermidine/putrescine ABC transporter ATPase subunit;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87669"
FT                   /db_xref="GOA:D7A253"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A253"
FT                   /inference="protein motif:TFAM:TIGR01187"
FT                   /protein_id="ADH87669.1"
FT                   /translation="MSNGVAEKTQKTIGGIRRKFAPWNDPQAVPLIRYQNVTKRFGEFT
FT                   AVDNLSLDIYEREFFALLGPSGCGKTTLMRMLAGFEDPTEGKITLAGQNLVGTPPYKRQ
FT                   TNMMFQSYALFPHMSVWDNIAFGLRQDRMEKGAVAARVEEMLKLVKLEKFAKRKPHQLS
FT                   GGQRQRVALARSLAKRPKVLLLDEPLGALDKKLREETQFELMDIQMELGMTFLIVTHDQ
FT                   EEAMTVADRIAVMNHGKLVQVDQPAVIYEQPNSRYVADFVGDVNILDAKVEALAPGAVT
FT                   LRSEAAPDMPIRVAQECAAKVGDSVAVALRPEKLRVELDPPADPSVNTLTGTIWDIGYL
FT                   GDLSIYHVELPNGMRVKAAKPNLTRMVERPITWEDKVYVSFTPDAGVVLTN"
FT   gene            333574..334974
FT                   /locus_tag="Snov_0337"
FT   CDS_pept        333574..334974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0337"
FT                   /product="Glutamate--putrescine ligase"
FT                   /EC_number="6.3.1.11"
FT                   /note="KEGG: azc:AZC_4442 glutamine synthetase family
FT                   protein; PFAM: glutamine synthetase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87670"
FT                   /db_xref="GOA:D7A254"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D7A254"
FT                   /inference="protein motif:PRIAM:6.3.1.11"
FT                   /protein_id="ADH87670.1"
FT                   /translation="MAKKKRPDKDVVEAPRGVTSLAEAKAWMAARGITEIECAVPDLAG
FT                   VGRGKIMPVSKFLSGPTMNLPLSVFFQTISGDYPPYDGLVDSVVVDSDLVMEPDFSTLA
FT                   VVPWAQDPTAQIIHDAYHRDGRPVDLAPRQVLKNVVELYSHKGWKAVVAPEIEFYLVEP
FT                   NTDADYPLKPPIGRSGRPEIGRQSYSIQAVNEFDALFEDMYDYSEAQGLEIDTLIHEDG
FT                   AAQMEINLLHGDPVVLADQVFLFKRTIREAALAHKIYATFMAKPIADEPGSAMHIHQSI
FT                   VDAETGKNIFSDKDGDPTPEFFSFIAGQQRYMPAVMSIMAPYVNSYRRLTRDSMAPINV
FT                   QWGYDNRTAGLRVPPSSPAARRVENRVPSSDANPYLVIAASLACGYLGLVEGLRPTDPL
FT                   EADAKFLDFELPRGLLEAVAALQYSEEIAGVLGPSFVKTYTAVKQQEFDTFMRVISPWE
FT                   REYLLLNV"
FT   gene            complement(335352..336314)
FT                   /locus_tag="Snov_0338"
FT   CDS_pept        complement(335352..336314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0338"
FT                   /product="Luciferase-like, subgroup"
FT                   /note="PFAM: Luciferase-like, subgroup; KEGG: bja:blr5498
FT                   putative oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87671"
FT                   /db_xref="GOA:D7A255"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D7A255"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ADH87671.1"
FT                   /translation="MAKSGEQPSPHSAPLPAACWSPSPRVAFNSSRRWAAIAARTKRIR
FT                   LGSAVTVLSSDDPIRVFQRFATVDAISNGRAEVILGRGSFTESFPLFGFDLKDYEALFS
FT                   EKLDLFAALLKDNGTADGVTWNGNLRPPLEKQHVYPLVESGTLKTWIGVGGSPESVVRA
FT                   ARYGLPLMLAIIGGDPARFAPYVDLYHRAVDQLGGVAHPIGVHSPGYVAETDEQAREEF
FT                   FADYKRMRDRIGAERGWPPMGRDEFEREVTRGSLYLGSPETVARKIAKTATTLGIGRFD
FT                   MKYSAGPLAHEKSMKCIELYGRQVIPRVRELLAQEKVEA"
FT   gene            336519..337403
FT                   /locus_tag="Snov_0339"
FT   CDS_pept        336519..337403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0339"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: xau:Xaut_4653 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87672"
FT                   /db_xref="GOA:D7A256"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A256"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH87672.1"
FT                   /translation="MTVLLDIDQLRTFIAIAETGSFTKAADVVHKTQSAVSMQMKRLEE
FT                   RVGKAIFARDGRASRLTDEGDRLLDYARRIVKLNMEAVASLASAELSGRVRLGVPDDYA
FT                   DRYLPEIMARFSNTHPNVELTVVCDPSTDLIDRIDTGDLDLAIVTDCEMINRETEIIRR
FT                   EQLLWVGSNRHPVHLEDPVPLALGRQTCNWRQEAISMLQAVGRPFRILYTSSNSTAVSA
FT                   AVLSGLAISVLPESGLRPGMRVLGPSDGFPALAPCRIGLLRNRHEASPLADALANHIVQ
FT                   GLDNISEAAIAAE"
FT   gene            337734..338156
FT                   /locus_tag="Snov_0340"
FT   CDS_pept        337734..338156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0340"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: nwi:Nwi_1654
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87673"
FT                   /db_xref="GOA:D7A257"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D7A257"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADH87673.1"
FT                   /translation="MSAPVPGDLVPFLRYADPHAAIAWLKKALGFSPILVVDDGHGGVA
FT                   HAELALGTSALMIGGVKDDVLRMRTPAEAGGVTQGIYVVVPDADALWTCTMEAGAEVVM
FT                   AIYDTPYGSREFTVRDPEGHLWSVGTYRAGSYKSDS"
FT   gene            complement(338309..339679)
FT                   /locus_tag="Snov_0341"
FT   CDS_pept        complement(338309..339679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0341"
FT                   /product="glutamate/cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="TIGRFAM: glutamate/cysteine ligase; KEGG:
FT                   azc:AZC_2967 glutamate-cysteine ligase; PFAM:
FT                   glutamate--cysteine ligase GCS2"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87674"
FT                   /db_xref="GOA:D7A258"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011556"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR035434"
FT                   /db_xref="UniProtKB/TrEMBL:D7A258"
FT                   /inference="protein motif:TFAM:TIGR01436"
FT                   /protein_id="ADH87674.1"
FT                   /translation="MARDQIDTQPIESRDDLVAWLEAGCKAPMKFRIGTEHEKFPFTLN
FT                   GHEPVPYEGPNGIRALLEGMQALNCWEPIMEGSTIIGLADNVGGGAISLEPGGQFELSG
FT                   APLITIHETCAEVNSHLTQVREVATPLGFGFLGLGMSPKWTLAQTPVMPKGRYKIMTAY
FT                   MPKVGTHGLDMMYRTCTVQVNLDFSSEADMVQKLRVGLALQPVATALFANSPFTEGKPN
FT                   GFLSFRSEIWRDTDNNRSGMLPFAFEKGMGFERYVDYALDVPMYFIKRGDHYIDVAGSS
FT                   FRDLLAGKHPAVPGETATVSDWANHLSTIFPEVRLKRYLEMRGADGGPWANLCALPALW
FT                   TGLLYDQASLDAAWELAKGWSADERQKLRDDVPRLGFKAEIAGRSMHELAREVVAISRA
FT                   GLARRDKRDSQGRDETRFLQPLEESLVSGLTPAEVLLKRYETEWNRSVEPIFDDCAY"
FT   gene            complement(339818..340495)
FT                   /locus_tag="Snov_0342"
FT   CDS_pept        complement(339818..340495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0342"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mdi:METDI0732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87675"
FT                   /db_xref="GOA:D7A259"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D7A259"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADH87675.1"
FT                   /translation="MPIHRRSLLLGAPFLLAGCTTARRQEPTPVARSLAYAPSYETMYA
FT                   ALDGEPYPVPAVDLSQIDPRFLRREVAYATREEPGTIVVDVEARYAYLVMENGRALRYG
FT                   VGVGKEEGFNFRGAATIARKAEWPRWTPTPDMIRREPERYAKYAGGLPGGPGNPLGPRA
FT                   LYLYRDGRDTLYRLHGTIEPWTIGTMVSSGCIRLLNQDIIDLYRRVPAGSRAVVLSSAG
FT                   TAA"
FT   sig_peptide     complement(340427..340495)
FT                   /locus_tag="Snov_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.813) with cleavage site probability 0.463 at
FT                   residue 23"
FT   gene            340607..341521
FT                   /locus_tag="Snov_0343"
FT   CDS_pept        340607..341521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0343"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bid:Bind_0309 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87676"
FT                   /db_xref="GOA:D7A260"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A260"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH87676.1"
FT                   /translation="MDLAAALRAFVRTVERGSVTAAARDLAVTQPAVTKHLRNLERHVG
FT                   ARLLERSARLVRPTPQGAALYETSRSALASIDSALEGVRRDMGAIEGTLRIHAPACLGA
FT                   RRLHGIVMEFQAAHPGVNVDLILENRSVDLVYENLDLAVKYGRPEGQDLVIRRLGLVRR
FT                   VLVAAPSFLARCGPVDTLERLSEVDIVTTPAVVSPRDMLMLQRAGTPLGESIEVPVRPV
FT                   LRTNAAEVIEQTLLGGHAAGPVQVLFAARDLAAGRLVRLLPEYEVRPSEAFLAYPSVRF
FT                   MRPVVRAFTDFAVPALRATEGIT"
FT   gene            complement(341556..342680)
FT                   /locus_tag="Snov_0344"
FT   CDS_pept        complement(341556..342680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0344"
FT                   /product="glutamate--cysteine ligase GCS2"
FT                   /note="PFAM: glutamate--cysteine ligase GCS2; KEGG:
FT                   azc:AZC_2303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87677"
FT                   /db_xref="GOA:D7A261"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:D7A261"
FT                   /inference="protein motif:PFAM:PF04107"
FT                   /protein_id="ADH87677.1"
FT                   /translation="MTTEEYRIGIEEEYFIVDGETKSALRRMPAPFMDQARGALGEAVS
FT                   GEMLQSQIEMMTRPHVSAADARRQLHGLRRSLGEVAAEFDLAFLAAGTHPTASWQTGKR
FT                   TPTQRYDGLMHDLQMVGERNMLCGMHVHVELPDADQRVDVMRRILPYLPIFVALSTSSP
FT                   FWESKRTGLMGYRLAAYDELPRTGLPELFESAKDYQDYVDALVAARAIRDSSYVWWTIR
FT                   PSQKHPTLELRAPDSCTRVEDSVAIAALYRALVRHLVRDPKLNAGIDAVDRAIAVENKW
FT                   RAQRYGIHGSFVDRRTREAVPVTQAVETLIDQLREDARALGGLDELEHLRTILGGGTSA
FT                   DIQIAVYQEAAHRTGNRNEALNAVKTWLAHASAQ"
FT   gene            complement(343013..343795)
FT                   /locus_tag="Snov_0345"
FT   CDS_pept        complement(343013..343795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0345"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   xau:Xaut_4104 16S ribosomal RNA methyltransferase RsmE"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87678"
FT                   /db_xref="GOA:D7A262"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D7A262"
FT                   /inference="protein motif:PFAM:PF04452"
FT                   /protein_id="ADH87678.1"
FT                   /translation="MARHQEDSSDQPYDFRAQRLYVDDDLGEGTLVRLDRDRAHYVADV
FT                   IRLEVGGALHLFNGRDGEWRAVREPAGRREAVLRCEARLRRQAEPADLDYVFAPLKHAR
FT                   LDYMVQKAVEMGAGRLVPVMTRRTQASRVNTERMRANVIEAAEQCGILSLPAVLEPSAL
FT                   ARWLADLAPERRLVFCDEAAPEADPLAELREAVAGPLAVLIGPEGGFDEEERRLLKARP
FT                   GTIVLSLGPRILRADTAAVAALAMVEAARQTAANFSAR"
FT   gene            343910..344623
FT                   /locus_tag="Snov_0346"
FT   CDS_pept        343910..344623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0346"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azc:AZC_2377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87679"
FT                   /db_xref="UniProtKB/TrEMBL:D7A263"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87679.1"
FT                   /translation="MRGSILQARQMRFTARACVPALGGAFVAVMLGAFPAHAQWIGAPG
FT                   GDGSSSGSSGAVTITAPSPGPAAGAGGGFAPGMGAPQQAAPQGMSQGAAQANPNMSECQ
FT                   GQVMKLRGDLEARGGALEKAAKAKRPPTELCPLFRNFTSAQQSFYSYLSTNKTKCGVPD
FT                   EVIAQLKKNVNSVNATRNKVCEVAKLQESGGGAGPSGPPPQGQISAGLGLPSGLPSVGA
FT                   PKGGMFDTLGGDALR"
FT   sig_peptide     343910..344026
FT                   /locus_tag="Snov_0346"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 39"
FT   gene            344630..345580
FT                   /locus_tag="Snov_0347"
FT   CDS_pept        344630..345580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0347"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /note="KEGG: nha:Nham_3184 4-hydroxybenzoate
FT                   polyprenyltransferase; TIGRFAM: 4-hydroxybenzoate
FT                   polyprenyl transferase; PFAM: UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87680"
FT                   /db_xref="GOA:D7A264"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:D7A264"
FT                   /inference="protein motif:TFAM:TIGR01474"
FT                   /protein_id="ADH87680.1"
FT                   /translation="MTAPSTPAGPAPADSAVSWVDRAPAALRPFLRLARIDRPIGSWLL
FT                   LIPCWWSVALALGMQARAGEADYSRALILGVLFAVGAVAMRGAGCTWNDILDRDIDVRV
FT                   ERTRARPLPAGQVTLLGAFAFLALQALVGLVVLICLPPFAIVTALASLGLVAIYPLMKR
FT                   VIWVPQAVLGLTFSWGALMGFAALLEELPAAAFLLYAGSVLWVIGYDTIYAHQDREDDA
FT                   LVGVKSSARLFGRATKPWLVGFYAAAAALIGVALVTAGAGPYAWGGLGIFVVQLGTQVR
FT                   RLDIDDRALCLKLFKSNRDAGLILLAGFLLDALVG"
FT   gene            345640..346272
FT                   /locus_tag="Snov_0348"
FT   CDS_pept        345640..346272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0348"
FT                   /product="3'-5' exonuclease"
FT                   /note="KEGG: azc:AZC_3929 3'-5' exonuclease; PFAM: 3'-5'
FT                   exonuclease; SMART: 3'-5' exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87681"
FT                   /db_xref="GOA:D7A265"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7A265"
FT                   /inference="protein motif:PFAM:PF01612"
FT                   /protein_id="ADH87681.1"
FT                   /translation="MSIRLHRGDLVDLSRYTPENAPFVAIDTETLGLNPHRDRLCVVQL
FT                   SPGDGTADVVQIPAGAGPGSAPNLEALLTDPRITKLFHFARFDVAVLGKTFGLTVAPVW
FT                   CTKIASRLTRTYTDRHGLKELVRELIGVDLSKQQQSSDWAAEELSEAQLQYAASDVLYL
FT                   HALREKLASMLARDGRTELAQSCFEFLPTRAKLDLAGWPDEDIFAHS"
FT   gene            346411..347388
FT                   /locus_tag="Snov_0349"
FT   CDS_pept        346411..347388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_0067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87682"
FT                   /db_xref="GOA:D7A266"
FT                   /db_xref="UniProtKB/TrEMBL:D7A266"
FT                   /inference="similar to AA sequence:KEGG:Xaut_0067"
FT                   /protein_id="ADH87682.1"
FT                   /translation="MNKHVEPPVRLGASAAEPAARRAPASARVETDRSKTVARFKAAAR
FT                   HSRRVRFFRWALPVGVTTALGLTLAVNYLDPFSIAVDLPFELGRISLSGSKVKMEFPKL
FT                   HGFTSDNRGYSVTAEAAYQDLTKPDAIDLETIAAKLELADHGWVNLVAATGHYDTKTEK
FT                   LMLDGGIRFDTSSGYGGHLQNASVDIKGGKLVSKKPVEFTYLDGKLTADSIEVTQKDSR
FT                   ALLVGNVQLDFKMPPADGAKPSDGARPSNTANASGAANASATSTAAATPPASRTAAAAQ
FT                   PTDIFHGAPSPVPVVVNGATPANVPLPPRRPPQLRGATTVGATP"
FT   gene            347437..348123
FT                   /locus_tag="Snov_0350"
FT   CDS_pept        347437..348123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0350"
FT                   /product="OstA family protein"
FT                   /note="PFAM: OstA family protein; KEGG: xau:Xaut_0066 OstA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87683"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2W5"
FT                   /inference="protein motif:PFAM:PF03968"
FT                   /protein_id="ADH87683.1"
FT                   /translation="MITLLRFAGAAGLALLVTGAACLGPLARPALAQARNVPNALQGFA
FT                   ANRDEPIRINANSLEVRDQQKQAVFTGNVVVIQGDTTLRCKELVVYYDGKESGGKAGAP
FT                   ASSEALASGSPINSSAIRRLEINGSVVVTTKEQTATGDYGTFETASNTITLNGSPVVLT
FT                   SGPNVIRGKKLTVDLASGMSRFDGGRIESLIVPNSMKDGALPGGPGAKPGAGAKPAAKP
FT                   GAKPTQ"
FT   sig_peptide     347437..347535
FT                   /locus_tag="Snov_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.968 at
FT                   residue 33"
FT   gene            348288..349271
FT                   /locus_tag="Snov_0351"
FT   CDS_pept        348288..349271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0351"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: azc:AZC_3926 putative ABC transporter
FT                   ATP-binding protein in NtrA/RpoN 5'region; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87684"
FT                   /db_xref="GOA:D7A2W6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2W6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87684.1"
FT                   /translation="MGFFSAIVGRGKSAPRGGRDNGTARGFGSGGRTGRTEARRDPDFT
FT                   SNLAPEITPGLEADMEALFAAAPVKASPKSFATPLRPEPVDDRGVLRATGLAKSYGGRK
FT                   VVRDASINVRRGEAVGLLGPNGAGKTTIFYMITGLVKADAGRIELDGHDVTHLPMYRRA
FT                   RLGVGYLPQEASIFRGLSVENNIRAVLEVVEPSRKERERQLDALLEEFRVTHVRKSPSI
FT                   ALSGGERRRVEIARALASRPTFMLLDEPFAGIDPIAVGDIQTLVRHLTQRGIGVLITDH
FT                   NVRETLGLIDRAYIIHSGAVLMEGSPDEIVASEEVRRLYLGEEFRL"
FT   gene            349344..350942
FT                   /locus_tag="Snov_0352"
FT   CDS_pept        349344..350942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0352"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="KEGG: rpa:RPA0050 RNA polymerase factor sigma-54;
FT                   TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 DNA-binding domain protein; sigma-54 factor
FT                   core-binding region; sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87685"
FT                   /db_xref="GOA:D7A2W7"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2W7"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ADH87685.1"
FT                   /translation="MSLSPRLEFRQTQSLVMTPQLMQAIKLLQLSNLDLVAYVEAELER
FT                   NPLLERQVEPEGERPAEMEGEGGDQLERVSDADLDPRASHASEAADGERDERVSDWLEE
FT                   RLETSRSAIEDRLDTTLENVYPDDAVREPTGLAPGGEAPAYSEWAGVGTGGRDDDGYNL
FT                   EAFVSAETTLADHLEGQLALAVSNPVERLIGQNLIDLIDEAGYLSADLAGVAERLGAPL
FT                   AQVEKVLAVVQGFDPPGIGARSLSECLAIQLKERNRYDPCMAALLSHLELLARREFTTL
FT                   KRVCGVDDEDLAEMVGEIRRLNPKPGLAFGSGVIQPIVPDVFVRGGPDNWLVELNADTL
FT                   PRVLVNQAYYSRVQKTTRNDREKAFLSDCMQTATWLTRSLDQRARTILKVATEIVRQQD
FT                   AFLTLGVQHLRPLNLRMVADAIGMHESTVSRVTSNKYMATPRGIFEMKYFFSSSISASD
FT                   GGEAHSAESVRFRIKQMIDAESPDDVLSDDTLVQRLREAGIDIARRTVAKYREAMRIPS
FT                   SVQRRREKQAALSAG"
FT   gene            351116..351709
FT                   /locus_tag="Snov_0353"
FT   CDS_pept        351116..351709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0353"
FT                   /product="ribosomal subunit interface protein"
FT                   /note="KEGG: xau:Xaut_2035 sigma 54 modulation
FT                   protein/ribosomal protein S30EA; TIGRFAM: ribosomal subunit
FT                   interface protein; PFAM: sigma 54 modulation
FT                   protein/ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87686"
FT                   /db_xref="GOA:D7A2W8"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2W8"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ADH87686.1"
FT                   /translation="MPLRVSGKNIDVGEALRQRVADRVAGAMGKYFDGGWSGHVTVARE
FT                   GSGYRSDCALHLDSGTILQAHADAQDPYSSADAAVERIETRLRRYKSRIKRRAANGEGE
FT                   GLAETVPLTVFSTPDHEDAELLEGWNPTVVCEATANLPRLSVSDAVLELDFTGAAVLVF
FT                   RHAGHGRINVVYRRGDGHVGWVDPPVSAVTEEVH"
FT   gene            351816..352280
FT                   /locus_tag="Snov_0354"
FT   CDS_pept        351816..352280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0354"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="KEGG: azc:AZC_0344 PTS IIA-like nitrogen-regulatory
FT                   protein; TIGRFAM: PTS IIA-like nitrogen-regulatory protein
FT                   PtsN; PTS system, fructose subfamily, IIA subunit; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87687"
FT                   /db_xref="GOA:D7A2W9"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2W9"
FT                   /inference="protein motif:TFAM:TIGR01419"
FT                   /protein_id="ADH87687.1"
FT                   /translation="MALNDILALSAIFPSLRVGSKKQALQELSAHAAQILKRDEREIFE
FT                   TLNQRERLGSTGVGSGIAIPHGKLAKMDKLFGMFARLEKPIDFEALDGEPVDLIFLLLA
FT                   PEAAGADHLKALARVARLLRDPEVAKKLRNSRDAAAIFTILTGTPATDAA"
FT   gene            352397..352720
FT                   /locus_tag="Snov_0355"
FT   CDS_pept        352397..352720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mno:Mnod_7736 transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87688"
FT                   /db_xref="GOA:D7A2X0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2X0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87688.1"
FT                   /translation="MPATPVPANLALAPEQCRAARAMLDWSVEELAARAHVTVDWLAAF
FT                   EQGREPGDGFDHEAERLRRVLEEAGIELLDAGEASSGGGPGLRIKQKAGYIPAERLSSA
FT                   NDV"
FT   gene            complement(352952..354025)
FT                   /locus_tag="Snov_0356"
FT   CDS_pept        complement(352952..354025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0356"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   nha:Nham_2536 zinc-binding alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87689"
FT                   /db_xref="GOA:D7A2X1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2X1"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ADH87689.1"
FT                   /translation="MPKMKAAIFVEPGRIVLDEKPIPDVGPLDALIRITTTTICGTDVH
FT                   ILKGEYPVAKGLTIGHEPVGVIEKLGSQVTGYTEGQRVIAGAITPSGHSYACLCGCGSQ
FT                   DGAGTKHGFKAMGGWKFGNTIDGTQAEYVLVRDAIANLAPVPDALTDEEVLMCPDIMST
FT                   GFSGAESGEVKIGDHVAVFALGPIGLCAVAGAKLKGATRIIGVDTVPERLAIAKQLGCS
FT                   DVVDFKQGDVYEQIMALTDGRGVDVAIEALGTQNTFETALRVLRPGGTLSSLGVYSSDL
FT                   KIPLGAFSAGLGDNKIVTTLCPGGKERMRRLIDVIASGRVDLKPLVTHRYKLDDIEAAY
FT                   DLFSHQRDGVLKVAITP"
FT   gene            complement(354117..354818)
FT                   /locus_tag="Snov_0357"
FT   CDS_pept        complement(354117..354818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0357"
FT                   /product="ribosome biogenesis GTP-binding protein YsxC"
FT                   /note="KEGG: xau:Xaut_0361 ribosome biogenesis GTP-binding
FT                   protein YsxC; TIGRFAM: ribosome biogenesis GTP-binding
FT                   protein YsxC; PFAM: GTP-binding protein HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87690"
FT                   /db_xref="GOA:D7A2X2"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2X2"
FT                   /inference="protein motif:TFAM:TIGR03598"
FT                   /protein_id="ADH87690.1"
FT                   /translation="MDTTAQDDDKPEAGGAAAAFSPEEIEAGRRLFAGEWNFLSAAPTI
FT                   PTMPPMRGIEIALAGRSNVGKSSLVNALTGRKALARTSVTPGRTQELIFFGLGPELTLV
FT                   DMPGYGFAKAPKDKVDAWTATIHAYLRGRANLARVFVLIDSRHGLKPIDTEVLDGLDKA
FT                   AVSYAIVLTKADQLKKGELAQRVEATQAALLRRPAAFPIVFPTSSREGWGIPELRAAVV
FT                   RLMAERGIAAG"
FT   gene            complement(354823..356652)
FT                   /locus_tag="Snov_0358"
FT   CDS_pept        complement(354823..356652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0358"
FT                   /product="membrane protein insertase, YidC/Oxa1 family
FT                   domain containing protein"
FT                   /note="KEGG: xau:Xaut_1921 putative inner membrane protein
FT                   translocase component YidC; TIGRFAM: membrane protein
FT                   insertase, YidC/Oxa1 family domain containing; membrane
FT                   protein insertase, YidC/Oxa1 family; PFAM: 60 kDa inner
FT                   membrane insertion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87691"
FT                   /db_xref="GOA:D7A2X3"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2X3"
FT                   /inference="protein motif:TFAM:TIGR03593"
FT                   /protein_id="ADH87691.1"
FT                   /translation="MTTENRNMIIAIVLSMAVLIAWQYFSGIPQMEQQRQQHAAQQQAA
FT                   QQQAAQPSGEAGTAAPAPGTSAPAPAGTAPKALTRAEALARSPRAVIDTPRVIGSVALK
FT                   GGRIDDLSLKDYRETVDPNSPIIVLLSPSGGPNPFYAEFGWVPGAGASVQVPNAETLWT
FT                   APEGAKLTHEAPLVLSWDNGAGLIFRRTLSIDANYMFHVVDEVENTTAAPVALHPYGLV
FT                   SRHGTPHVLGYYILHEGLIGVTSEAGLHEIKYKDIAERKTETFPSVGGWLGITDKYWAA
FT                   TVIPGIQEKVQARFSAAQAGNDFSYQTDFLGDAVSVAPGAKASTEGRLFAGAKEVRVVD
FT                   GYQSTYNIDRFDLLIDWGWFYFITKPLFLVIDWIYKGVGNFGVAILIVTVMLKIVFFPL
FT                   ANKSYASMAKMKAVQPEITALRERYGDDRVKLQQEMMEIYKKEKINPVAGCLPIVIQIP
FT                   VFFALYKVLFVTIEMRHAPFFGWIKDLSAPDPTTIFNLFGLIPWDPGQVPVIGHFLLLG
FT                   VWPIIMGITMWAQMKLNPAPPDPTQKAIFDWMPLIFTFMLGSFASGLVIYWAWNNTLSV
FT                   IQQSIIMRRNGVKIELWDNVKELFGRKKKPKAG"
FT   gene            complement(356649..357050)
FT                   /locus_tag="Snov_0359"
FT   CDS_pept        complement(356649..357050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0359"
FT                   /product="ribonuclease P protein component"
FT                   /note="KEGG: azc:AZC_4054 ribonuclease P protein component;
FT                   TIGRFAM: ribonuclease P protein component; PFAM:
FT                   ribonuclease P protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87692"
FT                   /db_xref="GOA:D7A2X4"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2X4"
FT                   /inference="protein motif:TFAM:TIGR00188"
FT                   /protein_id="ADH87692.1"
FT                   /translation="MHRIVKRKDFLAAASGLRANSGPLLLQGRDRADDTAPRIGLTVTK
FT                   KHGNAVERNRIRRRLRAAVRDALPRAGKDGFDYVIVARRAALGTPFADLVKDIERGIAR
FT                   LHSGRRPPKPAPRDSAAQLPARADGDTLP"
FT   gene            complement(357116..357250)
FT                   /locus_tag="Snov_0360"
FT   CDS_pept        complement(357116..357250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0360"
FT                   /product="ribosomal protein L34"
FT                   /note="KEGG: azc:AZC_4055 50S ribosomal protein L34;
FT                   TIGRFAM: ribosomal protein L34; PFAM: ribosomal protein
FT                   L34"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87693"
FT                   /db_xref="GOA:D7A2X5"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2X5"
FT                   /inference="protein motif:TFAM:TIGR01030"
FT                   /protein_id="ADH87693.1"
FT                   /translation="MKRTYQPSKLVRARRHGFRARMATRNGRKIINARRAHGRKRLSA"
FT   gene            357701..359269
FT                   /locus_tag="Snov_0361"
FT   CDS_pept        357701..359269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0361"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: azc:AZC_4070 periplasmic sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87694"
FT                   /db_xref="GOA:D7A2X6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2X6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH87694.1"
FT                   /translation="MKKRSGAGSQAIALPAAAAGFGELRLHAGTPQVTAETAAATSPKP
FT                   PRHLGLSGKLLAFTLAFVLLAEVLILVPAVAAFRLNWLSDRLAGARTAALVLDAAPDGM
FT                   ISPQLTQELLRSVGAITVALKRDDTRRLLASTDMPPEVDHHADVRDVGPWQAVSEAFDT
FT                   LLARDGRVIRAVGTPPRGDGFVEIVIDETPLRKAMLRFTGNLLLVSLVIAALTGALVYL
FT                   GLAWMFVRPMRRLTQRMVAFRADPSHPVPEVETDGRMDEIGQAERELTAMQQQIAETLQ
FT                   QKSHLAALGLAVSKINHDLRNLLASVQLISDRLADIRDPAVQRFAPKLEVALDRAIAYC
FT                   EHTLAYGKAQEPAPERRMVPLAPLVAEVRDTLGLGPDEAQGIGFVESVDRELEVDADPD
FT                   QLFRVLLNLCRNAVEALSARSPNEPSRDQIRITGRREGAIVIIEVADTGPGVPERARAH
FT                   LFEAFQGSARRGGTGLGLAIAAELMHAHGGDIQLVPGTIGATFQLRVPDRPVDLEAHRA
FT                   LRQHG"
FT   sig_peptide     357701..357757
FT                   /locus_tag="Snov_0361"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.612) with cleavage site probability 0.561 at
FT                   residue 19"
FT   gene            359247..360533
FT                   /locus_tag="Snov_0362"
FT   CDS_pept        359247..360533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0362"
FT                   /product="glycosyl hydrolase family 2 protein"
FT                   /note="KEGG: azc:AZC_0891 glycosyl hydrolase family 2
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87695"
FT                   /db_xref="GOA:D7A2X7"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2X7"
FT                   /inference="similar to AA sequence:KEGG:AZC_0891"
FT                   /protein_id="ADH87695.1"
FT                   /translation="MPCASMAERKGEGRGRGRWFWAGLILLATIHAAVAADVTVSGRQI
FT                   LNDGKRFDVRGATGDGPLPMLATLGATTVRTYGEDPGPILDAAEKAGLKVIVGLWVGQP
FT                   RQGADYGDRAFVERQLAELQAMVEKYRNHPALLMWGIGNEVEVELADDSPAWPAIEQVA
FT                   AMVRRVDPAHPTMGVLAETGSDKVKKLIAQAPSIQVLGLNSYGDALYSAASRARAQGWE
FT                   GPIVVTELGALGQWQAAQAPWGAPFEPSSTQKAIQLRRYLKALEGEEVGTIAFLWGSKQ
FT                   EVTPTWHSLLLPDGVWLEASEAMAEAWGGQAPAENHAPRIGYLRVADDPSAPFAVWPAG
FT                   DEGSFTLDAVDPDGDMLEARWSVMAESAARSVGGDPEAAPHAFPEAVRQSGPTGARISG
FT                   LPAGRYRVFVEVHDGRGAAATANMPFEVR"
FT   gene            360781..360857
FT                   /locus_tag="Snov_R0007"
FT                   /note="tRNA-Arg1"
FT   tRNA            360781..360857
FT                   /locus_tag="Snov_R0007"
FT                   /product="tRNA-Arg"
FT   gene            complement(361273..362031)
FT                   /locus_tag="Snov_0363"
FT   CDS_pept        complement(361273..362031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0363"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bpy:Bphyt_6213 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87696"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2X8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH87696.1"
FT                   /translation="MTENRELAGHTALVTGAARNVGRAIAVALARAGARVVVHARSSVD
FT                   AANETVAQCQQAFGGADGAFAHFADLTDPEAVRIMFAEVEARFGGLDLLVHNAAERADG
FT                   PFDEISFAEWRRIVGSILDSAFLCDQAALPLLRRSAAASIIHIGGVAAHVGVRHRAHVS
FT                   AAKAGIVGLTRALAAEFASEQITVNCISPAQMETERKGHMPEHFRQRPVPLGRPGQPAE
FT                   LASLVCFLAGPSGRFITGQTIHLNGGWYMG"
FT   gene            complement(362078..362908)
FT                   /locus_tag="Snov_0364"
FT   CDS_pept        complement(362078..362908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0364"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   bxe:Bxe_B2585 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87697"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2X9"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ADH87697.1"
FT                   /translation="MTGLDAWIGRMETSAARLDGWPLAGLRAALDQNEAVQAGTALPPT
FT                   GQWLYFQPLAPQSRLGADGHPERGGFLPPIELPRRMWAASDMTYHRPICVGDEVEKRSR
FT                   IANVSSKSGRTGTLAFVTVEHSYLRSGMLMLSETQTLVYRDAPSPGEPPSPPQPAPDGA
FT                   LWSQEVTPDSRLLFRYSAVTFNAHRIHYDEPYARQVEGYPGLVVHGQLTATLLIEAFRK
FT                   ERPKFAVGGFSFRAMRPVFAGTTIHLEGAGDGDGYRLWARDQDGAVIVEAKVRP"
FT   gene            363006..363227
FT                   /locus_tag="Snov_0365"
FT   CDS_pept        363006..363227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0365"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: pla:Plav_2982 biotin/lipoyl attachment
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87698"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Y0"
FT                   /inference="protein motif:PFAM:PF00364"
FT                   /protein_id="ADH87698.1"
FT                   /translation="MAKVDIKTEITGNVWKIEKAVGEQVGEEDVILILESMKMEIPVSA
FT                   PEDGVIIEILVAEGDTVTEGTVVARIEA"
FT   gene            363231..364592
FT                   /locus_tag="Snov_0366"
FT   CDS_pept        363231..364592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0366"
FT                   /product="Methylcrotonoyl-CoA carboxylase"
FT                   /EC_number="6.4.1.4"
FT                   /note="KEGG: sil:SPO2540 carbamoyl-phosphate synthase,
FT                   putative; PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87699"
FT                   /db_xref="GOA:D7A2Y1"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Y1"
FT                   /inference="protein motif:PRIAM:6.4.1.4"
FT                   /protein_id="ADH87699.1"
FT                   /translation="MKKILVANRGEIACRVFRSSRALGLSNVAVYSDADAESAHVEAAD
FT                   QSVGVGPAPARESYLRVEKVLDAARETGADAIHPGYGFLSENAEFAQSVIDAGLIWIGP
FT                   SPETIRQMGDKQRARQIAEAAGVPVVPGSIRFEPGMLEGLEPAAEAVGYPLLVKAAGGG
FT                   GGIGMRRVDGPDKLTDIVVATQSMAQKSFGNGAVFLERFVPKARHVEIQVFGFGDGRAI
FT                   HLFERDCSLQRRFQKVIEEARAPGLPPHVTDAMAAAAVRLCEATRYSGAGTVEFIVDAG
FT                   TFEFFFLEMNTRIQVEHPVTEMITGRDLVAMQIELARGSLAFIPQAEIKTHGHAIECRL
FT                   YAEDPNKMFMPAPGPLATFRPPTGMAHLRIDSGYREGDVVTPFYDPMVAKVVAWGEDRE
FT                   EARRRAVEALRAFSIDGIRSNRHFLLACLGDENFVSGDVHTGFIDAHRMRLLAA"
FT   gene            364628..365500
FT                   /locus_tag="Snov_0367"
FT   CDS_pept        364628..365500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0367"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: transcriptional regulator TrmB; KEGG:
FT                   bbr:BB3556 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87700"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR021586"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Y2"
FT                   /inference="protein motif:PFAM:PF01978"
FT                   /protein_id="ADH87700.1"
FT                   /translation="MAGKLAIAANESDDLLADLKRLGFTEYEAKIYIQLLRMPPSTAYE
FT                   ISKGANVPRPNTYHALEALAQRGAVLPVSENPVRYVAAPPNDFLAALSNQTRALCADLS
FT                   ERLSSIAPSSKGEYVWMLRGEGNVHSKIDTLIEESDTSIWIKASDTVLRRHKEALRKAA
FT                   ARGIEIFIVLFGPDAEEFRFGPTCRVYIHEGNGVRMGTTDNLFTVSIDHIETLTATVEG
FT                   EVVAAYTRNGPIVNLAESLVRHDYYMAEIFARLGPQIDEAFGPYLRDLRLACFSPEQAA
FT                   SFKKRTGLS"
FT   gene            complement(365558..367753)
FT                   /locus_tag="Snov_0368"
FT   CDS_pept        complement(365558..367753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0368"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG: bbr:BB1576
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87701"
FT                   /db_xref="GOA:D7A2Y3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Y3"
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /protein_id="ADH87701.1"
FT                   /translation="MTVQDTHTLRAARGEALIAEARANGRGSLDEAAGKALLADFGVRV
FT                   PRSRFAADVVQAAEIAGELDGPFVVKVVSPDILHKSDAGGVALRLADADAVRAAVEAMA
FT                   AKPLIAAAKVDGWLVEEMMPSGREIVIGGYRDPQFGPMIMVGLGGIFVEVLRDISFRIC
FT                   PIEAKDAEEMLAELKGHALLDGARGEAGIDKAALIDIMLRIGGAGGLLMRHQADIAELD
FT                   LNPVIASQNGAVAVDARVILTPQAEADIAFEAPDASPLDAFRPLFEPRTVAVLGASTKD
FT                   VAIANTFIRRMKAFGYEGSIYPIHPAAEEIEGLKAYPSLADTPEPVDYAYIAVGAERIP
FT                   GILAAAGGRCRIAQVISSGFGELEDGKALQDALVEGGRTGGARILGPNCLGTYSPRGGL
FT                   TFPAEAPKEVGTIGVISQSGGLTTDIIKRGEWRGLRFSGAVTIGNSADVEPHELLAYYL
FT                   ADPQTRAIGIYMEDVKHGRAFYEQLKKASKPVVILKGGRSALGRLAAASHTGALAGDEK
FT                   AWEALQKQTPAVLVATVDEFIDLLLALQHFDLHPDHPTRTVTLFGNGGGSSVLGTDAFA
FT                   GAGLEVAPYGEEARRLLEAMKLPPGTSVANPIDTPVRTLQEKDGFVAGEILDIVYGHAH
FT                   PDAVLMHLNLSAFVGRGSVDPIDNLFTVVGQTKEKWPGGPHFALALRTDGSAALDDRRR
FT                   HYREKARAIGVPVFDEIAPAAKALAGIGHLERRLNGR"
FT   gene            complement(367764..369299)
FT                   /locus_tag="Snov_0369"
FT   CDS_pept        complement(367764..369299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0369"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: bbr:BB2690
FT                   putative carboxyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87702"
FT                   /db_xref="GOA:D7A2Y4"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Y4"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="ADH87702.1"
FT                   /translation="MPHDVMLEKLDERRTQARRMGGLDKLAKRAERGQLNAKERLDALV
FT                   DPGSFFEVGLLGASGVFDADVEATPRDGKITGFGRIEARDVGVVVNDFTTKGASTSATN
FT                   SKKMGYIRRTCTERGMPFLHIGESTGARLPDAMGSKGMGALLGNDTTQFKRMRDTPWVA
FT                   AALDTSFGSSAWLCCCADFAVMKKGSIMSVSSPRLVSMAIGEKVDLEELGGWRLHAEQT
FT                   GLIDYFVDTDAEAMAVIRQFLSYMPSHNGELAPNAPVTEGSGEDQDRILAVLPEKRTQV
FT                   YNMKKIIEVIFDRDSFFEVKARFGKSAVVGLARLNGQAVGVVANNPQVGGGALSAEACR
FT                   KIIDLTVLCDSFNLPIVRLVDTPGFVVGTEAERRGAPGHIMNFMNATCLTTVPSVTVLC
FT                   RKAYGRAYVAMGGGAHNDAMIAWPTAEVSFMDPVFATSIVHNLTAGQEGFEDALAHIQK
FT                   DLEIWDMARIFSAQDVVKPQETRAWVIRMLDIQRRRRSGGLGQHLMRTWPTSY"
FT   gene            complement(369355..370431)
FT                   /locus_tag="Snov_0370"
FT   CDS_pept        complement(369355..370431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0370"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: oca:OCAR_6795 O-succinylbenzoate-CoA
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87703"
FT                   /db_xref="GOA:D7A2Y5"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Y5"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ADH87703.1"
FT                   /translation="MSRLRRIRLSRLRLPLIRPYRLSYRTFDEFEPYLVEVEDSDGCTG
FT                   FADAHISPGSSSETREGGWAFCLAKMDAIIGKAPADAKEIVLADFAKSKVAATALTAAI
FT                   EVLEGSELLDVTDTRSQPLLTPINALEPEAIAAEVEKWIGEGFRTFKVKVGKDVDADLA
FT                   RVAAIQQVVSGRATLRLDANRAFSREQGIAFASRLDPAGIELFEQPCDSDDWEANAAVA
FT                   AASTVPLMLDEPICTLGDIERAAKIERVGFCKLKLKRFGSLQRLADGLNAVRAHGMSPV
FT                   LGDGLGSEVQGWLEACVARDTVDNAGEFNGFLKPKTGLFENPLPFESGEVRMPAGYRPQ
FT                   LDRAAVERATIATHDVAA"
FT   gene            370858..371829
FT                   /locus_tag="Snov_0371"
FT   CDS_pept        370858..371829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   reh:H16_B2308 extra-cytoplasmic solute receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87704"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Y6"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ADH87704.1"
FT                   /translation="MLKFLLRTAALAAAIAMMPAGARADFPDKPIRYLLHVSPGGATDV
FT                   MARKLAIAMEKILGVPLVVENKPGGRGATQLAELAAAKPDGYTIGAVTSTHIGAFNQTL
FT                   KQYKVDSFDWIARLVNEPYLIVVNKDSKITSMKDLVEAANAKPGSVVMAGFVRGSGGHF
FT                   AWEIMAKSADLDSKKVRWVPFDSVGDAVTAALGNHAEVAIAYVDLVKTHVQAGNLRVVA
FT                   VMSDKRVPQFPDVPTLKEQGYAADTSWQQMRGIIGPKGIPEPIKAKLADAVKQALETPE
FT                   LKAYMEESALVPAFQGPADFTATAQRENAATKEWMATLGLTR"
FT   sig_peptide     370858..370932
FT                   /locus_tag="Snov_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.964 at
FT                   residue 25"
FT   gene            371906..372409
FT                   /locus_tag="Snov_0372"
FT   CDS_pept        371906..372409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_1331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87705"
FT                   /db_xref="GOA:D7A2Y7"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Y7"
FT                   /inference="similar to AA sequence:KEGG:Xaut_1331"
FT                   /protein_id="ADH87705.1"
FT                   /translation="MATQHDEPTVDVSAEPKDLSFRLELGDALAGAALLAFAVTFWVLG
FT                   ADIDDGGGYGVGAATFPRGIALLLGIGALVLLANGLVHLFGPPSGHLVTIGRPLHVIAG
FT                   MGLMLAFAPAMRHLGYYPTMGVFLAALLWVADCRRPLHILAYVAGFLLFSKVVFEMVLS
FT                   IPLP"
FT   gene            372418..373944
FT                   /locus_tag="Snov_0373"
FT   CDS_pept        372418..373944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0373"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112
FT                   transmembrane; KEGG: amt:Amet_1107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87706"
FT                   /db_xref="GOA:D7A2Y8"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Y8"
FT                   /inference="protein motif:PFAM:PF01970"
FT                   /protein_id="ADH87706.1"
FT                   /translation="MIDGFLAGLSAFSSWQVMAGLLGGVVIGYVVGALPGLSAGVGMAL
FT                   LIPFTFGLDPVVSVVMLVSLYMASEYSGAIPAILMNTPGEPSSAITALDGYPMRERGEA
FT                   GEALTLSILGSAVGSIISTLLLIFTVMWMTKIALAFGPTEYFALAVLGLSLISTLAGHS
FT                   ILRGFIALLFGLLLTTVGADPVDGVMRYVFTDNLLGGFPFIAALIGLFALSEVLRMLES
FT                   PGDRVTPLKELPGLTAQFGLLKPHAGNLVRSTFIGYILGVIPGAGATIASITAYSVQKR
FT                   LSKSPETFGKGNPEGVVAAETANNACMPGALAPMLALGIPGKASTAVLVGALAIQGVRP
FT                   GPLIFTQHPEIPYSIYIALLVGMPFMVLLGLFGSRLWVRLTTIPASVVTGIVAATCLLG
FT                   TYSESNDIFAIGVAVGFGIVGYLLSKVDIEPAPIVLALVLGYMMESNFRRSLVMSGDDM
FT                   GVFLREPISAVCLVLAAIIFVAPLLQNLLAWRRRRGELDIRPGADTEVSR"
FT   gene            373941..374834
FT                   /locus_tag="Snov_0374"
FT   CDS_pept        373941..374834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0374"
FT                   /product="Citrate (pro-3S)-lyase"
FT                   /EC_number="4.1.3.6"
FT                   /note="KEGG: bja:bll0499 citrate lyase beta subunit; PFAM:
FT                   HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87707"
FT                   /db_xref="GOA:D7A2Y9"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Y9"
FT                   /inference="protein motif:PRIAM:4.1.3.6"
FT                   /protein_id="ADH87707.1"
FT                   /translation="MNGERPLRSVLYVPGIRERALEKIRELDVDALIIDLEDSIAPEMK
FT                   PQARENACRAVSAGGYGFRQVAIRVNSRGTRWFEDDLAAVAAAGPDIVVLSKVEAPDDI
FT                   GEAHRLLRSAGAAPGLQLWAMIETPLGLLDLSEIVREGRKQPDNRLAGLVLGTNDIAKD
FT                   TGVLAGDDRAAMVPWLLNAVLVARAHGLSVFDGVYNAFTDMDGFVRECAQGRQLGFDGK
FT                   TLIHPSQIALANRLFAPADEDVAEALTIVEAFALPENADKGVITLGGKMVERLHAMSAK
FT                   RLIAIDAAIKARGSFA"
FT   gene            375025..375957
FT                   /locus_tag="Snov_0375"
FT   CDS_pept        375025..375957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0375"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: bja:blr4463 ABC transporter substrate-binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   3; SMART: extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87708"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Z0"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADH87708.1"
FT                   /translation="MALDLDTHSRAKGGPMGARLRSALLGVLGLALATGGLATALPQQA
FT                   EASMPAACAALQAKYPSLKGKTLINAINPHTPGYETIDPADPTKYIGFDIDLGEAIGEC
FT                   LGFKLTYKPVTFAALLTTLQAEQADIVISDIYATKERAKAADFITYLKVFDGVLVAKGN
FT                   PKGIDGINLSLCGAVAAENTGYVEVPLIQALEAECKKAGKPAPEILLFDNNANCIQAIL
FT                   AGRADTYINDVNTVDGAVKAYPDKLAKATAVTLPYSVGIAVPRNKVEFRDAVMAALTEI
FT                   QKSGLQAELMKKWNLPAEQLESPKLVLAD"
FT   gene            376040..377665
FT                   /locus_tag="Snov_0376"
FT   CDS_pept        376040..377665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0376"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: ABC transporter related;
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; KEGG: bbt:BBta_6505 ABC transporter
FT                   permease/ATP-binding protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87709"
FT                   /db_xref="GOA:D7A2Z1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Z1"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADH87709.1"
FT                   /translation="MDLFLHYLSMPYLIDGVGYTLLITVLGLLGGLLMGVVLAAMQLSR
FT                   FRALAIIARGYSIIFRGTPLILQMVFCYNALPLIGIKLTAISAAGLALALNEAPFIAEI
FT                   LRSNVIGVDRGQVSAGQALGMTPAAIMRRVIAPQAIRSMVPALGNEAVSALKNSSLASV
FT                   VAVQELTLRSTQLASATFDFFSIFFASGLMYLILTGAIAVIQIVVEMLLDLDRPPPKEQ
FT                   LRRFLRAMLPGRAEPVPADAAGAVPPDVAKEILEEIAVDPLPPASPKAALARPDREARA
FT                   RRLAGNNVAVEVKGLRKRYGDQTVLDGIDLTVRAGEVVALLGPSGSGKSTLLRCINRLE
FT                   GWEDGTIRVGGRFLGSDEAGRPLSPRTTAQMRASVGVGMVFQQFNLFGHLTAEENIAGP
FT                   LRWVQGLSRLDARRRAQELLERVGLAHRADALPRHLSGGQQQRVAIARAVAPGPSVLLL
FT                   DEPTSALDPELVGEVLEVIRRLAVEDGLAMIISTHQLHFAGDVADRIVFLAGGSIVEEG
FT                   PAQQVLREPRHPLTARFLSTMAAD"
FT   gene            377733..378971
FT                   /locus_tag="Snov_0377"
FT   CDS_pept        377733..378971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0377"
FT                   /product="Acetamidase/Formamidase"
FT                   /note="PFAM: Acetamidase/Formamidase; KEGG: bra:BRADO1537
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87710"
FT                   /db_xref="GOA:D7A2Z2"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Z2"
FT                   /inference="protein motif:PFAM:PF03069"
FT                   /protein_id="ADH87710.1"
FT                   /translation="MTKHHLPATPDTVHWGYFSRTLDPVLTLKSGERAVIETITHHAND
FT                   DYERMIAGDRAAEEIFLWTKEAKTLRRRGAGATEGPFTYGSGEGLGVHLLTGPIAVEGA
FT                   EPGDVIEVRIIDAWPRPSANPAYQGRFFGSNPSANWGFQYKDLIEEPKPREVVTIYELD
FT                   MGEAAVKALYSYRWTPQTDPDGIVHPTIDYPGVRVDHGTIVKKEGILPGIKVPARLHFG
FT                   TMGLAPAEADFVSTIPPNYTGGNMDDWRIAKGARMYYPVAVPGGLFSCGDAHASQGDSE
FT                   LSGTAIEISLTGEFEFILHKKEQLDGTLLEGLNHPLLENDELWSVYGFSVANYLTELGP
FT                   DHQTEILKRGSLDNAMRDAFRKLRRFLMTTQKLSEDEAISLMSVAADFAVTQVVDANWG
FT                   LTGSIRKSIFAGR"
FT   gene            379072..381408
FT                   /locus_tag="Snov_0378"
FT   CDS_pept        379072..381408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0378"
FT                   /product="transcriptional regulator, AraC family with
FT                   acetamidase/formamidase activity"
FT                   /note="KEGG: bja:blr4466 transcriptional regulatory
FT                   protein; PFAM: Acetamidase/Formamidase; helix-turn-helix-
FT                   domain containing protein AraC type; SMART:
FT                   Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87711"
FT                   /db_xref="GOA:D7A2Z3"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Z3"
FT                   /inference="protein motif:PFAM:PF03069"
FT                   /protein_id="ADH87711.1"
FT                   /translation="MNAEPFTSEAYAEGARERAWQEVLGGFGLHSLGGRQGTPAHASAL
FT                   SRLSSLGVRLGTLAADAQTLRPLSGRGGLPLLLLPVETTMVLTIAGDSQIVPAGHVVLG
FT                   PRGADWQVQFQRGVRALALSVPAEAFRGRKVAPLAACPPRVFAPDGLADVLARTVQSGS
FT                   GALDRLSDAEWEAVAQSAAELLLALSAELATTRADPSSSRAALLQRIYAAIERNIGSED
FT                   VSIAEIARGEGISERYLQKLFEGTGESFSHYVRERRLQRAWHDLANPGEATVPISEVAY
FT                   RYGFADSAHFSRLFRERFGLPPRELRRREAGRHGQDALPSGQRGWPQEALVQLRARQTE
FT                   AEPDARRGVVLGSDPPADAPESPAHHYLPVNAHHVHWGFFSRSLKPLLEIDSGDIVTVE
FT                   TLTQHASDAPELMIEGDPGAESVFHWTRAAKAVDRRGAGPLDASVFGRGAGEGFGVHIC
FT                   TGPIAIRGAQPGDVLEVEILDIEPRPSRHPDHAGRVFGSSVAAWWGFHYSEFLSEPHPR
FT                   ETVTIYEILADADEPHAKAVHAYRWEPQTDPSGVRHLLYDYPGVPVRPGTVTPKKGVLE
FT                   GVRIPLRPHFGVIAVAPRETGLVDSVPPAYFGGNLDNWRLGKGATIYLPVSVPGALLSV
FT                   GDPHAAQGDGELSGTAIECSMTGTFRVILHRKADTAGTLLADLTYPLIETTDDWVLTGF
FT                   SHPNYLAEFGADGQSEVYAKSSLDLAMRDAFRKVRRFLMTTKGLSEDEAIALMSAAVDF
FT                   GITQVVDGNWGVHAILSKRLFPDRG"
FT   gene            complement(381413..382240)
FT                   /locus_tag="Snov_0379"
FT   CDS_pept        complement(381413..382240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0379"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rle:RL1231 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87712"
FT                   /db_xref="GOA:D7A2Z4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Z4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH87712.1"
FT                   /translation="MSGKTFFITGANSGFGFAIAAAALREGHQVIGTVRSEETRAALAE
FT                   RLPAVRPVLCDVTEFDRIDDVVRQAEDDHGPVDVLINNAGYGHEGVLEESPLEEMRRQF
FT                   DVNVFGAVAVAKAFLPRFRERRRGFIVNVTSMGGMITMPGIAYYCGSKFALQGISEVMR
FT                   AEMAPFGVHVTALCPGSFRTDWAGRSMVRTERSIPDYDALFDPIRQARQARSGKQLGDP
FT                   EKLAAAVLRLVESDTPPPQLLLGSDALGLVSDRIERLRQEIEAWKPVTISTDG"
FT   gene            382337..383251
FT                   /locus_tag="Snov_0380"
FT   CDS_pept        382337..383251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0380"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: bid:Bind_1549 AraC family transcriptional
FT                   regulator; PFAM: AraC-type transcriptional regulator domain
FT                   protein; helix-turn-helix- domain containing protein AraC
FT                   type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87713"
FT                   /db_xref="GOA:D7A2Z5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Z5"
FT                   /inference="protein motif:PFAM:PF06719"
FT                   /protein_id="ADH87713.1"
FT                   /translation="MKAVEERSARRELVELAERLAPRHGYNPTGLDNVRLLRTEAVLHD
FT                   IPVLYRPGAVFVLQGRKQGLLEDEVYLYDEEHYLAVSVPVSFRMQSIASAERPLLAVYV
FT                   EFDMRLAAEIASEVGVRRAEPAAGKMRGLASSRMEPAIEDVVLRLLRALRDPVELAVLG
FT                   AAISRELHYRVLVGPQGGAMIAALQQRGTSGRIVQSLARLRETYDSALSVAALAGEAGM
FT                   SVPSYHVHFKALTGSTPMQYVKAMRLHEARLMIARQDRTIAEVAACVGYASPAQFSRDF
FT                   KRHFRRTASEEARWVRQHLGELA"
FT   gene            complement(383279..384586)
FT                   /locus_tag="Snov_0381"
FT   CDS_pept        complement(383279..384586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0381"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bpy:Bphyt_6342 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87714"
FT                   /db_xref="GOA:D7A2Z6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Z6"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADH87714.1"
FT                   /translation="MSAADIFAEGFKAQPYWWDAAEPETDLDPLPARADAVVIGSGYAG
FT                   LNAATELARAGLDVVVIDGERIGEGGSTRSGGMVSSGQKLVVGGAIKGIDPELFNRMIG
FT                   DSISSFDYLQNLIQGEGLDADLKITGRFFGAHAPSLLQPTWHNGRILAEKTGVTVHLYD
FT                   RANQRHAIGSDYYHGGIVVDEYGGLHPGKYHQALRQRARASGAKLRSHAKAGPVQDADG
FT                   GLKRVPTTRGDILARHVVSATNGYTRKDGHPDLARRVVPVKSYQIATEPLPADLIETLI
FT                   PRARMISDTRRDVIYSRPSPDGTRILFGSRPGFFEREDRDAAPAIYERMTEIWPELKAY
FT                   RISHAWSGFVAMTVDKVAHMGRRDNSDFAVGCNGNGVALMSYLGYQTAQKILGRQNRTT
FT                   AFDREQFTAVPLYSGNPWFVPIVAAWYRLQDWYERR"
FT   gene            complement(384673..385419)
FT                   /locus_tag="Snov_0382"
FT   CDS_pept        complement(384673..385419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0382"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bxe:Bxe_A2431 polar amino acid ABC transporter
FT                   ATPase; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87715"
FT                   /db_xref="GOA:D7A2Z7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Z7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87715.1"
FT                   /translation="MNRADTLIELDGVTKSFGSFQVLKGISLSVKDGEAVCIIGPSGSG
FT                   KSTILRCINGLIPIDGGSIRVGQHEVHKLKTEKEMRPLRHQVSMVFQQYNLFPHRTVLQ
FT                   NIMMAPVQVLGHDAREVEARAHRLLAKVRLSNKADAYPGQLSGGQQQRVAIARALAMEP
FT                   QVILFDEVTAALDPETVKEVLTAIRELVDDRLTCILVTHEMKFAREVADRVCFTDHGRI
FT                   VESGPPAQIFDAPQDARTREFLGQVL"
FT   gene            complement(385416..386228)
FT                   /locus_tag="Snov_0383"
FT   CDS_pept        complement(385416..386228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0383"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: bxe:Bxe_A2432 polar amino acid ABC transporter
FT                   inner membrane protein; TIGRFAM: polar amino acid ABC
FT                   transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87716"
FT                   /db_xref="GOA:D7A2Z8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Z8"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADH87716.1"
FT                   /translation="MQWPLTYHEKKRAVQLAIVLALVAWLAADALTGGAANWQRVWLRL
FT                   PLLLTGSGSGWPLTGGFVLNIFLGLCSMVLAAVMGTLLAFGMMARNRAIRLPCFFIMNF
FT                   LRNSPWLVLLFAMLYIIPFNVRLFGFSIAVPAFVKAVIGLALPTGANFAEIIRGAVQSI
FT                   HSGQWEAARAFGYMPMAIYWRIILPQALRRMIPGWMNLYALLMIATSLATVTGIQDVIT
FT                   TLNTLLSMENERVIVYFYIATLFLFFAYCYPIALLARRMEQSVKGDAL"
FT   gene            complement(386230..386946)
FT                   /locus_tag="Snov_0384"
FT   CDS_pept        complement(386230..386946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0384"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: bxe:Bxe_A2433 polar amino acid ABC transporter
FT                   inner membrane protein; TIGRFAM: polar amino acid ABC
FT                   transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87717"
FT                   /db_xref="GOA:D7A2Z9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Z9"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADH87717.1"
FT                   /translation="MFGLDYSWLSDPVYQDWLLRGTLTTIGLALASSAIAILIGAFGAL
FT                   ALSLRIAWLDALIELFVELFRNTPPLLQMLFFYFTLSTIGLRVTDPATGLSVPLLSAFD
FT                   CALVSLSLFGGALCIEAFRSGLESLPHSVTEAARSLGYSRWARFRRIEMPIASRICLPA
FT                   LTNILTNLFKTTSQASVITVPELMYYAGQIYNDTFRTAEVMLLVLLIYVSLVSLLSWGM
FT                   SRIEQALAFPGYGKGH"
FT   gene            complement(386972..387796)
FT                   /locus_tag="Snov_0385"
FT   CDS_pept        complement(386972..387796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0385"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: bxe:Bxe_A2434 polar amino acid ABC transporter
FT                   periplasmic ligand-binding protein; PFAM: extracellular
FT                   solute-binding protein family 3; SMART: extracellular
FT                   solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87718"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D7A300"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADH87718.1"
FT                   /translation="MRTSILTIAASLAMTLGIGAASADTLADVKAKGTLTIGVKNDYPP
FT                   YGFLNDKGEIVGFEVDLGKYIAKELLGPEGKFELVPVVAANRIEFLNSGRIDIILATLG
FT                   VTEERGKVIDFSEYYVSAPGPSVIAPKAATFSKWEELKGLTLCGIQGSYYNKHLSGDLG
FT                   IQLTAFKTQPEAYRALKDNRCVGFVFDDMTLRQKTEEADWAGYKIAVDPYEYIPQAAGI
FT                   RKNDVAFRDAVNKAITKAEAEGKLIEWETTYGMPPAKYIAERAKAAAAKLKP"
FT   sig_peptide     complement(387725..387796)
FT                   /locus_tag="Snov_0385"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 24"
FT   gene            387996..388760
FT                   /locus_tag="Snov_0386"
FT   CDS_pept        387996..388760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0386"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: mlo:mll9009 transcription regulator; PFAM:
FT                   regulatory protein IclR; Transcriptional regulator IclR;
FT                   SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87719"
FT                   /db_xref="GOA:D7A301"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A301"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADH87719.1"
FT                   /translation="MAAPTASGSQLLDRAALLLDLIADGTSEGATLKELVERSGLNTAT
FT                   CHRILNTLVGHRLLARDDKRKRYRLGAKMFIYGARAARGPGLISRCEMSLSRLRKKTGE
FT                   TTHLMARHNHDSLCLDRRDGECVVQTLTGSIGGSVPLGAGPGSIAMLAFLDREEQEFIL
FT                   RANEPRFAAFRDLAADKVWRLIEETRARGHAVDIGELIPGIAGVAMPILDETGVPVASL
FT                   GFTFLCAKIVPGLVENYAALLRAEIDLIERRS"
FT   gene            complement(388768..389469)
FT                   /locus_tag="Snov_0387"
FT   CDS_pept        complement(388768..389469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0387"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ara:Arad_9641 short-chain dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87720"
FT                   /db_xref="GOA:D7A302"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A302"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH87720.1"
FT                   /translation="MTARTVLISGGGRGIGAATGRVMMQAGWNVSLGMRSPALPDWAEE
FT                   GPGQVQACAYEATDPAAAERWVAEARARFGGIDAVVANAGIMIRKDVIAAEDEELARLM
FT                   EVHVAAPRRLAKAAWNDLAASGRGRVIIVSSLSGKRVKSAISSLYSVSKFAATGLAHAL
FT                   RHTGFELGIRATAVCPGFVATDMGLPLTTRTAEELTDPADIGRAIRFLIELPNTSSVAE
FT                   FAVNWTLEESF"
FT   gene            complement(389480..390802)
FT                   /locus_tag="Snov_0388"
FT   CDS_pept        complement(389480..390802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0388"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   ara:Arad_9647 oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87721"
FT                   /db_xref="GOA:D7A303"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A303"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADH87721.1"
FT                   /translation="MSKFSPFATTLWYATAAPAPQTTRLEGRVSADVCVVGAGFTGLTT
FT                   ALELARQGVKVVLLEAEEAGFGGSGRNAGHCTPTFSYYSLPSLRKILGEPWAERLIHRQ
FT                   TRANDRVGAMIRDYQIDCEWRQNGYVMGALRPGAVELLKGKVEQYNDVGARTRLLGRDE
FT                   VETLTGSPRFYGGWLHEEAGHMNPLGYARGLARAVMQEGGTLYTASPAEDVEPEGLRWK
FT                   VRTPQGEVVADKVIFATGAYTVKAWPKLDRSFKILRVFVCATQPLDPDVRRSVLPQDTT
FT                   MHDGRGDIYVYKYNAEGRIVASMFPMGARGSDIPYTHQVMADRLKWLHPQIRQPIRWEY
FT                   FWYGELDMQVRTVPRLYGLAPGVVALTGLSGRGVPTGSMLGGILSEWAMGVPEKDLSLR
FT                   VEPLKAAPFYMDYAPKLRLRYFRYADTRAARREGAELPPHA"
FT   gene            391052..391342
FT                   /locus_tag="Snov_0389"
FT   CDS_pept        391052..391342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0389"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK23758 gene product from transcript
FT                   GK23758-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87722"
FT                   /db_xref="UniProtKB/TrEMBL:D7A304"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87722.1"
FT                   /translation="MSRVPATLLAVIMLAASAAAPAFAQDAGTMPGNLNNLNQPVIPPG
FT                   NPDNLNPGADAPQPLTGELVPLPGPPPVGGAADLKLPDCAPPNCGTPQIMQ"
FT   sig_peptide     391052..391126
FT                   /locus_tag="Snov_0389"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            391538..392482
FT                   /locus_tag="Snov_0390"
FT   CDS_pept        391538..392482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0390"
FT                   /product="choline ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="KEGG: oan:Oant_2920 substrate-binding region of
FT                   ABC-type glycine betaine transport system; TIGRFAM: choline
FT                   ABC transporter, periplasmic binding protein; PFAM:
FT                   Substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87723"
FT                   /db_xref="GOA:D7A305"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:D7A305"
FT                   /inference="protein motif:TFAM:TIGR03414"
FT                   /protein_id="ADH87723.1"
FT                   /translation="MILRSLVACLSLSATLLGSPAFASEPAACAKPRFSDVGWTDITAT
FT                   TTIASQILQSLGYKPEVSVLSVAITFKALENGDRDIFLGNWMPLQEPTQGPLVKAGKVD
FT                   VVVDNLKDARIGFATSKEAHDAGLKTYADIAKFKDQLGGKLYGIEAGSGANNTISKMIT
FT                   EDTFGLKGFDLVESSEQGMLAQVSQKIRMKQPVVFFGWRPHPMNVNLPIAYLSNGNDVF
FT                   GPNDGGATVVTLTRPGYVKECPNVGRLLTNLVFDVAMEDRLMSDILDKGMTPDAAVRAW
FT                   LKENPAVLDKWLAGVTTFDGKPSVTAVKSGLGL"
FT   sig_peptide     391538..391609
FT                   /locus_tag="Snov_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(392485..393450)
FT                   /locus_tag="Snov_0391"
FT   CDS_pept        complement(392485..393450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0391"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: oan:Oant_2921 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; ThiJ/PfpI domain protein; SMART:
FT                   Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87724"
FT                   /db_xref="GOA:D7A306"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7A306"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADH87724.1"
FT                   /translation="MIFAHSDEPLDVTLLLFSGLSLLSLAATLDPMRGANRVLGRAAYR
FT                   WKLTSIDGQMPVASCGLPIPVDGAFDPSMQQDALIVVAAFDAVHHATPRILKSLRAGAT
FT                   RSKIVGGIESGSWLMGFAGLLDGRRATTHWEDLEDFAARFPNADVEPDRFVVDEPVFTT
FT                   GGATPALDCMLSLIRARNGYSAALDVASLYIYEEVRTGSDVQPIVSLGRIRQHEPRVAE
FT                   AIRIMETHIDRPLTIAAIARRVGVSTRGLETLFQKTVDVSPGVYYVTLRLNAARRLVLD
FT                   TNLPIADIAERTGFSAIASLSRAYRRQFGAPPSAARRTRS"
FT   gene            393555..394457
FT                   /locus_tag="Snov_0392"
FT   CDS_pept        393555..394457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0392"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   sme:SMc01637 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87725"
FT                   /db_xref="GOA:D7A307"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7A307"
FT                   /inference="protein motif:PFAM:PF05853"
FT                   /protein_id="ADH87725.1"
FT                   /translation="MPLSMNREVFITCAVTGAGDTVGRSSHVPVTPQQIAESAIDAAKA
FT                   GAAVVHCHVRDPETGAASRRRDLFREVTDRIRSAEVDVVLNLTAGMGGDLVFGSVEAPF
FT                   PVNAAGTDMAGATERVAHVAECLPEICTLDCGTMNFNLGDYVMTNTPSMLRAMARQMTA
FT                   LGVRPEIEAFDTGHLWFAKQLAEEGLIENPVLIQLCMGIPWGAPDDLNTFMAMVNNVPA
FT                   NWTFSAFSIGRNALAYPAAAVLAGGNVRVGLEDNLYAGKGQLATNAQLVEKAATVVTNM
FT                   GARILGPQEVREKLKLVKR"
FT   gene            394469..395980
FT                   /locus_tag="Snov_0393"
FT   CDS_pept        394469..395980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0393"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein; KEGG:
FT                   rlg:Rleg_6430 3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87726"
FT                   /db_xref="GOA:D7A308"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR026578"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A308"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ADH87726.1"
FT                   /translation="MTSLAPISRAACIGGGVIGGGWVARFLLAGIDVKVFDPHPEAERI
FT                   VAEVLANAERAYGLLTSVPLPPRGRLTFCASVGEAVADAEWIQESVPERLDLKRRVLAE
FT                   IDAAAPADALIGSSTSGLLPSDLQEGLGHPERLFVAHPYNPVYLLPLAEIVGGKATSAA
FT                   TIARAKDALDAIGMKGVVIAREIEAFVGDRLLEALWREALWLIKDDICDVETLDDVIRY
FT                   SFGLRWAQMGLFQTYRIAGGEAGMRHFLAQFGPCLQWPWTKLTDVVDLDEALVEKIGAQ
FT                   SDAQAKGLSIRQLERIRDENLVGILQALKAGQGGEGWGAGKLLAEFEQRLRESAGHADA
FT                   VDIHAPLPLVETRVSPAWIDYNGHMTEHRYLQVFGDTTDALLRLIGADLAYVEGGHSYY
FT                   TVETHLRHLDEAHLGEALRATCQILSVDEKRIHIFHRLFAGAGNREVATAEQMLLHVDT
FT                   RAGRATPAPEIILARLRPIATAHAQLDAPEGAGRAVGQKRSMAAV"
FT   gene            396311..396970
FT                   /locus_tag="Snov_0394"
FT   CDS_pept        396311..396970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0394"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: [2Fe-2S]-binding domain protein; ferredoxin;
FT                   KEGG: azc:AZC_1402 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87727"
FT                   /db_xref="GOA:D7A309"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:D7A309"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="ADH87727.1"
FT                   /translation="MHSHSEPGLSRRDLLAAGAATVAGSAAVGPAHAQDAVSTTSVDTA
FT                   PRAPIHAPVRFTVNGRAQALELDTRTSLLDALREHLHLTGTKKGCDHGQCGACTVMVDG
FT                   VRINSCLTLAVMHEGAEVTTIEGLGTPERLHAMQAAFVKHDGYQCGYCTPGQICSAVAV
FT                   LDEIKAGIPSHVTADITATPEFSVDEVRERMSGNICRCGAYSNIIEAITEVAGRAA"
FT   sig_peptide     396311..396412
FT                   /locus_tag="Snov_0394"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 34"
FT   gene            396967..397917
FT                   /locus_tag="Snov_0395"
FT   CDS_pept        396967..397917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0395"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; KEGG:
FT                   azc:AZC_1401 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87728"
FT                   /db_xref="GOA:D7A310"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:D7A310"
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /protein_id="ADH87728.1"
FT                   /translation="MKPFTYERAASPAQAAAAAIQMPGAKFIAGGTNLLDLMKLQIETP
FT                   AHLIDVNGLALDTIEPTQEGGLRIGALVSNTDLAADARVRRDYGLLARALLAGASGQLR
FT                   NKATTAGNLLQRTRCPYFYDTDQPCNKRHPGSGCSAIGGVTRQLGVIGTSDACIATHPS
FT                   DMAVALRALDATVETVRADGATRRIPVAELHRLPGDTPHVETALEPGELITAVVLPAPV
FT                   GGTQIYRKVRDRASYAFALVSVGAVLQHDGTGRIAVGGIAPKPWRVEEAEAELANGARA
FT                   FTTRLLAGARPTRDNAFKVALVERTLAAVLNEARG"
FT   gene            397921..400131
FT                   /locus_tag="Snov_0396"
FT   CDS_pept        397921..400131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0396"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; aldehyde oxidase and xanthine
FT                   dehydrogenase a/b hammerhead; KEGG: azc:AZC_1400 putative
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87729"
FT                   /db_xref="GOA:D7A311"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:D7A311"
FT                   /inference="protein motif:PFAM:PF02738"
FT                   /protein_id="ADH87729.1"
FT                   /translation="MKFDTPATTNPIDQMKVVGQPLDRIDGPLKTTGTAPYAYERHDVA
FT                   AAPAYGYVVGSAIAKGRIARMDVSAAQRAPGVLAVVTAENAGLLDKGKYNTAKLLGGPE
FT                   IEHYHQAVALVVAETFEQARAAAPLVKIDYATEAGSFDLHAARVAAFPPEENEITGPPE
FT                   THVGDFAGAFAQAPVTLDETYTTPDHSHAMMEPHATLAAWEGDKLTVWTSNQMIAWANG
FT                   DLAKTLRVPTEKVRVISPFIGGGFGGKLFLRADVVLAALGARAAGRPVKVALQRPLIAN
FT                   NTTHRPATIQRIRIGATREGVITAIGHESWSGDLEGGGPETAVNQTRLLYAGANRMTAM
FT                   RLAVLDLPEGNAMRAPGEAPGMMALEIAMDEMAEKLGIDPIEFRIRNDTQVDPEKPERP
FT                   FSARAFAECLRLGAERFGWDARNPRPGQWREGKWLVGIGMAAAFRNNLLMKSGARVRLD
FT                   GDGRVTVETDMTDIGTGSYTIIGQTAAEMMGVPIEKVTVRLGDSSFPVSAGSGGQFGAN
FT                   NATAGVYAACVKLREEVTQRLGFNSEDAVFADGQVRAGNRSVLLGAAAAEGDIIAEDAI
FT                   EYGDLDERYQQSTFGGHFVETTVDAYTGETRIRRMLAVCAAGRILNPKSARSQVIGAMT
FT                   MGAGAALMEELAVDTRRGFFVNHDLAGYEVPVHADIPHQEVIFLDETDPLSSPMKAKGV
FT                   GELGICGVGAAVANAVYNATGVRVRDYPITLDKYLDRLPDAA"
FT   gene            400254..400844
FT                   /locus_tag="Snov_0397"
FT   CDS_pept        400254..400844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0397"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="KEGG: azc:AZC_0692 two-component response regulator;
FT                   PFAM: ANTAR domain protein; response regulator receiver;
FT                   SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87730"
FT                   /db_xref="GOA:D7A312"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7A312"
FT                   /inference="protein motif:PFAM:PF03861"
FT                   /protein_id="ADH87730.1"
FT                   /translation="MTADPALRIVIVDESPLRAAILEEGLREAGYRNVLRLPERHDLLA
FT                   RLHAIDPDVIVIDLEDPSRDVIEQMFQVSREVKRPIAMFVDQSDSSTIAAAIDAGVSAY
FT                   IVDGLKKERVKPIIDMTISRFRAFARLREELEQTRTELEERKTIDRAKGILMKMKGLDE
FT                   PQAYALLRRTAMNEKRRLVDIAQSVITAAELLK"
FT   gene            400855..402006
FT                   /locus_tag="Snov_0398"
FT   CDS_pept        400855..402006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0398"
FT                   /product="putative nitrate transport protein"
FT                   /note="KEGG: azc:AZC_0691 putative nitrate transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87731"
FT                   /db_xref="UniProtKB/TrEMBL:D7A313"
FT                   /inference="similar to AA sequence:KEGG:AZC_0691"
FT                   /protein_id="ADH87731.1"
FT                   /translation="MRRLSIGFIPLTDAAVVIACAERGFAAAQGLRLDLHREVSWANIR
FT                   DKVNVGLLDGAHMLAPLAIASSLGLGHVRVPLVAPFALNLNGNAITVANALHEAMQATG
FT                   EDLSSAEGAARALGLVARQRLKDGQDPLTFATVYPFSTHTYMLRHLLAAAGLDPDRDVR
FT                   LVVVPPPYTVENLRSGLIHGFCVGSPWNSVAVEAGVGRVLLLGSEIFARAPEKVLGVHA
FT                   RFANSEPDVLAQLVRALDAAARWCDQPQSHEELAALLAEPRHLGLPRDMLTRALAGRLK
FT                   GTGDAVPRSDVDFLVMHRNGANRPDPAQALWIYGQMVRARQAQFSTDAAHEAMQVYQPA
FT                   LYDAALGTHGTPPAVEPDPVGTRFGMPFRPEDIEGYLAEVDRV"
FT   gene            402558..403895
FT                   /locus_tag="Snov_0399"
FT   CDS_pept        402558..403895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0399"
FT                   /product="nitrate-binding protein NrtA precursor,
FT                   periplasmic"
FT                   /note="KEGG: xau:Xaut_2504 nitrate-binding protein NrtA
FT                   precursor, periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87732"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D7A314"
FT                   /inference="similar to AA sequence:KEGG:Xaut_2504"
FT                   /protein_id="ADH87732.1"
FT                   /translation="MTDTPSRRSKSRSDSRLSRRSFLKVSAATLGTASLVEALRFSFPG
FT                   GVPSAYAAGPETTKAVLGYIALMDASPLVIAKEKGLFAKHGVPDVEVVKQASWGATRDN
FT                   LVLGGAANGIDGAHILSPMPYLISTGKVTQNNVPTPMYILARLNLDAQAISVSNEYKDL
FT                   KVTTDASALKAAFAAKKAAGKEVKVAMTFPGGTHDLWLRYWLAAAGIDPDKDVSTIVVP
FT                   PPQMVANMKVGNMDAFCVGEPWNEQLVNQGIGYTACTTGEIWKHHPEKALGMRADFVEK
FT                   NPNATRAILMAVMEAQQWCDQPANKEEMSTIVGKRQWFNVPVADILGRAKGDINYGNGR
FT                   VVKGSDQYMKFWQDQASYPFKSHDAWFVTEDMRWGKFEPTTDVKALVDKVNREDLWRDA
FT                   AKALGVAAADVPSSTSRGKETFFDGKVFDPGDPSAYLASLEIKRVA"
FT   gene            403949..404860
FT                   /locus_tag="Snov_0400"
FT   CDS_pept        403949..404860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0400"
FT                   /product="nitrate ABC transporter, inner membrane subunit"
FT                   /note="KEGG: xau:Xaut_2503 nitrate ABC transporter, inner
FT                   membrane subunit; TIGRFAM: nitrate ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87733"
FT                   /db_xref="GOA:D7A315"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005889"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A315"
FT                   /inference="protein motif:TFAM:TIGR01183"
FT                   /protein_id="ADH87733.1"
FT                   /translation="MSLTALKSETTVPPKPAAGGKSGAKVVRLVFPARPAAAPGRFATL
FT                   GHSLAVTLVPPLVVLMLLLGLWELLCAGPGATLPPPSSIWQDSYDLIVDPFFVNGPQDI
FT                   GLGWRVLVSLQRVAIGFGLAAGVGILLGVLIGQSVWAMRGLDPIFQVLRTVPPLAWLPI
FT                   ALAAFRDSNPSAIFVIFITAIWPVIINTAVGVRNIPQDYRNVAQVLRLNPFEFFAKIML
FT                   PAAAPYIFTGLRIGVGLSWLAIVAAEMLTGGVGIGFFIWDAWNSSRLSDIIVALVYIGV
FT                   VGFVLDRLVAGIGAFVTRGTAA"
FT   gene            404871..405665
FT                   /locus_tag="Snov_0401"
FT   CDS_pept        404871..405665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0401"
FT                   /product="nitrate ABC transporter, ATPase subunits C and D"
FT                   /note="TIGRFAM: nitrate ABC transporter, ATPase subunits C
FT                   and D; PFAM: ABC transporter related; KEGG: azc:AZC_0684
FT                   nitrate transport ATP-binding subunits C and D protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87734"
FT                   /db_xref="GOA:D7A316"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005890"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A316"
FT                   /inference="protein motif:TFAM:TIGR01184"
FT                   /protein_id="ADH87734.1"
FT                   /translation="MTAYLKLDHIDKVFARGGNVTEVLKEVSLDVTRGEYISIIGHSGC
FT                   GKSTLLNIVAGLTPATTGGVILEGRQVDGPGPDRAVVFQNHSLLPWLSVYDNVRLAVDK
FT                   VFSGVKNRAERHDWTLHNLELVQMVHAKDKRPAEISGGMKQRVGIARALAMEPKVLLLD
FT                   EPFGALDALTRAHLQDSVMQIHAAIGNTVLMITHDVDEAVLLSDRIVMMTNGPSARIGE
FT                   VLDVELPRPRRRLDLVTDPTYLACREAVLKFLYERHRFVEAA"
FT   gene            405676..406137
FT                   /locus_tag="Snov_0402"
FT   CDS_pept        405676..406137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0402"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: azc:AZC_0683 putative
FT                   hemoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87735"
FT                   /db_xref="GOA:D7A317"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:D7A317"
FT                   /inference="protein motif:PFAM:PF00042"
FT                   /protein_id="ADH87735.1"
FT                   /translation="MTPERIALVRESFAKVRPIADDAAALFYGRLFQIAPEVRPLFPAD
FT                   LTEQGRKLMTTLAVVVNSLDDLPALLPVVQRLGARHAGYGVTGEHFAPVGAALLWTLEK
FT                   GLGEGFTPEVRMAWTEAYHVLATVMIDALKSAAPPVQESPFGRIVGVQP"
FT   gene            406134..407396
FT                   /locus_tag="Snov_0403"
FT   CDS_pept        406134..407396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0403"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: azc:AZC_0682 putative nitrite
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87736"
FT                   /db_xref="GOA:D7A318"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="UniProtKB/TrEMBL:D7A318"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADH87736.1"
FT                   /translation="MNPAIRLPRERLLIIGNGMAAAKLCEELDSAAHGRFDVTVVGAEP
FT                   HLAYNRVLLSCLLAGEIGAPDIELHSAAWWRAKGVTVRTGCPVAAIDIEARHAVLADGT
FT                   VLGWDKLVFATGSQAIRLPVPGMELPGVMTFRDRADVEAILASASPGRRAVVIGGGLLG
FT                   LEAATGLAGAGIETAVIHLADRLMERQLDARAAGLLKRAVEARGIAVHLNASTQCIEGT
FT                   DRVEALRLADGRCLPADLVIVACGVRANAELARAAGIACQRGVLVDDGLATDMPGVYAL
FT                   GECAEHRGQVYGLVEPAYEQARVLAARLAGGSARYEGSVTATNLKVSGVKVFSAGDFMG
FT                   GADTQDIVLFDARAEHYRRLVLRPDAAGTRLVGAVLFGDTADGLYYLDLIRSGRDISAE
FT                   RADIAFGRPDLPLPNLAREAA"
FT   gene            407396..409189
FT                   /locus_tag="Snov_0404"
FT   CDS_pept        407396..409189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0404"
FT                   /product="precorrin-3B synthase"
FT                   /EC_number="1.7.7.1"
FT                   /note="TIGRFAM: precorrin-3B synthase; KEGG: xau:Xaut_2499
FT                   ferredoxin-nitrite reductase; PFAM: nitrite and sulphite
FT                   reductase 4Fe-4S region; nitrite/sulfite reductase
FT                   hemoprotein beta-component ferrodoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87737"
FT                   /db_xref="GOA:D7A319"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR012798"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:D7A319"
FT                   /inference="protein motif:TFAM:TIGR02435"
FT                   /protein_id="ADH87737.1"
FT                   /translation="MGSDFSPEQKRYLEGFVAGIAATRASGGITGSAANAASAPVVAAE
FT                   PTGPDAAAHRAMARFEAEGRKLVNEEKIKREELGLDSYARMKQHARDGAFPKGGDVFRW
FT                   KFHGLFYVAPTQDSYMCRLRIPNGILKHWQFEGVADLAEHHAGGYSHITTRANLQIREI
FT                   PVTEGPAVLEGLVGLGLTSRGAGADNIRNVTGSPAAGIDPQELIDTRPYALEWHHHILA
FT                   DRSLYGLPRKFNVAFDGGGRIGALEETNDIGFQAVEVADGFGVAPGVWFRVVLGGITGH
FT                   LDLARDTGVIVRPEEATAVADAMVRVFIDHGDRTDRKKARLKYLLDAWGFEKFLAAAEE
FT                   KLGAKLTRVPAEAVAPRPEPDRLAHVGVHKQTQEGLNWVGVVLPVGKMSVEQMRGLARI
FT                   ARDLGDGELRLTVWQNLILSGVADANVALVEAALEALGLTSRATAIRAGLVACTGAAGC
FT                   KFGNADTKATAEAIARHCEGRVAVDLPVNIHVTGCHHSCAQHYIGDIGLVGARVPLNEE
FT                   GDTVAGYHVVVGGGFGPDAAIGRELWRDVREEEAPVRVEALLRAWLANRMDDAETLARF
FT                   TRRHEPEALRSLVDMAAEISA"
FT   gene            409186..410766
FT                   /locus_tag="Snov_0405"
FT   CDS_pept        409186..410766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0405"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; FAD-binding domain protein; Fe-S cluster domain
FT                   protein; KEGG: azc:AZC_0680 sulfite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87738"
FT                   /db_xref="GOA:D7A320"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D7A320"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ADH87738.1"
FT                   /translation="MNAPMLQPMPAVSYLPETAPFSEEQRAWLNGFFAAVLAPPTGTPV
FT                   ALDAPAAPAIEDDGAPWHDPAMPLDERMKLAEGRPLPRRLMAAMAQQDCGQCGYVCESY
FT                   AAALAAGTEAKLNLCAPGGKETARMLKALAAELDGAPAAVPATSAPAAPVGAPGTSRDN
FT                   PALVTLVSRHRLNKGASEKETWHVEFDLAAAGLDYTVGDSFGIFPENDPALVAAVLAAI
FT                   GADGSEEIEGRTVADILARDVSLGGAPDGLFQLLTYLTGGEARRRARALAAGEDPDGDA
FT                   AGLDVLAALEKFGRPAIAAEVLVEALEPLQPRLYSISSSPKATPGRLSLTVDTVRYKLG
FT                   SRTRLGVGSTFLSGRLEPGTPMRAYVQKAHGFALPADPATPVIMVGPGTGVAPFRAFLW
FT                   ERMASGAKGRNWLFFGHQRSDCDFFYEDELSGMRAGGHLARLTLAWSRDGSEKVYVQDR
FT                   MREVGADLFAWLEEGAHFYICGDAKRMAKDVERALVEVVAAHGGRTTDDALAYVAGLKK
FT                   AGRYQADVY"
FT   gene            410766..413477
FT                   /locus_tag="Snov_0406"
FT   CDS_pept        410766..413477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0406"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molybdopterin
FT                   oxidoreductase Fe4S4 region; molydopterin
FT                   dinucleotide-binding region; BFD domain protein
FT                   [2Fe-2S]-binding domain protein; KEGG: xau:Xaut_2497
FT                   molybdopterin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87739"
FT                   /db_xref="GOA:D7A321"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/TrEMBL:D7A321"
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /protein_id="ADH87739.1"
FT                   /translation="MNAPVPPPLGEVVAAASSGRPAVRTTCPYCGVGCGVLATLDGQGG
FT                   ALIAGDPEHPANFGRLCSKGSALGETLGLETRLLHPMAREGDGPLLRIGWGTALDRIAS
FT                   AFRDTIDRHGPDSVALYLSGQLLTEDYYAANKLAKGFLGTANVDTNSRLCMASSVAGHR
FT                   RAFGSDTVPGCYEDLDEADLVVLVGSNAAWCHPVLFRRIEAARARRGTRVVVIDPRRTA
FT                   TGDEADLFLPVRAGMDSIVFSGLLVRLAEHGALDDAYIAAHTSGFEATLAAARELAPDV
FT                   ATAARAAGVEAEALEEFYRLFERTERVVTCYSQGVNQSAQGTDKVNAIINCHLATGRIG
FT                   RPGMGPFSLTGQPNAMGGREVGGLANQLAAHMDFSPGSVDRVGRFWQAPHMATREGLKA
FT                   VALFDAIAAGKVKALWVMGTNPAVSLPRADGVREALRGLDFLAVSDNVAANDTLGCRPH
FT                   LVLPALAWGEKDGTVTNSERRISRQRAFLSPPGEAKADWWAIAQVGKRLGHAAAFKWRS
FT                   AAEVFREHAALSAFENGGTRDFDLSGLAGLDDAAFDALAPVQWPVRGAGESKRFFAEGG
FT                   FYTSDRKACFVPPRRPELARATSEAYPFLLNTGRIRDQWHTMTRSGLSPRLGAHLPVPF
FT                   AEINAEDAARLGITDGAMVRVASAHGALAVEARLAAGQPRGTVFVPIHWSEATSSCGRL
FT                   GALVAGDTDPASGQPEAKATPVTLVPVEMPFRGFVLSRQAMTPPPAQWWARATLDGAIA
FT                   YILADDRPPQDWLHAWLGDETGAVRLDDAGAGRYRFADFDEAGRIRLVAFVERSDRRLD
FT                   WSGALSWFADEERDIARRGQVLSGRAESGGACGPVICACHGVAQDSIEAFIAGNPAAGL
FT                   AGIGAALKAGTNCGSCIPELRRLLARTEPALG"
FT   gene            complement(413474..414823)
FT                   /locus_tag="Snov_0407"
FT   CDS_pept        complement(413474..414823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0407"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: PAS fold domain
FT                   protein; Oxidoreductase FAD-binding domain protein;
FT                   oxidoreductase FAD/NAD(P)-binding domain protein; KEGG:
FT                   azc:AZC_2751 globin; SMART: PAS domain containing protein;
FT                   PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87740"
FT                   /db_xref="GOA:D7A322"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D7A322"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADH87740.1"
FT                   /translation="MHTLYMISAEANTMTDTAAATAQPAHVDQRGPRAFVVESRHKESE
FT                   VITSFVLRPADGRPPAPHEAGQHLTLFAEVPGHGRQKRNFTISSAPNGETYRITVKREP
FT                   AGTVTKWLHDSAEPGTRLDIARPDGSFVLPRGDERPIVMVSAGVGLTPMVAMLEEFVRE
FT                   KRHVRVQFVHCTQNGGTHALGKHVRDLAAASDGIETTFLYTRPESGDVAGRDFDISGHL
FT                   SLDWLAAHTPLNEAEYFVCGPLRFLRDFVPGLAQRGVPVERLNYEFFGPVEDLFGDATD
FT                   GGTTPSPQSGTVAARTARAVHGFSREQIGDALLDSAADAIIASATDGTIVLWNAGAERI
FT                   FGFTEEEALGQSLDIIIPEPFRARHWEGYDETIASGVSRYGAGDLLAVPGLHKDGRRIS
FT                   IEFTIVLMKDETGKVTGMVAALRDVTARFEETKALKKKLAALEAATGGNS"
FT   gene            414860..415315
FT                   /locus_tag="Snov_0408"
FT   CDS_pept        414860..415315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0408"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="KEGG: pde:Pden_1690 BadM/Rrf2 family transcriptional
FT                   regulator; TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87741"
FT                   /db_xref="GOA:D7A323"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A323"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ADH87741.1"
FT                   /translation="MRLTRYSDYAMRVMLYLAARGDRPCSISEMAAAYGISQNHLMKVM
FT                   NDLGRAGYVASTRGRNGGFRLARPANEIVVGDLLRHTEDDLDLVDCPRCVLSRGCGLSS
FT                   VLDEALMAFLAVLDRYTLADLIDRRQGFQSLLLSLDSGMGRIQPGLA"
FT   gene            415315..416478
FT                   /locus_tag="Snov_0409"
FT   CDS_pept        415315..416478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0409"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="KEGG: mlo:mll8143 hypothetical protein; PFAM: HPP
FT                   family protein; CBS domain containing protein; SMART: CBS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87742"
FT                   /db_xref="GOA:D7A324"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:D7A324"
FT                   /inference="protein motif:PFAM:PF04982"
FT                   /protein_id="ADH87742.1"
FT                   /translation="MAVSTTALVLVSSAGLLVACVAGARPRPSPLAMHLEWALSAFARI
FT                   RLFRPILAGATLRDRILACLGALVGIALTAFVSAVAAGNVTDLLWIVPPMGASAVLLFA
FT                   VPASPMAQPWPAIGGNVISALIGIAVAHFMPLSALSAGIAVASAIAAMSLLRCLHPPGG
FT                   AAALVGLFAGASSSYWFPLMPVGVNAVILTASAWVYHRMSGHTYPHAPAAPAAAPKPTQ
FT                   ELPWTFSRSDVASALEEMGETFDIDTADLETLLRTIEQRALARSYKQLTCRELMSTGLI
FT                   SVAASAAPEEARAKLVASDVRRLPVLDTDGRIVGAVGLRDLIRPAATVRALMTPAATAT
FT                   PEAHAIDLLGRYAHDRVHAVFVVDEDRKPIGVVTEADWLAVLTRGLE"
FT   sig_peptide     415315..415389
FT                   /locus_tag="Snov_0409"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.870) with cleavage site probability 0.719 at
FT                   residue 25"
FT   gene            complement(416483..416920)
FT                   /locus_tag="Snov_0410"
FT   CDS_pept        complement(416483..416920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0410"
FT                   /product="Protein of unknown function DUF1810"
FT                   /note="PFAM: Protein of unknown function DUF1810; KEGG:
FT                   bid:Bind_2803 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87743"
FT                   /db_xref="InterPro:IPR014937"
FT                   /db_xref="InterPro:IPR036287"
FT                   /db_xref="UniProtKB/TrEMBL:D7A325"
FT                   /inference="protein motif:PFAM:PF08837"
FT                   /protein_id="ADH87743.1"
FT                   /translation="MDDPYDLKRFVSAQETVFDTAVAELRAGRKRSHWMWFIFPQLRGL
FT                   GRSPTAEFYGIGSLKEARAYLAHPVLGPRLERATQAVPLESGRSLHDIFGSPDDMKFRS
FT                   SMTLFALACDAPDSVFRRALDLGCAGDMDKATLALLDEERA"
FT   gene            416995..417441
FT                   /locus_tag="Snov_0411"
FT   CDS_pept        416995..417441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0411"
FT                   /product="protein of unknown function DUF296"
FT                   /note="PFAM: protein of unknown function DUF296; KEGG:
FT                   sme:SM_b20067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87744"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="InterPro:IPR025707"
FT                   /db_xref="UniProtKB/TrEMBL:D7A326"
FT                   /inference="protein motif:PFAM:PF03479"
FT                   /protein_id="ADH87744.1"
FT                   /translation="MKSKLLGEGEGGRLFALVLDPGEEAFAAIRDFAAKEGISAASVTA
FT                   IGAFSRATVGWFDFDTRDYRRIPVEEQCEVLSALGDIARDDDGKASLHLHAVLGLSDGS
FT                   TRGGHLLDGIVRPTLEVMITETPAHLHRRKRPGLGISLIDLGSG"
FT   gene            417458..418441
FT                   /locus_tag="Snov_0412"
FT   CDS_pept        417458..418441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0412"
FT                   /product="Glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /note="KEGG: rpd:RPD_1383 glutaminase; PFAM: Glutaminase,
FT                   core"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87745"
FT                   /db_xref="GOA:D7A327"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:D7A327"
FT                   /inference="protein motif:PRIAM:3.5.1.2"
FT                   /protein_id="ADH87745.1"
FT                   /translation="MHGPDAVIPAIPQPKVTNPVPDLERIVSDIAEEMRARPDRGEVAT
FT                   YIPELARADPNAFGIAVIAADGQVAVGGDADVPFSIQSVSKVFTLTLALGKIGNLLWKR
FT                   VGREPSGSPFNSIVQLEAEHGIPRNPFINAGAIAVTDVILSGHQPREALGEILRFMHFL
FT                   AEDSSIGIDEAVAASEQRTGFRNRALANYMKSFDVLENPVDYTLGVYFHHCAIAMSCRQ
FT                   LAMAARFLAHGGRNPSTGFSVVSAERARRINAIMLTCGHYDGSGEFAYRVGLPGKSGVG
FT                   GGILAIAPGKASIAVWSPGLDASGNSHLGRIALEALTQRLGWSVFG"
FT   gene            complement(418566..418751)
FT                   /locus_tag="Snov_0413"
FT   CDS_pept        complement(418566..418751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0413"
FT                   /product="putative glutamine synthetase translation
FT                   inhibitor GstI-like protein"
FT                   /note="KEGG: bra:BRADO3394 putative glutamine synthetase
FT                   translation inhibitor GstI-like"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87746"
FT                   /db_xref="InterPro:IPR021232"
FT                   /db_xref="UniProtKB/TrEMBL:D7A328"
FT                   /inference="similar to AA sequence:KEGG:BRADO3394"
FT                   /protein_id="ADH87746.1"
FT                   /translation="MRTNIQRASAQIVQFPVGGRAGLAARRAELRASEPLKVNPAVIFG
FT                   SWYHEEAIREDAGPKN"
FT   gene            419202..420236
FT                   /locus_tag="Snov_0414"
FT   CDS_pept        419202..420236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0414"
FT                   /product="Glutamate--ammonia ligase"
FT                   /EC_number="6.3.1.2"
FT                   /note="KEGG: met:M446_4572 glutamate--ammonia ligase; PFAM:
FT                   glutamine synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87747"
FT                   /db_xref="GOA:D7A329"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D7A329"
FT                   /inference="protein motif:PRIAM:6.3.1.2"
FT                   /protein_id="ADH87747.1"
FT                   /translation="MTKYKLEYIWLDGYKPTPNLRGKTQIKEFDHFPSLEELPLWGFDG
FT                   SSTEQAEGRSSDCVLKPVAIYPDPARKNGALVMCEVMMPDGVTPHATNARATILDDEGA
FT                   WFGFEQEYFFYKDGRPLGFPEHGYPAPQGPYYTGVGFKNVGDIAREIVEEHLELCLEAG
FT                   INHEGINAEVAKGQWEFQIFGKGSKKAADEVWMARYLLLRLTEKYGVDIEFHCKPLGDT
FT                   DWNGSGMHCNFSTKFMREVGGKDYFEALMAAFAKNLDDHIAVYGPDNHMRLTGKHETAP
FT                   WNKFSYGVADRGASIRVPHSFIRNDYKGYLEDRRPNSQGDPYQIASQVLKTISEVDTKA
FT                   AAAA"
FT   gene            complement(420520..421950)
FT                   /locus_tag="Snov_0415"
FT   CDS_pept        complement(420520..421950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0415"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   bpt:Bpet3488 putative membrane-associated phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87748"
FT                   /db_xref="GOA:D7A330"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D7A330"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ADH87748.1"
FT                   /translation="MLRFLSEYWPHITLVTSAAIGVVAAIHAAMTKDDVRAAIGWVGVI
FT                   LLSPFVGAFLYLVAGINRIRQSAAGRRRASQDRRRHHERPPIAIALSPSLSAMKRLGDR
FT                   VAAFPLTTGNAVELLDSGDAAYPAMLDAIRAAKRHVALSSYIFDNDPVGVQFADALIEA
FT                   HKRGVAVRVLIDAIGARYSRPSIVGRLMEGGVTVDLFMGNLIGLRLPYANLRSHRKMLI
FT                   VDGGLAFTGGMNIRAQFMAAFGGDDPARDTHFRVEGPAVEQLLTVFSQDWSFTTDEFLD
FT                   GPAWAEAPQGTHGPVAVRVVPSGPDRNLASAHNMIMGALAVAQSRVHVCSPYFLPDQQL
FT                   IGALTVAGRRGVEVDIVIPSANNLKLVDYAMTAQLDQVIAGECRVWRAEGMFDHSKLMA
FT                   VDGCWAYVGSSNLDPRSLRLNFELDLELYDPTIATAIETRVAAMMAASRPETLGTLARR
FT                   PFLEKLRNRAIWLASPYL"
FT   gene            complement(422097..424538)
FT                   /locus_tag="Snov_0416"
FT   CDS_pept        complement(422097..424538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0416"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="SMART: peptidase S16 lon domain protein; AAA ATPase;
FT                   TIGRFAM: ATP-dependent protease La; KEGG: msl:Msil_3172
FT                   ATP-dependent protease La; PFAM: peptidase S16 lon domain
FT                   protein; AAA ATPase central domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87749"
FT                   /db_xref="GOA:D7A331"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:D7A331"
FT                   /inference="protein motif:TFAM:TIGR00763"
FT                   /protein_id="ADH87749.1"
FT                   /translation="MTHPDFERFDPVRMADAGGNNGASGATNGNVPADQLIVLPVRNFV
FT                   LFPGVVLPLSVGRAASIAAAQQAVREGRPIGILMQRDASVEEPSPTDLHRMGVVANILR
FT                   YVTAPDGTHHLVLQGEQRFHVDEFVREKPFVTARVKRLEESEERSSEIEARFVHLQGQA
FT                   TEALELLPQVPAELVAAVRGSNSPAGLADLVAAYIDISADEKQELLETVDIVARMNKVS
FT                   RLLAHRIEVLRLSQEISKQTKASLDERQREVLLREQMAAIQKQLGEDDGNSQDIADLEK
FT                   AITDAGMPEDVEQMARKELGRLRRMQDASAEYGMVRTYLDWLIALPWKLPETAPIDIAE
FT                   ARKILDEDHFGLDKIKRRIVEYLAVRKLAPGGKAPILCFAGPPGVGKTSLGQSIARAMG
FT                   RKFVRVSLGGVHDEAEIRGHRRTYVGALPGNIIQGIRKAGTRDCVMMLDEIDKMGSGIQ
FT                   GDPSAAMLEVLDPEQNGTFRDNYLGVPFDLSRVVFIATANMLDTIPGPLRDRMEIIQLT
FT                   GYTDTEKLQIAKRYLVRRQLEANGVKPEQVEVDDEALKAIIRAYTREAGVRNLEREVGR
FT                   AVRHVAVGIAEGSVSHARISVDTLPEMLGPPIFEDEVALRVSVPGVATGLAWTPVGGDI
FT                   LFIEATRVPGRGGLILTGQLGDVMKESAQAAWSLVKSRAEELGIDPELFAKNDVHVHVP
FT                   AGATPKDGPSAGVAMFTALVSLLTGRTVRKDTAMTGEISLRGLVLPVGGIKEKVVAAAR
FT                   AGLTRVMLPARNRRDYEDIPQDARDRLEFVWLERVDEAMANALEPRESPDQPALPLKAA
FT                   S"
FT   gene            complement(424556..424978)
FT                   /locus_tag="Snov_0417"
FT   CDS_pept        complement(424556..424978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0417"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: msl:Msil_3173
FT                   molecular chaperone (small heat shock protein)-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87750"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:D7A332"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ADH87750.1"
FT                   /translation="MKKTDPRLWMWSDAIDMLNRAERMHRQMFQPASRADAVSPRRHAP
FT                   CWEPPVDMIETERELIVLAALPGVDPERISVAIQNGTLAISGERVLPAELNRATIHRME
FT                   LPQGRFERQLVLPPGRYEVAHPRVVNGCLAIVLRKV"
FT   gene            complement(425089..426006)
FT                   /locus_tag="Snov_0418"
FT   CDS_pept        complement(425089..426006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0418"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: acr:Acry_2830 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87751"
FT                   /db_xref="GOA:D7A333"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A333"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH87751.1"
FT                   /translation="MELRHLQHFIAVAEEQHFTRAAQRANIVQSALSSSIRALEEELDA
FT                   RLFLRTTRQVRLTAAGEAFLEKARRVLDAVREAREAVSSAAALERGTLDIGAVPSLPAF
FT                   IDLPALLAAFHALYPGIEVRLSQGGSEPLTEKLRAGTLDLAILPLCEPVPDIAASVVAC
FT                   EGLVLVCAPAHPLAGRTEVTLAELAGEPFVDFQPGWGTRRLVDKGFGQAGLERRIAFEV
FT                   SDLDSLLALVARGLGVALVPETVAEARRDMLAVVDIAGPDLCWELVVAHLAPGRGGMSA
FT                   LDEAPRAFLDLMLSRAEPAKTQAA"
FT   gene            426156..427037
FT                   /locus_tag="Snov_0419"
FT   CDS_pept        426156..427037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0419"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="KEGG: rpc:RPC_1857 6-phosphogluconate dehydrogenase,
FT                   NAD-binding; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87752"
FT                   /db_xref="GOA:D7A334"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A334"
FT                   /inference="protein motif:PRIAM:1.1.1.31"
FT                   /protein_id="ADH87752.1"
FT                   /translation="MKVGFIGLGSMGAGMARNLLKAGHEVTVFNRSPAKAAPLVEAGAV
FT                   AASSVAEACKGEAVITMLADDAAVSSVAEGEGGILASLAPGALHVSASTISVALSEKLT
FT                   AAHAEAGQLYAAAPVFGRPEVAAAGELFVAAAGPADTLTLAQPLFDAIGRQTFVFSDTP
FT                   SKANLVKLSGNFLIACVIETLGEALALVGKGGVDQKQYLDFLTSTLFGAPVYRNYGNLI
FT                   VDTTPRPVGFAAPLGLKDMRLALAAAEELRVPLPVGSLLRDRFLTLLANGGEGQDWSAI
FT                   GRLAAKDAGGVV"
FT   gene            427059..428057
FT                   /locus_tag="Snov_0420"
FT   CDS_pept        427059..428057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0420"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: mea:Mex_2p0869
FT                   putative chaperone-associated ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87753"
FT                   /db_xref="GOA:D7A335"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D7A335"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADH87753.1"
FT                   /translation="MEQIDIGSSGVKTSRIGLGTWAIGGWMWGGSDEAEAIATIRTAVE
FT                   RGVTLIDTAPVYGFGHSEEIVGKALAEGGLRAKAQIATKAGLAWVDGKVHRDSRAARLR
FT                   QEVEDSLRRLRTDVIDLYQIHWPDLETPFDETARTLEELRQAGKIRAIGVSNFSPAQMD
FT                   AFRAHAPLHAVQPPYNLFERDIEKDVLPYAARSGLTVLSYGAICRGLLSGRMRADTTFT
FT                   GDDLRKFDPKFTGERFPRYLAAVAELDTLARERFGKTVLALAVRWVLDQGPTIALWGAR
FT                   RPDQLDPVGEIAGWTIDEATKGEIDAILARHVPEPIAPTFMAPPAKRPLTA"
FT   gene            428311..429327
FT                   /locus_tag="Snov_0421"
FT   CDS_pept        428311..429327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azc:AZC_0718 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87754"
FT                   /db_xref="InterPro:IPR021225"
FT                   /db_xref="UniProtKB/TrEMBL:D7A336"
FT                   /inference="similar to AA sequence:KEGG:AZC_0718"
FT                   /protein_id="ADH87754.1"
FT                   /translation="MRLIGSFLIGSAGFVGVAVAVAWVSNASLPTPADAARADLPPFRM
FT                   APAAPETASAVVDEPSARPARTVMDVRNFYAAGEIPQPSNWLFDPAVMPIRPAVVAAVP
FT                   VPAPTAEPTVETVSAVPLPAANPLAAGRVMAGNEPEDALTFAPRPPKKPKLDAEIAALP
FT                   PPMEEDVAPDEPAPAPAVTEAPKDELRYPTREDKFAVYDIRAKKLYLPSGKKLEAHSGY
FT                   GAKMDNVRYVHVRMEGVTPPNRYSLKMREALFHGTEAVRMTPVGDGKMYGRNGFLLHPY
FT                   LLGPRGDSNGCVSVADYDAFLAAFKRGEVQELVVVESMPGSGDTLNPLLSWLTGKRS"
FT   sig_peptide     428311..428373
FT                   /locus_tag="Snov_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.463 at
FT                   residue 21"
FT   gene            429371..430633
FT                   /locus_tag="Snov_0422"
FT   CDS_pept        429371..430633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0422"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="KEGG: mno:Mnod_5869 glycine
FT                   hydroxymethyltransferase; PFAM: glycine
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87755"
FT                   /db_xref="GOA:D7A337"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:D7A337"
FT                   /inference="protein motif:PRIAM:2.1.2.1"
FT                   /protein_id="ADH87755.1"
FT                   /translation="MSTLHAGYFTEGLDADPELAAALRGELKRQQDGIELIASENIVSR
FT                   LVLEAQGSVLTNKTVEGLPYARYYGGAEFADAIEALAVERAKKLFNCRFANVQPHSGSN
FT                   ANAGVFLGLLKLGDTILSMNTAAGGHISHGHPATLTGRDYRIVPYGVSRETERIELDEL
FT                   RTLALDHAPKLIVAGGSAYPPAIDFAGMRAIADEVGALFMVDMAHFAGLVATGLYPHPF
FT                   PHAHVVTSTTYKSLRGARGGIVLWNDASLNDRINYGIFPGVQGSVMMHAVAGKAACFGE
FT                   ALKPEFHAYNEAVLANARAMAAALATEGLRIVGGGTDCGLMLVDLSPLGVTGDIAAKAL
FT                   EKAGLAVNKNLVPFDPRPPEAPSGLRLSSNAGTARGFGIAEFETIAGWIARVVKAPADA
FT                   AAIAAVRAQVTSLCASFPIYA"
FT   gene            complement(430743..431675)
FT                   /locus_tag="Snov_0423"
FT   CDS_pept        complement(430743..431675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0423"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: rpt:Rpal_1743 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87756"
FT                   /db_xref="GOA:D7A338"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A338"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH87756.1"
FT                   /translation="MRNATLKQLRAVAAVVETGSVTGAARKLNVTPPAVTMQVQQLEEH
FT                   LGLPLLDRAGDRFQPSAAGREVLAAIARIEQAMADCGAALDAMKGLKSGRVSVGLVSTA
FT                   KYFVPAALGSFTRAHPGIDVVLTVGNREEIIAGLRGDNIDVAIMGRTPLDMEVDKTLIG
FT                   DHPHVIIAPADHPLLGRRLPPSALATSTFMSREPGSGTRGLMERFFEENGIAPRIGMEI
FT                   GSNETIKQAVMAGLGLAFISGHTIAAEVADGRLAALDVEGLPVVRQWFVVKRTAKRLTP
FT                   PAAALTEFLSRRGPEFLPSTPYVHVEATA"
FT   gene            431857..432882
FT                   /locus_tag="Snov_0424"
FT   CDS_pept        431857..432882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0424"
FT                   /product="Inositol phosphatase/fructose-16-bisphosphatase"
FT                   /note="PFAM: Inositol
FT                   phosphatase/fructose-16-bisphosphatase; KEGG: xau:Xaut_3528
FT                   inositol phosphatase/fructose-16-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87757"
FT                   /db_xref="GOA:D7A339"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:D7A339"
FT                   /inference="protein motif:PFAM:PF00316"
FT                   /protein_id="ADH87757.1"
FT                   /translation="MIRPTLQDHLDRWSQADDSRRDVASAVLALAGAGIRISQLLAAGP
FT                   LAGALAAVRGHHADGDSQKELDVVADTLVREALAGTQVALFGSEEAEEAVALNPAGSLA
FT                   VAVDPLDGSSNIDTNMTVGTIFSILPYIGPASLLQPGSAQLAAGFLVYGPQTALALTVG
FT                   AGTQIFILDRASGDFLLAEERAMVLPETAEYAINGSNTRHWDLAIRCYVEDCQAGVDGP
FT                   RAKDFNTRWVASMVADVFRILVRGGVYLYPGDARRGYMQGRLRLVYEANPVAFLMEQAQ
FT                   GAATDGHRPILELEPTHLHQRVPLVFGSRAEVERIARYHHDAAAMPERSPLFGRRGLLR
FT                   A"
FT   gene            432896..433771
FT                   /locus_tag="Snov_0425"
FT   CDS_pept        432896..433771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0425"
FT                   /product="Phosphoribulokinase"
FT                   /EC_number="2.7.1.19"
FT                   /note="KEGG: acr:Acry_0822 phosphoribulokinase; PFAM:
FT                   phosphoribulokinase/uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87758"
FT                   /db_xref="GOA:D7A340"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A340"
FT                   /inference="protein motif:PRIAM:2.7.1.19"
FT                   /protein_id="ADH87758.1"
FT                   /translation="MSIHHPIISVTGSSGAGTTSVRRIFEQIFRREDVAAAYIEGDAYH
FT                   RYDRAEMKRVMAEEAGRGNHHYSHFGPDSNLFEELEETFRSYAQTGTGQFRHYVHDDKE
FT                   AEEYGGAPGTFTAWEPIPTPTDLLFYEGLHGAVVSGNIDVARYADLKIGVVPVINLEWI
FT                   QKIHRDRSHRGYSTEAVTDTILRRMPDYVNYICPQFTHTDINFQRVPTVDTSNPFIARW
FT                   IPTADESIVVIRFKSPRGIDFPYLLSMIQGSWMSRANSIVIPGGKLDIAMQLILTPMIL
FT                   HLVEKKRRAA"
FT   gene            433785..435809
FT                   /locus_tag="Snov_0426"
FT   CDS_pept        433785..435809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0426"
FT                   /product="transketolase"
FT                   /note="KEGG: rsp:RSP_3268 transketolase; TIGRFAM:
FT                   transketolase; PFAM: Transketolase domain protein;
FT                   Transketolase central region"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87759"
FT                   /db_xref="GOA:D7A341"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D7A341"
FT                   /inference="protein motif:TFAM:TIGR00232"
FT                   /protein_id="ADH87759.1"
FT                   /translation="MLTRNAPTSQRPPQDLPEVLHDDMANALRALAMDAVEQAKSGHPG
FT                   MPMGMADVATALFSRFVKIDPTRPDWYDRDRVVLSAGHGSMLLYAVNHLLGYADMGTDQ
FT                   LRRFRQLGAVTAGHPEHGHTLGVETTTGPLGQGLATAVGMALAERMLNARFGDDLVDHY
FT                   TYVIAGDGCLMEGISHEAIDLAGHLKLGKLILLWDDNGISIDGRTTLSTSTDQLARFEA
FT                   AGWDVMRVDGHAYHAVTDAIAEARGTERPTLIACRTTIGFGAPTKAGTEGAHGAPLGPD
FT                   EIAGARARLGWSHPPFEVPDDVREAWAHTAARGRTAREAWERRLSGSGRRAAFEAAMEG
FT                   ELPADFDEKLDAYKRELSQSAPKVATRKASEMALGVINAETELTVGGSADLTHSNLTYT
FT                   KGLMPVTPGNFAGRYLHYGIREHAMAAVMNGLALHRGTIPYGGTFLVFSDYARGAMRLS
FT                   ALMGQRVVYVLTHDSIGLGEDGPTHQPVEHLAMLRATPNLHVFRPADAVETLEAWQLAL
FT                   HAERTPSVLALSRQNLPTFRTTHSEENLTGYGAYVARKPERRRDVTLLATGSEVELAFK
FT                   AADMLALRGVDAAVVSMPCWELFEKQSADYRRAVLGTAPRVAVEAAARFGWDRWIGERG
FT                   RFVGMEGFGASAPAADLYRYFNITPEAVVAAACDLITCA"
FT   gene            435821..436906
FT                   /locus_tag="Snov_0427"
FT   CDS_pept        435821..436906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0427"
FT                   /product="fructose-bisphosphate aldolase, class II, Calvin
FT                   cycle subtype"
FT                   /EC_number="4.1.2.13"
FT                   /note="TIGRFAM: fructose-bisphosphate aldolase, class II,
FT                   Calvin cycle subtype; ketose-bisphosphate aldolase; KEGG:
FT                   nha:Nham_4048 fructose-1,6-bisphosphate aldolase; PFAM:
FT                   ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87760"
FT                   /db_xref="GOA:D7A342"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7A342"
FT                   /inference="protein motif:TFAM:TIGR01521"
FT                   /protein_id="ADH87760.1"
FT                   /translation="MARITLRQLLDHAAEHGYGVPAFNINNMEQGIAIMDAAQAVDAPV
FT                   IMQASRGARSYAGDIMLARMIDALTEMYPSIPICMHQDHGNNEATCLSAIQHGFTSVMM
FT                   DGSLKADAKTPADYDYNVTITRRVVDAAHWVGASVEGELGVLGSLEHGSGEQEDGHGAE
FT                   GALSHDQLLTDPDQAVDFVARTKVDALAIAMGTSHGAYKFTRKPDGDILAMHVIEEIHR
FT                   RLPSVHLVMHGSSSVPQALQDLFNASGGEMPQTWGVPVEEIVRGIRHGVRKVNIDTDCR
FT                   LAMTAQFRKVGQANRSEFDPRKFLKPAMDAMRDLCRERFEQFGTAGHAAQIKVLPLAAM
FT                   AKRYASGALDPVIGGAQAAAE"
FT   gene            436975..438444
FT                   /locus_tag="Snov_0428"
FT   CDS_pept        436975..438444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0428"
FT                   /product="Ribulose-bisphosphate carboxylase"
FT                   /EC_number="4.1.1.39"
FT                   /note="KEGG: bbt:BBta_6397 ribulose bisophosphate
FT                   carboxylase; PFAM: ribulose bisphosphate carboxylase large
FT                   chain; Ribulose bisphosphate carboxylase, large
FT                   subunit-like"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87761"
FT                   /db_xref="GOA:D7A343"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR020878"
FT                   /db_xref="InterPro:IPR020888"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/TrEMBL:D7A343"
FT                   /inference="protein motif:PRIAM:4.1.1.39"
FT                   /protein_id="ADH87761.1"
FT                   /translation="MNAIDKTASADKPRSRYSAGVMEYRKMGYWQPDYEPKDTDVIALF
FT                   RVTPQDGVDPIEASAAVAGESSTATWTVVWTDRLTACDKYRAKCYRVDPVPNSPGSWFA
FT                   YIAYDLDLFEPGSISNLSASIIGNVFGFKPLKALRLEDMRLPVAYVKTFDGPATGIVVE
FT                   RERLDKFGRPLLGATVKPKLGLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRER
FT                   FLYCMEAVNKAQASTGEIKGTYLNVTAGTMEDMYERADFAKSLGSNIVMIDLVIGYTAI
FT                   QSMAKWARRNDMILHLHRAGHSTYTRQKSHGVSFRVIAKWMRLAGVDHIHAGTVVGKLE
FT                   GDPHTTKGYYDICRDDFVPQNLAHGVFFDQDWASTRKLMPVASGGIHAGQMHQLIDLLG
FT                   EDVVLQFGGGTIGHPMGIQAGATANRVALECMILARNEGRDILAEGPDILNEAARHCMP
FT                   LKQALETWKDVTFNYSSTDTPDFVPQATAAE"
FT   gene            438600..439019
FT                   /locus_tag="Snov_0429"
FT   CDS_pept        438600..439019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0429"
FT                   /product="Ribulose-bisphosphate carboxylase"
FT                   /EC_number="4.1.1.39"
FT                   /note="KEGG: bbt:BBta_0452 ribulose 1,5-bisphosphate
FT                   carboxylase small subunit; PFAM: ribulose bisphosphate
FT                   carboxylase small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87762"
FT                   /db_xref="GOA:D7A344"
FT                   /db_xref="InterPro:IPR000894"
FT                   /db_xref="InterPro:IPR036385"
FT                   /db_xref="UniProtKB/TrEMBL:D7A344"
FT                   /inference="protein motif:PRIAM:4.1.1.39"
FT                   /protein_id="ADH87762.1"
FT                   /translation="MRITQGAFSFLPDLTDEQITKQVQYCIDKGWAVNIEFTDDPHPRN
FT                   TYWELWGQPMFDVRDAAGVMFELNACRKAYAGRHYIRVSAFDSTHTWESLRLSFITDRP
FT                   AEEPGFALERQEVDGRSIRYTTRAYAANRPEGARY"
FT   gene            439307..440251
FT                   /locus_tag="Snov_0430"
FT   CDS_pept        439307..440251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0430"
FT                   /product="CbbX protein"
FT                   /note="TIGRFAM: CbbX protein; PFAM: AAA ATPase central
FT                   domain protein; KEGG: rsp:RSP_1280 CbbX protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87763"
FT                   /db_xref="GOA:D7A345"
FT                   /db_xref="InterPro:IPR000470"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:D7A345"
FT                   /inference="protein motif:TFAM:TIGR02880"
FT                   /protein_id="ADH87763.1"
FT                   /translation="MDAVIDEPKAAGATKPTAIDLRAEFASSGLAEVLEQLDRELVGLG
FT                   PVKQRLREIGALLLVDRARARFDLQAVSPTLHMSFTGNPGTGKTTVALRMAEILHRLGY
FT                   VRKGHLVTVTRDDLVGQYIGHTAPKTKEVLKRAMGGVLFIDEAYYLYRPENERDYGQEA
FT                   IEILLQVMENQRDDLVVILAGYGDRMERFFMANPGFRSRVAHHIDFPDYSGEELEAIGG
FT                   RILETMNYRMSAGAQEAFQRYIDLRMQQPHFANGRSIRNALDRARLRQANRLFNSERPV
FT                   TAADLATIEAEDILASRVFSGGIDSYPPLRAAD"
FT   gene            440368..441048
FT                   /locus_tag="Snov_0431"
FT   CDS_pept        440368..441048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0431"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="TIGRFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   azc:AZC_1810 ribulose-phosphate 3-epimerase; PFAM:
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87764"
FT                   /db_xref="GOA:D7A346"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:D7A346"
FT                   /inference="protein motif:TFAM:TIGR01163"
FT                   /protein_id="ADH87764.1"
FT                   /translation="MALIAPSMLASDFARLGEEVRAVDAAGADWIHLDVMDGHFVPNIT
FT                   FGPDVIKAMRPHTDKVFDVHLMIAPVEPYIEAFAKAGADIITVQAEATDHLDRCLQLIR
FT                   SLGKKAGVALNPATHESVLAYVLEKTDLILAMTVNPGFGGQAFIPDVVPKLHRLRAMIG
FT                   GRPIHLEVDGGVTPETAPLCTEAGANVLVAGSAVFKGGADAYAANIAAIRGSCRPARGQ
FT                   SAAA"
FT   gene            complement(441210..442082)
FT                   /locus_tag="Snov_0432"
FT   CDS_pept        complement(441210..442082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0432"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kra:Krad_3279 2-oxoglutarate dehydrogenase E2
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87765"
FT                   /db_xref="GOA:D7A347"
FT                   /db_xref="UniProtKB/TrEMBL:D7A347"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87765.1"
FT                   /translation="MTDMTEPSPESPGPRPSDVPTGAKPSGPAAPASRSKGPPQDPEAF
FT                   QRWIGIERLKVDMRRLELETKRMEAPETMPPRRRSPVLPILYGVILVALVGLTAFLASQ
FT                   VLALRGEIGALRTAQTEIGQRLAAAESEQTGLREAVEAAQTKANAAASVQPAPQASSQT
FT                   PAAPSVAPADASSQAAAPAAPDPALPGSGYTVRIFAPVNAVAKAKIDGFVNPLKAAGYD
FT                   VVVSDTGVVQTTSNSLSYHASSEEMAKRLSTLIQQKKPALAMEMRASPSIPPSARQILI
FT                   LNLTEDAFK"
FT   gene            442419..443309
FT                   /locus_tag="Snov_0433"
FT   CDS_pept        442419..443309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0433"
FT                   /product="high-affinity nickel-transporter"
FT                   /note="PFAM: high-affinity nickel-transporter; KEGG:
FT                   pst:PSPTO_4280 nickel/cobalt efflux protein RcnA"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87766"
FT                   /db_xref="GOA:D7A348"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:D7A348"
FT                   /inference="protein motif:PFAM:PF03824"
FT                   /protein_id="ADH87766.1"
FT                   /translation="MPAFAELLQQGAAHAWLFIPSAILLGALHGLEPGHSKTMMAAFII
FT                   AVRGSVPQAVLLGLAATVSHTLVVWTIALGGVYLWQGVAPETFEPYLQLASAAVILAMA
FT                   AWMIWRTRQDRIAEAAHDHHHHDRSHHAHGDKSHHDRSHHDHCHDGNDDHVFELATEGY
FT                   QDAHELAHADDIRRRFAGRQVSTWQIVLFGLTGGLIPCPAAITVLLLCLQLRELALGFT
FT                   LVLSFSVGLALTLVAVGVVAALSVQHATKRIAWFGELARRAPYVSGALLVAVALYVGWH
FT                   GWTGLAHLPAAAVSG"
FT   gene            complement(443324..444001)
FT                   /locus_tag="Snov_0434"
FT   CDS_pept        complement(443324..444001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0434"
FT                   /product="SNARE associated Golgi protein-like protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   oan:Oant_1851 SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87767"
FT                   /db_xref="GOA:D7A349"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D7A349"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADH87767.1"
FT                   /translation="MEAIAADLAAFMRGHEYLVPVVIGLIAFAESLVLVGLVVPATALM
FT                   LAIGGLIGSGILSPVPVISGAIVGAALGDIVSYWLGRWVGPRVVHRWPLQGYRHQVAQA
FT                   RLFFRRFGFASVFVGRFFGPVRATMPLVAGMMRMDQRRFQFANVSSAIVWAPVMLAPGW
FT                   IAGKGANQLGAASSGEWLVLMVGITLVMLIATAVILRVVQGRIAKRPRNRRAARTSARA
FT                   SAG"
FT   gene            444133..444402
FT                   /locus_tag="Snov_0435"
FT   CDS_pept        444133..444402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0435"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   met:M446_3505 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87768"
FT                   /db_xref="GOA:D7A350"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A350"
FT                   /inference="protein motif:PFAM:PF02583"
FT                   /protein_id="ADH87768.1"
FT                   /translation="MSHTVTNKARLIARVRRLKGQMEAIERALESEVACADILNQVASV
FT                   RGAINGLTAELIEDHLREHVVSAEGEAREEAAAELIDVIRTYMR"
FT   gene            444523..446907
FT                   /locus_tag="Snov_0436"
FT   CDS_pept        444523..446907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0436"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   azc:AZC_2392 mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87769"
FT                   /db_xref="GOA:D7A351"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D7A351"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADH87769.1"
FT                   /translation="MLANGPRTTECFMPLRAIPGILLLALCVTFAAPLKAQTLASPPAQ
FT                   PAQTTPESTRPEGTRQDLRALLDTLEDDAARTAFLARLRALVESGTVAPEPAAPERDDW
FT                   LAGATRSLGSFSNSVLGLVGEIEQLPEQAERFFEDLSDPLVLQRVGWAAIMVITVLAAA
FT                   LLAEYVAKLLLSRLRRAVEARHARGLPMRALLLGIRTVLDILPIAAFAAASFGVLALVE
FT                   LNFVIRLAVVTVINANVLARLILAAGRAVLTPDAPHLRLFPLENESAAYGYLWVRRFAY
FT                   TVVYGYFLLRAAWVLGLALPTYHFLSHALGLFVAGMCIVFILQIRAGVAARLRRIGARE
FT                   GRAARLRDTVADFWHVLLIAYVVAAYIVRVFDVAGGFAFLTQATLLSLLTVALAALAIS
FT                   LLLRAFDKVFRLNGEMRERYPLLEARANRYLPALRSGMQGLVLAVATLVLLEIWGARPF
FT                   EWLASDHGQGAVGRLISIGVVVLAGLIAWELATVFSERLRAGNPSSTRLKTLLPFLQNA
FT                   FRVVLLTLGGLILLSEIGVNIAPLLAGAGVLGLAIGFGAQTLVKDVITGIFILMEDTIS
FT                   VGDVVEVGAHSGLVEKISIRTVHMRDFDGNVHSIPFGEVQTIKNMSKDFAYAVIDVRVS
FT                   YRENIDEALALMSEVAADMAAKGPLAETIVAPFEVVGVEALEESYIWLRGRFKTRPLGQ
FT                   WNVKREFYRRIKAAFDARGIEIPYPHRTVYLGTDKKGEAPPLRLVSQRPEDLSAPQRAR
FT                   RAEAARAARTPGPLIEEHPGARERSEEDEEPMLPTIEERRH"
FT   gene            447142..448122
FT                   /locus_tag="Snov_0437"
FT   CDS_pept        447142..448122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0437"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   msl:Msil_0234 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87770"
FT                   /db_xref="GOA:D7A352"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D7A352"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ADH87770.1"
FT                   /translation="MLSRLLRHPVTLIVGVVVALFVIYEISVRFFAYTADAYVMSDIVV
FT                   ISSQIEGPVSKLAVQNNQTVAANQLLFEIERTPFALKVQEAQASLAQAQANLGLAQDEV
FT                   NAAKANIASAQAIQANAQEQLNRIKTLSGEGFSPEAQLDVATRDVATAGANVSSTQAQL
FT                   AVATQRVTVANAAIGSTQAELARAEYDLSKTVVAAPEAGRITPFTTRLGDYLRPGTEVL
FT                   AIITDRRRRVVANMNERHLERIRIGQRVLLTLGNDPWQLHLGRVSGIAAGVARSPHNPE
FT                   IVPYVEPTTDWVRLPRRFPIEIELDDWPAGVGLFNGADARVLIWF"
FT   gene            448240..449238
FT                   /locus_tag="Snov_0438"
FT   CDS_pept        448240..449238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msl:Msil_0235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87771"
FT                   /db_xref="GOA:D7A353"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:D7A353"
FT                   /inference="similar to AA sequence:KEGG:Msil_0235"
FT                   /protein_id="ADH87771.1"
FT                   /translation="MDDVTRHAFATATGVLAAVYISLAMGWQDPYWAALSVMIIANVDR
FT                   DALFTKGVLRITGTFIGVIGGYYVGQWAEGLNALQAALVMIAAAVGTYGRQRSAYGYAW
FT                   FYGGLTFALVMLYTMTQPEQLYDFAWYRCYEIVTGVVCGTLASWALGPRAGELHARLVA
FT                   QAAATSQVNAERQSMVAAVGALIIIVTWSLFDLPQLPQVLISSLIIIDNDPVASRHRGA
FT                   QRIFGCIIGGTAGLVVIGLDATDMWWWVTMLFLGVFTFARIHLGGTTQAYIGTQSAIAY
FT                   LVTLVGTGPPTTLEPPIDRLVGIVIGVSIMTTLVWAFNSVKPAEKVADGPA"
FT   gene            complement(449239..449574)
FT                   /locus_tag="Snov_0439"
FT   CDS_pept        complement(449239..449574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0439"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gbe:GbCGDNIH1_0258 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87772"
FT                   /db_xref="UniProtKB/TrEMBL:D7A354"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87772.1"
FT                   /translation="MKHIKTDWTDVVLVCRKCAKKLGGSFGPDGEQSLPKALRKEIARR
FT                   EGGKPMKKPRRKGARVAVVEIDCLDICPKGAAVVVPASAPSRWRSVPRGTDVATLLDEI
FT                   APARDQD"
FT   gene            complement(449715..452894)
FT                   /locus_tag="Snov_0440"
FT   CDS_pept        complement(449715..452894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0440"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="KEGG: mrd:Mrad2831_3044 hydrophobe/amphiphile
FT                   efflux-1 (HAE1) family protein; TIGRFAM: transporter,
FT                   hydrophobe/amphiphile efflux-1 (HAE1) family; PFAM:
FT                   acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87773"
FT                   /db_xref="GOA:D7A355"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D7A355"
FT                   /inference="protein motif:TFAM:TIGR00915"
FT                   /protein_id="ADH87773.1"
FT                   /translation="MNLSKFFIDRPIFAGVLSVVIFLAGLLALRVMPISEYPEVVPPQV
FT                   IVRATYPGANPKVIAATVATPIEEQINGVEDMLYMSSQATTDGVMTLTVTFKLGTDPDK
FT                   ATQLVQNRVAQAEPRLPEEVRALGITTAKSSPNFIMVVHLLSPNDRYDITYLRNYAVLN
FT                   VKDRLARISGVGQIDIFGAGDYSMRVWLDPQKIAEHGLSAGDVANEIRAQNVQAAAGIV
FT                   GASPAAEGVDLQLSVNAQGRLETEEEFGDIVVKTGTDGQVVRLRDVARIELGAADYALR
FT                   SLLDNKQAVGIGVFQAPGSNALEIAENVRKTMEEVKKTMPEGVDYAIVYDTTRFVDASI
FT                   EAVVHTLFEAVLLVVIVVVVFLQTWRASIIPLLAVPVSIVGTFAVMYIFGFSINALSLF
FT                   GLVLAIGIVVDDAIVVVENVERNIENGLTPRAAAYQAMTEVSGPIIAIALVLVAVFVPL
FT                   AFISGLSGQFYRQFALTIAISTVISAINSLTLSPALAALLLRGHDAPPDMLQRVINALF
FT                   GWFFRGFNFVFSRGSRGYGSGVRGTLKVKSLVMIFYALMLGATWWLFQAVPSGFVPAQD
FT                   KQYLVGFAQLPDGATLDRTEEVIRKMTEITLAEPGVASAVAFPGLSIAGFSNSSNAGIV
FT                   FSVLKPFEERTDPSLSAGAIAASLNQKYGVIKDAFIAMFPPPPVQGLGVVGGFKLQLED
FT                   RAGQGYEALSEVTNAFMAKAMAAPELTGQFTTYQINVPQIFAAIDRTKARQLGVPVQSV
FT                   FETLQVYLGSLYVNDFNKFGRTYSVRVQADAPFRSRPEDIGKLKVRSISGEMIPLSALL
FT                   KVEQTAGPERAQRYNGFLTADFNASPAPGFSSGQAQDAAKRIAEEVLPPGFDYEWTDLT
FT                   YQEILAGNSATLVFPIAILLVFLVLAAQYESLTLPIAIILIVPMGLLAALFGVWLGGGD
FT                   NNIFTQIGLVVLVGLSAKNAILIVEFARELEFVGRNPVDAAIEAARLRLRPILMTSFAF
FT                   IMGVLPLVLSTGAGAEMRHAMGVAVFAGMIGVTFFGLFLTPVFYVLLRRITGNRPLRQH
FT                   GEVLPAAHPAE"
FT   gene            complement(452938..454239)
FT                   /locus_tag="Snov_0441"
FT   CDS_pept        complement(452938..454239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0441"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: xau:Xaut_0320 RND family efflux transporter
FT                   MFP subunit; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87774"
FT                   /db_xref="GOA:D7A356"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D7A356"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADH87774.1"
FT                   /translation="MSNDNLGNDAGSSQIVHVEIARDVASQHKRHRWREAGVVLTLAAL
FT                   ATGAAVFLAWPSSNALATDPAPAAAAPPAMPVAVAVLEPRDTMKWDEFSGRLQAVERVE
FT                   VRPRVAGAVKTIHFREGALVKQGELLVTIDPEPFQAELDRAEAQSAAAEARLLFTKNEL
FT                   DRGQKLVDSRVVSVQDLDQRTNNYKEAQANLRAAQADVQTAKLDLGYTEVRAPVDGRVG
FT                   RIDVTVGNLVSAGPTSPVLTTLVSVDPIYVGFAADEGAVSEALATLGNGDVLGEIDRIP
FT                   VEITTATTGEKPARGHLQLVDNQVDTATGTFRLRAVFDNPDGRLVPGQFARVRMGRAKT
FT                   EPALVINERAIGTDQDKKYVFVVDPENKAVYREVKLGPPSEGLRVVASGLKEGERIVVN
FT                   GLQRVRPGALLAPEIVPMNTTASAANPNTSVAAR"
FT   gene            complement(454256..455092)
FT                   /locus_tag="Snov_0442"
FT   CDS_pept        complement(454256..455092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0442"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: xau:Xaut_0321 alpha/beta hydrolase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87775"
FT                   /db_xref="GOA:D7A357"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7A357"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ADH87775.1"
FT                   /translation="MTALWTEDRLEMDGTALPVRVYRAAASMRPTPLVLHLHGGCFTDG
FT                   DLECSVKVCQLMAEAGAVVVSADYPLAPEHPFPAALNVSFAALGLLHAQRAKWAGRGSR
FT                   LFVAGEEAGANLAAALAMMARDQGAPAVAGQILLSPMIDPSLCTGSIHAAEAGAAGCKW
FT                   ADGWHRYLGSADKAAHPYAAPFGSRRLAGVAPALIITCSDCPMRDESLAYARRLAESGI
FT                   AVETSVLETPADSPDEIDASMDASIDASPQWEAPLRDLFQNFLAEHSASPVRTIRA"
FT   gene            455247..456176
FT                   /locus_tag="Snov_0443"
FT   CDS_pept        455247..456176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0443"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: mpt:Mpe_A0871 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87776"
FT                   /db_xref="GOA:D7A358"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A358"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH87776.1"
FT                   /translation="MDQIAAMRAFVRVVEAGNFSRAADLLEMPKPTITKLIQQLESHLR
FT                   TKLLNRTTRRVGVTPDGAAYYERALALLSDLDELDGSMTKAQTTPSGRLRVDVGSSLAL
FT                   NVLIPALPDFHARYPDIQLDLGVSDRPADLVGENIDCAIRGGELLDPSLIARRIGQVEL
FT                   VMCATPGYIQRHGMPQHPRDLRDGHRVIAYFSPRTGRRFAFDMIRGEETYELDLPYAVA
FT                   VNDSTAYLAACLTGLGIAHAVEPMIQPYLAAGTLVPVLPEWRGEPIVLHVVYAPNRHLS
FT                   SRLRVFVDWVAELFASGNVYRRRPEALF"
FT   gene            complement(456180..456908)
FT                   /locus_tag="Snov_0444"
FT   CDS_pept        complement(456180..456908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0444"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ara:Arad_2946 amino acid ABC transporter;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87777"
FT                   /db_xref="GOA:D7A359"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D7A359"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87777.1"
FT                   /translation="MSLIEITEVKKRFGDNEVLKGINIDVAPGEVIAIIGKSGSGKSTL
FT                   LRCINGLETIDEGSISVAGAQLLPDELHLKALRLKVGMIFQSFNLFPHLTAGRNVMLSQ
FT                   MVVKKTAKAEAEAMARRQLERVGLGHKFDAYPDQLSGGQQQRIAIARALAMQPIALLCD
FT                   EITSALDPELVSEVLAVVKELAGEGMTLMMVTHEMRFARDVCSRVVFMHQGRVHEIGPP
FT                   EEVFAAPKTPELKQFLGVLH"
FT   gene            complement(456886..457545)
FT                   /locus_tag="Snov_0445"
FT   CDS_pept        complement(456886..457545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0445"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: ret:RHE_PF00160 amino acid ABC transporter
FT                   permease; TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87778"
FT                   /db_xref="GOA:D7A360"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A360"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADH87778.1"
FT                   /translation="MSDFTTWDIVRNLLLAARWTVLLSLVSFIGGSIVGALLLFIRTAK
FT                   GRLGPAFVKAYVEVFQGTPLLMQLFLAFFGLGLFGIDVPAWLAAGLALILWSAAFLTEI
FT                   WRGCVESVARGQWEASSSLGMGYVQQMRHVILPQALRVAIPPTVGFSVQVVKGTALTSI
FT                   IGFVELSKAGTVVTNATFEPFKVYGLVALIYFCLCWPLSKSSQILERKLNVAHRNH"
FT   gene            complement(457542..458216)
FT                   /locus_tag="Snov_0446"
FT   CDS_pept        complement(457542..458216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0446"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: rhi:NGR_b21550 probable amino acid ABC
FT                   transporter, permease protein; TIGRFAM: polar amino acid
FT                   ABC transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87779"
FT                   /db_xref="GOA:D7A361"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A361"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADH87779.1"
FT                   /translation="MNYAFDYGWLFEYWPVLAKGLAVTVELTLVGGVLGVALGVACAWA
FT                   RALGPSWLRPFVAAYVELIRNTPFLIQLFFIFFGLPALGLRMGELEAANLAMVVNLGAY
FT                   GCEIIRAGIQATPKGQFEAGASLGMSRIQTFWHVVLVPALQRIWPALSSQIVIVMLGSA
FT                   AVSQIATEDLTFAANFIQSRTFRAFEAYFVSTLIYLALAIALRQLLRGVGWTIFPRRGA
FT                   AR"
FT   gene            complement(458406..459209)
FT                   /locus_tag="Snov_0447"
FT   CDS_pept        complement(458406..459209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0447"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: avi:Avi_1513 ABC transporter substrate binding
FT                   protein (amino acid); PFAM: extracellular solute-binding
FT                   protein family 3; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87780"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D7A362"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADH87780.1"
FT                   /translation="MNPIFVHRRTLLALAAGALIASTQAPLPAHADALATIEANKVIRI
FT                   AVPQDFPPFGTVGADMQPKGYDVDMAKLIADKMGVKLELVPVTSANRIPYLQTNKVDLV
FT                   ISSLGKNPDREKVIDFSAAYAPFFNGVFGPAEVAAKDAKDLSGKTVGVTRGAVEDLELT
FT                   KIAPADVTIKRYEDNNGTISAFLSGQVDLIATGNVVAAAILERNPPKKPEIKFLIKNSP
FT                   CFIGLNKNEPALLAKVNDIIAAARKDGALEAISQKWLGAKLPAEL"
FT   sig_peptide     complement(459114..459209)
FT                   /locus_tag="Snov_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 32"
FT   gene            complement(459214..459957)
FT                   /locus_tag="Snov_0448"
FT   CDS_pept        complement(459214..459957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0448"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: rhi:NGR_b21570 probable transcriptional
FT                   regulator protein, GntR family; PFAM: GntR domain protein;
FT                   regulatory protein GntR HTH; SMART: regulatory protein GntR
FT                   HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87781"
FT                   /db_xref="GOA:D7A363"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A363"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADH87781.1"
FT                   /translation="MNPATANIEEAILSAILAGRIAPGTRLGEQKLADLFGVSRTRVRE
FT                   AMMRLETRGVVQVSARRGWYVVEPSAEEAREAFQTRRVIETGLLQTVREVPPQVLASLK
FT                   EHVAMERQVIEAGDVSSRACLLGDFHIHLADALGNRLLTEIIRDLTARTTLISMLYQPT
FT                   EKAEESSHDHEDIVAAMEAGDLALAARLMDEHIGKVEAGLDLTARPDPLASLRELLTPS
FT                   AFAGNAPSVPHAHSHSHPPSLRKED"
FT   gene            complement(460216..462384)
FT                   /locus_tag="Snov_0449"
FT   CDS_pept        complement(460216..462384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0449"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   KEGG: azc:AZC_1772 methylmalonyl-CoA mutase; PFAM:
FT                   methylmalonyl-CoA mutase; cobalamin B12-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87782"
FT                   /db_xref="GOA:D7A364"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D7A364"
FT                   /inference="protein motif:TFAM:TIGR00641"
FT                   /protein_id="ADH87782.1"
FT                   /translation="MTATARRIPDFSAIDWKAPALALPPEGAGAWETPERIAVKPLYGP
FT                   DDVAGLAFVDSYPGIAPFLRGPYPTMYATQPWTIRQYAGFSTAEDSNAFYRRNLAAGQK
FT                   GLSVAFDLATHRGYDSDHPRVAGDVGMAGVAIDSILDMRTLFSGIPLDRMSVSMTMNGA
FT                   VLPILALYVVAAEEQGVKPAQLSGTIQNDILKEFMVRNTYIYPPGPSMRIIADIFAFTA
FT                   KEMPRFNSISISGYHMQEAGATQDLELAYTLADGVDYVRAGIAAGMPVDAFAPRLSFFW
FT                   AIGMNFFMEVAKLRAARLIWAKLMKDLGASNPKSLPLRTHCQTSGWSLTAQDVFNNVMR
FT                   TMVEAMAATQGHTQSLHTNALDEALALPTDFSARIARNTQLLIQQESGTTRAIDPWGGS
FT                   FYVERLTADLAQKALGHIAEVEALGGMAKAIEAGIPKLRIEEAAAITQARIDSGAQTVV
FT                   GVNKYRPTREMLIDVLKVDNSAVRAAQLDKLRRLKAERDPQAVEAALAALENGARGNAN
FT                   LLALAIDAARAKATVGEISDALERVFGRHRAEIRAVTGVYRREAGAMGDRVARMRQRIE
FT                   AFEHEEGRRPRILVAKVGQDGHDRGQKVIASAFADLGFDVDIGPLFATPQEAARQAVEN
FT                   DVHVIGISSLAAGHLTLVPQVKAALAAEGRPDIMVVVGGVVPPQDYEAVRAAGAEAIYP
FT                   PGTVIAEAAEELVDKLAARLGHKKQAAE"
FT   gene            complement(462381..464237)
FT                   /locus_tag="Snov_0450"
FT   CDS_pept        complement(462381..464237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0450"
FT                   /product="Methylmalonyl-CoA mutase"
FT                   /EC_number="5.4.99.2"
FT                   /note="KEGG: azc:AZC_1773 putative methylmalonyl-CoA
FT                   mutase; PFAM: methylmalonyl-CoA mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87783"
FT                   /db_xref="GOA:D7A365"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D7A365"
FT                   /inference="protein motif:PRIAM:5.4.99.2"
FT                   /protein_id="ADH87783.1"
FT                   /translation="MDLDLASFPPATRADWLKLVEGVLKGAPYDKRMLTRTADGYTLDA
FT                   LPERRREAAAIVGRRAGASWKVIARIDHDDPAAANAQLLEDLDGGADGFSLVFASAPSA
FT                   GGFGLPVRHEELVQALKGVMPELITLRVEAGQYQGRDIALALARLFEAQDPARLDIRFG
FT                   LDPIGDFAALGAAPIEWDALSARLGQTVATLRARGLVSPMVRADGRLHHATGATDAQEL
FT                   AAVLATAIAYLRALEAAGLSLEDAAGAIEVTLTADVDQFGTQAKPRAFRQLWAAALSAC
FT                   GIEAKPVAIHMETAWRSLTRRDPHVNLLRGTIAAFAAGVGGADSVNVLPYTQALGLPDA
FT                   DARRLARNTQIILIEESHLHRVADPSAGAGAMEERTEKLAAAAWELFRQIEREGGMVES
FT                   LTSGAWQRRVAEARAARTKDVATRRLPITGTSEFPLLGEAVPTVLAPARRVAAAPPSEG
FT                   ALLCEPLTAQRLAEPFEHLRDAAEAAGARVFLADLGTAADFTPRAAFARSAFEAGGIAA
FT                   PANDGFADTAALAAAFRESGARLVCLCSSDEVYATSAAEAAKALRQAGAAAIYLAGRPG
FT                   EHEADWRAAGIDAYLYAGGDLLALLEEAHRRLGIPATREGSE"
FT   gene            complement(464248..466275)
FT                   /locus_tag="Snov_0451"
FT   CDS_pept        complement(464248..466275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0451"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding
FT                   protein"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein;
FT                   biotin/lipoyl attachment domain-containing protein; KEGG:
FT                   xau:Xaut_4726 carbamoyl-phosphate synthase L chain
FT                   ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87784"
FT                   /db_xref="GOA:D7A366"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR041265"
FT                   /db_xref="UniProtKB/TrEMBL:D7A366"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ADH87784.1"
FT                   /translation="MFKKILIANRGEIACRVIKTARRMGIATVAVYSDADKDALHVEMA
FT                   DEAVHIGAAPAAQSYLLIDRIIAAAKQTGAEAVHPGYGFLSERAAFPEALAAEGIVFIG
FT                   PNPRAIEAMGDKIESKKAAAAAKVSTVPGYLGVIEDAEHAMRIADEIGYPVMIKASAGG
FT                   GGKGMRIANSRAEVQDGFDRARSEAKSSFGDDRVFVEKFIVQPRHIEIQVLGDKHGNVI
FT                   HLGERECSIQRRNQKVVEEAPSPLLDEATRKRMGEQAVALAKAVNYDSAGTVEFVAGQD
FT                   KSFYFLEMNTRLQVEHPVTELVTGIDLVEQMIRVAAGEKLSITQADVKLKGWAVESRVY
FT                   AEDPYRGFLPSIGRLTRYRPPAEGVKDAVTTRNDTGVYEGGEISLFYDPMIAKLITHAP
FT                   TREEAIEAQADALDAFAIDGIQHNIPFLSALMAHPRWRAGTLSTGFIADEYPDGFHPTA
FT                   PSPALARRLAAVAAVIDNVGNAHKRKISGQLAGRPVIFEHQRVVSLGGGQGGLALHCEV
FT                   DRAAGGFIVTFLDEDGRAAGTHELRSGWQPGELVWNGVFDDEAIAVQVRPRLNGVSLAH
FT                   RGVAVDALVYTRREAELAALMPTKVQSGAGKQLLCPMPGLVVSIPVSEGQEVKAGEALA
FT                   VVEAMKMENVLRAERDATVGKILAKAGDSLAVDAVILEFA"
FT   gene            complement(466285..467817)
FT                   /locus_tag="Snov_0452"
FT   CDS_pept        complement(466285..467817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0452"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: azc:AZC_1775
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87785"
FT                   /db_xref="GOA:D7A367"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D7A367"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="ADH87785.1"
FT                   /translation="MKHILDELEQRRAGARLGGGEKRIEAQHRRGKLTARERIELLLDT
FT                   GSFEEFDSFVQHRCTDFGMEKSKIPGDGVVTGWGTVNGRQVFVFAKDFTVFGGSLSEAH
FT                   AAKITKIQDLALKTRAPIIGLFDAGGARIQEGVAALGGYGEVFKRNVLASGVIPQISVI
FT                   MGPCAGGDVYSPAMTDFIFMVRDTSYMFVTGPDVVKTVTNETVTSDELGGAKVHTTRSS
FT                   VADGAYDNDVECLLQMRRLIDFLPENNLSGVPSWPSFDDGERIDASLDTLVPDNPNKPY
FT                   DMKELIGKVVDEGDFFEIQEAFARNIVTGFGRVEGRTVGIVANQPMVLAGVLDADASRK
FT                   AARFVRFCDAFEIPILTFVDVPGFLPGTAQEYGGLIKHGAKLLFAYSQATVPLVTLITR
FT                   KAFGGAYDVMASKHIGGDVNYAWPTAQIAVMGAKGAVEIIFRADIDDPEKIAARTKEYE
FT                   QRFLSPFVAAERGYIDEVITPRSTRKRIARALAMLASKRIEAPMKKHDNLPL"
FT   gene            467960..469402
FT                   /locus_tag="Snov_0453"
FT   CDS_pept        467960..469402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0453"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: xau:Xaut_4724 hypothetical protein; PFAM:
FT                   Protein of unknown function DUF2083,transcriptional
FT                   regulator; helix-turn-helix domain protein; protein of
FT                   unknown function DUF955; SMART: helix-turn-helix domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87786"
FT                   /db_xref="GOA:D7A368"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="InterPro:IPR026281"
FT                   /db_xref="UniProtKB/TrEMBL:D7A368"
FT                   /inference="protein motif:PFAM:PF09856"
FT                   /protein_id="ADH87786.1"
FT                   /translation="MAGMSKKVFAGHAVRNVRERLGLTQIDFARRLSLSPSYINQIESN
FT                   QRPVTAAVLLAISRTFDLDITRFGADDLDRIVADLREALADPVFRGLEPSLQDLKNATT
FT                   HAPAFAHAFLRLHGALRRLDERRAALDDAVVSVAREVDGEARNPAPYEEVRDHFHYIDN
FT                   YVDGLDRAAEERNAALDLFAREDAVAVLAQHLRQRHDIVVDMAPADALDAPLVAYDRHR
FT                   RVATLSRTLDRASQAFRLAALIARFEQSDLIDQHVIDAGFRSATAREVCRLSLQNYYAG
FT                   ALMLPYRRFARLARERRHDLDILAAITGASLEQVCHRLSTLQRPGEKGVPFYFLKVDRA
FT                   GNVIKRHSATRFQFARYGGACPVWNVHEAFEQPSRTLVQVGEMPDGVRYLCLARGTSKP
FT                   ATRYGARERRFALGIGCEISYAGELVYADGLDLKSAAVAPLGVNCRICPRASCPERAFP
FT                   PLDREIVLDPDRRDVVPFSVRD"
FT   gene            complement(469420..470055)
FT                   /locus_tag="Snov_0454"
FT   CDS_pept        complement(469420..470055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: acr:Acry_2758 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87787"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A369"
FT                   /inference="similar to AA sequence:KEGG:Acry_2758"
FT                   /protein_id="ADH87787.1"
FT                   /translation="MRARGQPLRHHVLITGTGRAGTSFLVQLLTNLGLNTGYATDNFIL
FT                   DPIARAGLEFDARDANAPYIVKSPWICDYIEELLEDVSVRIDHVIIPVRNFEAAAASRA
FT                   YVQKINTGVEDGSRPVPGGLWHTEKASDQIGVLQQRFTRLVEQLVRFDVETTFIWYPRL
FT                   TQDAAYLRSKLAKALPMPDQKTFEEVFTRTIRPEWVHQFGATDRTMAV"
FT   gene            complement(470100..471401)
FT                   /locus_tag="Snov_0455"
FT   CDS_pept        complement(470100..471401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0455"
FT                   /product="glutamine synthetase, type III"
FT                   /note="KEGG: azc:AZC_1499 glutamine synthetase III;
FT                   TIGRFAM: glutamine synthetase, type III; PFAM: glutamine
FT                   synthetase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87788"
FT                   /db_xref="GOA:D7A370"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017536"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D7A370"
FT                   /inference="protein motif:TFAM:TIGR03105"
FT                   /protein_id="ADH87788.1"
FT                   /translation="MANDLAHAAKELGIKYFLISYVDLFGGLRAKLVPAAAIGGMQKAG
FT                   AGFAGFATWLDMTPADADLFAVPDPDSLIQLPWKPEVAWLASDLVMNDELVAQAPRNLL
FT                   KTTMLGADSIGYQMKTGVECEFFLTTPDGSKISDGADNATKPCYDQSALMRRYDVIKEI
FT                   CDSMLTLGWGPYQNDHEDANGQFEMNWNFGDALITADRHVFFKFMARSIAEKHGLRATF
FT                   MPKPFIDLTGSGCHMHTSLWSGDANVFEDEAGELGLSDIGYNFIGGLIHSADALCAITN
FT                   PTVNSYKRINAPRTVSGATWAPNTITYTGNNRTHMIRIPDAGRLELRLPDGAANPYLMP
FT                   AAVLAAGLDGVQNQRDPGKRLDINMYTDGHKVRGAKKLPLNLLDALRALEKSSVLRNAL
FT                   GAPFIDGYIKLKTEEWNAYSRHLTQWERDNTLDI"
FT   gene            complement(471499..472836)
FT                   /locus_tag="Snov_0456"
FT   CDS_pept        complement(471499..472836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0456"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase; KEGG:
FT                   msl:Msil_2634 ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87789"
FT                   /db_xref="GOA:D7A371"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A371"
FT                   /inference="protein motif:PFAM:PF01645"
FT                   /protein_id="ADH87789.1"
FT                   /translation="MSDHSNIPRTKPRASATFDDYTLSEIRRAAATGIYDIRGAGAKRK
FT                   VPHFDDLLFLGASMSRYPLEGYREKCSTEVVLGTRFAKKPIELKIPITIAGMSFGSLSA
FT                   NAKEALGRGASAMGTSTTTGDGGMTNEERGHSIQLVYQYLPSRYGMNPDDLKRADAIEV
FT                   VVGQGAKPGGGGMLLGQKITERVAAMRTLPVGIDQRSACRHPDWTGPDDLEIKIEELRE
FT                   ITDWEKPIYVKVGAARPYYDTALAVKSGADVVVVDGMQGGTAATQEIFIEHVGIPTLAA
FT                   VRQAVKALQDLGMHRKVQLIVSGGIRNGADVAKALALGADAVAIGTAALVALGDNDPHY
FT                   QAEYEALGTTAGAYDDWHEGRDPAGITTQDPALMARLDPVAAGRRLANYLAVLTLECQT
FT                   IARACGKSHVHNLEPEDLVALTIEAAAMAQVPLAGTDWVPGRNGSF"
FT   gene            complement(472844..473554)
FT                   /locus_tag="Snov_0457"
FT   CDS_pept        complement(472844..473554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0457"
FT                   /product="glutamate synthase alpha subunit domain protein"
FT                   /note="PFAM: glutamate synthase alpha subunit domain
FT                   protein; KEGG: azc:AZC_1501 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87790"
FT                   /db_xref="GOA:D7A372"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR012061"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D7A372"
FT                   /inference="protein motif:PFAM:PF01493"
FT                   /protein_id="ADH87790.1"
FT                   /translation="MTAPTADATFFDLAAAPLRELNSALHKLSADTNETYWKVANPAGR
FT                   HAVAAGLDVPVTVEIDGPVGYYCGGMNKQARIIVNGNAGVGVAENMMSGLVHVKGDASQ
FT                   AAGATAHGGLLIIDGNASARCGISMKGIDIVVKGSVGHMSAFMAQAGTLTVLGDAGDAL
FT                   GDSLYEAKLFVRGSVAGLGADCIEKEMREEHKALLAAKLEAAGILGEVDIGEFRRYGSA
FT                   RTLYHFHVDNVSSY"
FT   gene            complement(473575..474456)
FT                   /locus_tag="Snov_0458"
FT   CDS_pept        complement(473575..474456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0458"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   azc:AZC_1502 amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87791"
FT                   /db_xref="GOA:D7A373"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D7A373"
FT                   /inference="protein motif:PFAM:PF00310"
FT                   /protein_id="ADH87791.1"
FT                   /translation="MCGIVGLFLKDKKLEPELGAMVAQMLDVMCDRGPDSAGFAVYGAG
FT                   MPGFVKLTLRGPAGTDFSALGAAIGHLVTPRDTHAVLSVPVAEEATVRAALARIAPDVR
FT                   VVGAGARMELYKEVGLPADVAKRFKLETMSGTHAIGHTRMATESAVTTDGAHPFSTGPD
FT                   QCLVHNGSLSNHAGVRRLLAREGLPVTTENDSEVAAAYLTYRMRGGDSLGEALEHSLDD
FT                   LDGFYTFVVGTESGFGVLRDPIACKPAVMAETDGYVAFGSEYRALAGLPGIESARVFEP
FT                   EPAKVYFWDRAA"
FT   gene            complement(474681..475370)
FT                   /locus_tag="Snov_0459"
FT   CDS_pept        complement(474681..475370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0459"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: azc:AZC_1503 transcriptional regulator; PFAM:
FT                   helix-turn-helix domain protein; Cupin 2 conserved barrel
FT                   domain protein; SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87792"
FT                   /db_xref="GOA:D7A374"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7A374"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADH87792.1"
FT                   /translation="MVRSKREPDLTDTSRRPAAKAETTNEDLSTGSGAPLVNERTLEQA
FT                   LGQQVRAVRRELELTVSDLASAAGISVGMLSKIENGLISPSLATLQAISSALNVPISTL
FT                   FTTFEEKRDCSYVPAGQGVRIERRGTKVGHQYELLGHALGGDVVVEPYLITLSEEAVSY
FT                   TGFRHAGVEFIHMLSGEVIYRHGDRTYHLRPGDSLLFDSAANHGPEELLVRPMTYLSII
FT                   IYPRQPG"
FT   gene            475511..476905
FT                   /locus_tag="Snov_0460"
FT   CDS_pept        475511..476905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0460"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: msl:Msil_3303
FT                   soluble pyridine nucleotide transhydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87793"
FT                   /db_xref="GOA:D7A375"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A375"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADH87793.1"
FT                   /translation="MYDYDMIVIGSGPSGRRAAVQSAKIGKSVLVIEKGRRVGGVSVHT
FT                   GTIPSKTLRETVLNLSGWRERGFYGRAYRVKQDIGAGDLMARLHKTLDHEVEVLEHQFA
FT                   RNGVKNARGEARFLDPHTIEITGETGEIETVTGEHVLIAVGTKPFRPDYVPFNGMTVFD
FT                   SDEIVDLPKLPRSLAVIGAGVIGVEYATIFSALDVAVTLIEPRTSFLDFIDKELIEEFT
FT                   HELRDRNVGLRLGAAVTSITLGPDERPVCKLADGRTVQADMLLFAAGRVGATDRLNLDA
FT                   AGLNVDHRGRLKVDPKTLQTEVPHIYAAGDVIGFPSLASTSMEQGRVAACHAFGLEPPP
FT                   PPEFFPYGIYSVPEMSTVGMSEEEVRKREIPYECGIARFRETSRGHIMGLSNGMMKMIF
FT                   SVKTRRLLGVHIVGEGATELIHIGQAVLNLKGTIDYFIENTFNYPTLAEAYKIAGLDAW
FT                   NRMPRV"
FT   gene            complement(476902..477774)
FT                   /locus_tag="Snov_0461"
FT   CDS_pept        complement(476902..477774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0461"
FT                   /product="Methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /note="KEGG: xau:Xaut_4086 methenyltetrahydrofolate
FT                   cyclohydrolase; PFAM: Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, NAD(P)-binding domain;
FT                   Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87794"
FT                   /db_xref="GOA:D7A376"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A376"
FT                   /inference="protein motif:PRIAM:3.5.4.9"
FT                   /protein_id="ADH87794.1"
FT                   /translation="MVETRIIDGKAFAEKLRKRVASEVTAFHAATGVTPGLAVVLVGED
FT                   PASSVYVRNKGKQTVEAGMASIEHKLPASTTQAELLALIATLNTEKEVHGILVQLPLPG
FT                   HIDAQAVLSTIDPAKDVDGFHVVNAGRLAVGIDALVPCTPLGCVMLLKDALGSLAGLEA
FT                   VVVGRSNIVGKPLAQLLLREDCTVTIAHSRTRDLPEVCRRADILIGAVGRPEMIRGDWI
FT                   KPGATVIDVGINRITGPNGKHRLVGDVAFEEAQGIAGAITPVPGGVGPMTIACLLANTL
FT                   TAAKRQVGS"
FT   gene            complement(477786..478655)
FT                   /locus_tag="Snov_0462"
FT   CDS_pept        complement(477786..478655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0462"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="KEGG: xau:Xaut_4704 formyltetrahydrofolate
FT                   deformylase; TIGRFAM: formyltetrahydrofolate deformylase;
FT                   PFAM: formyl transferase domain protein; amino acid-binding
FT                   ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87795"
FT                   /db_xref="GOA:D7A377"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:D7A377"
FT                   /inference="protein motif:TFAM:TIGR00655"
FT                   /protein_id="ADH87795.1"
FT                   /translation="MTDMTEPYVLTLSCPDRPGIVAAVASFLFERGGNILEAQQFDDTE
FT                   SGRFFMRVVFDRAADSGAIAELKAEFEAVAEKFALNWRLRGRNQKRRVMLLVSKFDHCL
FT                   ADLLYRWRIGEIPMEIAGIIANYPRETYAHLDFADIPFHYLPVTKQTKMEQEAQLWELF
FT                   QKSGAEVAVLARYMQVLSDGLSAKLSGRCINIHHSFLPGFKGAKPYHQAHERGVKLIGA
FT                   TAHYVTSDLDEGPIIEQDVERISHQDTADDLVRKGRDIERRVLARALAWHLDDRVLLNG
FT                   HRTVVFRD"
FT   gene            complement(478732..479355)
FT                   /locus_tag="Snov_0463"
FT   CDS_pept        complement(478732..479355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0463"
FT                   /product="Sarcosine oxidase gamma subunit"
FT                   /note="PFAM: Sarcosine oxidase gamma subunit; KEGG:
FT                   xau:Xaut_4703 sarcosine oxidase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87796"
FT                   /db_xref="InterPro:IPR007375"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:D7A378"
FT                   /inference="protein motif:PFAM:PF04268"
FT                   /protein_id="ADH87796.1"
FT                   /translation="MADRSSHDPLAGIAFDRLPPAGAYGVAGEPGVVASIAEPFVALVV
FT                   ARPGKAASVVDRLNRAFSVTLADRPHAAIEGNTTVIGTAPGRFLVLSRTDADLFGTLRA
FT                   ILGTEAMVTEQSDGNVTFSVTGDRAPDMLAKGALIDLDPVAFHVGDAATTVIAHIGVTL
FT                   WRSGEKNWRVLVGRSYEASFTRFLIASAAEYGLRLENQGSEGRG"
FT   gene            complement(479348..482329)
FT                   /locus_tag="Snov_0464"
FT   CDS_pept        complement(479348..482329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0464"
FT                   /product="sarcosine oxidase, alpha subunit family"
FT                   /note="KEGG: azc:AZC_1494 sarcosine oxidase alpha subunit;
FT                   TIGRFAM: sarcosine oxidase, alpha subunit family; PFAM:
FT                   glycine cleavage T protein (aminomethyl transferase);
FT                   HI0933 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87797"
FT                   /db_xref="GOA:D7A379"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006277"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041117"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:D7A379"
FT                   /inference="protein motif:TFAM:TIGR01372"
FT                   /protein_id="ADH87797.1"
FT                   /translation="MSRAQRNRLDAGGLIDRSQVLDFFFDGRRYRGHAGDTLASALLAN
FT                   GVRLVGRSFKYHRPRGIFSAGAEEPNALVELRDGGRREPNTRATVAELYDGLEATSQNR
FT                   WPSLGLDVLSVNRLVSPFLGAGFYYKTFMWPAKAWEKLYEPFIRRAAGLGRAAEGNDPD
FT                   HYEKATTFCDVLVIGAGPAGLMAALAAGRTGARVILADEDFLPGGRLNAEVHEIGGQPG
FT                   AAYAAHVAAELASLPNVRVMPRTTVFGVYDGGTYGALEKVGDHLRVPAPFQPRHRFWRI
FT                   VARRAVLAAGATERPIVFGGNDRPGVMLAGAVGTYVQRFAVRPGRHVALFANNDAAWRG
FT                   MLAAQAAGANVEAIVDVRGDVASVLTEAAKAKGIRIFTGARVIATHGKKLRTIDVAASG
FT                   RGRETLYIDTLAVSGGWSPAVHLTCHHGGKPVWNEAVAAFVPGSTPPGLAVAGAANGSF
FT                   ALGAILKEGAQQGAEAAEALGFPVPPLDVPHTSEESTALKPFWHVADSKGAAFVDLQND
FT                   VTAKDVGIAHREGFRSVEHLKRYTTLGMATDQGRTSNVTGLAIMAELTGASIAETGTTI
FT                   FRPPYTPVSLGALAGHHRGKDFRPVRLTPTHEWAARQGAVFVETGPWLRAQYFPRKGEK
FT                   DWLETVTREVKAVRSSVGLIDVSTFGKIDLQGPDVGAFLDRVYINTFSTLAVGKARYGV
FT                   MLREDGMVMDDGTTARLAPEHYVMTTTTANAAKVFQHLEFCLQVLWPELDVSLASVSEH
FT                   WAQIAIAGPVARTVLSRVVDKGVDVSDAALPFMGAIEGTVMGGVKARLFRLSFSGELGY
FT                   EIAVPARQGAKLAQALMQAGHEYGITPYGTEALGVMRIEKGHVSGNELSGQTTAGDLGL
FT                   GRMASAKKDYIGRVMAGRPGLVDPDRPSLVGFRPADRTKRLRAGAHFLGLGAPADTAHD
FT                   EGYMTSVAYSPQLGHWIGLGLLKGGAKRIGDRVRAYDPVRGEEFELEVCAPAFIDPQGE
FT                   RLRG"
FT   gene            complement(482326..482610)
FT                   /locus_tag="Snov_0465"
FT   CDS_pept        complement(482326..482610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0465"
FT                   /product="Sarcosine oxidase delta subunit heterotetrameric"
FT                   /note="PFAM: Sarcosine oxidase delta subunit
FT                   heterotetrameric; KEGG: azc:AZC_1495 sarcosine oxidase
FT                   delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87798"
FT                   /db_xref="GOA:D7A380"
FT                   /db_xref="InterPro:IPR006279"
FT                   /db_xref="InterPro:IPR038561"
FT                   /db_xref="UniProtKB/TrEMBL:D7A380"
FT                   /inference="protein motif:PFAM:PF04267"
FT                   /protein_id="ADH87798.1"
FT                   /translation="MRIPCPYCGERDAHEFAYLGDATPARPDPAAEDAEQRFHDYVYLR
FT                   DNPAGAHIEWWYHANGCRQWLKVERDTRTHAIAGARAAREADTPAGDAA"
FT   gene            complement(482610..483860)
FT                   /locus_tag="Snov_0466"
FT   CDS_pept        complement(482610..483860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0466"
FT                   /product="sarcosine oxidase, beta subunit family"
FT                   /note="KEGG: azc:AZC_1496 sarcosine oxidase beta subunit;
FT                   TIGRFAM: sarcosine oxidase, beta subunit family; PFAM: FAD
FT                   dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87799"
FT                   /db_xref="GOA:D7A381"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006278"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A381"
FT                   /inference="protein motif:TFAM:TIGR01373"
FT                   /protein_id="ADH87799.1"
FT                   /translation="MHYSWLSILKNGLTGQKGWTPAWRDAAPKPSYDVIIVGGGGHGLA
FT                   TAYYLAKVHGIHNVAVIEKGYIGSGNAGRNTTIIRSNYLLPGNEPFYEWSMKLWEGLEQ
FT                   ELNYNAMVSQRGILNLFHSDAQRDAYARRGNAMRLAGADSELLDQRQVRAMYPFLDFDN
FT                   TRFPVQGGLLQRRGGTARHDAVVWGYARAADRLGVDIIQNCEVTGFLREGEAIVGVETS
FT                   RGPIRSAKVGLAVAGSSSRVAQKAGLRLPIESHVLQAFVSEGLKPLIDGVITFGAGHFY
FT                   ISQSDKGGLVFGGDIDGYNSYAQRGNLPVIEDVAESGMALMPRIGRLRLLRMWGGIMDM
FT                   SMDGSPIIDRAPVPGLYLNAGWCYGGFKATPASGWCFAHLLAKDEFHDVGGAYRLDRFR
FT                   TGHLIDEKGVGAQPNLH"
FT   gene            483964..484935
FT                   /locus_tag="Snov_0467"
FT   CDS_pept        483964..484935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0467"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: xau:Xaut_4699 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87800"
FT                   /db_xref="GOA:D7A382"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A382"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ADH87800.1"
FT                   /translation="MAQPDTLPFDLRSLELFLAVCDAGTMAQAARRLGLTQPAISQAVA
FT                   EMERRMGVALFDRSARPLALTAAGGALRQRASALLSEARQIAPLLREAERARLPLIRTG
FT                   IVDSLSRVLIAPLVRALAEKAEQVSLLSGLTAAHAGALLTRQLDLLVGADALDEIEGLE
FT                   RWPLLTEPYVLLMPANLPAPSRVADIEELTRTVPLVRFSARSKTGMEVERHLRRLRLEL
FT                   PRPLEFDTPYGVTAAVADGAGFAVTTPLCLIEAAVPLDGLACHALPGPGLARHLTLIAR
FT                   RQELGRLPREIAAFCRERLLASKPAVAALVGEGLAEGFRVEP"
FT   gene            complement(484939..486153)
FT                   /locus_tag="Snov_0468"
FT   CDS_pept        complement(484939..486153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0468"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: rru:Rru_A0045
FT                   3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87801"
FT                   /db_xref="GOA:D7A383"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D7A383"
FT                   /inference="protein motif:PFAM:PF00109"
FT                   /protein_id="ADH87801.1"
FT                   /translation="MPARVAITGLGSLSALGQDVPSHLAGLRAGTVGIGETQGVDVSTM
FT                   KTKISAEVRGFVPEDHFDPRQLGLLDRTSQFAVVVARQALADAGPALEGAARHRAGAIF
FT                   AASVGFHAVDDSYRKLYADKAPRPHPFTVPRAMPSGQVSHVTMDLGIHGPSFSIASACS
FT                   SASHAIGTAFHMIRSGMLDVAVAGGAESQITYGMLKSWEALRVLAPDGCHPFSKDRAGL
FT                   VIGEGGGAVVLENMDRAIARGATIHAELVGFGMSADGMDITAPDMASAAASMRFALEDA
FT                   GLAPEQVGYVSAHGTATVLNDKTETAALRHVFGAHLDRLPVSSSKSQYGHTMNASGALD
FT                   LVTTVLALREGFLPPTMGFNEADPECDIDCVANASREAPIEVAISSSFAFGGLNAVLAV
FT                   RRYEG"
FT   gene            complement(486153..486422)
FT                   /locus_tag="Snov_0469"
FT   CDS_pept        complement(486153..486422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0469"
FT                   /product="phosphopantetheine-binding protein"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87802"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D7A384"
FT                   /inference="protein motif:PFAM:PF00550"
FT                   /protein_id="ADH87802.1"
FT                   /translation="MQTDDPAVAEIVDFISGEVGVDSNLLTPETPVSELGISSLDLIET
FT                   IFKLESRFGIEIPNDGPLSGNDVTVGTLVQHVAELLAAQKAKTA"
FT   gene            complement(486569..488050)
FT                   /locus_tag="Snov_0470"
FT   CDS_pept        complement(486569..488050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0470"
FT                   /product="beta-galactosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="TIGRFAM: beta-galactosidase; KEGG: mag:amb0219
FT                   beta-glucosidase A; PFAM: glycoside hydrolase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87803"
FT                   /db_xref="GOA:D7A385"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017736"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:D7A385"
FT                   /inference="protein motif:TFAM:TIGR03356"
FT                   /protein_id="ADH87803.1"
FT                   /translation="MLRRRDFLASAVAATALPALPLGARAQQGQPPVAMPPAPAQVQPL
FT                   SPAGQPQLPPGFVWGASTSSYQIEGAVKEGGRKPSIWDTFSHTPGRIADGTNGDIACDH
FT                   YNRYPGDVELMAKGGFQAYRFSIAWPRVIPDGTGQVNAAGLDFYDRLVDKLMERGILPM
FT                   ACLYHWDLPQALQDRGGWHNRDMAGWFADYARAAVGRLGDRVKPWAMLNEPSVHAIFGH
FT                   GFGNHAPGLTGWPSYVMAQHHQNLAQGTGITAVRALRSNLKLGTVFSLQPIYPASQDPA
FT                   DLAAAQRFDACWNTINLDPLFKGSYPAPFENVFAQLVKPGDMEAIRVPVDFLGMNYYGP
FT                   SWIKHDPAAFLAQAGYGAVPEGTPRTLLGWPISAQGLVEVLTRLRDQYGNPPVFITENG
FT                   ACYEDPAPANGVVQDPERVEYIRAHLVACSEAIRQGCALNGYFAWSLLDNFEWAEGERR
FT                   RFGLINVDFATQQRTPKASYLYLSQVMRAHAAARP"
FT   sig_peptide     complement(487970..488050)
FT                   /locus_tag="Snov_0470"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.968 at
FT                   residue 27"
FT   gene            complement(488070..489404)
FT                   /locus_tag="Snov_0471"
FT   CDS_pept        complement(488070..489404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0471"
FT                   /product="Gluconate transporter"
FT                   /note="PFAM: Gluconate transporter; KEGG: tle:Tlet_1725
FT                   gluconate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87804"
FT                   /db_xref="GOA:D7A386"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:D7A386"
FT                   /inference="protein motif:PFAM:PF02447"
FT                   /protein_id="ADH87804.1"
FT                   /translation="MYLTYAAIFVAVVAVFALLTARGRVHAFLALVAAAFAFNWGIGWS
FT                   LGYVVKSFGTGFSQSLAALGLVVVAGALMAEIADGTGATARLQQMARGWRRRSPPLALL
FT                   GLIGGMGSTPGAAFAVLDPLRRGIGGDSPRSALVLGLSLSAGHGLLIPAPVMLANLTIL
FT                   RGDWLLAAFIGLPAAILCVLLGMFFARLAATDAPRPVDTAESIGGETLHAPRRGALALL
FT                   VTSLVLIALLIVQSLGDIASEPFGGGNDRLFILALGSPMLLVAVGVGLLLLLSWNWEPG
FT                   GLGEEGWAARAFARVAPLLLIVGAAGGLAKVVQDTGTAEMVAETAIDLLPAHGALALLV
FT                   PFALAAIVKTLQGSSLVAAITAAGMMMELLAPLGLDDPTGRTLAALAVGAGAMTVSQIN
FT                   DGFFWLVARAGGFTPPAALARLSVGTALQGALAVAVLMLFRLIAG"
FT   gene            489566..490906
FT                   /locus_tag="Snov_0472"
FT   CDS_pept        489566..490906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0472"
FT                   /product="glycoside hydrolase family 5"
FT                   /note="PFAM: glycoside hydrolase family 5; KEGG:
FT                   aca:ACP_0988 glycosyl hydrolase, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87805"
FT                   /db_xref="GOA:D7A387"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:D7A387"
FT                   /inference="protein motif:PFAM:PF00150"
FT                   /protein_id="ADH87805.1"
FT                   /translation="MIFHFLSRLLPLAVLLLAAAPLARAQSDAPASPTPGFVRVEGKRF
FT                   VNPDGSTFPIRGMSFGNWLLPEGYMFKFTVQRSPADIEGVIEYLAGPEEAARFWKDFRE
FT                   TYIREEDVAFLAASGFTTVRVPLHWKFFLDPKNPDSVDPNGEGWVLIDRLVGWAKTHGI
FT                   KLILDIHAAPGGQTGVNHDDGVGYPLTFYVPEFKRRTITMWRAIAERYRDETAVLGYDL
FT                   LNEPVTPYHDTDFLNSRLEPFYRDLVTAIREVDPNHPIMLAGAQWSTNFDVFGPPFAEN
FT                   LGYTYHMFWAAPQRSSIQKYANFANRWQVPIFVGETGELNNDWNAQFRALNERFGIGWS
FT                   FWTYKNLDSPSTVASIRKPAGWDAIAHFGSVPRSQWATMDKPSREAVQATLRAYLDNAR
FT                   FANTAVNRGYVASLGLKVPETASTGAPCGRLASLDPAGASQLETPCP"
FT   sig_peptide     489566..489643
FT                   /locus_tag="Snov_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.955 at
FT                   residue 26"
FT   gene            490903..492417
FT                   /locus_tag="Snov_0473"
FT   CDS_pept        490903..492417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0473"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   met:M446_6034 malonyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87806"
FT                   /db_xref="GOA:D7A388"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7A388"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADH87806.1"
FT                   /translation="MTNHLFDTLRAGQPEGGRVFIATPEGAVFTYADMERRAAQYANAL
FT                   VSLGVKPGDRVALQVEKSVEAIFAYLGTVRAGGVFLPLNTAYTAPEIDYFLGDAEPAVF
FT                   VCDPAAEATLAPIARARGVAHLFTLDADGKGTLSAAADAAAANFEDVERGPDDLAALLY
FT                   TSGTTGRSKGAMLTHDNLASNALALVDTWRFGPEDVLIHALPIFHTHGLFVATNVILAA
FT                   GASMIFLPKFDPEAILRLMGRASVMMGVPTFYTRLLKAPGLTPEAAAKMRLFISGSAPL
FT                   LADTHREWRARTGHAILERYGMTETGMNTSNPYDGERIAGTVGMPLPGVSLRVVAPDDG
FT                   TELGAGEIGMIEVRGPNVFKGYWRMPEKTAAEFHDGWFVTGDLGLIGPDGYVQIVGRGK
FT                   DLVISGGYNVYPKEIESEIDALDGVVESAVIGLPHADFGEGVTAVVVARPDAALDEKAV
FT                   VAALEGRLARYKLPKRVIFVDDLPRNTMGKVQKNLLREQYKALYAG"
FT   gene            492477..493037
FT                   /locus_tag="Snov_0474"
FT   CDS_pept        492477..493037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0474"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /note="KEGG: rle:RL0293 putative
FT                   methylated-DNA--protein-cysteine methyltransferase;
FT                   TIGRFAM: methylated-DNA/protein-cysteine methyltransferase;
FT                   PFAM: Methylated-DNA-[protein]-cysteine S-methyltransferase
FT                   DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87807"
FT                   /db_xref="GOA:D7A389"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:D7A389"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ADH87807.1"
FT                   /translation="MDPLAQHYLVFETARGFCGLAWSAAGITRFQLPTSSAAATERNLL
FT                   RRVPVARPGEPTPEIAETVAAVRRYFDGETVDFSDVRLDLGEQEAFFADIYAALRRVGW
FT                   GATTTYGALAKELGAGPEAARDVGQAMARNPVPLIIPCHRVLAAGGKLGGFSAPGGADT
FT                   KAHMLELEGVDLRPPAPAQGSLF"
FT   gene            complement(493054..493338)
FT                   /locus_tag="Snov_0475"
FT   CDS_pept        complement(493054..493338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0475"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   xau:Xaut_3092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87808"
FT                   /db_xref="GOA:D7A390"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A390"
FT                   /inference="protein motif:PFAM:PF02583"
FT                   /protein_id="ADH87808.1"
FT                   /translation="MASMQNETRNACLKRLSRIEGQVRGLSRMVEEDRYCIDIVTQVAA
FT                   VRAALKKVEEEVLRDHVAHCVEHAIQSGDADEQRGKVSELIAVLGKLKA"
FT   gene            493404..495893
FT                   /locus_tag="Snov_0476"
FT   CDS_pept        493404..495893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0476"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; YHS domain protein;
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   sal:Sala_2544 heavy metal translocating P-type ATPase;
FT                   SMART: TRASH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87809"
FT                   /db_xref="GOA:D7A391"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D7A391"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADH87809.1"
FT                   /translation="MADHEHEAKPSGASCCGSHAKAPSEKPAEAADSCCGSHDHDHAGH
FT                   DHSHHGHAHAQGHTHDHAGAAAHMAKDPVCGMDVDPHTAQHRAEHGGRTYYFCCAGCRT
FT                   KFVADPEKYLGERAPVAPVPEGTEYTCPMHPEVRQIGPGSCPICGMALEPVLVSLDDGP
FT                   NHELVDMTRRFWIGLALAVPVVVLEMGGHFLPAVHHFIPPQLSNWIQLVLATPVVLWAG
FT                   WPFFERGWQSLLTRNLNMFTLIALGTGVAYLYSLVAVLAPGVFPPAFRDAQGAVAVYFE
FT                   AAAVITVLVLLGQVLELRAREQTSGAIKALLDLAPKTALRINPDESEEEIPLDQVAVGD
FT                   KLRVRPGEKVPVDAQVVEGRSAVDESLVTGESMPVTKTEGDHVIGGTLNRSGGLVVAAE
FT                   KVGRDTMLARIVQMVAEAQRSRAPIQRLADQVSGWFVPLVVLCAVLAFAAWAVWGPEPQ
FT                   LAHALIAAVAVLIIACPCALGLATPMSIMVGVGRGAQMGVLIKNAEALERMEKIDTLVV
FT                   DKTGTLTEGQPSVTAIVTSEGVEEAEALRFAAAVERPSEHPLARAIVTAAQDRSLDIPK
FT                   VRGFDSPVGKGAYGLVDGKRVVLGSAGFLKELGIATDALAGQADELRREGATAIFVGID
FT                   GKAAAVVAIADPVKATTPQALADLASEGIRVVMLTGDNRTTAEAVARRLGITEVEAEVA
FT                   PDQKAAVVEKLKREGRVVAMAGDGVNDAPALASADVGIAMGSGTDVAIESAGVTLLRGD
FT                   LGGIVRARRLSEATMSNIRQNLFFAFIYNAAGVPIAAGVLYPVFGLLLSPMIAALAMSL
FT                   SSVSVIANALRLRAAKV"
FT   gene            complement(495994..497220)
FT                   /locus_tag="Snov_0477"
FT   CDS_pept        complement(495994..497220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0477"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mdi:METDI1124 putative FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87810"
FT                   /db_xref="GOA:D7A392"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A392"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADH87810.1"
FT                   /translation="MSRQEGIVIVGAGQGGFQAAASLREAGFTGPVTLVGEEPGLPYQR
FT                   PPLSKAYMKGDAGIEQIELRPAAFFADHDIQIVNARAEAIDRAAQRVVLEGGEALPYAH
FT                   MILATGARNRPLPVPGRELAGVYYLRSHADADALRERLEGARRVVVIGAGFIGLEFAAV
FT                   ARTLGHEVTVIEAAARPLARAVSPEMSAFFADAHTSMGTSLLLGAGVIGLIGAAGHVTG
FT                   VETTDGMVHPADFVVVGIGVTPNVELAAEAGLEVANGIVVDAHLSTMDPAISAIGDAVA
FT                   YPSRFADGLVRLESVQNAVDQAKAVAARLTGRPAPYAAVPWFWSDQSDLKLQMVGLAGP
FT                   TDDAVLRGDPASRRFSVFRFRDGVLTAIESVNRPADHMLGRRLLAGTPTITPEQAADES
FT                   FELKSLLGK"
FT   gene            complement(497217..497939)
FT                   /locus_tag="Snov_0478"
FT   CDS_pept        complement(497217..497939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0478"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="KEGG: pzu:PHZ_p0194 1-acylglycerol-3-phosphate
FT                   O-acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; SMART: phospholipid/glycerol
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87811"
FT                   /db_xref="GOA:D7A393"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D7A393"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ADH87811.1"
FT                   /translation="MSRLRSSAFLVLLVLWTVLLAPTIPYYALRNAPRATRRFSRIWAG
FT                   GVLAILRIVGVSCRTIGEANRPDGPALYVANHQSTFETIASAVLVPDVAIILKEELYKI
FT                   PVFGWFLRKSPMIAIDRAGGGTAMKKMFREGREAAAEGRSLLIFPEGTRQPVDVRAPMQ
FT                   RGVVLLYKALGLPVVPMVHNAGLFWLARSFEIRPGEITVSFLPPIPAGLPEAEFMERLS
FT                   AAIYDERDRLVAQAQEAA"
FT   sig_peptide     complement(497877..497939)
FT                   /locus_tag="Snov_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.685) with cleavage site probability 0.355 at
FT                   residue 21"
FT   gene            complement(498158..499870)
FT                   /locus_tag="Snov_0479"
FT   CDS_pept        complement(498158..499870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0479"
FT                   /product="adenine deaminase"
FT                   /EC_number="3.5.4.2"
FT                   /note="TIGRFAM: adenine deaminase; KEGG: gox:GOX1719
FT                   adenine deaminase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87812"
FT                   /db_xref="GOA:D7A3Z2"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7A3Z2"
FT                   /inference="protein motif:TFAM:TIGR01178"
FT                   /protein_id="ADH87812.1"
FT                   /translation="MTMLDSAALGRFIDAGRGVAPADVVIKDVRLLDVITGAITQTDIA
FT                   IVGDRIVGTYDSYDGREVIDGNGLFAVPGFIDTHLHVESSLVTPLEFDRCVLPHGVTTA
FT                   ICDPHEIANVLGAEGIEYFQRCAEHTIMDLRVQLSSCVPATTFETAGAELDADDLVALR
FT                   GHKSGIGLAEFMNFPGVLFKDEGCLAKLAAFSEGHIDGHAPLLRGRDLNGYISAGIRTE
FT                   HEATGLNEAREKLMKGMTVLIREGSVSKDLHALIPLVSADTSAFLAFCTDDRNPLDIAE
FT                   QGHLDYMIREAITGGAPLHHVYRVASWSAANAFGLRDRGLIAPGRRADIVLLDNLEACS
FT                   VRHVISAGRLVTPELFASRGTVEPVGLESMKAEPVAAQDFRIPASETATRVMGVVPGRI
FT                   ITEDLAFDLPLIGGEKHVDLDKDAVKVCVVARHGKNRNIGRGFVHGFGMKRGAIASSVG
FT                   HDSHNICVVGADDADMAVAVNRLIELKGGFVVAEGGAVKAELALPVAGLMSAGSFEEVH
FT                   DALIPLRAAAKALGVVLPEPFLQVAFLPLPVIPHLKITDFGMFDVNSFALIGG"
FT   gene            complement(499873..500832)
FT                   /locus_tag="Snov_0480"
FT   CDS_pept        complement(499873..500832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0480"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: oan:Oant_1146
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87813"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D7A3Z3"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADH87813.1"
FT                   /translation="MELRRLGRSDILVPPLCFGGNVFGWTADETTSFRLLDGLVEAGFS
FT                   FIDTADVYSRWADGHAGGESETIIGNWMKARGNRAKIVLATKVGGDMGLGKRCLKPDYI
FT                   RSAVEASLKRLQTDYIDLYQSHWDDPETPFEDVLDIYEELIKAGKVRLIGASNLSPARL
FT                   FEALAVATREKLPRYETFQPEYNLYDRAGYENELEPICSGNGLGVITYFSLAAGFLTGK
FT                   YRSAADAQKSVRGRAAVDKYLNDRGRRILAALDQVSAAHGVSPSQVALAWVMARPSVTS
FT                   AIASASKVEQLGDLLASAELRLTNSEISRLDAASAWKE"
FT   gene            complement(500932..501714)
FT                   /locus_tag="Snov_0481"
FT   CDS_pept        complement(500932..501714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0481"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="KEGG: mno:Mnod_3729 transcriptional regulator, DeoR
FT                   family; PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87814"
FT                   /db_xref="GOA:D7A3Z4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D7A3Z4"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ADH87814.1"
FT                   /translation="MNISSRQQDILVLARAQGRVSVEDLAGRFEVSPQTIRKDLNDLCV
FT                   RRLMSRVHGGAVVASGVENLAYEARRAMAQGAKRAIAEAAALMVPNRASLFINIGTTTE
FT                   EVARALADHEDLLVITNNLNVATLLYRHPKIELIMAGGPVRHADGAVIGSSAVDFIRQF
FT                   RVDYAVIGASAIEEDGTLLDFDYREVQVARAIIDNARQVILVADRSKLERSAPVRIGAM
FT                   SEVDTFVTDTVSSPELRHVCQREQVELIEVGSLDEDGF"
FT   gene            complement(501826..502938)
FT                   /locus_tag="Snov_0482"
FT   CDS_pept        complement(501826..502938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0482"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: rpc:RPC_1050 acetyl-CoA C-acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87815"
FT                   /db_xref="GOA:D7A3Z5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D7A3Z5"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADH87815.1"
FT                   /translation="MSRAFIASARRTAVAPRRGAFNTVEAHDLAAPVLRACLDDAGVAP
FT                   DAVDHVILGNALSGGGNVARLAALAAGLPDGVPALTIDTQCCSGLDAIILAARLVEAGA
FT                   AEVVLAGGVESWSRAPLRARRPKAPDEKPAFYERPAFAPFPERDPDMIEAVAGLAREKG
FT                   ISRERQNGFAIHSHEKALAARERLKAEIVPVAGLDHDAFSRALTMKLCARAPVLAGDGE
FT                   TVIDATGAAVEADAAAAVLVVSERRAAAGGIATLDGLSVGGAPEQPAMALVPAVERLLA
FT                   RHQGTPAVVELMEAFAAQALANIDALGLDPAGINPGGGALARGHPIGASGAILAVRLFH
FT                   ELKARPEGTRGLAAIAAAGGLGAAMLLQRT"
FT   gene            complement(502935..504329)
FT                   /locus_tag="Snov_0483"
FT   CDS_pept        complement(502935..504329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0483"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   xau:Xaut_2006 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87816"
FT                   /db_xref="GOA:D7A3Z6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7A3Z6"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADH87816.1"
FT                   /translation="MARTIGAKLEALAAAAPSRRALICDDETVSRAALAARIGGLAAWL
FT                   TERSAPGEGIALAMGNAPALVEAFLACAVSGRQALVYDPAWPAPYRAAIDAALAPRVTL
FT                   ETAPEVPPAPFPAPPAPEAPFYVGFTSGSTGTPKGYRRSHRSWIDSFHVSALEFGLSER
FT                   DVVMAPGGLAASLHLYGVVHALHIGATAVMMHQFHPRRALRLIARHGVTALYATPTQLQ
FT                   MLIDAAGGEAFPSLRMLMISGAKWRAETRAATEALFPKAGIAEFYGASETSFITIGHPD
FT                   EKVPAGSVGRAAHGVSLRIHDAEGRDLPSGEAGAIWVGSSMLFDEYACGSAPETRREDG
FT                   FLTIGDHGRLDEDGFLYLHGREKRMLVTSGLNVYPEEVEAVLGGLSGIEEAAVFGLPDA
FT                   LRGVELVAVLRGHVDEPALRAACRALLPAAKIPRRFLALDDWPRTSGGKADLRVLEAIA
FT                   VERLKR"
FT   gene            complement(504334..504891)
FT                   /locus_tag="Snov_0484"
FT   CDS_pept        complement(504334..504891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0484"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: dac:Daci_4601 BioY
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87817"
FT                   /db_xref="GOA:D7A3Z7"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D7A3Z7"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ADH87817.1"
FT                   /translation="MKDRSLVQIALYAAIFAVLGLLPRFDLPIAGGVPITAQSMGAMLA
FT                   GVMLGGWRGALSIVLLLFVVALGAPLLAGGRGGLGVFFTPSVGFLFGWVAAAFVAGWIM
FT                   QKLRKAPVFPAALVASVVGGILVLYAFGIVGMAAMGNLTLKEAAIACLVFIPGDTIKAV
FT                   LVALIAQTVARGMPEALLSRNA"
FT   gene            complement(504888..505499)
FT                   /locus_tag="Snov_0485"
FT   CDS_pept        complement(504888..505499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0485"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: azc:AZC_3756
FT                   putative cobalt transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87818"
FT                   /db_xref="GOA:D7A3Z8"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D7A3Z8"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ADH87818.1"
FT                   /translation="MISLYLPERTWLHGIPAGWKLIALALVSLTVAPFDNPSLMAGLVA
FT                   AVLALYASLGRAALAQIALLRPLWPLFLILLALHWWRGDVLLGAVVILRILAMVLLANA
FT                   VTMTTRMDAMMDAVEPLLRPLALFGVAPRAVALAVAMMIRFVPLLFALWEALNESWRAR
FT                   TGRRGGWRLLAPFCIQTLRMSHHTAEALAARGGAPRGERR"
FT   gene            complement(505496..506191)
FT                   /locus_tag="Snov_0486"
FT   CDS_pept        complement(505496..506191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0486"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: azc:AZC_3755 ABC transporter ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87819"
FT                   /db_xref="GOA:D7A3Z9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A3Z9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87819.1"
FT                   /translation="MHGDSLLLENVTLRRGGRVVLDSVSLDLSERRIGLIGNNGSGKSS
FT                   LIRLLNGLLTADEGRVVVHGLDAKEKAAELPRKVGFIFQNPDHQIIFPTVAEEVAFSLE
FT                   QAGMPRREAAKEAIPALARFGRDHWAERPVHALSEGEKQFLCIIAVLVMQPAVLVLDEP
FT                   FSSLDLPTRRRLEALIAGLPQQVILIAHELDAFAGYDRVIWLHEGKVAMDGAPEAVITA
FT                   YRAFVEAGG"
FT   gene            complement(506323..507156)
FT                   /locus_tag="Snov_0487"
FT   CDS_pept        complement(506323..507156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0487"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: azc:AZC_2900
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87820"
FT                   /db_xref="GOA:D7A400"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D7A400"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADH87820.1"
FT                   /translation="MSRVVLPGGTRVPALGIGTWMMGERPAARKEETESVRLGVELGLT
FT                   LVDTAEMYGEGACETFLGEALAGLRDKVFLVSKVYPHNASRAGVVAACERSLKRLKTDH
FT                   LDLYLLHWRGGVPLAETIIGFEHLKSQGKIRHWGVSNFDTDDMNELYETPGGEGCAVNQ
FT                   VLYNLTRRGPEYDLLPWLEEQEIPLMAYSPIEQGRIKTSGVLAQIAAKHGAKPFQVALA
FT                   WVLRSPNNIVIPKASRPEHMRENAGARDIKLDNDDLAALDAAFPPPSRKRSLEML"
FT   gene            507279..508274
FT                   /locus_tag="Snov_0488"
FT   CDS_pept        507279..508274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4592 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87821"
FT                   /db_xref="GOA:D7A401"
FT                   /db_xref="InterPro:IPR011213"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A401"
FT                   /inference="similar to AA sequence:KEGG:M446_4592"
FT                   /protein_id="ADH87821.1"
FT                   /translation="MSATPLTRPTADADLPDAPEPGLAIGLSAVIVAVTGDDPKVLTIR
FT                   HGDGRDSLPSGPLERGHRTLEVGLRSWVERQTLQELGYVEQLYTFGDRDRGEDGGRALS
FT                   LAYLALVREARPAGDTEAAWQSWYRYFPWEDWRGGRPAVLDSLEHGLRAWAAGAASSRM
FT                   GEIRAERIALCFGGMGGNEAGWNEERVLERYELLYEAGLVAEALRERGSERAASGPSGV
FT                   EMREDHRRMLALAIARLRGKIKYRPVVFEVMPPSFTLGQLQRTVEALSGARLHKQNFRR
FT                   LVEQQRLVEETGETTAETGGRPARLVRFRREVLLERPAPGVRLPGGFGRR"
FT   gene            complement(508275..508700)
FT                   /locus_tag="Snov_0489"
FT   CDS_pept        complement(508275..508700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0489"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bja:bll2568 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87822"
FT                   /db_xref="GOA:D7A402"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7A402"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH87822.1"
FT                   /translation="MDLTLEPALAAEEEAVAALWRECGLTVPYNDPAADFRFALGREAS
FT                   DVLVARQDGRVVATVMVGHDGHRGWLYYVAVAPALQGKGIGAQIVAAGEEWLKARGVVK
FT                   LQLLVRETNTRVVSFYENLGFEIAPRVVMSKWLDGRE"
FT   gene            508880..509950
FT                   /locus_tag="Snov_0490"
FT   CDS_pept        508880..509950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0490"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /note="KEGG: mdi:METDI3401 putative quinolinate synthetase
FT                   A (NadA-like); TIGRFAM: quinolinate synthetase complex, A
FT                   subunit; PFAM: Quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87823"
FT                   /db_xref="GOA:D7A403"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:D7A403"
FT                   /inference="protein motif:TFAM:TIGR00550"
FT                   /protein_id="ADH87823.1"
FT                   /translation="MLDLDVAARMGTTEDFAPDLAPANAPSSPSALPLAHLYERVSKHV
FT                   TPAEWPLIVRDVEAIERLKKQRNAVVLGHNYQAPEIFNTVADIVGDSLALAREAVTVDA
FT                   DVIVMAGVHFMAETAKLLNPSKIVLMPDMEAGCSLAESITAEDIRLLRQRYPGVPVVTY
FT                   VNTSAEVKAESDYCCTSGNAVKVVRAVAKEWGVNRILMLPDEYLARNVQKEVPEIELIA
FT                   WKGHCEVHERFTPQDIRDLRENHPGVVVLAHPECPPEVVAAADYAGSTAGMADYVRDEK
FT                   PARVVLITECSMADNVAVNHPDVEFVRPCNLCPHMRRITLPNIRRALETMGHQVEIDPA
FT                   VADRARLAVERMLAIR"
FT   gene            509969..511477
FT                   /locus_tag="Snov_0491"
FT   CDS_pept        509969..511477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0491"
FT                   /product="L-aspartate oxidase"
FT                   /note="KEGG: met:M446_4590 L-aspartate oxidase; TIGRFAM:
FT                   L-aspartate oxidase; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87824"
FT                   /db_xref="GOA:D7A404"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D7A404"
FT                   /inference="protein motif:TFAM:TIGR00551"
FT                   /protein_id="ADH87824.1"
FT                   /translation="MSHSPENIVVVGGGVAGLATALRLAPMKVTLVVASPLGSDAATGW
FT                   AQGGIAAAIGDDDRPDFHAIDTLTAGAGLSEPHVARRVAAAAPEAIDWLVGLGTPFDRN
FT                   ANGSLALGLEAAHSRRRIVHADGDGTGRVVLETLAKAARACPSIQVIEAVRATELLLTE
FT                   GRVAGVAVRDREGRVTALAARAVVLATGGLGGLYASTTNPLGAVGSGLALAARAGAALR
FT                   DMEFVQFHPTAIAAGADPMPLATEALRGEGAKLLNARGERFMAEVPGQELAPRDVVARA
FT                   IFAQIAQGHGVVLDARLKDVERRFPGVVALCRANGLDPARAPIPVRPAAHYHMGGIKVD
FT                   DAGRSTVPGLWACGEVASTGLHGANRLASNSLLEALAYAQWIAADIAGEEAAHSAVPAP
FT                   VSPRAPSPARAEIRALMDLKVGVVRDAANLEAAARWLGELADRHDDDPSLVALMVTEAA
FT                   LRREESRGGHFRADYPLPATLARHSETTLDALDRREAGEVRRVA"
FT   gene            511493..512350
FT                   /locus_tag="Snov_0492"
FT   CDS_pept        511493..512350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0492"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="TIGRFAM: nicotinate-nucleotide pyrophosphorylase;
FT                   KEGG: mex:Mext_2646 nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87825"
FT                   /db_xref="GOA:D7A405"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:D7A405"
FT                   /inference="protein motif:TFAM:TIGR00078"
FT                   /protein_id="ADH87825.1"
FT                   /translation="MTLPPLPRLLVEPVVRAALLEDLGRAGDVTTDSVIPVEARFDAVI
FT                   ASRQTGVIAGIDAAVIAFELIDPSLSIVVERRDGTSVGPGDVVMRLNGSARAILTAERV
FT                   ALNIACRMSGVATATAGLVEIARQHGKAHIVCTRKTTPGLRALEKHAVKAGGGSNHRFG
FT                   LDDAVLIKDNHIAVAGGVAPAIRAAKANAGHMVKIEVEVDTLNQLEEAMAEGVDAVLLD
FT                   NMTPPVLKEAVSIVGGRALTEASGRVSRETVGPIAASGVDLISVGWITHSAPILDLGLD
FT                   AASV"
FT   gene            complement(512365..512709)
FT                   /locus_tag="Snov_0493"
FT   CDS_pept        complement(512365..512709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SORBIDRAFT_01g002330; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87826"
FT                   /db_xref="UniProtKB/TrEMBL:D7A406"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87826.1"
FT                   /translation="MSIDMEQLQRDILTAASGAAATDIGNLAGFSRSQLRKIAKQTEWI
FT                   RAGRLAGDLDDELFRFHLDDLARLIDSFVRVLAALTIVMMERVWNAIVGVVWRTMETAI
FT                   GAPIPLPFRP"
FT   gene            complement(512723..513229)
FT                   /locus_tag="Snov_0494"
FT   CDS_pept        complement(512723..513229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0494"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GI18025 gene product from transcript
FT                   GI18025-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87827"
FT                   /db_xref="GOA:D7A407"
FT                   /db_xref="UniProtKB/TrEMBL:D7A407"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87827.1"
FT                   /translation="MTTARVKVPPALPLASSLWRVMAFIIVFAVTAGCALRLAPQYDPS
FT                   IVRGIESANEQAMVLFATVAPGVKASTFPTRAPAYAQVIGQLDALRLLAESRPAPPPSS
FT                   FGPSAGQVVDPPTPSILTNVSALIAQMRDRDARHGLTAAQVPGFRQSYETWMEQAITYE
FT                   TALRR"
FT   misc_binding    513465..513566
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score
FT                   57.14"
FT   misc_binding    513567..513694
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score
FT                   29.81"
FT   gene            513749..515044
FT                   /locus_tag="Snov_0495"
FT   CDS_pept        513749..515044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0495"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.1"
FT                   /note="KEGG: bxe:Bxe_B1348 D-amino acid dehydrogenase small
FT                   subunit; PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87828"
FT                   /db_xref="GOA:D7A408"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A408"
FT                   /inference="protein motif:PRIAM:1.4.99.1"
FT                   /protein_id="ADH87828.1"
FT                   /translation="MRQIAVIGAGITGITTAYALNEKGYDVTVIDRQRYAAMETSFANG
FT                   GQLSASNAEVWNSWSTVLKGIKWMFTPDAPLLMNPLPSWHKYSWMAEFLANIPNYKANT
FT                   VETTRLAIQARNYMFEIAARENIDFNHVTRGILHIYRDKVGYDAAAKVSELYAEGGLER
FT                   RPVTPSEIRAIEPTLHGSYYGGFFTPSDSTGDIHKFTRGLADACRRKGVRFINEASVDS
FT                   VTHTGKGQAGTGVEIALTIVPDAEDARPVRETLAFDGVVVCAGVGSRALAAQLGDRVNV
FT                   YPVKGYSITVMLDDEQSQAGAPWVSLLDDQTKIVTSRLGKDRFRVAGTAEFNGENRDIR
FT                   ADRIRPLTDWVRKLFPDVNTDRAVPWAGLRPMMPDLMPRVAAGAKPGVFYNTGHGHLGW
FT                   TLSCATAQIIAGTVASAMPVETPRPALRIAAE"
FT   gene            515189..516100
FT                   /locus_tag="Snov_0496"
FT   CDS_pept        515189..516100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0496"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: mlo:mlr5377 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87829"
FT                   /db_xref="GOA:D7A409"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A409"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH87829.1"
FT                   /translation="MAFSLRQLQYFVAVAENGSVSSAAHTLSISQSTVTEALRELELDL
FT                   GFKLLERHARGADLTLKGHHFLRHARKILGDVADARRAFAGSEAAALDGRLSVGVTPLV
FT                   AGYIYSDLIARFRRAFPRIAVEAVEDAADYLEHLLVGGELDVAVMVLPSGRRSEALQTE
FT                   AVEVSPYRAWMPLGHPALTQERVSLRDLSAEPHVLLTIDEIAEASEGVWRRLGIRPPVA
FT                   FRTRSVEAVRSLVATGAGVAVLPDLTYRPWSLEGDKIEARALIDEVPAVEVATAWRRGS
FT                   PLSAAAAGFVSIAATRHASRGR"
FT   gene            516229..517392
FT                   /locus_tag="Snov_0497"
FT   CDS_pept        516229..517392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0497"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: rlg:Rleg_3723 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87830"
FT                   /db_xref="GOA:D7A410"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D7A410"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH87830.1"
FT                   /translation="MPRIARYLPALAACASLSLQPALAAEMTSLGKGEGQVDIVAWAGY
FT                   IERGDTDKAYDWVTDFEKKTGCKVNVKTAGTSDEMVALMNEGGFDLVTASGDASLRLIA
FT                   GKKVAPVNTKLIPSWGTVDERLQNAPWHTVDGVHYGVPYQWGSNVLMYNTEAFKGEAPK
FT                   SWNVVFEEQTLPDGKSNKGRVQAFDGPIYIADAALYLMAHKPELGIKDPYELTEEQYKA
FT                   ALDLLRQQRKIVQRYWHDAMIQIDDFTNEGVVASSSWPFQVNLLQSQKKPIASTIPSEG
FT                   ATGWADTTMLHADAAHPNCAYMWMEHSLSPKVQGDLASWFGSVPAVPAACKGNELLGAE
FT                   GCKTNGIEDFEKIHFWRTPVAKCPTQAAGCVPYYRWVSDYIAVLGGR"
FT   sig_peptide     516229..516303
FT                   /locus_tag="Snov_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            517565..517924
FT                   /locus_tag="Snov_0498"
FT   CDS_pept        517565..517924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0498"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ape:APE_2384 acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87831"
FT                   /db_xref="GOA:D7A411"
FT                   /db_xref="UniProtKB/TrEMBL:D7A411"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87831.1"
FT                   /translation="MTRRMTAYTATTKGILIGVIAFTAGGAIVAGVVSVWDRAAIALED
FT                   PALQVCEQGEDHAPHPRGGYAFAATHMARMPHGVGTVWQPRLSTADLLPTPSLGERAAH
FT                   AFRTVFSCTPRSTPS"
FT   sig_peptide     517565..517654
FT                   /locus_tag="Snov_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.867) with cleavage site probability 0.448 at
FT                   residue 30"
FT   gene            517897..518940
FT                   /locus_tag="Snov_0499"
FT   CDS_pept        517897..518940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0499"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: rec:RHECIAT_CH0003932 probable
FT                   spermidine/putrescine ABC transporter, ATP-binding protein;
FT                   PFAM: ABC transporter related; Transport-associated OB
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87832"
FT                   /db_xref="GOA:D7A412"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A412"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87832.1"
FT                   /translation="MHATLDTVLTTPAVRFQGVMRHFGTVKAVDGVDLAIQPGEFFAML
FT                   GPSGSGKTTCLRLIAGFEQPDAGHIDIFGETVEGLPPYRRAVNTVFQDYALFPHLSVGE
FT                   NVAYGLRVRGVGRAERDKLAREALAMVKLAGMEGRRPVQLSGGQRQRVALARALVVRPK
FT                   VLLLDEPLGALDLKLREEMQVELKNLQRALGLTFVFVTHDQSEALSMADRVAVFNEGRI
FT                   VQVGPPEEVYERPATRFVAGFVGSANVLGAAQAAALGAAERPCSLRPEKIALLGPGDPV
FT                   PEGAALVEADVLDVSYQGPVRRVAARCASGLTLTAAVPASGPRVAPGEGVRLAIPRAAI
FT                   EPMEGEG"
FT   gene            518937..519884
FT                   /locus_tag="Snov_0500"
FT   CDS_pept        518937..519884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0500"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mlo:mlr5383 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87833"
FT                   /db_xref="GOA:D7A413"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A413"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87833.1"
FT                   /translation="MSLAVLDLPAPPEGLRRRLSDFLVRRARLLTLLLLVPPLLWIGLV
FT                   YLGSLFVFLGQAVFSIDEFSGTIVREPTTATLLELFRPANFDIVMRTVFVAAAVTALCA
FT                   IIAFPIAYYAARYAGPRTKAGFYLAVMMPLWSSYLVKVYGWKLLLAREGAIGWFAGKLG
FT                   LAGALQAWLDLPVVGGPSLSVSYTGMVLTFTYLWLPFMILPVQAALERVPPHLIEAAGD
FT                   LGASPRMVLRTVILPLAMPGVVAGAIFTFSLTLGDYIVPQIIGTSALVLGQAVYTLQGT
FT                   AGNIPLAAAFSLVPILVMALFLTLAKRTGAFDAL"
FT   gene            520026..520826
FT                   /locus_tag="Snov_0501"
FT   CDS_pept        520026..520826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0501"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rhi:NGR_c21720 putative
FT                   transmembrane component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87834"
FT                   /db_xref="GOA:D7A414"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A414"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87834.1"
FT                   /translation="MTRAPLSLKIAALGGLAFLHVPLLFILLYAFTTEEKSYAFPPPGF
FT                   TLKWFAIVWDRADIWAAVGLSLKVATIATLLALVLGTLAAGALARAKFLGREPISLLFV
FT                   LPIALPGIVTGIALRQAFGLMEMPFSFWTIVLGHATFCIVVVYNNAVARLRRLSPSLIE
FT                   ASMDLGADAFQTFRLVVLPNIGTALLAGGMLAFALSFDEVIVTTFTAGQQSTLPIWMLS
FT                   ELIRPRQRPVTNVVAVLIIIVTFLPILAAYYLTREGEVVAGSGK"
FT   gene            520837..522276
FT                   /locus_tag="Snov_0502"
FT   CDS_pept        520837..522276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0502"
FT                   /product="Aminobutyraldehyde dehydrogenase"
FT                   /EC_number="1.2.1.19"
FT                   /note="KEGG: ara:Arad_3974 betaine-aldehyde dehydrogenase
FT                   protein; PFAM: Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87835"
FT                   /db_xref="GOA:D7A415"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR015657"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D7A415"
FT                   /inference="protein motif:PRIAM:1.2.1.19"
FT                   /protein_id="ADH87835.1"
FT                   /translation="MTALSDTDMLIGSEFVAGTETPETVLNPKTEETLIELPEASPDQI
FT                   DAAVSAADKAFRTWSRTTPAERSYLLLKLADRIEQEAEAFATLEALNCGKPRHAVLNDE
FT                   IPGVVDCFRFFAGAARTQHGMVAGEYMAGHTSMIRRDPIGVVASIAPWNYPLMMAAWKL
FT                   APALAGGNTVVIKPSEQTPLTLLKLAKVIADIFPEGVVNVVVGRGESVGNALIHHPRVA
FT                   MVSLTGDIATGKKVLTAAAKTVKRTHLELGGKAPVIVFDDADIDAVVEGVKIFGYYNAG
FT                   QDCTAACRIYAGEKVYEKLVADLASAVSGLKFGQADDAQNDIGPLISARQRARVASFVE
FT                   RASELNHIEIATGGKLASGKGFFYEPTVVAGALQSDEIVRREVFGPVVSVTRFEDVDEA
FT                   VAWANDSDYGLASSVWTRDIGKGMATASRLQYGCTWVNCHFMLVNEMPHGGLKQSGYGK
FT                   DLSAYALEDYTVVRHVMVKNG"
FT   gene            522474..523574
FT                   /locus_tag="Snov_0503"
FT   CDS_pept        522474..523574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0503"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: bpt:Bpet0632 RND efflux membrane fusion
FT                   protein; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87836"
FT                   /db_xref="GOA:D7A416"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D7A416"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADH87836.1"
FT                   /translation="MRRSTGVLLTVAVLVGAGALAQQRGWIDVGALVGGRGEANAAAEP
FT                   KPAPHIPVEVAPARQVTVTTDISSIGSLQSDESVKVASEVAGRIQEIRFKEGEQVKAGD
FT                   VLVQLDAALVKASLDETEARLDLAEANFSRAQKLQASGSGTARALDEAQAELNTSRALL
FT                   HSQRVQIAKHTITAPFDGVVGLRSVSNGAYIDTGDELVNLEKIDTLKLDFKVPERHLAS
FT                   VSPGQTVMVSVDALPSRTFTGTIYAIDPMVDVNGRSLSVRARLDNAQMALRPGLFARVT
FT                   IKGRETRDAVFVPESAIVPRGQERLVWQVVDGKAREAKVQLGQRGNGEVEIKGVPAGAT
FT                   IVVAGQGRLQPDALVEVVTPPPAPQG"
FT   sig_peptide     522474..522539
FT                   /locus_tag="Snov_0503"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.991 at
FT                   residue 22"
FT   gene            523584..526658
FT                   /locus_tag="Snov_0504"
FT   CDS_pept        523584..526658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0504"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   pla:Plav_2000 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87837"
FT                   /db_xref="GOA:D7A417"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D7A417"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ADH87837.1"
FT                   /translation="MGISELCIRRPVFATVLSLLMVLIGIVSFSRLTVREYPNIDEPVV
FT                   SVVTTYPGASASIVESQVTQVLEGSIAGIEGIDVLESTSRSESSRITVRFRLEIDPDVA
FT                   ASDVRDRVSRVRQRLPDEIDEPVISKVEADAQPVMFVVFRSDRMTPLELSDYIDRYIVD
FT                   RFKNITGVADVQIYGERRYAMRIWIDRERLAAYNLTVQDVEDALSAQNVEIPSGRIESV
FT                   DREFTVLSRTALANVEQFNNIVVKRADGAQVHMSDVARVELGAADERRASRFNGGAAII
FT                   VGLIKQAVANPLDVSAGVREVLPAVNESLPEGMSGAIGNDNAVFIDRSIKSVFHTIFEA
FT                   VLLVVLVIVVFLRSIRASIIPIVTIPISLITTFGIMYALGFSVNTLTLLAFVLAIGLVV
FT                   DDAIVVLENIFRHIEHGMKPIPAAIKGAREIGFAVIAMTMTLAAVYAPVAFAPGRTGRL
FT                   FLEFALTLAGAVIVSGFVALSLTPMMCSRLLKHEDKPGRVSAFIERRLRGMEEGYRRLL
FT                   GATLRVRPLILLVAFCVAGASAYFLSVLPSELSPVEDRGVVRVSGSGPEGSTLAYTARY
FT                   TNQVEGILEKEPEVNSVLIINGFPEVHRFLVIGRLKDWDERDRRQQEIVRKVTPELRRI
FT                   AGVNAYANNPPSLGASNNSRPIEFVIQTSGTYEQLDEYVDRFLDRIRDYPGLISVDSDL
FT                   KLNKPEISVAVDRAKAADLGIDIAVLGRTLESLLGGRQVTRFEVGGEQYDVYVQLDARD
FT                   RSSPATLDTIYLRAASGEMVQLSNLVSVRESVAPQELKRFNQLRSATISANLAPGFSQG
FT                   EALAHLDEVAREVLPQTVQTDVSGQSREFRAAGQSLVLVFLLALGFIYLVLSAQFESFR
FT                   DPVIIMLTVPLSMTGALAALYFSGGSLNVYSQIGLVTLVGLITKHGILIVEFANQQQES
FT                   GLDRRAAVIEAAVLRLRPILMTTGAMVLGAVPLAFAAGAGAESRAQIGWVIVGGMSLGT
FT                   LLTLFVVPTVYSLIGRIHHTAHAEIAPGLVHTPAE"
FT   gene            526893..528443
FT                   /locus_tag="Snov_0505"
FT   CDS_pept        526893..528443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0505"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   met:M446_1975 glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87838"
FT                   /db_xref="GOA:D7A418"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:D7A418"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADH87838.1"
FT                   /translation="MVARVQDEMYDLAIIGGGINGCGIARDAAGRGVSVVLLEQGDFAG
FT                   ATSSASTKLIHGGLRYLEHYEFRLVREALMEREVLWAIAPHIIRPLRFVLPHHKGLRPA
FT                   WLLRLGLFLYDHLGGRKLLPATRTLDLSRDEAGKPLREGYHRAFEYSDCWVEDSRLVVL
FT                   NALDAAERGADIRSHARVVGAERAADHWRVEVDQDGTRTTLRARVLVNAAGPWVHEVLA
FT                   RVIGMNSPADVRLVQGSHIVVRKLYEHDRAYIFQNADGRIIFAIPYEHDFTLIGTTDRD
FT                   FGREPAKPVASPEEIAYLCAAASEYFKVPVTPDRVVWTYSGVRPLYDDGASKAQEATRD
FT                   YVLELENGEGRPPLLSVFGGKITTYRRLAEHALEKLAPFLSSAKKSSWTGKEPLPGGDF
FT                   AVNDQPRIVAQLKRAHPWLDEALARRLVVAYGTRALRLLDGMRGPADLGRIFGADLSEA
FT                   EVRYLMREEWARTAEDVLWRRSKLGLRLDAEQVAALDAFMQDNAPHRLQSASLREVAR"
FT   gene            528440..529549
FT                   /locus_tag="Snov_0506"
FT   CDS_pept        528440..529549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0506"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: met:M446_1974 ABC transporter related; PFAM:
FT                   ABC transporter related; TOBE domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87839"
FT                   /db_xref="GOA:D7A419"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A419"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87839.1"
FT                   /translation="MILELDGVSRTVAGVPYIRDVSLRLEHGSLNVLLGATLAGKTSLM
FT                   RLMAGLDAPTSGRILVDGRDVTGLPVKKRSVAMVYQQFINYPSLSVYENIASPLRVQGL
FT                   PKAEIETRVTEAAKLLKLEPYLQRLPLALSGGQQQRTAIARALVKRADLVLLDEPLANL
FT                   DYKLREELREELPRIFASTGAVFVYATTEPTEALLLGGNTATLMEGAVTQFGPTADVYR
FT                   RPADLATARVFSDPPLNMLKVTKSSGTVLLESGAVLPASGTFATAADGRYTMGVRAHHL
FT                   EVEDVAVAERTSHADGRIRLGAVISVTEVTGSESFLHMQMGEERLTALVPGVRRLEPNA
FT                   PVEVLIDPSHILLFDADGRRAGRVLDAAA"
FT   gene            529561..530658
FT                   /locus_tag="Snov_0507"
FT   CDS_pept        529561..530658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0507"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: met:M446_1973 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87840"
FT                   /db_xref="GOA:D7A420"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:D7A420"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87840.1"
FT                   /translation="MASITLDGLAHAYRPDPRGPQDYALKEINHVWRQGGAYALLGPSG
FT                   CGKTTLLNIISGLVTPTKGRILFDGRDVTNLPTEARNIAQVFQFPVVYDTMSVRENLAF
FT                   PLKNRHLPREAIARRVEEIAGRLDLTSVLDRKAANLTADAKQKISLGRGLVRSDVAAIL
FT                   FDEPLTVIDPHLKWQLRSTLKELHRALDLTMIYVTHDQTEALTFADTVVVMHDGAVVQT
FT                   GTPEELFERPAHTFVGHFIGSPGMNLLPASVEGRTAHIGGEHGVSVELARAYPALPAGE
FT                   RIELGVRPEFATLTRPGSGVPVKLRRIDDIGRARIARIEIAGHPAAATVPGALSLNGDE
FT                   AGLKLDPRQIHIYAGGVLVAGEGGA"
FT   gene            530658..531560
FT                   /locus_tag="Snov_0508"
FT   CDS_pept        530658..531560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0508"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rpt:Rpal_4892
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87841"
FT                   /db_xref="GOA:D7A421"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A421"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87841.1"
FT                   /translation="MDKPVNNRAWLLVAPVFLIVAFSAIVPIMTVVNYSVQDTFGNNQF
FT                   FWNGLGWFQELLDPSTELGGRFFDALWRNLLFSAIILAIEVPLGILVALSMPREGWKVA
FT                   ATLVVMALPLLIPWNVVGTIWQVFARADIGLLGYAVNWLGIPYNYTGDTLAAWITIIVM
FT                   DVWHWTSLVALLCYAGLKSIPDAYYQAARIDGASRWAVFTTIQLPKMKRVLLIAVLLRF
FT                   MDSFMIYTEPFVLTGGGPGNATTFLSIDLVKIALGQFDLGKAAAMSLVYNLIVLALCWV
FT                   FYTVMINAGTERRKQETPA"
FT   gene            531557..532375
FT                   /locus_tag="Snov_0509"
FT   CDS_pept        531557..532375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0509"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_1971
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87842"
FT                   /db_xref="GOA:D7A422"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A422"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87842.1"
FT                   /translation="MSASTHRSRSDALVMGLYLVFLLLPIYWLVNMSLKTNFEISTTLT
FT                   LWPRDITFEHYVKIFTDSSWYSGYINSLSYVVLNTIISITLALPAAYAFSRYTFVGDKH
FT                   LFFWLLSNRMAPPAVFALPFFNLYSAIGLFDTPWAVALAHCLFNVPLAVWILEGFMSGV
FT                   PREIDETAAIDGYSFPRFFVKIFMPLIASGIGVAAFFCFMFSWVELLLARTLTATNAKP
FT                   IAVTMTRTVSAAGMDWGLLAAAGVLTIIPGALVIWFVRNYIAKGFALGRV"
FT   gene            532386..532691
FT                   /locus_tag="Snov_0510"
FT   CDS_pept        532386..532691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0510"
FT                   /product="Protein of unknown function DUF2160,
FT                   transmembrane"
FT                   /note="PFAM: Protein of unknown function DUF2160,
FT                   transmembrane; KEGG: met:M446_1970 small integral membrane
FT                   protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87843"
FT                   /db_xref="GOA:D7A423"
FT                   /db_xref="InterPro:IPR018678"
FT                   /db_xref="UniProtKB/TrEMBL:D7A423"
FT                   /inference="protein motif:PFAM:PF09928"
FT                   /protein_id="ADH87843.1"
FT                   /translation="METGTSLLPESLAWMAWTWQTGLFFAVIASLLLVFTLLALWRPER
FT                   ARVGVLGIPTTRGDRLFITLLGSAFINLAWLGLVGPDLGWALALCLVYALAVFRLV"
FT   gene            532746..534509
FT                   /locus_tag="Snov_0511"
FT   CDS_pept        532746..534509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0511"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: rpe:RPE_1384 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87844"
FT                   /db_xref="GOA:D7A424"
FT                   /db_xref="InterPro:IPR014597"
FT                   /db_xref="UniProtKB/TrEMBL:D7A424"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH87844.1"
FT                   /translation="MLQSSSRGRLLLAASAVALIAFAAPARADEAAAKKWIDNEFQPST
FT                   LSKEDQLKEMQWFINAAKPFAGMEINVVSETITTHEYEAKTLAKAFSEITGIKLTHDLI
FT                   QEGDVVEKIQTQMQSGKNIYDAWVNDSDLIGTHFRYKQAVNLTDFMAGEGKDVTSPTLD
FT                   LNDFIGLSFTTAPDKKLYQLPDQQFANLYWFRYDWFTNPDYKAKFKAKYGYELGVPVNW
FT                   SAYEDIAEFFSNDIGTIDGVKVYGNMDYGKKDPSLGWRFTDAWLSMAGNGDRGLPNGLP
FT                   VDEWGIRMEGCRPVGSSVERGGDTNGPASVYAITKYIEWLKKYTPPQAGGMTFSEAGPV
FT                   PAQGNIAQQMFWYTAFTADMVKPGLPVMNADGTPKWRMAPSPHGSYWKDGMKLGYQDVG
FT                   SWTLLKSTPAERRKAAWLYAQFVTSKTVSLKKSHVGLTFIRESDIWSPSMTERAPKLGG
FT                   LVEFYRSPARVQWSPTGSNVPDYPKLAQLWWQNIGDASSGAKTPQAAMDSLAAAQDSVM
FT                   ERLERAGVQGECGPKLNAKKPMEYWVELAKKEGNLAPQPKLANEKPQGETIDYDTLIKS
FT                   WPATPPKKSTN"
FT   sig_peptide     532746..532832
FT                   /locus_tag="Snov_0511"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 29"
FT   gene            complement(534601..535581)
FT                   /locus_tag="Snov_0512"
FT   CDS_pept        complement(534601..535581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0512"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: dge:Dgeo_2171
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87845"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D7A425"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADH87845.1"
FT                   /translation="MRSLGTDGLRVSDIGLGCYGMSGEYGTPNDPESIATIHRALELGL
FT                   DFIDTSDAYSAGKNEQLVGEALKGRRDKAILATKFGNVRGPNGERGFTNGRPDYVPVAC
FT                   EASLKRLGVEVIDLYYLHRIDPDVPIEETVGAMARLVEAGKVRHLGICEAGVNTIRRAH
FT                   ATHPLAALQTEYSLWSRDVEAEILPTVRELGIGFVAYSPLGRGFLTGAFRTRTDLIEAD
FT                   RRHDHPRFKEGNFEQNVGLLGTIERIAKKHGAALSQVALAWLLSRGDDIVPIPGTKRRS
FT                   YLEQNWGARAVTLDEDDIAALDAGFPLHAAAGGRYPKGQLDKLGL"
FT   gene            535721..536476
FT                   /locus_tag="Snov_0513"
FT   CDS_pept        535721..536476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0513"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: bra:BRADO6233 GntR family transcriptional
FT                   regulator; PFAM: GntR domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87846"
FT                   /db_xref="GOA:D7A426"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A426"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADH87846.1"
FT                   /translation="MVDEAAGAGALRPMSVNPLEEMGGEAEARSLTSATYRRLKKDILA
FT                   CALQPGQRLKISDLAAQYGCSPGAVREALTRLVAEELVVSEDQRGFRVAPVSRSDLLDL
FT                   TQTRIDIETAALRHAIAKGGLDWQAGIVSTIFRLSNEPVLDDSGAPNPRWSKLHQDFHM
FT                   ALVAGCNSPRLMRLCLAYFHQSQRFRVLTIRYHERGRSADAEHRELADAVIGRDAERAV
FT                   RLLADHYNRTTNLIIDVDRDGDLSMLTAT"
FT   gene            536579..537316
FT                   /locus_tag="Snov_0514"
FT   CDS_pept        536579..537316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0514"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bja:bll7370
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87847"
FT                   /db_xref="GOA:D7A427"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7A427"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADH87847.1"
FT                   /translation="MDSAFIEPTLDAGAAVGQLVLVPGLGCTEQLFAGQVCRLARHSRV
FT                   RFADTRRDDTIAGMARRLLEEVDGPFALAGLSMGGYVAMEVVRQAPSRVTRLALLDTTA
FT                   APDAESAREFRLKLSDLALRGHLDEVHEALWPRLVAPSRRDDAVLEGQVYSMLVATGGA
FT                   AFARQQNAIIGRADSRPVLEGVAVPTLIVVGSEDIVTPVATAAEMAGLVPGARLTVVEG
FT                   SGHLSTMEAAATVADAMEEWLTH"
FT   gene            537402..539144
FT                   /locus_tag="Snov_0515"
FT   CDS_pept        537402..539144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0515"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: avn:Avin_21310 ABC
FT                   transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87848"
FT                   /db_xref="GOA:D7A428"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A428"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87848.1"
FT                   /translation="MSSIAAASGVARPSAASRWLSLETFVLGGAILSLVILVVLPVASL
FT                   VVASLWSEDGVTLAYYERALTGGSYLRALGNSLTLGAWVGLISVIVGVPLAWAVSRTNV
FT                   PGKPLIQATATLSYLSPPFLTSIAFVNLFSPNAGIINVLLRDVLGLGITFDIFTMSGLV
FT                   FVTALHTFPFVYLLASSALQSVDASYEEAAQILGASKIRTALTITAPLVAPAILSGTLL
FT                   AFVNAIALFGSQAIIGLPGRIVTLPTRIYALFDYPPQYGLAAALSLLFVAITVIALYLQ
FT                   RMFLARRSYVTLGGKGARSQLVDLGPWRWVLFGVCVLVCLFAVVMPFASLIAVSLSKSW
FT                   GLDFWQSLTLDNYRFILFEYDVTRRAILNSLVLATIAATACVALGAIIGWIDVRTKMPG
FT                   RRLLDYASLVPLGLPGIVMAVALLQFWLSVPYIVLYGTFAILLLAYIGRYVPLGVRAAN
FT                   SSLRQVDPSLEEAAHILGASWGHTMREITLPLIRPGLLAGWLLVFVPVVQELSASILLF
FT                   SSGTITLAVAVYNLYETGYIEPVSALAMVNMTIIVVAMLIAHRLGAGRKTVSDDSSTSF
FT                   GGAR"
FT   gene            539144..540232
FT                   /locus_tag="Snov_0516"
FT   CDS_pept        539144..540232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0516"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tga:TGAM_1014 ABC-type transport system,
FT                   ATPase component, putative Fe3+ transporter (FbpC/AfuC);
FT                   PFAM: ABC transporter related; Transport-associated OB
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87849"
FT                   /db_xref="GOA:D7A429"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A429"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87849.1"
FT                   /translation="MARILISGLTKSYTGNGAALSALDLDIKDNQFVTLLGPSGCGKTT
FT                   TLRLIAGYMTPDAGTIRVGDRVISSAEGVAPPDKRGMGMVFQNYAVWPHKTVYENVVFG
FT                   LKLRRIPSEEARRRVLETLALVNLTGLENRFPAELSGGQQQRVALARSLVVEPEILLLD
FT                   EPLSNLDAKLRERMRLELKQLQRRTGITFVYVTHDQAEALALSDQIAVMHGGKLQQYGT
FT                   PDDVYRRPANKIVADFMGIVNFVPGIARGGETIEIDGVEMRSPHAGGLVPGEPIDVAVR
FT                   PENVRLSRDGADGKRLTGTITEKTYLGNLIEYWVQLASGAVLRAQTHPLEQFDPGEAVG
FT                   LVIDAQESSVFPRGEASPSTKH"
FT   gene            540259..541185
FT                   /locus_tag="Snov_0517"
FT   CDS_pept        540259..541185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0517"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mms:mma_0818
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87850"
FT                   /db_xref="GOA:D7A430"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7A430"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADH87850.1"
FT                   /translation="MQSATAPKPVVTGREHWTKNGDAELFLWQKAPADGRTPAGTILFV
FT                   HGSSMASQPTFDLQVPGRPWSSAMDYFVDKGFETWCVDMRGYGRSDKRPGTRATIAEGA
FT                   EDLVAATDYIIRETGATSFHTYGISSGALRAAAFTELKPERVKRLALDAFVWTGEGSHT
FT                   LENRRKKLPDFREGERRPIDKAFVYSIFNRDHPGAAEDKVIEAFADGITALDDSMPNGT
FT                   YIDMCTRLPLIDPAKITVPTIIMRGEWDGIAGFDDLAAFFKLLPNPDKQFAVMPGISHA
FT                   SIQQKNYMIVYHILHAFFTQPDPVYRG"
FT   gene            541225..542262
FT                   /locus_tag="Snov_0518"
FT   CDS_pept        541225..542262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0518"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: tga:TGAM_1016 ABC-type Fe3+ transport system,
FT                   periplasmic component (FbpA/AfuA)"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87851"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:D7A431"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH87851.1"
FT                   /translation="MLKNAIVHRSVRCWLAAGAGLLIGSFAFAASAEEVDMAKAKAEGK
FT                   LVWYTSTAIGQANNLALMFEKQTGIKVELFRSGGSAILRRFMQEASAGKIAADVMTMSD
FT                   PAAADQLSEKGTFVAFKPKDFDKITETARNKDGYWIAQRLNAITIYMRGDKVPPAERPK
FT                   KWTDLTDAKYDGKLVMTDPSFTSVQLTTVGVLADKYGWDYYEKLNDGDIMIVQGNQQVA
FT                   DNIKRGERLIAVGALDVYIAADRRNGHDFVSIYPEDGTLLIPSPTGIIKGGPHPNAAKA
FT                   FAEFMISPEAQKTFPETGEYSARVDMAPPAGNPKVDEIKLMPVDYEKLETQAAEIKEKF
FT                   NDIFR"
FT   sig_peptide     541225..541323
FT                   /locus_tag="Snov_0518"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.837 at
FT                   residue 33"
FT   gene            542409..543254
FT                   /locus_tag="Snov_0519"
FT   CDS_pept        542409..543254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0519"
FT                   /product="5-carboxymethyl-2-hydroxymuconate
FT                   Delta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="KEGG: gdi:GDI_0995 putative fumarylacetoacetate
FT                   (FAA) hydrolase protein; PFAM: fumarylacetoacetate (FAA)
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87852"
FT                   /db_xref="GOA:D7A432"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D7A432"
FT                   /inference="protein motif:PRIAM:5.3.3.10"
FT                   /protein_id="ADH87852.1"
FT                   /translation="MKLCRVGELGKEKPALVDGNGRLRDISQVIGEIDGGVLERGDLGK
FT                   LAGLDVEALPLIAGTPRYGVPIANVSKMVCIGLNYSDHAKEAGLAIPSEPIIFLKAPSA
FT                   FCGPNDPTIIPVGSSKLDWEVELGVVIGKTTRNISEADAFSAVAGYCVVNDVSERAFQM
FT                   QSSQWDKGKNCDSFGPIGPWFVTKDEVPDPQALAMKASVNGTVMQDGSTSTMIFDVRTL
FT                   VSYVSRYMTLAPGDIIATGTPPGVGMGQKPEPIWLKAGDVVEIEIAGLGHQCQRVTARG
FT                   "
FT   gene            complement(543294..543806)
FT                   /locus_tag="Snov_0520"
FT   CDS_pept        complement(543294..543806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msl:Msil_3270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87853"
FT                   /db_xref="GOA:D7A433"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR022411"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D7A433"
FT                   /inference="similar to AA sequence:KEGG:Msil_3270"
FT                   /protein_id="ADH87853.1"
FT                   /translation="MQVRIRAVMAALLLLVPSQVNADGSGDPAAVSSSDGEYADKNGNP
FT                   TFKIDKDGTVDWYTSVGYIRYTANCMQCHGPDGLGSSFGPSLVDALKTLSYSQFTDTVT
FT                   NGKQNVSASQDLVMPAFGTNPNVMCYLDAIFVYLRARSDGALGRGQPQKNAPKPAGYSK
FT                   TEDACMG"
FT   sig_peptide     complement(543738..543806)
FT                   /locus_tag="Snov_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(543903..545039)
FT                   /locus_tag="Snov_0521"
FT   CDS_pept        complement(543903..545039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0521"
FT                   /product="putative GAF sensor protein"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; PFAM: GAF domain protein; regulatory protein MerR;
FT                   KEGG: rpe:RPE_2603 putative GAF sensor protein; SMART: GAF
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87854"
FT                   /db_xref="GOA:D7A434"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D7A434"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ADH87854.1"
FT                   /translation="MGKTDKDILTTADTARLLGVSIRTAQLLIEGGSVPSWKTPGGHRR
FT                   VYRADIMALIEKRAQDEALPSATVIVVAPAERLAFYERLFADVAECTAEVFDDVHDALF
FT                   AIGSARPYAILVDLDETDPERLALLNNVASNPSLGHTRLLAVAASARALPDRVLRLDAP
FT                   DQAPAAIRASLADAGEVIVAQDDLPFPIALNESQRLVALERSGLLDTAPEEAFDRLTWL
FT                   AARNLDAPIALLTLLTPTRQWFKSRFGLDLPETPRSWAFCNHTILQKGVFSVEDLSRDP
FT                   RFAKNPAVQGQPLFRFYAGAPVMDNEGFTVGSLCVIDYKPRKLDEREAQTLMALAALAS
FT                   DEVRLRAIDRQLRETLRRVERQAPVRTGTATAPHKRDH"
FT   gene            545425..547044
FT                   /locus_tag="Snov_0522"
FT   CDS_pept        545425..547044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0522"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: mrd:Mrad2831_0323
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87855"
FT                   /db_xref="GOA:D7A435"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A435"
FT                   /inference="protein motif:PFAM:PF00732"
FT                   /protein_id="ADH87855.1"
FT                   /translation="MITQAAHAEDRDFSRRAHENQARLTAGLKPSYDFIVCGAGASGSV
FT                   VARRLAENPDVHVLLIEAGGSDDAETVLDPAQWPANLGSERDWGFQAQPNPHLNGRALP
FT                   MSMGKGLGGGSSINVMVWARGHRSDWDHFAAEADDPAWGYDAVLDIYRRIENWQGAPDP
FT                   DYRGTSGPVWVQPAPDPSPIAGAMVDAARELGIPAYDHPNGRMMEGAGGAAISDALIRD
FT                   GRRHSLYRAYVRPMLDRPNLTVLTDTLVRRVLFTGRRATGVEIVRGGEVLIVGAEKEIV
FT                   LSLGAIHTPKVLMHSGIGDRAELDRFAIPVVQHLPGVGQNLQDHVSFGCIWDYAEPLAP
FT                   RNSGSEATLYWKSRPDLDAPDLLFCQLEFPVASERTAARGVPEHGWTMFAGLAQPASRG
FT                   RVRLQDSDPLAPVAIDANMLSDPADMDTAVACVELCRELGNAHAFRPLVRGEAMPGNLK
FT                   GEALRQFIREAAVTYWHQSCTAKMGRDPMSVVDASLRVYGVDGLRVADGSIMPRVATGN
FT                   TQAPCAVIGERAAAMLRTAHGL"
FT   gene            547189..547965
FT                   /locus_tag="Snov_0523"
FT   CDS_pept        547189..547965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0523"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: bja:blr2694 VirG-like two component response
FT                   regulator; PFAM: transcriptional regulator domain protein;
FT                   response regulator receiver; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87856"
FT                   /db_xref="GOA:D7A436"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7A436"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ADH87856.1"
FT                   /translation="MHQLVSVSRHEVPANPLDRPFPLGRVLVVDDDRDMRHAVIGHLNE
FT                   HRCHAVGCGVRDMPHHLRHDQFSLIVLDVQSGPPDRFAVLRQIRDRSPVPVILVACQRC
FT                   NDADRIVALELGADDCLIKPFDPRELLARAGAILRRQEMGRQLTARPVRGGYRFNGWEL
FT                   RRRTRRLTDPSGKAVDLTKGGYALLVAFLEAPLRPLSREQLLSATRTHQDVFDRSIDVQ
FT                   VLRLRRKLEPDPAQPRLIRTERGIGYVFDAAVETVF"
FT   gene            complement(547980..548891)
FT                   /locus_tag="Snov_0524"
FT   CDS_pept        complement(547980..548891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0524"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: scl:sce1410 putative AraC-like transcription
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; protein of unknown function DUF861
FT                   cupin_3; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87857"
FT                   /db_xref="GOA:D7A437"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:D7A437"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADH87857.1"
FT                   /translation="MTDPLSQIVQLLRPRAVYSKAMSGAGRWGVRYSDFGQPGFCAVIE
FT                   GRCLLTLDGKAPVALEEGDFVLLPATPAFTMSGFEPVALAPLDPRATPTPTGEVRHGRA
FT                   EGPPDVRLFGGHFTFESPDAALLVALLPAMIHVRGIPRLSQLVRVLGEEAGEDAIGRDL
FT                   VLARLVEILLIEALRAAPREDASPSLLRGLADPRIALALRQMHGEAERAWTVAELARGT
FT                   GMSRSAFFDRFARTVGICPMEYLLAWRMALAKDLLRGGHIALDEVARRIGYGSASTFST
FT                   AFSRHVGQPPGRFMREAARTAA"
FT   gene            548987..549730
FT                   /locus_tag="Snov_0525"
FT   CDS_pept        548987..549730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0525"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   scl:sce1411 putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87858"
FT                   /db_xref="GOA:D7A438"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A438"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH87858.1"
FT                   /translation="MKTILITGCSSGYGLETARYFHCRGWTVVATMRNPREDLLPSSER
FT                   MRILPLDVTNPESIAAAFENSGPIDVLVNNAGIGVVGAFEATPMEHVRKVFETNTFGVM
FT                   AMTQAAIRQFRARRSGVIVNVTSSVTLAAMPLAAAYTASKMAIEGFTASLAFELAAFGV
FT                   RVKLVEPGYAPTTRFAQNVDIDIADLIPPDYAPFAEPIFAEYAQPAMVTREIDVAEAIW
FT                   QAATDIEGRLRFPAGADAVALAQLG"
FT   gene            complement(549738..550619)
FT                   /locus_tag="Snov_0526"
FT   CDS_pept        complement(549738..550619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0526"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="KEGG: bpt:Bpet4157 LuxR family transcriptional
FT                   regulator; PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87859"
FT                   /db_xref="GOA:D7A439"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7A439"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADH87859.1"
FT                   /translation="MQAAERAITPEGTSHDAGLAQEIIGLYEAEPDLITLPAALFAGVG
FT                   RLIDADVVTYSEFHHTSGEFRSLLSVEDDPARRAEGIAAYARHMHSHAFWRYDPAFFGE
FT                   RALRESDFFSDEEFLALPIAREVFLPSNARHIMSIVMRHEAYVLTINGFRTIGRTAFSD
FT                   AARDRLEAFRPHIMRSYRQAFQRTLATLTPTDRLRIAFPELTPRQLEVGSWIARGKSNE
FT                   DIATILDVGVDTVKAHVKAIHAKVGADGRLAIAVIAHTIPPFARMPPLWRIGEDVWAGA
FT                   AQRERDRPRRAS"
FT   gene            550797..553289
FT                   /locus_tag="Snov_0527"
FT   CDS_pept        550797..553289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0527"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dma:DMR_29330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87860"
FT                   /db_xref="UniProtKB/TrEMBL:D7A440"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87860.1"
FT                   /translation="MWKDPVGNTPSIVQTNFGPWGTSLPADGESYCAPTSVVMGLYYLG
FT                   GNGFTQLAPASYAGPDDRESILFERLIAGIIGTSPTQGTGSLAGLADYFAARGLGLDQY
FT                   TYISTGIPDVQWLDTQLAPNYVEDPQWISLTVFSVGWFYKPKDDEPTCGCTLCNDGGHT
FT                   LAPLKVDLFTQKVTLNNAYPMSFLDVPNEPSSNPQTVELQLVPEGMTVEGLNDPQQYSE
FT                   VMTDILGSGDDFAILWLAESWIISASALPTTPGYAPATWQIDGPKSLNTNEATLTVLAP
FT                   LAGRGGFVKYGEGTLLLTNSNRLMGRNEVCNGTLASTLTTDTPFGTWTVVLRNGGALAL
FT                   APETSDPVAVEIASGHLARFIVDAGGGTLRLDGTNSYSVTLGGCDDGELPNIVLANDGT
FT                   LAIAPGGGISALGTSQKVLVTGTDGNLPIVTDGIVTPAILGIDTDLSGKFVTYDVTSGF
FT                   IAASPTLSTSLGINSVTVSTVYEVVDEQVIDSGAAPQLAALELNGGTVSGSGAQLLVGN
FT                   QAAGGVAGIIMNAGSIGVDTLTIGAAAAIVYASTSDGLEISSNLSGSGGLSLFGPGTLT
FT                   LSADNSGSLSGMVNVNTGTLIAAGTSATGSGTVQVHSAGRLEVTGSVAGPIDVAQGATL
FT                   HLENGTLEGAVSIAAVGDSPMPGGIFEGAGVISGEATIGGIVRPGPLTGILEFQATATI
FT                   AGSAMIYWRLEKLVADVDSKPGEGWNGYLFNDASSGVGLSGDAPMYLLEFAGLGVHPDA
FT                   GDPFWKQPRRWQFMMFPNGYANIWFGDGNLYYSAGNFGLVLESDNSVYLTWTPTDPQGP
FT                   AQRRRAQIAARNRSLSRK"
FT   gene            complement(553326..554093)
FT                   /locus_tag="Snov_0528"
FT   CDS_pept        complement(553326..554093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0528"
FT                   /product="putative hydrolase protein"
FT                   /note="KEGG: rlt:Rleg2_2054 putative hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87861"
FT                   /db_xref="GOA:D7A441"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7A441"
FT                   /inference="similar to AA sequence:KEGG:Rleg2_2054"
FT                   /protein_id="ADH87861.1"
FT                   /translation="MGLNSLISLSLAGGMLLALAAGVPAHAADPVRNVVIVHGALADGS
FT                   GWRKVHDLLVAKGYNVTVVQPPMTTLEADVAAARRILDLQEGPSVLVGHSYGGMIITEA
FT                   GNADNVASLVYIAAFQPDAGENLLDLAGRTPPATTGIKATEDGFLYLDPKVYAADFAAD
FT                   VPAAEAKFMANSQVFPSKVAFETRIKHPAWKGKKSWALIATDDRAINPELMRFMAKRAG
FT                   STPVEVKGSHAVFMSQPEAVAALIEKAAKAPAK"
FT   sig_peptide     complement(554010..554093)
FT                   /locus_tag="Snov_0528"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 28"
FT   gene            complement(554305..555336)
FT                   /locus_tag="Snov_0529"
FT   CDS_pept        complement(554305..555336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0529"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase"
FT                   /EC_number="3.5.99.7"
FT                   /note="TIGRFAM: 1-aminocyclopropane-1-carboxylate
FT                   deaminase; KEGG: smd:Smed_6456
FT                   1-aminocyclopropane-1-carboxylate deaminase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87862"
FT                   /db_xref="GOA:D7A442"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005965"
FT                   /db_xref="InterPro:IPR020601"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D7A442"
FT                   /inference="protein motif:TFAM:TIGR01274"
FT                   /protein_id="ADH87862.1"
FT                   /translation="MSLFVSLLDKFERYPLTFGPTPIEPLPRLSAALGGKVEIYAKRDD
FT                   CNSGLAMGGNKLRKLEYIVPDAIACGADTLVSIGGVQSNHTRMVAATAAKIGMKCVVIQ
FT                   EKWVPHYDAVYDRVGNILMTRLMGADSRLIDAGFDIGIRQSWEDAIRSVEAMGGRPYPI
FT                   PAGASVHKFGGLGYVGFAEEVARQEEELGFRFDYIIVCVVTGSTQAGMIVGFAHQGRAE
FT                   RVIGIDASGTLERTRAQVRRIVDDTAELVGLGRTVREDEIVINPDYAYPAYGVPSEETN
FT                   EAIRLAARTEAMITDPVYEGKSMQGLIDLTRKGFFPDGSKVLYAHLGGVPAINGYSYYY
FT                   KDG"
FT   gene            555494..555970
FT                   /locus_tag="Snov_0530"
FT   CDS_pept        555494..555970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0530"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="KEGG: smd:Smed_6457 AsnC family transcriptional
FT                   regulator; PFAM: Transcription regulator, AsnC-type-like;
FT                   SMART: Transcription regulator, AsnC-type"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87863"
FT                   /db_xref="GOA:D7A443"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A443"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADH87863.1"
FT                   /translation="MEDPFTPSLDRTDMRILRALQAEGRLTNAELALRVNVSAATCHRR
FT                   TQRLFDEGYITGVRAQVAPAAVGLGALVMVGVVLDRSTPESFAAFEEAVLKLKEVLDCN
FT                   LVAGDFDYLLKIRVRDMADFNKLHGQKLIALPGVRQTRTFFVMKEVKEDARLPF"
FT   gene            complement(556037..556330)
FT                   /locus_tag="Snov_0531"
FT   CDS_pept        complement(556037..556330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0531"
FT                   /product="putative ATPase with chaperone activity"
FT                   /note="KEGG: bpt:Bpet4107 putative ATPase with chaperone
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87864"
FT                   /db_xref="UniProtKB/TrEMBL:D7A444"
FT                   /inference="similar to AA sequence:KEGG:Bpet4107"
FT                   /protein_id="ADH87864.1"
FT                   /translation="MVDTAEVAASICLARPDPETYGELASFALPIIDVDMRHQIAEALT
FT                   AIIAQAEATRRNALKLPGGSAEVIASSEHIVVCAKRIWQLIDDPQGSGKRRR"
FT   gene            complement(556492..559431)
FT                   /locus_tag="Snov_0532"
FT   CDS_pept        complement(556492..559431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0532"
FT                   /product="transcriptional regulator, winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   NB-ARC domain protein; KEGG: bja:blr6255 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87865"
FT                   /db_xref="GOA:D7A445"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7A445"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ADH87865.1"
FT                   /translation="MIERDAASVGQLSFGPFTFFPGQQLLVEDETPINLGSRARAILLA
FT                   LLEQQGEVVSKAQLIQRAWPDTFVEEANLRVHIGALRRALGDGQDGRRYIVNIPGRGYS
FT                   FVFPVERSDAVGAREMPPALAADSPSLPPALARIVGRSETVQQVKALLVEQRFVSIVGP
FT                   GGIGKSTVAIAVAHEMRGRFSEGVCFVDLSALGDPQLVPAALAAALGVGLRSESPTQSL
FT                   IAATRAKPLLLLLDSCEHVIETVSHLAEQLFGNGGEDLHILATSREPLRVEGERIHRLS
FT                   SLDVPPTRANLSSAEALAYPAVQLFVERAAANLGGFQLTDAEAPLVAYLCRRLDGIALA
FT                   IEIAAGRVESLGVAGLASRLDDRFRLQLQGRRTALRRHQTLSTLLDWSYALLPPFEQLV
FT                   LRQLAILAGNFTMDDAVAIIADDEATDSEIVNAVANLVEKSLITADVHGLQAHYRLLDT
FT                   TRAYAAVKLAESGKVELLRRRHAAIFRDALHRANLAWEIQPAPAWTEDHRHLIDNVRAA
FT                   LDWAFSPKGDAEIGVALTLGAVPLWFQLQLIAESHQQVRLALASTDLDRAPHIQMRLQA
FT                   VLAWSLMQIRGQVDETRTAWERTLELAEALDDRDYQLRALWGLWSGLLNQSRFREALAL
FT                   AHRFAEVAARGSDLNDSYVGYRMIGYILHLLGRQTEARRYLEPMVKGYVVPITGSQIIR
FT                   FVFEQKATGRCFLARILWLQGSFDAAIAEIDDIVASAEASDDRLTLCQVLVQAACPVAF
FT                   FADDLVRARRFVGMLVDESARDGIEFWQVWGQCFAGVLMIREGDLSNGIKSLGEALGRL
FT                   RNISYGVYYIVFLAEYAAALAQVGEFDRALSCLEEALARSEQNEEGWFAPELWRLAGEL
FT                   AALRGGTDAGGEAEQRLATALNIAREQEALFWEIKAAVSLARLWQRQDRVREAEALLAP
FT                   LVSRFAGSLDQPLLREAAELSDRLKTAASPVGKSKYRKPLDGPATRTLQ"
FT   gene            complement(559532..560323)
FT                   /locus_tag="Snov_0533"
FT   CDS_pept        complement(559532..560323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0533"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mlo:mll4146 sugar ABC
FT                   transporter permease protein ThuG"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87866"
FT                   /db_xref="GOA:D7A446"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A446"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87866.1"
FT                   /translation="MLRRSLLYWGALLPLLGLNLFPFAVALDTIYRRRGGEDMGAFWAG
FT                   MWLRTELGTSLVNSLVIALATAIASTLVALPAAYALSRFRFRGRRAFSEALLGTQMLTP
FT                   IMLVLGLSQMIAGMGLTDTRFALVLLYSAFQVPFAVWMLRGYIDAIPVELEEAALLDGA
FT                   SRRQILGSIILPLSVPAILVTATFAFITAFNEFVLALTLLRSPANFTLPLRVNALTAGR
FT                   YAVDWPDVMAAVLVASLPVLIMFIGLQRYMLRGLRLSLGAT"
FT   sig_peptide     complement(560243..560323)
FT                   /locus_tag="Snov_0533"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.926) with cleavage site probability 0.656 at
FT                   residue 27"
FT   gene            complement(560316..561224)
FT                   /locus_tag="Snov_0534"
FT   CDS_pept        complement(560316..561224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0534"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mlo:mll4147 sugar ABC
FT                   transporter permease protein ThuF"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87867"
FT                   /db_xref="GOA:D7A447"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A447"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87867.1"
FT                   /translation="MPAADIKSTQSRLTQNRNLLLLLLAPSAMATGLIALVPVLLLVRM
FT                   SLSEVSRFGRIGAYVGWENFARLAADPLLPAILLRTGIWTGSVVAGTVLIALPTALILN
FT                   QRFLGRGLAQFLVLAPWAISVASMAVVWRHALTDEGGLLNRLAVAAGLLDRPIPWLGSV
FT                   PAAFGFEILIAILVSVPFSTVILLAGLSSIPDDLYDAARLDGARAVDRLKFLTLPLLRP
FT                   FIWIVLIFNIAYVTNSFPIIWILTQGGPANGTDILVTYLYKLAFTFGRLDEAAALSILL
FT                   LGGLAALTILMLRALERPAHA"
FT   sig_peptide     complement(561132..561224)
FT                   /locus_tag="Snov_0534"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.897) with cleavage site probability 0.639 at
FT                   residue 31"
FT   gene            complement(561211..562434)
FT                   /locus_tag="Snov_0535"
FT   CDS_pept        complement(561211..562434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0535"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: oan:Oant_3895 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87868"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D7A448"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH87868.1"
FT                   /translation="MTRLAKIFLILSLALLSLGIPGAQAVDLRFTAGEYSGFTRPFLER
FT                   VARDYEVLHPGTRIQIEVIPWDSYLQKLTTDISSGDQPDLSIVPTMWISDLAADGLLEP
FT                   LDGLASPEFKAKFIPAFLVPATVKGQLLGFPAAASARAMVVNTELLQKAGAPEPKTWDA
FT                   LRTAAQKIAALPNTYGFGLPGKEVEVDTYFYYALWGFGGEIIKDGKSGLSSPEAIRAAT
FT                   FYMSLINDKATEPAPTAHSREDIFKLFKEGRIGIIFTYPMLVPQLKTEAPNLKYAVMPF
FT                   PVETKPVTLGVTDVLTMSSSSKNKQEAFDFLQFLYSDKYRTEFDRAEGLLPVTVSEAAS
FT                   SYYKDNPDIAAFAAGLAYARFFPTIKGWPEISDITVRALQTMYLGQKTSTEAMTDAARQ
FT                   IDDVLARR"
FT   sig_peptide     complement(562357..562434)
FT                   /locus_tag="Snov_0535"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(562903..563268)
FT                   /locus_tag="Snov_0536"
FT   CDS_pept        complement(562903..563268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0536"
FT                   /product="conserved hypothetical protein; putative inner
FT                   membrane protein"
FT                   /note="KEGG: efe:EFER_3975 conserved hypothetical protein;
FT                   putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87869"
FT                   /db_xref="GOA:D7A449"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:D7A449"
FT                   /inference="similar to AA sequence:KEGG:EFER_3975"
FT                   /protein_id="ADH87869.1"
FT                   /translation="MPERREARAPGLQPERTALSWSRTGFLALLVAALLGRAGTPAASL
FT                   IELALILLLVPMAGLFLYRGFRIPCDGNAKHDDVAERRSALLFVCLGIAALAGLHGMAT
FT                   LGRIVVYLQSHGIDMRM"
FT   gene            complement(563274..563618)
FT                   /locus_tag="Snov_0537"
FT   CDS_pept        complement(563274..563618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0537"
FT                   /product="protein of unknown function DUF202"
FT                   /note="PFAM: protein of unknown function DUF202; KEGG:
FT                   pct:PC1_2741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87870"
FT                   /db_xref="GOA:D7A450"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:D7A450"
FT                   /inference="protein motif:PFAM:PF02656"
FT                   /protein_id="ADH87870.1"
FT                   /translation="MRWWQTGTRPDYRFSLANERTFLAWIRTALALIAGAVGIDQFASH
FT                   LGSPLTRLSLALVLFCAGGTLAATAYMRWARAERAMRHDADLPRSLLLPLLATLTALLA
FT                   TALAWLVVTS"
FT   gene            complement(563657..564073)
FT                   /locus_tag="Snov_0538"
FT   CDS_pept        complement(563657..564073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0538"
FT                   /product="protein of unknown function DUF126"
FT                   /note="PFAM: protein of unknown function DUF126; KEGG:
FT                   mms:mma_2389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87871"
FT                   /db_xref="InterPro:IPR002840"
FT                   /db_xref="UniProtKB/TrEMBL:D7A451"
FT                   /inference="protein motif:PFAM:PF01989"
FT                   /protein_id="ADH87871.1"
FT                   /translation="MAQTLLCHPGIGPDVEGIALVASDDFSARYDLDRIKGVFSRPAHK
FT                   LFGEDYRERVLVLNNVKGGVASAWMLNEMASRDVKPAAFVFNRVNPILAQGAALAGLPL
FT                   VDRFADGDVTTLICNGERIRVRPSEGQVILLDRP"
FT   gene            complement(564073..565317)
FT                   /locus_tag="Snov_0539"
FT   CDS_pept        complement(564073..565317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0539"
FT                   /product="protein of unknown function DUF521"
FT                   /note="PFAM: protein of unknown function DUF521; KEGG:
FT                   mms:mma_2388 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87872"
FT                   /db_xref="InterPro:IPR007506"
FT                   /db_xref="UniProtKB/TrEMBL:D7A452"
FT                   /inference="protein motif:PFAM:PF04412"
FT                   /protein_id="ADH87872.1"
FT                   /translation="MKLNEEERALLAGEGGRARQWAIRHQIEVGRFFDAEDMVEVDQAH
FT                   VMADPESLGEAGVRWLSDMAGLPEAERRVRVPTITDPRGVDFAAYKRLHQTDEMATLEE
FT                   RAIRAFEAMGVLMTNTCINYQTILPPVRGEHVAFGDTGVVIYSNAVFGARSNFEGGPSA
FT                   IAAGLTGRTPRYGYHLEKNRLGTKLFELRHQPKDFSEWGALGAVVGRGSGSYWAVPVIT
FT                   GVENAPTSDDLKHFGAALASFGSVAMFHMPGVTPEAPTLADAFDGPPPPASPITAEDIA
FT                   NVYEGYAARGDKVDVVVFSAPQLSLIELEKVANLLDGRRVHSGTTLIAATSPEIKFAAD
FT                   RMGLTRRIEASGGIVLSGVCFYQSYAREMAEANGWSRLMSNSAKLVNIIGGYGYKPTLA
FT                   TMERCVDSAVAGKVL"
FT   gene            complement(565314..566588)
FT                   /locus_tag="Snov_0540"
FT   CDS_pept        complement(565314..566588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0540"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="KEGG: rpa:RPA1784 TRAP dicarboxylate family
FT                   transporter DctM subunit; TIGRFAM: TRAP dicarboxylate
FT                   transporter, DctM subunit; PFAM: TRAP C4-dicarboxylate
FT                   transport system permease DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87873"
FT                   /db_xref="GOA:D7A453"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D7A453"
FT                   /inference="protein motif:TFAM:TIGR00786"
FT                   /protein_id="ADH87873.1"
FT                   /translation="MTSGIAITVLFLLLMVASLPVFVAMGIAGFLGFALSKGLDGALYG
FT                   FTETLWQATHVYELIAIPLFILTGTVMQQSGAGRDLFAVVNAFAGRVRNATGVATILAC
FT                   GIFAAICGSSIATAATVGLVAVPALREQGYGDARAGGFVAAGGTLGILIPPSIPLILYG
FT                   IITDTSIGQLFIAGVVPGILMMGVFAAYALWSRPQVVVNGSEGGDRWALLRGSVGVLLL
FT                   PPVIVGAIYLGLFTPTEVGALAVIYVAGLGLLQRRLDGRKLVAAVLAATRTTVMLMMLI
FT                   VFGQYFAHYLTYEEVPQIIAQSITQVPGGPLVTITLVVLVYLLLGMFLESAAMLLISVP
FT                   IFFPVAMAIGMDPLTFGIFAIMAMEIAQISPPVGINLFTIHGISRIPLERLALGVLPFI
FT                   GIQIVFLYLIFFMPEIVLWLPGQMK"
FT   sig_peptide     complement(566517..566588)
FT                   /locus_tag="Snov_0540"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.806 at
FT                   residue 24"
FT   gene            complement(566591..567076)
FT                   /locus_tag="Snov_0541"
FT   CDS_pept        complement(566591..567076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0541"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: bpt:Bpet2787 putative
FT                   integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87874"
FT                   /db_xref="GOA:D7A454"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D7A454"
FT                   /inference="protein motif:PFAM:PF04290"
FT                   /protein_id="ADH87874.1"
FT                   /translation="MISRFLDIAARAFTAASATIVAILALPVAYDAISRSLRHPSIWVF
FT                   DVSLYLMIAAAFLGNAYALRSGAHFRMMMAVDMAGPRVRHWADRLTFLVTFLFAVAMTW
FT                   LSAGYVAENYQLGFTSGTLFDAPLWIPQLAMPLGGLSLAIEALRRLILDDYPDVLEG"
FT   gene            complement(567110..568108)
FT                   /locus_tag="Snov_0542"
FT   CDS_pept        complement(567110..568108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0542"
FT                   /product="Extracellular solute-binding protein, family 7"
FT                   /note="PFAM: Extracellular solute-binding protein, family
FT                   7, bacteria; KEGG: rpt:Rpal_5036 TRAP dicarboxylate
FT                   transporter-DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87875"
FT                   /db_xref="GOA:D7A455"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D7A455"
FT                   /inference="protein motif:PFAM:PF03480"
FT                   /protein_id="ADH87875.1"
FT                   /translation="MKTTVKLVVALAATLFVAPALAQDKITLSLATWGASSHPQVKTYA
FT                   KVFMDEVVKRTNGKVEWKYFPDDTMVKQAFVPSAIPGGQVDISLTTLDNWIGRVPQVAI
FT                   TASPLWTLTMEQAQAELQPERPLFKHFEELLAKQNTKLLSLFDIGAPALFSKFDARDPA
FT                   SLKGRTLRAYSKGASQSLQALGAAPVTMGVADVYSALQRGAIDGALGGLQGAYGLKHYE
FT                   VTKYALGTGGVLGALINGYVMNRRSFERLPDDVKKAVLEATQVALDTTNKEIAQSYQQY
FT                   LADTRKHGLEVSELKPGTPERAAWEAALKDYREEIKDEFPAETVALVTSVR"
FT   sig_peptide     complement(568040..568108)
FT                   /locus_tag="Snov_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(568152..569594)
FT                   /locus_tag="Snov_0543"
FT   CDS_pept        complement(568152..569594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0543"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: bbr:BB4315 putative
FT                   sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87876"
FT                   /db_xref="GOA:D7A456"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR032506"
FT                   /db_xref="UniProtKB/TrEMBL:D7A456"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ADH87876.1"
FT                   /translation="MPAPSNVLIIMSDEHNKAITGCYGNAVVATPNIDALAARGTLFEA
FT                   AYTNCPVCVPARASFACGRYVHDIGHWDNADPYDGTQRSWHHHLRASGHEVTSIGKLHF
FT                   RSAADDYGFTESLIPMHVVEEKGDLLGLVRDELPKRKGAWKMARLAGPGESSYTFYDRD
FT                   ILARAQIWLRGAAARARAKPWALFVSFVAPHFPLTAPPEHYYRYYDDARLQWPKLYETQ
FT                   ARPEHPYLREYAECFAYDEHFAGPDDVRRALAGYYGLVGFLDENIGKLLATLDATGLSQ
FT                   DTRVVYVSDHGDNLGARGLWGKSTMYEEAVSVPLIAAGPGFEPGKRVRTPVSLVDLSAS
FT                   ILSWCGEEKPTDWPGEDLAGDLPPDRAVFSEYHGMGSKSGFYMLRDRRFKYVHYVDHRA
FT                   QLFDLEADPQELNDLADDPAFSDVRAQLNARLCAICDPNDTDRRAKARQAEQLHRNGGR
FT                   EAVIARGDLGFSPPPGFSPDFM"
FT   gene            569662..570438
FT                   /locus_tag="Snov_0544"
FT   CDS_pept        569662..570438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0544"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: bbr:BB4313 GntR family transcriptional
FT                   regulator; PFAM: regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87877"
FT                   /db_xref="GOA:D7A457"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A457"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADH87877.1"
FT                   /translation="MPVVTMERSFPLEAVRDLADRDVSGRAKYAVLTECLRTMILAGNL
FT                   PAGTRLPTERDLATLSGLSLGTVQRALRTLVEEGYLTRTPKLGSFVTERTQIRQPWHCR
FT                   FLAEDGRTVLPVSPTTRKRLVIEEVGPWTAHLGPAAAGYLYIERDFNVAGEFSVDSRFW
FT                   GDANRLSALRSGPVSQLDGENLKHLIASRCHLPVTHVIHKLRYARQGQEPARLILTALT
FT                   WSHEAPLYYQEFTIPPNSRELLVSDEIEQSAAFGIE"
FT   gene            complement(570495..570755)
FT                   /locus_tag="Snov_0545"
FT   CDS_pept        complement(570495..570755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_6181 putative type-I PKS"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87878"
FT                   /db_xref="UniProtKB/TrEMBL:D7A458"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87878.1"
FT                   /translation="MCDDCFDDEDAAPTDFPLVDIARAARMIERDIAGELAPEEAWAVY
FT                   FGEASGALDWRVLDRLARSVDAAKLLLSLSGAGRRPHLQPS"
FT   gene            complement(570768..572054)
FT                   /locus_tag="Snov_0546"
FT   CDS_pept        complement(570768..572054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0546"
FT                   /product="sigma-70 region 3 domain protein"
FT                   /note="PFAM: sigma-70 region 3 domain protein; KEGG:
FT                   bav:BAV1914 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87879"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7A459"
FT                   /inference="protein motif:PFAM:PF04539"
FT                   /protein_id="ADH87879.1"
FT                   /translation="MNAHPPAAALRSANVTPLARLDIPGGGEVVLHRGHAFIGHMSPPL
FT                   GTSIYDLADPRKPRLVAQIAPKDGFSHTHKVKVAGDLMITNVERHRRHFYRKGERIEAV
FT                   TAELAAHLGRPPQEAEIAAALGVKEGDVADLRAGLARGYDDGGFRVWDIADPAHPRELA
FT                   YVKTGGIGVHRFDMEERYAYISTEMAGYVGNILVIYDLADPTRPREVSRWHLPGQHVSA
FT                   GETPTWSGQRHRLHHALRVGDVMWAACWYAGAYAIDVSDINRPHTIGSFNYHPPYPEPT
FT                   HTFFPLVQPLGGRNVALAIDEEHDHVPGQPHAFLWVLDIADLTKIAPISTFHVGEAASP
FT                   YATAGGRFGAHQFQERQVGSLVFATWFAGGLRVIDLADPTLPKEIGHFIPARASGHVAP
FT                   QSNDVDVNADGIVCLLDRDCGLDILQFEG"
FT   gene            complement(572051..573571)
FT                   /locus_tag="Snov_0547"
FT   CDS_pept        complement(572051..573571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0547"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112
FT                   transmembrane; KEGG: sme:SMc00500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87880"
FT                   /db_xref="GOA:D7A460"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:D7A460"
FT                   /inference="protein motif:PFAM:PF01970"
FT                   /protein_id="ADH87880.1"
FT                   /translation="MNLSLSLLSDQFLLNFSYLWLIVIATTIGIIIGAMPGFGSANTII
FT                   MLLPFTLAVDVEVAMIFMVSLFVASHMGGGITSILLNIPGNGGSAATCLDGYPMARKGL
FT                   GQQALVLSFVASTVGGMVTALMSIFLLPYIARLAFYMHSVEMVVILLFGITLIASVASD
FT                   NMLKGLIAGFLGLLIGAIGADHIYSTPRGTFGFIELYDGVPLIAVLIGVFAISEALIMM
FT                   ESSSVLSDTGKQMMRQSGWKETWEGVVWSFQRTWHMIWTGIIGLIIGIVPGAGASIAAF
FT                   VAYQQSRLYSKTPEKYGTGIPEGVIAPESANNGCASGDLIPLLVIGVPGGTTAAVMLIV
FT                   MTYHGVQLGPRLFIQNPGIGYGVFITMLIAYAVMLFTTLPLTRWVSKLVLIPTPVLAPI
FT                   IIAFTLVGAFAPRGYMFDLWLTLLFGAIGYVCRRTGFNVVALLIGVILGPMLEANVMRA
FT                   LRISGNDPWVFFSSPVGNILWAALAVSLAIPSIVQWRRNRAAARTATA"
FT   gene            complement(573602..574105)
FT                   /locus_tag="Snov_0548"
FT   CDS_pept        complement(573602..574105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0548"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpb:RPB_4418 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87881"
FT                   /db_xref="GOA:D7A461"
FT                   /db_xref="UniProtKB/TrEMBL:D7A461"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87881.1"
FT                   /translation="MNDDRKAKVATGADWIIPVLGAIFATYYLISIKDLDWEAKVSGVF
FT                   CAVMLFGLIGIFALRTAIGLLRGTHYLEFRSLYESHRLAVLRGSLFALTVTSVAVIPWA
FT                   GFTLSTFGFLFACFLWLQRMSVRAAAITAGALALGGYVLFILILRTSFPQGPFESLVST
FT                   LTGL"
FT   gene            complement(574171..575172)
FT                   /locus_tag="Snov_0549"
FT   CDS_pept        complement(574171..575172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   dia:Dtpsy_0125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87882"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D7A462"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ADH87882.1"
FT                   /translation="MTIMLDRRHVLMAGAGALAASLARPARAAGDFPDKPIQVLIPTGE
FT                   GGGVDQAARAFNRIWSKYLGANFEYSYFPGASGQVGYEVFISKRPADAYNILFGNIGPE
FT                   MIMYATQKVKYKYQEDFTYIGSMDIDDSVIWVGSSSKFKTIQELVEEGKKREITLSTSR
FT                   LPHPSTIGALALAEATGMKVRMIPYGGGGPARSAAITGEVDGCATFLSSSLGLGDQARF
FT                   LTVFNDTNRAPELTNNAPPVNQALGTKIPQMSGQRAIAIHTKAVEAYPDRVKKLTDSFK
FT                   QVFADPEYKTVAEKAGTPWEFIQYGDAASCQESAKEFVELADRFRSLLTATK"
FT   sig_peptide     complement(575086..575172)
FT                   /locus_tag="Snov_0549"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.987 at
FT                   residue 29"
FT   gene            complement(575447..576514)
FT                   /locus_tag="Snov_0550"
FT   CDS_pept        complement(575447..576514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0550"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   smd:Smed_5823 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87883"
FT                   /db_xref="GOA:D7A463"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR016846"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D7A463"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADH87883.1"
FT                   /translation="MPDPVLIPARPGAIYRKQPRRSSSMSGDDHYLPLALINILGIAGI
FT                   VVWHLQGPSRPTGRLIVQILFFAGMSLVLYAGGIAPQQPDDVYTEGFAALLSKSARVLW
FT                   WTHLAWTIIGLIHIYVRLNRKPREAHLILDMAVAVIYLGVALSVMGFVFGMPVASLVTT
FT                   SGVVALILGLALQNTLGDVFSGIALTLGKAYAIGDWVQLSDGTAGRVTETNWRSTNLLT
FT                   AANNIVVLPNSMLARQGLTSLSRPDETHQITLGVRFAAVQSPRLIEEAMRSVLQASTRI
FT                   VQDPPPAVALKSIDAIAIDVELQFRVASLAVGTLAKNEIIDLIHGHRKADGLSLALPAQ
FT                   SLVFVPAPQATIVRL"
FT   gene            complement(576567..577484)
FT                   /locus_tag="Snov_0551"
FT   CDS_pept        complement(576567..577484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0551"
FT                   /product="beta-lactamase-like protein"
FT                   /note="KEGG: mdi:METDI4456 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87884"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D7A464"
FT                   /inference="similar to AA sequence:KEGG:METDI4456"
FT                   /protein_id="ADH87884.1"
FT                   /translation="MNLQNTAAPRRTGHEELVPSRYAVRVGEIDVLIVSDGVLPLPTKM
FT                   LGHNAEPAARAAWLNDMFLPTEAFDWALNVVVVRSGGQTILVDAGLGLDPDLNLPRAGQ
FT                   LIKRLAAVGIDLAAVTDVVLTHMHMDHVGGLLIDGVKERLRPDLRIHVAAAEVEFWKAP
FT                   DFSHVNMPAGFPDALRAAAKRFAKEYQSHLRLFDEEAEVAPGVVVSRTGGHTPGHSVVR
FT                   VASGGDRLMFAGDAVFAVGFEHPEWYNGFEHDPEEAARVRVRLLKELAATGSSLVATHL
FT                   PFPSVGHVAVEGDHFRWVPVFWDY"
FT   gene            complement(577603..578808)
FT                   /locus_tag="Snov_0552"
FT   CDS_pept        complement(577603..578808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0552"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bja:bll2792 putative dehydrogenase,
FT                   oxidoreductase FAD flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87885"
FT                   /db_xref="GOA:D7A465"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A465"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADH87885.1"
FT                   /translation="MRLVIIGAGFAGMYAALSAARLRNLQGVSPEELEIELVAPQPTLV
FT                   VRPRLYEPKPETLTAPLLPVLEEIDVRYVQGTAETVDTRSNSVGIVTGGGERRTLAYDR
FT                   LVLATGSRLFRPDIPGVAEHVFSVDQLDDAVALDRHLHALARRPASAARDTVVVAGGGF
FT                   TGIEAATEMPARLRTILGDKAGIRVVIVDRNDAIAPDMGAGPRPVIENALRKVGVETRL
FT                   GAGVAAVDADGVTLAGGERIESATVIWAAGMRAAPLTQQIPAERDNSGRLLVDRALRVP
FT                   GVGGVFATGDAAKAACDDIGNYALMSCQHATRMGAFAGHNAAAELLGVPTIAYHQEAYV
FT                   TCLDLGDAGALFTRGWDRQVEFVGAEAKKMKQEINTVWIYPPRAQRNVALASAEPERVT
FT                   DL"
FT   gene            complement(578913..579878)
FT                   /locus_tag="Snov_0553"
FT   CDS_pept        complement(578913..579878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0553"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: oca:OCAR_6762
FT                   non-heme chloroperoxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87886"
FT                   /db_xref="GOA:D7A466"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7A466"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADH87886.1"
FT                   /translation="MIGPLPHLSRRNVLVTALAGAVSATVRTSSAEGASNDHIAERNRI
FT                   MRTVTTKDGVQIFYKDWGPKTGQPIFFHHGWPLSSDDWDAQMLSFAGRGYRVIAHDRRG
FT                   HGRSTQVSDGHDMDHYAADVAAVVEHLDLRNVVHVGHSTGGGEATRYVARHGKGRVARL
FT                   VLISAVPPLMVKTSANPGGLPIEVFDGLRAKLAANRSQFYLEFASGPFYGYNRPGAEPS
FT                   QAVIWNWWRQAMMGGAKAQYDGIRAFSETDFTDDLTRITVPTLVMHGTDDQIVPIADSA
FT                   PLSAKLVKNGTLKTFEKLPHGICTTHADLVTAELLAFVAG"
FT   sig_peptide     complement(579783..579878)
FT                   /locus_tag="Snov_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.764 at
FT                   residue 32"
FT   gene            complement(579975..580925)
FT                   /locus_tag="Snov_0554"
FT   CDS_pept        complement(579975..580925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0554"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: bja:blr5120 transcriptional regulatory
FT                   protein; PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87887"
FT                   /db_xref="GOA:D7A467"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D7A467"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADH87887.1"
FT                   /translation="MDDTILRVPSLEDLFRTSEPIQEQPWTGARPTADEMARVLGTTPR
FT                   RIVTELSGSSIAHWNHGELHDVVEPMKDHVIMTYIGTMQRLERRTGRSLASGTARPGVV
FT                   TIIPSGTSSRWDIGGAVDVLQLYLPHAILERVAAEADTSGPAPLLERTGHLDPTTSRLL
FT                   MSASEVLDGSEALDALFRQQLTELLATRLLSAHTGAGASLQLALGGLAPTALRRAIERL
FT                   RSDDDADLSLAALAADAHLSRFHFCRAFKQSTGLSPHAWLRQHRLAQAMTMLRDTDESV
FT                   VSIAVTLGYGSQSAFAAAFRRLTGETPSDWRRRAR"
FT   gene            581144..582721
FT                   /locus_tag="Snov_0555"
FT   CDS_pept        581144..582721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0555"
FT                   /product="transcriptional regulator domain protein"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: oca:OCAR_6759 transcriptional regulator, CadC-family"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87888"
FT                   /db_xref="GOA:D7A468"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7A468"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ADH87888.1"
FT                   /translation="MKYHFADCVLDLDRRELTRASQSVAVGPQVFDLLVHLVENHERVV
FT                   SKDGLLDAVWNGRIVSESTLTSHINAVRKAIGDSGAEQRLVRTVARKGFRFVGDIQQVG
FT                   MSEASRDAAIMPEIAIPATAVTAHKPSIAVMPFQNLSGDPEQDYFADGVAEEIITALSR
FT                   VRWLFVIARNSSFAYRGRAADVQQISRELGVTYVLEGSVRKAADRIRITGQLVNASTNG
FT                   YLWADRFEGALDDIFTLQDRISGNVVGAIAPQMELAEIERARRKPTENLSAYDCYLRGL
FT                   AHLHRGGRESVEEALPLFRKAIELDGEFAPPYAMAAWGYFWRKVNGWTIDPVQETAEGI
FT                   ALARRGVELGRDDAVVLARAGHALAHLAGEFESGIGLLDRALFLNPNLAPAWFLGGFLR
FT                   VWHGEPEAAIDYFEHAMRLSPVDPELYRMQAGIAMAHLFAGRFETASLWADQAQRNLPS
FT                   FLMAVATGAASQALSGRTEEARRTMDQLRELAPALHISGLKDWLPIRRQEDFALFADGL
FT                   RQAGLPDK"
FT   gene            583009..583082
FT                   /locus_tag="Snov_R0008"
FT                   /note="tRNA-Gly1"
FT   tRNA            583009..583082
FT                   /locus_tag="Snov_R0008"
FT                   /product="tRNA-Gly"
FT   gene            complement(583367..583876)
FT                   /locus_tag="Snov_0556"
FT   CDS_pept        complement(583367..583876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0556"
FT                   /product="protein of unknown function DUF995"
FT                   /note="PFAM: protein of unknown function DUF995; KEGG:
FT                   rhi:NGR_b17890 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87889"
FT                   /db_xref="InterPro:IPR009337"
FT                   /db_xref="UniProtKB/TrEMBL:D7A469"
FT                   /inference="protein motif:PFAM:PF06191"
FT                   /protein_id="ADH87889.1"
FT                   /translation="MRTSTLTLAAIAVSLTCTLSASADAAQRRATATVMRPNDVRALYA
FT                   GKTWIWSDGAAYFAPNRRFVAWSGSGKQASYAEGEWRVTPLGRMCFSAIWRGVGPSGRN
FT                   ITCFGHRVMGGQVIYQQKEPGGAWYVFKHGQTAAGDEYAKFRAGDEASAGVGKVKQELK
FT                   LLSARS"
FT   sig_peptide     complement(583805..583876)
FT                   /locus_tag="Snov_0556"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.689 at
FT                   residue 24"
FT   gene            complement(583947..584876)
FT                   /locus_tag="Snov_0557"
FT   CDS_pept        complement(583947..584876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0557"
FT                   /product="endoglucanase family protein"
FT                   /note="KEGG: oan:Oant_4412 endoglucanase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87890"
FT                   /db_xref="GOA:D7A470"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:D7A470"
FT                   /inference="similar to AA sequence:KEGG:Oant_4412"
FT                   /protein_id="ADH87890.1"
FT                   /translation="MRPLSKKAYVAAVSGLMTLAAAVTLVAPGLSQTAPRPTAKPADQV
FT                   KFGVYDPEGVFAGDKSVGIEHVYIPWRDSDPTSLAKADAYAREHRRDLMVTVEPWSWSP
FT                   GTNVSGEQLLHGILAGAYDGPAKAVCGEIGKLDRPVTIRWGHEMDLPNGHFPWSSWAPD
FT                   DYVAAYRHFVSQCRIDAPQARFMWSPRGEERLAAYYPGDAYVDEVGLTVLDLQQYDIDQ
FT                   YGHARSFSEALRPAYDRVVGFGKPIVVAELGFQGDSAFMEQWLQDVRTVGGEFPQLAAV
FT                   VYFNAVDPYAWPEPYGRPDWRLQRGFVN"
FT   sig_peptide     complement(584775..584876)
FT                   /locus_tag="Snov_0557"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.511 at
FT                   residue 34"
FT   gene            complement(584896..586287)
FT                   /locus_tag="Snov_0558"
FT   CDS_pept        complement(584896..586287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0558"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="TIGRFAM: nucleotide sugar dehydrogenase; KEGG:
FT                   oan:Oant_4414 UDP-glucose 6-dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87891"
FT                   /db_xref="GOA:D7A471"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A471"
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /protein_id="ADH87891.1"
FT                   /translation="MKVAVIGTGYVGLVAGVCFADMGNRVVCVDTNAATVEKLRAGRSP
FT                   IYEPGIEELLRRNIAAGRLTVTTQAREALDGTEAAFICVGTPPRDSDGEPDLSLVYGAA
FT                   KDIANAMTGPLTVVVKSTVPVGTGDAVEEIIRRTRPDMSFSVASNPEFLREGSALADFQ
FT                   SPDRIVFGVEDAKAEETLRKLYLPLRATGAPQIVTRRRTSELIKYAANAFLATKISFIN
FT                   EMADLCEKVEGDVTELAAAVGLDSRIGGAFLRAGPGYGGSCFPKDTCALLHTAQEYGVP
FT                   LRVVEGTVAANNARKHRMAQKVIEAAGGSVIGMKIAVLGLTFKPDTDDMRDAPSIPLIR
FT                   HLQRAGAEIAAYDPQGLRQARDRLGNVAFHGDPYECAADADVVVLMTEWNELRSLDLGR
FT                   LHRIMRTPVMVDLRNIYPPELARRFGFRLVNIGRPGPRGTVHQLPPALVASPPIQSDAA
FT                   PILVK"
FT   gene            complement(586284..588227)
FT                   /locus_tag="Snov_0559"
FT   CDS_pept        complement(586284..588227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0559"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   smd:Smed_3671 putative cellulose synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87892"
FT                   /db_xref="GOA:D7A472"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7A472"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADH87892.1"
FT                   /translation="MNEVPPLILSAADDRPEAFADRRRYNRPRAALVPLLSPPQRVELF
FT                   LAISAWTAAYLFFWLWWLDPAHITSVGRFIFASLPFAWLTLMPIYFFTVFVGSRKPAGL
FT                   AQLPEGSTVAMVVTKAPSEPFEVVARTLEAMIAQPYPHDTWLADEDPSAETLDWCATHG
FT                   VRVSTRRGVDDYQREEWPRRVRCKEGNLAYFYDHFGYRLYDFVVQMDADHVPSRHYLER
FT                   MLAPFSDPRIGYVSAPSICNRNAGESWAARARLYAEASMHGPLQAGYTGGWAPLCIGSH
FT                   YAVRTEALETIGGLGPELAEDHSTTLMMNAGGWRGVHAIDAIANGDGPRSFADLATQEF
FT                   QWARSLVTILLRYSPALVPLLPARLRFQFLFCQLWYPLYSSIWAVLFLMPVVALASREH
FT                   FADVTYYDFVVHYAPMSVVLLCMIYRWRAGGWLRPANARVLSWEEILFVLAKWPWSLLG
FT                   TIYALRDFFTGSFVDFRVTPKGKGTVEPVPLRVVAPYVAISLGSAAPVLLLDDAGPASG
FT                   FYIFAIVNAVLYAVLVLVILVRHRIENPEGRGPRGRRPMEVGLVAALLALPLTAAVQRG
FT                   PEGLGALAWGALPVSYTYTVFSAAGAGLGYGTRKLIFVMPWAERPQQGTPSPSVDQQAD
FT                   QSPHRRNSGRTQ"
FT   gene            complement(588224..589210)
FT                   /locus_tag="Snov_0560"
FT   CDS_pept        complement(588224..589210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0560"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="KEGG: bov:BOV_A0474 UDP-glucose 4-epimerase;
FT                   TIGRFAM: UDP-glucose 4-epimerase; PFAM: NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87893"
FT                   /db_xref="GOA:D7A473"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A473"
FT                   /inference="protein motif:TFAM:TIGR01179"
FT                   /protein_id="ADH87893.1"
FT                   /translation="MNAPRILVTGGAGYIGSHACKALAANGFRPVAFDNLSLGHRDAVR
FT                   WGPFVHGDILDTQRLAEAMRAHGISAVIHFAALAYVGESVSIPARYYRTNVGGTLSLLE
FT                   ACRLAEVRHLVFSSSCATYGIPDHLPVSESAEQCPINPYGRTKLVAEEMLADEANANGL
FT                   HFAILRYFNAAGADPQLELGERHDPETHVVPLAIMAALGQAGPLAIYGDDYPTADGTCV
FT                   RDFVHVSDLAEAHVRALDHLLSGGHNLTANLGSGTGTSILQLIRAVERQMNCGVPIHVA
FT                   PRRSGDPPALYADITRARDLLGFAPRHSDLDAIVATAVRYHANGGLS"
FT   gene            complement(589207..590217)
FT                   /locus_tag="Snov_0561"
FT   CDS_pept        complement(589207..590217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0561"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   hne:HNE_2698 NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87894"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A474"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADH87894.1"
FT                   /translation="MTRILTIHDVADASHDRRVLITGGAGFIGSHLCDRLIEGGAYVIC
FT                   LDNFSTGRRHNVEHLVGHPRFSLIRHDVIDPIAVDVDQIYNLACPASPTAYAADPVHTT
FT                   KTSVLGALNLLKLATENGARILQASTSEIYGDPQVSPQPEAYWGHVDPTGPRACYDEGK
FT                   RCAESLFFDYARRFGTRIKIARIFNTYGPRMRGDDGRVTSNLIIEALRGTDMTVYGDGS
FT                   QTRSFCYVDETVEALIRLMATPDGVEGPVNIGNPDERTIQDFAGVVQRMTGSSSRISHR
FT                   PLPVDDPRRRCPDISEATRLLGWVPTISLEAGLALTIDYFREELVREPGVREAVA"
FT   gene            complement(590642..591994)
FT                   /locus_tag="Snov_0562"
FT   CDS_pept        complement(590642..591994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0562"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: bbt:BBta_3472 signal transduction histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87895"
FT                   /db_xref="GOA:D7A475"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7A475"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH87895.1"
FT                   /translation="MSLGSRSWSLKRRLATRLLVVLAIAVLGPPIAFLFFSWWTVGSLH
FT                   HRALQDQAADIVRGLDTRVTPPVLTLPEVLAAAYTRSNDSYFYLVLERDGTVVTASSPL
FT                   AASLATNATIVPPGEFFLVPRAGGAPWYTYSTNADGYRIVVAQDSSHENVLFDSIVREV
FT                   AGFTLWLALPLLLVALLVMMHTLNRAFRPIARAAEDARTITPGGQEAQISAHGLPREIT
FT                   PLVKAVNAALARLARAYDVERRFTTDAAHELRTPVAVLMARIDMLPEGPAKESLVLDTA
FT                   RLSRSVSQLLQVARLDAKPLAIDEDIDLARVVRHAVALLGPLAMQDGRRMEMTAPNRPI
FT                   MVRGNAQAIALAVTNLVENALSHTPAGTPIDVQVTSEPAIYVLDRGQGVPPDERMAIFE
FT                   RFQRSPNTASSGTGLGLAIVAEIAARHHAVASVEARAGGGSIFAIRWINSA"
FT   gene            complement(591991..592665)
FT                   /locus_tag="Snov_0563"
FT   CDS_pept        complement(591991..592665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0563"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: xau:Xaut_1280 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain protein; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87896"
FT                   /db_xref="GOA:D7A476"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7A476"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH87896.1"
FT                   /translation="MRLLLVEDERELAGLLDAGLRAAGFAVDRARTVADAEAALNTEGY
FT                   DIAVLDLRLPDGDGLDLLRRQRARGLAIPVLILTARDNLADRVRGLEQGGDDYVLKPFH
FT                   MDELVARLRALLRRPNQALGANIIVGNVALNTADRSVTVSHAPLPLSRRELGLLELFMR
FT                   RSGRVLTRECIERALYSFDDELESNAVEVLLHRLRRKLTGAGASPEIHTLRGIGYLLEE
FT                   AS"
FT   gene            complement(593110..595233)
FT                   /locus_tag="Snov_0564"
FT   CDS_pept        complement(593110..595233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0564"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; KEGG:
FT                   mpo:Mpop_4323 diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s); SMART: EAL domain protein; GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87897"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D7A477"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH87897.1"
FT                   /translation="MSGPCPKSAGRTGARLGDRNFAGLLDIMRDGFAVFDDQDRLIFHN
FT                   RRFLELFPFLEALGDLQGLTFYALASVPSGEWRWAPDPEKYVAQRLQRHAEADGEPFLI
FT                   PLENGGWVQARERRTPDGWTVSTWSDVSGLKAAETRLDDAIDGIPAGLILLDAEDRIEL
FT                   VNSGMRRIFAGADVALEAGQRLPEVLDGAEAKGFFALGPGDGAIRERLARSAQQPVEIA
FT                   LRDGGWILASHRRLPNGGTVGIWTDLTTQKKREAELIAMREQLRQHTEALADFARLIAQ
FT                   QARNDMLTGLPNRFALEERLDQLLRDGETGNLWVGVIDVDHFKGINDAVGHAAADDLLR
FT                   EVGRFLRGHLRGDDMLARIGADEFAMVLTELDEGEVMGIANRLHAATHSHVFRIGGHRF
FT                   SLTVSVGLSLAQPDRHSAASLLAAADTACRVAKEAGRDRVQIYDLGDPKVSTTQQRLGW
FT                   AERIRLGLELNRFTLHLQAIVDEKHRILGYEALIRLRNEDGAYCSPAQFLPAARRLGLM
FT                   GRIDSWVCRQCVGYAMQLIATGSDQYVSMNLGVHTLANIAFQSRLLDLVRTNPGVEQAL
FT                   RIEITETDEIYDAPQVSAFLAEMRELGMHVSLDDFGNGYNSFEALKQLPVDGIKIDWTV
FT                   TRDLLHDPIDEAQIRAAVSIAHSLGLELVIEGVEEEAQLVRLKELGATLFQGFYFHRPI
FT                   DAADIFEALPLAR"
FT   gene            595468..595623
FT                   /locus_tag="Snov_0565"
FT   CDS_pept        595468..595623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_2378 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87898"
FT                   /db_xref="GOA:D7A478"
FT                   /db_xref="UniProtKB/TrEMBL:D7A478"
FT                   /inference="similar to AA sequence:KEGG:Xaut_2378"
FT                   /protein_id="ADH87898.1"
FT                   /translation="MAAGSTGLGMTGRWVAAIGIVALVGAAIGLWARHGAAVFFDMVAA
FT                   GIAYCF"
FT   gene            595690..596280
FT                   /locus_tag="Snov_0566"
FT   CDS_pept        595690..596280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0566"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: electron transport protein SCO1/SenC; KEGG:
FT                   xau:Xaut_2379 electron transport protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87899"
FT                   /db_xref="GOA:D7A479"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7A479"
FT                   /inference="protein motif:PFAM:PF02630"
FT                   /protein_id="ADH87899.1"
FT                   /translation="MSNRRILLLLAAFVVGAVAIVGGALALLPQAPTTVSGQVAIGGPF
FT                   ELVDQDGQKVTQESFVGEPTLVFFGFTHCPDICPTTLFEMSQLFEALGPDARKVTGLFV
FT                   TVDPERDTPESMKSYLGSFHPSIQGLTGTPEQVAAVIKAYRAYAKKVPTQDGDYTMDHT
FT                   AIVYLMGKDGAFIAPFNLKRPPADAAAELRRYL"
FT   sig_peptide     595690..595770
FT                   /locus_tag="Snov_0566"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.956 at
FT                   residue 27"
FT   gene            complement(596231..598156)
FT                   /locus_tag="Snov_0567"
FT   CDS_pept        complement(596231..598156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0567"
FT                   /product="putative glycosyltransferase"
FT                   /note="KEGG: azc:AZC_0377 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87900"
FT                   /db_xref="GOA:D7A480"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:D7A480"
FT                   /inference="similar to AA sequence:KEGG:AZC_0377"
FT                   /protein_id="ADH87900.1"
FT                   /translation="MTPQAGGTEPEWGTAAPSLDLPVEAAGAPDRLSTADRFYALRRAR
FT                   RLGVGVDEVLLAAGHASADELARGAAHALGVPFEPLDAVAPLRLNTDSIAALLKSGLMR
FT                   YADGRVVLATRGLRLRQLAGTLARRPELRGQLRLTTPERLAAYVQRSFAGQLGWRAANE
FT                   LKRRHPELSAGTLRESRYVFAVLVMAMVALFTPLGQMSALGIWLSVPLLSFLLFGGALL
FT                   KFAACSLPPQSASPPMRRDAALPPYTLVVPLYREARVVPQLVDALDALDYPREKLQILL
FT                   VVEPDDAETATALAIRADWPGFEVIVAPALGPRTKPKAMNVALPFARGTYVGVYDAEDI
FT                   PDPLQLREVCTVFAAPGSERLGCVQARLAIDNLADGWITRQFAAEYAGYFDVVLPMLAT
FT                   CRLPLPLGGTSNHFRRDALEGVGAWDPYNVTEDADLGVRLAASGWQTAVIASTTDEEAP
FT                   RRFGAWMRQRTRWYKGWMQTLLVHARRPRRLARGAGLTGALALVFLLGSGVAAALINPF
FT                   LILGVLLDLWTQPASDLSPGALVLDWISLCVLVLGYASAMTAIALGMRRRRVPGLWRVL
FT                   PLVPVYWLMMSAAAWRALFHLVIAPYRWEKTDHGLARTSHRRPHIIRLPLRGSGAARRR
FT                   RRRAAA"
FT   gene            598238..599155
FT                   /locus_tag="Snov_0568"
FT   CDS_pept        598238..599155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0568"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: bbt:BBta_0788 putative ABC transporter,
FT                   periplasmic amino acid-binding protein; PFAM: extracellular
FT                   solute-binding protein family 3; SMART: extracellular
FT                   solute-binding protein family 3; ionotropic glutamate
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87901"
FT                   /db_xref="GOA:D7A481"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D7A481"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADH87901.1"
FT                   /translation="MRYFVPVVKSLAAKWLAAGLLAAALSSAVAGAASAQAATQPDAAS
FT                   AKALPTVAVPGFWDPKRRPERPDVTRLPTQIRFVTTDDYPPFSFRGEDGRPIGFNVDVA
FT                   RAICTELAIRCTLEVMPFDALVEALETGKADAAIAGLAITPASREKLDFTDRYFRSPAR
FT                   FVARRGDAATQVTPYVLASKSVGVVADTSHEAYLRDFFGEIAIKPYADSETVRAALQKG
FT                   DVDLIFGDGVQLGLWLNGTASNNCCAFVGGPFTESLYFGEGMGIAVKRGNEALRQSLNY
FT                   ALGQLWEEGVYTDLYLRWFPISVY"
FT   sig_peptide     598238..598351
FT                   /locus_tag="Snov_0568"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.945 at
FT                   residue 38"
FT   gene            599270..600928
FT                   /locus_tag="Snov_0569"
FT   CDS_pept        599270..600928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0569"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; KEGG: azc:AZC_0380
FT                   lysyl-tRNA synthetase; PFAM: Lysyl-tRNA synthetase, class
FT                   Ic"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87902"
FT                   /db_xref="GOA:D7A482"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="UniProtKB/TrEMBL:D7A482"
FT                   /inference="protein motif:TFAM:TIGR00467"
FT                   /protein_id="ADH87902.1"
FT                   /translation="MTATAQVEDVAAELHELAENAGAWPFEEARKIVERLKRKPKSEVL
FT                   FETGYGPSGLPHIGTFGEVARTTMVRHAFRVLTEDKIPTRLLCFSDDMDGMRKIPENVP
FT                   DPVALRPYLQMPLTAVPNPFGGGFASFGDHNNAMLRRFLDTFGFDYEFASATDYYKSGK
FT                   LDAVLLKAAEKYDAIMEVMLPTLGEERQATYSPFLPISPTSGRVLYVPLKEVNAKAGTI
FT                   TFTDEDGVDKTVPVTGGQVKLQWKPDFGARWAALDVDFEMFGKDHQTNAPIYDAICEIL
FT                   GGTAPEHYVYELFLDENGQKISKSKGNGLTIDEWLTYASPESLALYMFQSPRSAKKLHF
FT                   DVIPKAVDEYFNFLARYPVQDWKNRLGNPVWHIHSGNPPVEELPLTFGLMLKLASASNA
FT                   EDKSVLWRFIQRYAPGTSPATHPTVDKLADYAVRYFVDRVKPRRTFRLPDEVEAKALAA
FT                   LDAALAPLDGSDRDAIQNAVLDVGRAEPRYQDMKRKGPEGGPGVSFLWFSALYELLLGE
FT                   KEGPRFGSFVAAYGIPETRALIARALAGELAAGAA"
FT   gene            600988..601554
FT                   /locus_tag="Snov_0570"
FT   CDS_pept        600988..601554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0570"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_1403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87903"
FT                   /db_xref="GOA:D7A483"
FT                   /db_xref="UniProtKB/TrEMBL:D7A483"
FT                   /inference="similar to AA sequence:KEGG:Xaut_1403"
FT                   /protein_id="ADH87903.1"
FT                   /translation="MAKREKGRIDLRVDDPQQLLDMLDPYPFRERGLDGDVDEYICEHA
FT                   AETAPGHRLAIAIHLPAAVTGSERALGLPGIMQRHFERQAERRSSDLAHLFALGRKMLL
FT                   IGLIVLGVCLVVGQFLVGLFPGSRLAEVVMEGLVILGWVANWRPMEIFLFDWWPLVRER
FT                   RLYRRLAHADISVVAYEAARPSASH"
FT   gene            complement(601572..603263)
FT                   /locus_tag="Snov_0571"
FT   CDS_pept        complement(601572..603263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0571"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein TPP binding
FT                   domain protein; thiamine pyrophosphate protein central
FT                   region; KEGG: mrd:Mrad2831_2117 thiamine pyrophosphate
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87904"
FT                   /db_xref="GOA:D7A484"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D7A484"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ADH87904.1"
FT                   /translation="MNAAHSPSARTGAHLLVDALIANGVTRAFGVPGESYLDVLDALSD
FT                   TEVDFVVCRQEGGAAMMAEASGKLTGRPGICFVTRGPGATNASAGVHIAQQDSTPMILF
FT                   VGQISRSMRGREAFQEVDYRAVFGTLAKWAVEIDEAARIPEIIARAFRVAMQGRPGPVV
FT                   IALPEDVLSEYADVPDAPPVEPAETWPGLTDMMRLQKLLWEAERPIMIVGGTRWNPKAV
FT                   AALVRFAERCDLPVAVSFRRQMLFPADHPCYAGDVGLGINPKLVGRLKEADLVIVAGGR
FT                   LGEVPSQGYSLFPIPDPGVPFVHVHAEADELGRVYQPTLAINASNAAFAAALEGVQPPH
FT                   VVPWDDWREAVRDDYLAWTEEPPANPGAVQMATLVRYLRALPDDTTICNGAGNFATWVH
FT                   RFHRFRAYGTQLAPTSGSMGYGFPAAVAAKRAHPERTVVAVCGDGDFLMTGQEFATAVQ
FT                   YGIPVIAVVIDNGMYGTIRMHQEREFPTRVYGTALKNPDFAAYARAFGGFGVTVETDAE
FT                   FTPALEAALAAGLPAVVHVKLDPEAITPTMTLSALREKALADRSVG"
FT   gene            complement(603342..603833)
FT                   /locus_tag="Snov_0572"
FT   CDS_pept        complement(603342..603833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc00031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87905"
FT                   /db_xref="GOA:D7A485"
FT                   /db_xref="UniProtKB/TrEMBL:D7A485"
FT                   /inference="similar to AA sequence:KEGG:SMc00031"
FT                   /protein_id="ADH87905.1"
FT                   /translation="MELSSLVAPLVTALGSWPGARWLQGSGTAYLFVNATHVLGISLLL
FT                   GSILVLDLKLLGGLRGVPLAVLGPLNVRVAACGVALAFATGFWLFTVQPREYVGNPAFL
FT                   IKLGLIALALANVGVQHANPAYGRALEGATVSAGVRVSAAASALLWLAVLVSGRWIGFV
FT                   "
FT   gene            complement(603840..604235)
FT                   /locus_tag="Snov_0573"
FT   CDS_pept        complement(603840..604235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0573"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hne:HNE_3363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A486"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87906.1"
FT                   /translation="MSTAIRLPSLRVSALTLAGALAFVTPALAHHGWSWAESEQMTLQG
FT                   TIKTISMSPPHPTLHVTASDGVVWQVDLGNPRQTADSGFTGDTAKPGDAITVLGNRDRD
FT                   SAKPHMKAVRLTLAGKNYDMYPERITN"
FT   sig_peptide     complement(604146..604235)
FT                   /locus_tag="Snov_0573"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 30"
FT   gene            complement(604673..607111)
FT                   /locus_tag="Snov_0574"
FT   CDS_pept        complement(604673..607111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0574"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: azc:AZC_1009 DNA gyrase B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM domain
FT                   protein; DNA gyrase subunit B domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87907"
FT                   /db_xref="GOA:D7A487"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7A487"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADH87907.1"
FT                   /translation="MADSDNAATPSSNGEDYGAQSIQVLRGLDAVRKRPGMYIGDTDDG
FT                   SGLHHMVYEVVDNAIDEALAGYADEVTVTLNADGSVTVTDNGRGIPTDIHAEEGVSAAE
FT                   VIMTQLHAGGKFNQNSYKVSGGLHGVGVSVVNALSTTLDLTIWRNGLEHHIRFRHGDAE
FT                   APLAVKGPAPEGRRGTMVTFVPSPDTFTHIEFDYATLEHRLRELAFLNSGVRIVLTDAR
FT                   HPEVKREEMMYEGGVEAFVQYLDRSKQALLPKPIVIRAEKDGIAVECAMSWNDSYHENV
FT                   LCFTNNIPQRDRGTHFTGFAAALTRQVIGYSERSGIAKKEKVEPTGEDCREGLTAVLSV
FT                   KVPDPKFSSQTKDKLVSSEVRPVVEALVNEALGSWLEEHPAESKSLVTKVVEAAAAREA
FT                   ARKARELTRRKNPLDVASLPGKLADCQERDPAKSELFIVEGDSAGGSAKMGRNRAFQAI
FT                   LPLRGKILNVERARFDKMLSSEQIGTLITALGTGIGRDDFNVDKLRYHKIIIMTDADVD
FT                   GSHIRTLLLTFFFRQMPDLLDRGHVYIAQPPLYKVTRGKSEQYLKDERSLEDYLIDQGL
FT                   DEAALHLASGEVRVGADLHHVLESTRSFRNVMNGLHPRYNRAVVEQAAIAGAFAPGLLI
FT                   EEERAAAVAAEVARRLDLIAEDTERGWTGEADGSGYRFSRTVRGVKEVAVLDATFVGSA
FT                   EARRLDSLSAELQEVHAEPATLRRKGNDTLVFGPMDLFDAVTDAGRKGIALQRYKGLGE
FT                   MNAEQLWETTLDVNARSLLQVKVKEVADADDLFNRLMGDVVEPRREFIQDNALRASVDV
FT                   "
FT   gene            complement(607169..607783)
FT                   /locus_tag="Snov_0575"
FT   CDS_pept        complement(607169..607783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0575"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   azc:AZC_1010 LysE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87908"
FT                   /db_xref="GOA:D7A488"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D7A488"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADH87908.1"
FT                   /translation="MGILDLVVFAAALALAAASPGPSVIALVARTLVRGREGAALLVAG
FT                   IVLGDMVWLAGAALGLAALAVTLGSLFFLVRLAAAAYLIYLAYKLWTAPAQPAEAAEIR
FT                   EADSRAGLFLTGLGMTLGNPKAMAFYLALLPSIVDLNHLTMLGFAELCGVISVVLTLVF
FT                   GSYVALAHRARHLAASPRGIRLINRTCGTAMAGAAVLVATK"
FT   sig_peptide     complement(607703..607783)
FT                   /locus_tag="Snov_0575"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.920) with cleavage site probability 0.513 at
FT                   residue 27"
FT   gene            complement(607843..609000)
FT                   /locus_tag="Snov_0576"
FT   CDS_pept        complement(607843..609000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0576"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: azc:AZC_1012 recombination protein F; TIGRFAM:
FT                   DNA replication and repair protein RecF; PFAM: SMC domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87909"
FT                   /db_xref="GOA:D7A489"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D7A489"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADH87909.1"
FT                   /translation="MSRTRLTRLRLTDFRSYHHADIRAGDGPVVLVGPNGAGKTNLLEA
FT                   ISLLAPGRGLRRASLDQFAARGPEGTQAAGWAVSAVVEGAYGEVTLGTGLEADAGEARS
FT                   RRCRIDGEPVGSAAAFADHVRVVWLTPDMDGLFTGPPSERRRFLDRLVLAVDAEHGARV
FT                   NALERALRSRNRLLEEPSTDPRYLDAVEHELAALAVAVAAARLETVRRLAANIAQSRDD
FT                   TSLFPWASVALEGEVERALAREPATVVEDQYRLALRASRPRDRAAGRTLEGPHLTDLLV
FT                   GHGPKAIPAAQGSTGEQKALLIGLALAHARLVGEMAGMAPVMLLDDVVAYLDPARRAAL
FT                   FEALEALGSQVWMTGADPSAFVALGARAERFEVRPGQVLSSGAAS"
FT   gene            complement(608997..610112)
FT                   /locus_tag="Snov_0577"
FT   CDS_pept        complement(608997..610112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0577"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: azc:AZC_1013 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87910"
FT                   /db_xref="GOA:D7A490"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D7A490"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADH87910.1"
FT                   /translation="MKVTVERAELLKSLAHVHRVVERRNTIPILANVLMRTDARGLALR
FT                   ATDLDIEIVETIAAEVGQEGATTVPAHTIYDIVRKLPEGAQVQIETSGDRGTLTVRAGR
FT                   SRFALQTLPETEFPDLAAGEMTHRFTLPAGELKRLVDKTQFAISTEETRYYLNGIYLHV
FT                   ADASGPVLRAVATDGHRLAQAQTTAPAGATGMPGVIVPRKAVAEIQRLAEDAEAEVTVE
FT                   LSTAKIRVSLDRVVLTSKLIDGTFPDYGRVIPLGNDKTLVVDK