(data stored in ACNUC8465 zone)

EMBL: CP002030

ID   CP002030; SV 1; circular; genomic DNA; STD; PRO; 44084 BP.
XX
AC   CP002030;
XX
PR   Project:PRJNA47949;
XX
DT   16-DEC-2010 (Rel. 107, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Campylobacter jejuni subsp. jejuni ICDCCJ07001 plasmid pTet, complete
DE   sequence.
XX
KW   .
XX
OS   Campylobacter jejuni subsp. jejuni ICDCCJ07001
OC   Bacteria; Proteobacteria; Epsilonproteobacteria; Campylobacterales;
OC   Campylobacteraceae; Campylobacter.
OG   Plasmid pTet
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-44084
RX   DOI; 10.1371/journal.pone.0015060.
RX   PUBMED; 21124772.
RA   Zhang M., He L., Li Q., Sun H., Gu Y., You Y., Meng F., Zhang J.;
RT   "Genomic Characterization of the Guillain-Barre Syndrome-Associated
RT   Campylobacter jejuni ICDCCJ07001 Isolate";
RL   PLoS One 5(11):E15060-E15060(2010).
XX
RN   [2]
RP   1-44084
RX   DOI; 10.1089/fpd.2009.0493.
RX   PUBMED; 20455754.
RA   Zhang M., Li Q., He L., Meng F., Gu Y., Zheng M., Gong Y., Wang P.,
RA   Ruan F., Zhou L., Wu J., Chen L., Fitzgerald C., Zhang J.;
RT   "Association study between an outbreak of Guillain-Barre syndrome in Jilin,
RT   China, and preceding Campylobacter jejuni infection";
RL   Foodborne Path. Dis. 7(8):913-919(2010).
XX
RN   [3]
RP   1-44084
RA   Zhang M., Zhang J.;
RT   ;
RL   Submitted (04-MAY-2010) to the INSDC.
RL   National Institute for Communicable Disease Control and Prevention, Chinese
RL   Center For Disease Control And Prevention, 155 Changbai Road Changping
RL   District, Beijing, Beijing 102206, P.R.China
XX
DR   MD5; e723ea5ac6219f2f500ae31873a70128.
DR   BioSample; SAMN02603201.
DR   EuropePMC; PMC2993937; 21124772.
XX
CC   The DNA and the bacteria could be available from Dr. Maojun Zhang
CC   from Dept. of Diagnostics for Communicable Disease in the National
CC   Institute for Communicable Disease Control and Prevention, Chinese
CC   Center for Disease Control and Prevention. E-mail:
CC   zhangmaojun@icdc.cn.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..44084
FT                   /organism="Campylobacter jejuni subsp. jejuni ICDCCJ07001"
FT                   /plasmid="pTet"
FT                   /sub_species="jejuni"
FT                   /strain="ICDCCJ07001"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:757425"
FT   gene            join(43652..44084,1..5)
FT                   /locus_tag="ICDCCJ07001_pTet000001"
FT   CDS_pept        join(43652..44084,1..5)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000001"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66926"
FT                   /protein_id="ADT66926.1"
FT                   /translation="MKDEIINIIKEAIGENYKKVLWIFQEHIKNLINCYPSNENGLVFE
FT                   YKSRISSNDVISIIMFEKTGQKINISLFFENTRKKEKILELNPEEKNSEELILKALFIK
FT                   NKKVLLSDLFILDKVSMYYTRNKMFKEFQKLMIDNKEKGIL"
FT   gene            123..485
FT                   /locus_tag="ICDCCJ07001_pTet000002"
FT   CDS_pept        123..485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000002"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000002"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66927"
FT                   /protein_id="ADT66927.1"
FT                   /translation="MKNLSSNVLIAREKIERFFMRSSLEKVIKNYSENFSNKRDNDFAQ
FT                   GLIKYLYENDIIGENDKIFLEKNFQYIRVINEKEKRLINVYFCEKPIIDFFQNAEYEKE
FT                   LQYYGINEKDFIKTDI"
FT   gene            627..1025
FT                   /locus_tag="ICDCCJ07001_pTet000003"
FT   CDS_pept        627..1025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000003"
FT                   /product="cpp8"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000003"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66928"
FT                   /protein_id="ADT66928.1"
FT                   /translation="MIYEKKLTKKEIFSYAIFIAIIALICIFKNEIWEFVKFIFSNLDF
FT                   ICGNFANFVSEDNIIFFPVTTLLIVFTIAICAVWGLSNVLSLSLFIMPIFVAVFYIFNI
FT                   DISLKNLYSSYFIFLIIINGLLWSANQR"
FT   gene            1570..2127
FT                   /locus_tag="ICDCCJ07001_pTet000004"
FT   CDS_pept        1570..2127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000004"
FT                   /product="cpp12"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000004"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66929"
FT                   /protein_id="ADT66929.1"
FT                   /translation="MIISVVNKKGGVGKTPFAFSIAKDLEYFLQSNDNSIIEKIYPEKA
FT                   KILPTPKKIDNCVYDFGGFVEKGVLDIIKESNKIIIPCTSNYNSLLRTLETLNEIGNDD
FT                   RVCILVTDYRDEKEKRQICETLESNFTDLNLFFFKFSKIIENSMSSGASFTELYNENNL
FT                   SRLSYTNFFNEYQRLLDFIRKG"
FT   gene            2447..8254
FT                   /locus_tag="ICDCCJ07001_pTet000005"
FT   CDS_pept        2447..8254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000005"
FT                   /product="cpp14"
FT                   /note="GO_function: GO:0003676 - nucleic acid binding
FT                   [Evidence IEA]; GO_function: GO:0004386 - helicase activity
FT                   [Evidence IEA]; GO_function: GO:0005524 - ATP binding
FT                   [Evidence IEA]; GO_function: GO:0008168 - methyltransferase
FT                   activity [Evidence IEA]; GO_function: GO:0003677 - DNA
FT                   binding [Evidence IEA]; GO_function: GO:0008170 -
FT                   N-methyltransferase activity [Evidence IEA]; GO_function:
FT                   GO:0016787 - hydrolase activity [Evidence IEA]; GO_process:
FT                   GO:0032259 - methylation [Evidence IEA]; GO_process:
FT                   GO:0006306 - DNA methylation [Evidence IEA]"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000005"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66930"
FT                   /protein_id="ADT66930.1"
FT                   /translation="MRKKTKRQIEDEKDYGGRSLFDLIELEFSQGEENEQQNRELSEHR
FT                   EVTDNIERTSISSNTPSVDRQENSAIQLDNTREMGRVLSEHNQESRNVRSNDTSIATNT
FT                   NGISSLGEQRSRQEERTGANRYGDTSRRANKSQSIHSNRTPNLFSFISRNDDERQGTDT
FT                   RRNNQQSVLETATRNDGYERRSLKSGQKLDFVSDDEIYLGSLKDRFQKNLQAIKLSKTI
FT                   EQENRYATKQEQEILNKFSGWGGIPQAFDHQNKEWEKEFKELISTLDYAEYEKAKTSTL
FT                   DAFYTPKIIIDTIYQGLNQLGFNNDGHTKEIFEPSAGIGSFLSYAKNYSDKYHFTCVEL
FT                   DTISANILKHLHPNQTIYNKAFQHHLFDKPYDAFIGNPPFGQKKILDLNDTTLNKTSVH
FT                   NYFIGNAIKNLKEDGIAAFVVSSYFLDSKNSTIRNYIAEQATFLGAVRLPNNAFKKRAN
FT                   TEVTTDIIFFKKGKDLNIDKSWLESVEYYDDRFDEAEKRGMHPDVFNDFRINEYFKNNP
FT                   QNILGKMNIKSSQYGYSLECLDDGRDLKIALENFTKTLPKNIYKYQETKIKLSYYRIDR
FT                   ESPEYEKYSKTLSKLKDGNYFEYNNEIYMKIRSDDELVFSKPVLNEHDTRRIKKLIALR
FT                   DQFNTLIEYEKNESSDLLVENQRKYLNKLYDEFVAKEGYLNRDANKKAFREDVEANKIL
FT                   ALEKNYSSGISKSVALKEGIDPIAPSATKADIFFKRTINAQKEIKISTPKEALIASINE
FT                   YGRIDLKFLETNLNQPLEETLKSLEQDKLIFKDHKNPANYVLAEKYLSGNVKAKHKEVK
FT                   KLVEDGFNEFVNNLESLEQVLPKDLKAVDISISLGTTWIPIKYYKQFIEETLQITPKDY
FT                   DLFLMEKTGEWSLKGFGHSLSPYIRSQYATEKIGCFDLFEHGLLRKPIRIYDKKLDPSG
FT                   KEIRELNPKETAIANSKLENLKNEFIEWIYKDYDRRTDLENIYNERFNTNIEPLYNGEH
FT                   LELPNFNANIKLKKHQKNAIYRAIQENSIIFDHQVGAGKTLVAICSVMEQKRMGLLNKP
FT                   LIVVPNHLARQWNDEFYHAYTNANILVATNDDLKKDNREKFFSKITTNNFDAIIMTHSQ
FT                   FKLIPAPYEVIKKQYEEDINILEQTLEKKQNDDNVMRYSVKDLEKRIENFKVKLSDLQT
FT                   THKKSKAIDFSELGIDALIIDEAHEFKNLLITTSMGDISGLGNLKGSQKAYDLYSKTQY
FT                   IHEQNKKLYFLTGTPISNSITELYTLQRYIQPNILKEKGIQAFDSWASTFGEVTNAWEL
FT                   DSSGINYKIVARFNKFKNVPELSTMYKSVADIVTNNDIMKYQKDFVPKLYNDKPINIVA
FT                   PRSEAIAEFIGIQDENGAWNKGSIVWRMEHQQEDITRNNLLACTTDARKAGLDFRLIDP
FT                   HCNDYADSKINKLIENVFNEYNAWNDDKGTQLIFCDLSTPKQHSQKVSLNGNIATPNLN
FT                   KEEFVNINEAIEQAEEENSKSLDELLAEQAKFDVYTDILKKLVAKGIPQNEIRFIHDAK
FT                   TDLQKGQLFADMNSGKARILIGSTQKMGAGTNVQKRIVALHHLDCPWRPSDLEQRSGRV
FT                   IRQGNELFMRDPQNFRVKEFRYATERTYDARMWQVIESKARSIEQFRKAGADVRTLEDI
FT                   TSGAADAAEMKAEATGNPLILLQVQLSSDLRQEEMLYSGYKRQIHNNEESLKNNISKIN
FT                   YLKKNTEIYTTLKTIVDSNTNEHFQGKYYEIQSSNEAIAKDFIIFKDDNSDSNKARQKE
FT                   IELVFNKNIETLSKDYQKEYKIFEYKGLLISGEKTSLNTLSFYISTLDGKTFVEPENLV
FT                   YKQDSQLLSLANEVNFRGFMTKVNNFYNNLDKFISQENAQIQKLELEITELKSITGDNT
FT                   PKYKRKDYLEALREDNRIVMEEIEKMSKQKDYKSSFMPKSTKFLEELNKQSKTIKENAI
FT                   DY"
FT   gene            complement(8653..9150)
FT                   /locus_tag="ICDCCJ07001_pTet000006"
FT   CDS_pept        complement(8653..9150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000006"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66931"
FT                   /protein_id="ADT66931.1"
FT                   /translation="MPVLLRRVQLSTVSNNPLAFRICRPVPQIMILPLSVTSTFFFILN
FT                   VRKIRPTLSVPAEESKGWSATIFYLLYSLIGKPKLILQIKNKPLTVSLLHFQSRPRGSK
FT                   LHYILGRIYARIYPLDIGCLSCYNMCSGYIASSLKCYHFRTCEGGKPPFNPPFKRAGRL
FT                   II"
FT   gene            9792..11711
FT                   /locus_tag="ICDCCJ07001_pTet000007"
FT   CDS_pept        9792..11711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000007"
FT                   /product="hypothetical protein"
FT                   /note="GO_component: GO:0005622 - intracellular [Evidence
FT                   IEA]; GO_function: GO:0005525 - GTP binding [Evidence IEA];
FT                   GO_function: GO:0003924 - GTPase activity [Evidence IEA];
FT                   GO_process: GO:0006412 - translation [Evidence IEA]"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000007"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66932"
FT                   /protein_id="ADT66932.1"
FT                   /translation="MKIINLGILAHVDAGKTTLTESLLYTSGAIAELGSVDEGTTRTDT
FT                   MNLERQRGITIQTAVTSFQWEDVKVNIIDTPGHMDFLAEVYRSLSVLDGAVLLVSAKDG
FT                   IQAQTRILFHALQIMKIPTIFFINKIDQEGIDLPMVYREMKAKLSSEIIVKQKVGQHPH
FT                   INVTDNDDMEQWDAVIMGNDELLEKYMSGKPFKMSELEQEENRRFQNGTLFPVYHGSAK
FT                   NNLGIRQLIEVIASKFYSSTPEGQSELCGQVFKIEYSEKRRRFVYVRIYSGTLHLRDVI
FT                   RISEKEKIKITEMCVPTNGELYSSDTACSGDIVILPNDVLQLNSILGNEILLPQRKFIE
FT                   NPLPMLQTTIAVKKSEQREILLGALTEISDGDPLLKYYVDTTTHEIILSFLGNVQMEVI
FT                   CAILEEKYHVEAEIKEPTVIYMERPLRKAEYTIHIEVPPNPFWASVGLSIEPLPIGSGV
FT                   QYESRVSLGYLNQSFQNAVMEGVLYGCEQGLYGWKVTDCKICFEYGLYYSPVSTPADFR
FT                   LLSPIVLEQALKKAGTELLEPYLHFEIYAPQEYLSRAYHDAPRYCADIVSTQIKNDEVI
FT                   LKGEIPARCIQEYRNDLTCFTNGQGVCLTELKGYQPAIGKFICQPRRPNSRIDKVRHMF
FT                   HKLA"
FT   gene            complement(12664..13569)
FT                   /locus_tag="ICDCCJ07001_pTet000008"
FT   CDS_pept        complement(12664..13569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000008"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66933"
FT                   /protein_id="ADT66933.1"
FT                   /translation="MFKEVCNTLGINRIELAEKLGLSKTTIDAWSDKSRISKTAQVALE
FT                   LMLENHKLRSIIKNFQDGFTLLNSYNLEGNINTSSKDHNDLINRINHIFNELKLSEITC
FT                   ARAMGENNFAKINQILNFKTYPDFDFLEKFASTFKIDHHWLLTGEGSSFANNLIKSNFN
FT                   SQFINEAGEFDKIYIITCNDLLHTKIVVKQNNEFDLYQTDFCIGSKFIMEARECSDLCD
FT                   LYEFYQKFKCNISCLEFNEDDYRKLLSRNYYPKNILDREKISYMLFDLLDLREDNKEIY
FT                   GGFFGECINIIKSTLKDREE"
FT   gene            complement(13697..15067)
FT                   /locus_tag="ICDCCJ07001_pTet000009"
FT   CDS_pept        complement(13697..15067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000009"
FT                   /product="Cpp17"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000009"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66934"
FT                   /protein_id="ADT66934.1"
FT                   /translation="MSRSIRIFDDEIIAKKVFTKIENASKLPLNYINKNRDKYTKDIKT
FT                   GKLISKNMFRKNTEVVVKITSGSKNSQALSKHLDYISRDGNVELITNDFDRYAGEDEIL
FT                   EVKRIFKNEGSPIPLYKEGAKEKRHTINMVFSMKEHSTTPKEKLQQSVITTLKRMYPNN
FT                   FFIVAFHNDTDNPHCHVCLKVADKNGKRINPKKADLANLRAEFAKALNELGVEAKATKK
FT                   QREVEINQEFSVKLNTNNEINQALKIKMHYYQIMDFGEANYQFSTDKNAKKSYYVSYKT
FT                   KKGITTIWGQDLERVVKENKVLRGEYARFKIVGQEEYEIKRKAKINNKWQEVVKTLKKP
FT                   VWDVSVVGREKELKQITKKYKITHDKGVNNERDYTKQYRQRVLQELGNKSTIRREVAQE
FT                   RNFMRILSEQPMVHNTKRTQMLLHINALNQLQQGERGRSDNILRWTSARNNEITRDE"
FT   gene            complement(15067..15618)
FT                   /locus_tag="ICDCCJ07001_pTet000010"
FT   CDS_pept        complement(15067..15618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000010"
FT                   /product="cpp18"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000010"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66935"
FT                   /protein_id="ADT66935.1"
FT                   /translation="MNKNNNCVIKVSKDDKIILEYIKSETNASYSKIISILLKKFNSCD
FT                   TDEKNKINDEISKNKFYTSDENKIIKLKLTENEVNILKEISKNTGFSSITKQAKFLLLN
FT                   SIKNEKLFTNIEIDEFIKTRTEINAIGKNIYQLLKILRSGNSVKINENNLNKTMDNIRD
FT                   KIDILSDQLGAIIEKNNERI"
FT   gene            16122..16733
FT                   /locus_tag="ICDCCJ07001_pTet000011"
FT   CDS_pept        16122..16733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000011"
FT                   /product="cpp20"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000011"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66936"
FT                   /protein_id="ADT66936.1"
FT                   /translation="MEKDYKIKVTDVSELNEQYKEAIQEGTYEGEDVNKFFNTIKTFDI
FT                   AESLLKKDFSNQYIKFDIITDKEKIPLNIRLGDKNFEKGIEHLINIGSSKISKENINPE
FT                   IKKDLNNQLGTYKPKVYDEMLDGTFKALKNLSEVANKDIGVMISEFANSYSETREKFEK
FT                   KQINKKSFFKEKMNEFFKKKLNKILPNKEISNEKTYSRSR"
FT   gene            16754..17980
FT                   /locus_tag="ICDCCJ07001_pTet000012"
FT   CDS_pept        16754..17980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000012"
FT                   /product="cpp22"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000012"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66937"
FT                   /protein_id="ADT66937.1"
FT                   /translation="MPQKRIYLYVPFKDKEKAKSLGAMWDDKEKKWFAPKTLDKNIFSQ
FT                   WLYPHQKKEFSFDENEVLTAFKSALENQGLIIDGSPIMDGKIHRVKTTTDKGREMSGAY
FT                   SGFLDEYPAGFIQNFKTGIKENWKMPIEKNQSNNIKNSQKLHEQIKKDQELREKEILTL
FT                   QEKTALKLEDEYNNAKWANSNHAYLKKKGFDENFYLKQDKMGSLLIPLKDENGKLWSVQ
FT                   RIFPNGDKIIGVIKTQEEKDQGVEYLAKKQGCFHIIGAKSLEHCKEFIITEGFATAATI
FT                   YKALNKPVIMGVDAGNLSKIVETLKNKFENTPITLIADNDKKRELKGLSNVGVETAKEI
FT                   QQRFSDIKVIIPKISDQEAGQGVSDFNDIFLNKGLDEVKKQLNFIDFHNKLKAFKSMEK
FT                   TQPEKEITR"
FT   gene            19660..21453
FT                   /locus_tag="ICDCCJ07001_pTet000013"
FT   CDS_pept        19660..21453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000013"
FT                   /product="cpp26"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000013"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66938"
FT                   /protein_id="ADT66938.1"
FT                   /translation="MPKRNTIETITLGLFSDEDVSIICEDTIKLERGSVAVLSGNSEVG
FT                   KSFLALKVCANAINDGLKPFFWSVEDKNKAILERIKNIESFYSFNTAELEFSNELPKIN
FT                   KEPINCLKEELNELADCDLIVLDTFSAFFSTLGFKDQNNQNDVQNFFNILTDIAKSNNQ
FT                   AILLLHHLDKKGESLMGSSVIINAPRLVYKLSFEKGEDKNSTTYRLLEVLKDNNNINAG
FT                   EFQKTIKVLQNSSIDEPSIVNLRANSIDSNTLEIINKKDISAVSVNELAKGYVTMNENR
FT                   GVFYLSSRKLTDTNFYKVFKENDNKIDFKMTGANGSSYAISLKNSLLTQTHRNILDALF
FT                   LYIKKNVDTSVIKKYQENFWDMEVRLEPYKFLKQYLNKNSNNYSWLKQKFTEISRFAYD
FT                   LAFTQNVEDKDKKTITQRDKGILMFDSVERITKENGTIVSVFVLTVRREYIKKLETEST
FT                   LSYDDDLSKILINLNSLVAQDLIRFLTSFPDKKILSYSEFCEIKAYKFYKENSIISRQK
FT                   KEIIKLKDKLIEFGINIYGKGVEFADYDDEFFHNKYKNENDLFFIYQSNNKVKRYIKRD
FT                   DPMNQLNTKDNKFLLQKSLFG"
FT   gene            complement(21573..22187)
FT                   /locus_tag="ICDCCJ07001_pTet000014"
FT   CDS_pept        complement(21573..22187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000014"
FT                   /product="cpp27"
FT                   /note="GO_function: GO:0000150 - recombinase activity
FT                   [Evidence IEA]; GO_function: GO:0003677 - DNA binding
FT                   [Evidence IEA]; GO_process: GO:0006310 - DNA recombination
FT                   [Evidence IEA]"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000014"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66939"
FT                   /protein_id="ADT66939.1"
FT                   /translation="MNIAYIRVSTNKQELDSQKLEIMEYCHKNNIILDEILEVKISSTK
FT                   SQEKRKIKDLKQRLQSGDLLIATELSRLGRSMLEIINLVLEFNANNINFLFLRQRELSN
FT                   FNNPSSKLILSIYAYLAENERDLISQRTKAGLENAKASGKKLGRPKGSLNSIYDKDIDK
FT                   IQTLLDKDLSIRSIWKLFYKDSGKTYDGLLWFIKKRKLKQK"
FT   gene            complement(22184..22591)
FT                   /locus_tag="ICDCCJ07001_pTet000015"
FT   CDS_pept        complement(22184..22591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000015"
FT                   /product="VapD"
FT                   /note="GO_process: GO:0019089 - transmission of virus
FT                   [Evidence IEA]"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000015"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66940"
FT                   /protein_id="ADT66940.1"
FT                   /translation="MGINRKAINFDLSTKSLEKYFKDTREPYSLIKKFMLENGFEHRQY
FT                   SGYTSKEPIDERRVARIVTKLAKKFTWFGECVKEFDITEIGEQYSLKDTIQNLCIKEIN
FT                   KQAGYNKDFHGKFKEFTQKTPKNQKLKDLER"
FT   gene            complement(22582..22905)
FT                   /locus_tag="ICDCCJ07001_pTet000016"
FT   CDS_pept        complement(22582..22905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000016"
FT                   /product="cpp29"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000016"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66941"
FT                   /protein_id="ADT66941.1"
FT                   /translation="MAYPLLGTRIVLDEEKILKEGKYNLEDMYKMIDEYAKESGMIKIN
FT                   KETYHCKGDKYDLGCMTLFIYKYLIDSEWFTKNAKEWIWISEKEGNSDLISASKAEGEG
FT                   IWE"
FT   gene            23358..26126
FT                   /locus_tag="ICDCCJ07001_pTet000017"
FT   CDS_pept        23358..26126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000017"
FT                   /product="type IV secretion system protein VirB4"
FT                   /note="GO_function: GO:0005524 - ATP binding [Evidence
FT                   IEA]"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000017"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66942"
FT                   /protein_id="ADT66942.1"
FT                   /translation="MEKNPLFKGLTRPPMIFGVPMTPFVIAMGCIILIAFYSQNIFLVG
FT                   FSIPVFFIMKAMTKKDDFIFRLMFLKMRFLSNPASKNYHKVKTYSTNSYRQMPPNSNFP
FT                   KISVFGLNAEPSFEKLIPFSSLINDFVVITKDYFLMTTWEIGGISFEAEEDDELDIKND
FT                   LLNMLFKSFSNESVSFYFHNCRYSIEDKLTSKFNNAFLEEIDRKYYESFKQGTLRKNSL
FT                   YLTLIFNPLKVKIEKTTFMKSSFENKRKTINLFLAKFSEFADRLEANIKDFNPKRLKTY
FT                   SKDDKTYSEQLEFYNYLISGKFNPIRVLPSPIDQYLNGNLQNIQFGHDTIQFNQNDSTK
FT                   RFARCIEIKDYTNETFAGILDILMYLDVEYTITQSFSPIPRVDAKSAISKQKKQLIATE
FT                   DDGFSQVAQIDEALDQLTNGEISFGKYHFSILVYGNTIKECKDNTNEVVTKMNELGFGV
FT                   TLATIALPATFFSQLPSNFAIRPRINLISSINFSSLIALHNFSMGKRDKNCWGDAVSIL
FT                   KTPNKQPYYFNFHQSSGVNKNDFGELFLANTLILGQSGGGKTVFMNFIVDQMMKYASKD
FT                   TFPDDIPEENKKFTAIYLDKDKGALGNILCAGGRYISIENGKPTGFNPFMVESTQENIR
FT                   QLQSLMKLLVTRNNEILTTREEEMLNNAVNSLMKGFEKEERKYPISLLLENLTENVDDD
FT                   NSLKSRLALFKKGKQFGWVFDNEYDNLDFPDDINLFGIDGTEFLDDKDVSGILSYYILW
FT                   RVMSLADGRRLCIDIDEAWKWLENEIVQEEVKNKFKTIRKQNGFLRLATQSVEDFLKLK
FT                   NATTLIEQSATMVFLPNPKAKEEEYVKGVGLSYDEYMIIKGFNPAKRQFLIKRQDEKVI
FT                   CTLDLSSLGNENLKILSTGTAHIDTIEKIFSQENKSLDEKVLELKEFYKNS"
FT   gene            26137..26703
FT                   /locus_tag="ICDCCJ07001_pTet000018"
FT   CDS_pept        26137..26703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000018"
FT                   /product="cpp32"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000018"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66943"
FT                   /protein_id="ADT66943.1"
FT                   /translation="MSNKVIINKQEVQFGTQNNQIFCTSLDVAKVFGKRHDHVLRDIEN
FT                   ILNDLREIGTSQDLLNFGEVVRISKTTNPKNGKLVNRKMPMYNLTRDGFSLLAMGFTGK
FT                   KALQFKIAFIKAFNEMEKLLQKEIKSPNKYLTDLMELIYPNLPQNDYKVSVIITDNPYS
FT                   KEAKNVFSLNYLVDNRTPKDPKKLQ"
FT   gene            26700..27266
FT                   /locus_tag="ICDCCJ07001_pTet000019"
FT   CDS_pept        26700..27266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000019"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66944"
FT                   /protein_id="ADT66944.1"
FT                   /translation="MSDKELEIFELCERLSELLGDKEAIADLKKLYTNHPEMFKDMQEV
FT                   KEVINKVVSEPEIIVDANRDKRNYEIIKAAKIINDKKMADVVIKNESGTNEIFHANKKR
FT                   IKEFNRLNNKDNLLQVETPTLSTHQLNGLELMDKNPSGANALSATINQTIPQKDKSAND
FT                   FKAKLEEFSTKKTNAIKSINKEFKR"
FT   gene            27300..27722
FT                   /locus_tag="ICDCCJ07001_pTet000020"
FT   CDS_pept        27300..27722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000020"
FT                   /product="ssb1"
FT                   /note="GO_function: GO:0003697 - single-stranded DNA
FT                   binding [Evidence IEA]; GO_process: GO:0006260 - DNA
FT                   replication [Evidence IEA]"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000020"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66945"
FT                   /protein_id="ADT66945.1"
FT                   /translation="MNNVNLIGYLGKDFEIGTTNSGRVYAKNSLAITKRWKNERGNEES
FT                   STTWIPIVLFGKSAESASTHIKKGSQFACSGELSSNQYQDEDGNTRTMLSVIVSKFYWL
FT                   GKKDKDDTGTQNPQVPPKEPNIDYENTNIDEETQVF"
FT   gene            28017..29006
FT                   /locus_tag="ICDCCJ07001_pTet000021"
FT   CDS_pept        28017..29006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000021"
FT                   /product="cmgB5"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000021"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66946"
FT                   /protein_id="ADT66946.1"
FT                   /translation="MKKNIFGVNKAIGKSHPHENGARLISLDYNYTKEYNYNYEICVTQ
FT                   FNHLFSEVKSSHRVAALWLTPQNYIQKFKKSILILTSLLVLPNLAFSAGIPVVDATANQ
FT                   QMATQNAKQVAEWAKDASRWTETVAHYQKQIQAYKDELLSKTGIRDSVTFLKDIKQIYS
FT                   DFAEAGQNIQSFYNDVLRDPQKFLSDKGNEIFGKYTSFDRCNFDFLSQSEKNICKMNLI
FT                   TYAAQVETYNQASKQMDTISQTLQKLQDKLVNSKDIKESTDVGNAIQLEVAKIQMVKNQ
FT                   VDLANSSYENQRRIQEDMAIQEYSKSFDYKPQISTKELMQKAREQNKQ"
FT   gene            29003..29980
FT                   /locus_tag="ICDCCJ07001_pTet000022"
FT   CDS_pept        29003..29980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000022"
FT                   /product="hypothetical protein"
FT                   /note="GO_process: GO:0000747 - conjugation with cellular
FT                   fusion [Evidence IEA]"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000022"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66947"
FT                   /protein_id="ADT66947.1"
FT                   /translation="MNDLFQTLGESIQQIIDAIRQVGTSDKVAELSVLLSIIITLVIMY
FT                   KGYEVLMGTSQSPIRELTWDIAGKLLAITFALNIGGWLTLVINAMDGIYEWAGGGTQMY
FT                   KTLDEMYANTAQLANIIWAKSSGVGGAILAIVAMLLCYVGFIIAVAPTFAILVVTTFTQ
FT                   TLLVITAPIVFWLLIFKSTKNVFTQWIGLLLSNTLVILLVGLFLKTFMGEINGWIVSLS
FT                   QHVQSGSEVLGTSIFFVIASLVLVIMIISAKLYAEKIANVSMEGAMGGAIGSALNPVSR
FT                   LAGWTAGKAAGKTGAKLAAKGAWAGTKGGYSFAKKMYERARNAG"
FT   gene            30124..30786
FT                   /locus_tag="ICDCCJ07001_pTet000023"
FT   CDS_pept        30124..30786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000023"
FT                   /product="cmgB8"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000023"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66948"
FT                   /protein_id="ADT66948.1"
FT                   /translation="MKNEFNTAIDYEASFRYLIEKSNKRAWLIAFISIFIAIISIIAVV
FT                   LLTPLKTIEPYVIRVDNTTGMVDILTMLDEKEIKANEALDKYFISTYVKAREGYYYDLL
FT                   NQDYLLTQLMSSEKVANEYRALYEGDNARDQILKNSNEVSVQILSIVLGESNGVKTATV
FT                   RAIITTKNLTSKGTTQATKVITLSYDYILAKASEENRFLNPLGFKVLTYRIDDEVAQ"
FT   gene            30783..31670
FT                   /locus_tag="ICDCCJ07001_pTet000024"
FT   CDS_pept        30783..31670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000024"
FT                   /product="cmgB9"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000024"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66949"
FT                   /protein_id="ADT66949.1"
FT                   /translation="MKKIILINLLLCSFIWALNIPKTSTFDKRIAYAIYNANDVFQINA
FT                   KNGYVSVLEFGTDERIINTATGFAEGWDLIEKDNLLFIKPKAYKTQLVQQENNNIGESQ
FT                   ASQEFVLDPNPHDWKTNLIVITNLNTYVFDLKLVNQNNNATYKLSFSYPKKDLKAAKEF
FT                   LEAQEQENIRRDLNKNTIPRNWDFYMKINKGSEDISPNFAYDDGVFTYLGFDNTKTFPA
FT                   VFMYDNGKESILNTHIKKDGNYEVLVIQKITKQILLRSGDKVVGIFNRGYAKNPLDKTR
FT                   ETSNENIQREINKK"
FT   gene            31697..32869
FT                   /locus_tag="ICDCCJ07001_pTet000025"
FT   CDS_pept        31697..32869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000025"
FT                   /product="cmgB10"
FT                   /note="GO_function: GO:0009045 - xylose isomerase activity
FT                   [Evidence IEA]; GO_process: GO:0005975 - carbohydrate
FT                   metabolic process [Evidence IEA]; GO_process: GO:0009291 -
FT                   unidirectional conjugation [Evidence IEA]"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000025"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66950"
FT                   /protein_id="ADT66950.1"
FT                   /translation="MQDKEQDNLDNDFENHTSDLHDQKNHLRKIQAYVIFAVGGLLLVL
FT                   ILVYFLKSFLSSNTTTEEVQKEDNKDLAQSVKTKEFIPPPPQKTFDELIAQESPKPTQD
FT                   LILEPKPPKPRIVKGAGVTVVASSNNDGFGNNGTGNREEFGEKPNTVFEFGQNGTLQNS
FT                   NNLQGGSGDFVGEVFTPTIAKVSEFDQNLLLPKGTYIGCALKTRLVSSIKGGIACIVSN
FT                   DVYSANGNTLLIEKGSTITGTFNTGQMDDGMDRLFVIWQEIRTPNNIIIPVYSGATDEL
FT                   GASGVQGWVDHHYLKRFGSAVLLSMIDDSLAILADQIAGKDNKNNYANYTENTRDSAKE
FT                   IANTALEKMIDIKPTLYKNQGDLVGVYVNRDIDFSKVYKLTRKKNVNNAR"
FT   gene            32850..33842
FT                   /locus_tag="ICDCCJ07001_pTet000026"
FT   CDS_pept        32850..33842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000026"
FT                   /product="cmgB11"
FT                   /note="GO_component: GO:0005622 - intracellular [Evidence
FT                   IEA]; GO_function: GO:0005524 - ATP binding [Evidence IEA];
FT                   GO_function: GO:0008134 - transcription factor binding
FT                   [Evidence IEA]; GO_process: GO:0006810 - transport
FT                   [Evidence IEA]; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent [Evidence IEA]"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000026"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66951"
FT                   /protein_id="ADT66951.1"
FT                   /translation="MSITLDKYTQKFFGEFLKDDNINEICYNGDNKIWVQNSKGLWECI
FT                   DTKLDFEQAGHFATASASFKKDKIDVSRPILSCILVGGERMQIVIPPATKSEHISITIR
FT                   KPSKTRFKMEDHIKSGLFEDLNPDEKNKIKPSDEELIKLYEARDYQNFISKAVSYGKNI
FT                   IIAGETGSGKTTFMKTLIDFISLDDRIITIEDVEEIKFYEHKNFVQLFYPSEAKSTDFL
FT                   NSATLLKSCLRMKPDRILLAELRGAETYDFINVLASGHGGSITSCHAGSPEETFTRLAL
FT                   MTLQNPQGQCVPFEIIQKTLKDLIDIVVHIHAHHGKRRISGIYFKEMER"
FT   gene            34281..34814
FT                   /locus_tag="ICDCCJ07001_pTet000027"
FT   CDS_pept        34281..34814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000027"
FT                   /product="cmgD4"
FT                   /note="GO_component: GO:0016020 - membrane [Evidence IEA];
FT                   GO_process: GO:0009291 - unidirectional conjugation
FT                   [Evidence IEA]"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000027"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66952"
FT                   /protein_id="ADT66952.1"
FT                   /translation="MLEWRESAVVQDIKQECFDYTSKYRKEILGQEVYLFNPFSRQTHR
FT                   YNPLTYIDMSDKEHCDSQLMDLGNILYPQDGDSTSKFFNGLAQNLFIGLCYLWRDLQLT
FT                   DYGKEFQSAFDINVGEFNFYNILQLSKGFSLKNEGKTLKGFDDTYNFLSYCEVLDEATI
FT                   RRLETYFNINCRCY"
FT   gene            34825..35517
FT                   /locus_tag="ICDCCJ07001_pTet000028"
FT   CDS_pept        34825..35517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000028"
FT                   /product="cmgd4"
FT                   /note="GO_component: GO:0016020 - membrane [Evidence IEA];
FT                   GO_process: GO:0009291 - unidirectional conjugation
FT                   [Evidence IEA]"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000028"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66953"
FT                   /protein_id="ADT66953.1"
FT                   /translation="MSSFNAPLVPFESETLRLSTETSDFDLRDLRKKKMTIYIGITPDQ
FT                   LANAQFILNIFWSQLILLNTKELPQSNKDLKYTCLMVMDEFTAPGRIPIYQSAISFMAG
FT                   YWLRSLMIYQSNSQLETQPPLGYGKEGAKTLLTNHACQIFYAPREQEDAEAISRILGNT
FT                   TFKTKSRSINTGNNGGGSHSISEASRALMLPQELREMPFENELITIDSGKPILCNKAFY
FT                   YSGFLFYG"
FT   gene            35637..36074
FT                   /locus_tag="ICDCCJ07001_pTet000029"
FT   CDS_pept        35637..36074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000029"
FT                   /product="cpp44"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000029"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66954"
FT                   /protein_id="ADT66954.1"
FT                   /translation="MIKKSLDNLVIMALVFIMVGCSTAPKPKELDDNSALSINNSILEK
FT                   KYSFVPKDPYLSGFNWTYHIVVEKKTIDDDFIKNDLITKTFLLAHNSTKIILVGRKDLI
FT                   EQYKQYFEKNQVLAPIELQPVNPIERDFNKVNILFFNKTNF"
FT   gene            36086..36850
FT                   /locus_tag="ICDCCJ07001_pTet000030"
FT   CDS_pept        36086..36850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000030"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66955"
FT                   /protein_id="ADT66955.1"
FT                   /translation="MKKILFPFCVFGVINSVNALDLQLLSGDTRTSCEVILCLASPVKP
FT                   PECASSLAKYFSIHFKKPWKTIQARKEFLNLCPIDTTNDPEMYKYKNDILVNLDGECST
FT                   TALNQRIEKSKQPLKVEKICTGGGHNGSRECVEIKTYGFRINPELTNSCKLLASSKYTD
FT                   YHLKYTCNTKFYEKKDWERGYELKEVSQEIFNALPISQREQGEKLVPVSYAEFVRLPAD
FT                   KRKQGGFGKYYRVDIAFYQKIIIKKDCWINEK"
FT   gene            36853..37650
FT                   /locus_tag="ICDCCJ07001_pTet000031"
FT   CDS_pept        36853..37650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000031"
FT                   /product="cpp46"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000031"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66956"
FT                   /protein_id="ADT66956.1"
FT                   /translation="MNEEINSNENSLYELVKEDNSTNMVIQNYNELLSKFENLIKTIIA
FT                   KIDIGKQNSSSNTEDGIFKDLEKNIIELDNTFLALISYFKNPPSDEEKEFINKTASIKK
FT                   TMEDFAEFANEIQKLSLDDKLKKYNEQINKFCEIVEYKLSHNAENYNSFLDRFVENGKL
FT                   KLNTFSEIFTKMTKNTKWYLIFFSFTSIGLGMALGILILLTYIKYSEYNNLKERVSTIT
FT                   QGLATISIDENSKGSFTLSFAKNKKTIFNENKNSIQITLQGGE"
FT   gene            37726..38346
FT                   /locus_tag="ICDCCJ07001_pTet000032"
FT   CDS_pept        37726..38346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000032"
FT                   /product="cpp47"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000032"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66957"
FT                   /protein_id="ADT66957.1"
FT                   /translation="MAFGKLVNDKIVIDTNNALNYRGKEGDIQQRKVDTALIDVIKEAG
FT                   QVAAMEHGAVLFSAKVNEVWKNYFVNRDEKTHNIVLKPTNSQNRDDFIYINSNINEQGY
FT                   FYYTINQKRESAKELIEGVGIVEHQNQDGTKSHYLETNVRLYNEELKQELKEKGNEFIA
FT                   VISNAGIKVVNEAEMKAQKQEQQIQQTQEIKEPEKTQNQEFGR"
FT   gene            38448..39092
FT                   /locus_tag="ICDCCJ07001_pTet000033"
FT   CDS_pept        38448..39092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000033"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66958"
FT                   /protein_id="ADT66958.1"
FT                   /translation="MKANYIELEKKEGQISDIPYTIIKVEYPNLKKLQDNDLLMANDKG
FT                   QWLCGFIGLKENQKVDFKELDNGYIVPQYLYLNSKDKKEIDLFSNNLEITKVLQFDLNH
FT                   SWNKTEKNTQLDEEECLKIIKNTIEYINNFNKNISKKEFEKLSKEENIHKTNKLIEELI
FT                   TQEEGVSGLIEKDLKEMKKDKSYFFDKMSSFTKNQTTEKSIAKENINIFEK"
FT   gene            39191..41242
FT                   /locus_tag="ICDCCJ07001_pTet000034"
FT   CDS_pept        39191..41242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000034"
FT                   /product="cpp49"
FT                   /note="GO_component: GO:0005694 - chromosome [Evidence
FT                   IEA]; GO_function: GO:0003677 - DNA binding [Evidence IEA];
FT                   GO_function: GO:0003917 - DNA topoisomerase type I activity
FT                   [Evidence IEA]; GO_function: GO:0003916 - DNA topoisomerase
FT                   activity [Evidence IEA]; GO_function: GO:0003676 - nucleic
FT                   acid binding [Evidence IEA]; GO_process: GO:0006265 - DNA
FT                   topological change [Evidence IEA]; GO_process: GO:0006268 -
FT                   DNA unwinding during replication [Evidence IEA];
FT                   GO_process: GO:0006304 - DNA modification [Evidence IEA]"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000034"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66959"
FT                   /protein_id="ADT66959.1"
FT                   /translation="MRLFIAEKPELGRAIAEGLDGNYKSGEGYIQKGDNIITWAFGHIL
FT                   ELAKPEEYDEKYKLWKLEDLPLPIKEFKYLPKKESKKQLKIICDLIHSDKITSIVNCGD
FT                   ADDEGQILVDEIIQYSKTSKPVFRVLINDLTPKAVKEEIAKIKSNADFKGMSERGFARS
FT                   QADWIVGINLTRAYTIMARKNGYEGVLSVGRVQTPILALIVNRDKEFENFKSIDYFSLL
FT                   GDFNINNNTIKARLKTEDKILDENLAKEIKKSCENQNAKINLKIENKKEYPPLPYNLLV
FT                   LQAECAKLFGFSPDKTLEITQNLREKHKAITYNRSDCQYLPETMFEQAPNILNIIKENL
FT                   NSNDEIQALIASSDLTIKSKAFNDANISAHYGIIPTQNKISSQLTQDELVVYNLIAKRF
FT                   IIQFFHPREYQTTTINLEVNQRIFTATQNKTTKSGFRSLWQNVDSEEEQENNENDINDL
FT                   SILKNGDIAKCSLIEIEKKQTKPRPYYTMTTLLKDLNSVAKYVSDERIKKLLMEKDKDK
FT                   KGESGGIGTPATRSNHIKTLIEREYIEVSKDKKQIIKSTKKGRDLIKLSPKSLITPDMT
FT                   ALWFEQQKMIEISELRREQFLEEITKEVISEIQRIDKNQEFKILDNENKPKIQCPQCNK
FT                   GFLTKRKGKYGNFWGCSEYMEGCKAIYPDNKGTPNFETKQASKQRYYS"
FT   gene            41952..42305
FT                   /locus_tag="ICDCCJ07001_pTet000035"
FT   CDS_pept        41952..42305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000035"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66960"
FT                   /protein_id="ADT66960.1"
FT                   /translation="MLFFGVYTLFISILLSILLSIESLIPSKYNYEKQLVNVILKPILL
FT                   LLYGVGLIFLFFNTEVANSLAVEIINRINRFRIIESFLSSKEIGLYILAFIILLQVVFI
FT                   FWAVYKGFIENEL"
FT   gene            42295..42777
FT                   /locus_tag="ICDCCJ07001_pTet000036"
FT   CDS_pept        42295..42777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000036"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66961"
FT                   /protein_id="ADT66961.1"
FT                   /translation="MNYKKFQTMSKEEYFKKYNVGIRFLFGCDLNQKNETEMISLRVFL
FT                   PKKHFQEYKNIDIFKTMDLFKKTPLFKELIEQSIKIDFEKREFVMPDFFIKHDIEIIPY
FT                   FTQGGEKEEELSKEKFFELLKQNKIKELNYLCFLFFGLFCEEEYEYFCKAKELKCY"
FT   gene            42768..43382
FT                   /locus_tag="ICDCCJ07001_pTet000037"
FT   CDS_pept        42768..43382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ICDCCJ07001_pTet000037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ICDCCJ07001_pTet000037"
FT                   /db_xref="EnsemblGenomes-Tr:ADT66962"
FT                   /protein_id="ADT66962.1"
FT                   /translation="MLLENIQENNQYSFYSLQNDIDDIAKKYMDKFFAILTLARNENTK
FT                   FVNLKHFHNLKNAEMEIFFDNVFRNNEFKKNIKDKLELFDKGRKHLKKGSYPVLICFLN
FT                   ELYKNLIINDKQFENLLVSTKKEYFIRIIDKKRKGIINIYFQKDKENVWVDRFKIVTDG
FT                   FGGNDYDEKMLYYGLEKANYIKINEKFIEEELEKLNLLKFI"
XX
SQ   Sequence 44084 BP; 17245 A; 5756 C; 6891 G; 14192 T; 0 other;
     tttgaaaaat actatgtatc catatttgct caacgataaa atcaaaaatc attttatgat        60
     tttatgcaca gagattgagt gtaaaaaatg cggagaaaag atttatgttg agtttcaagc       120
     gaatgaaaaa tttatcttca aatgtcctga ttgctcgaga aaaaatagaa aggtttttta       180
     tgcgttctag cttagaaaaa gtgataaaaa actatagtga aaatttttca aataaaagag       240
     ataatgattt tgcacagggt ttaataaagt atctttatga aaatgatatc ataggagaaa       300
     atgataaaat ttttttagaa aaaaattttc aatatattag ggtaatcaat gaaaaagaaa       360
     aaagattgat taatgtgtat ttttgcgaaa aaccaataat tgattttttt caaaatgcag       420
     aatatgaaaa agaattgcaa tattatggaa taaatgaaaa agattttata aaaactgata       480
     tttgaaaaac gctctatatc tactataaca ttaataaatg tataatatta ataaatataa       540
     atatatatta attaatttaa gttaattttt ataaataata ttatatagtt atatataaaa       600
     atttttacaa aagataagga gcaaaaatga tttatgaaaa aaaattaact aaaaaagaaa       660
     tattttctta tgcaattttt atagcaatta tcgctttaat ttgcattttt aaaaatgaaa       720
     tttgggaatt tgtaaaattt attttttcta atttagattt catatgtggt aattttgcaa       780
     attttgtaag cgaagataat ataatatttt ttccagttac aactctttta atagtattta       840
     ctatagctat ttgtgctgtt tggggattat ctaatgtttt atctctctca ttatttataa       900
     tgcctatatt tgtcgcagtt ttttatattt ttaatattga tataagttta aaaaaccttt       960
     atagctctta ttttatattt ttaatcatta ttaatggtct tttatggagt gcaaatcaaa      1020
     gatgaaaaaa attacaatag tagcatacgc aatatgtttt ttatcaggct tatggttttt      1080
     atttagtgct attaaagagc attttggcat tttatctttt attcttggaa ttgcacttat      1140
     ttattttggt gttattaata taaaaagaat tttgaatgat tctaacgaga ataaagaaag      1200
     agaaagagaa gagctaatct tgaaaaagat aggagagtaa taaaatgcta gagatagata      1260
     ataataaaga atttaaaatc ttaagactaa acaaacaaga aattttaaaa attggaggta      1320
     atggcatttg cgacagttgt aataaaattt taagcaatga tggatttatg atctgcgttt      1380
     tattaagttg ctattgcgaa aaatgctacc aagaatggta taaagttgcg attaatcatg      1440
     aagaagatag agaaattgaa aaagatgttt atgaaaatat taaatcgaaa ataactaata      1500
     tttattttta gttcttatta ataaatatta gtatataata ttatacaaaa atataaaaaa      1560
     ggttttttta tgataatatc tgttgtaaat aaaaaaggtg gtgttggaaa aactcctttt      1620
     gctttttcaa ttgctaaaga tttagaatat tttttacaaa gcaatgacaa ttctattata      1680
     gaaaagattt atcctgaaaa agcaaaaatt ttaccaactc caaaaaaaat agataattgc      1740
     gtttatgatt ttggtggatt tgtagaaaaa ggggtattag atattattaa agaaagtaat      1800
     aagattatta ttccttgcac gagtaattac aattctttac ttagaacatt ggaaacttta      1860
     aatgaaatag gtaatgatga tagagtttgt atcttggtta cagattatag agatgagaaa      1920
     gagaaaaggc aaatttgtga aactcttgaa agcaatttta cagatttaaa tctctttttc      1980
     tttaaatttt caaagataat tgaaaattct atgagtagtg gagcttcttt tactgaactt      2040
     tacaatgaaa acaatctttc aagattaagt tatacaaact ttttcaatga atatcaaaga      2100
     cttttagatt ttattagaaa aggataaata ataatggaaa aaaaaccatt tacaatagca      2160
     gaagctttaa actctgaaac aagctctcaa aaaacatata gtaaagctga taaaaaatca      2220
     gctgggagaa aaactataga tcaaaaacta agaagagaca atttagtagt ttgcagactt      2280
     aatgaacaag aaatggaaat tttgaaaaaa ttaatggatt tagatttagt aagtgaatat      2340
     ggcacttata taagaaaatt aatcttaaaa gaggcacgat ctttaaatat taatagttaa      2400
     aaatgttaaa atatccttgc aaaaaacaaa aattacaagg atataaatgc gtaaaaaaac      2460
     aaaaagacaa attgaagatg aaaaagatta tggtggtcga agtttatttg atctaatcga      2520
     attagaattt tcacaaggag aagaaaatga gcaacaaaat agagaattat ccgaacatag      2580
     agaagttaca gataatattg aacgaactag catttcatca aatacaccaa gcgtggatag      2640
     acaagaaaat tccgcaatac agcttgataa tactagagag atgggcagag ttttatccga      2700
     acacaatcaa gaatctagga atgtcagatc taatgacact agcattgcca caaacacaaa      2760
     tggaattagc agtcttggag agcaaagaag cagacaagaa gagagaacag gggctaacag      2820
     atatggagat actagcagaa gagcaaataa atctcaatca atacatagca atagaacccc      2880
     aaatttattc tcctttattt caagaaatga tgatgaaaga caaggaacag atacaagaag      2940
     aaacaatcaa caatcagtat tggaaactgc aacaagaaat gatggatatg aaagaagaag      3000
     cctcaaatct ggacaaaaat tagattttgt aagcgatgat gaaatctatc taggttcttt      3060
     aaaagataga tttcaaaaaa accttcaagc cattaaactt tcaaaaacta ttgaacaaga      3120
     aaatcgctac gctaccaaac aagaacaaga aattctaaat aaattttcag gatggggcgg      3180
     tattcctcaa gcttttgatc atcagaataa agaatgggaa aaagaattta aagaacttat      3240
     tagcacactt gattatgcag aatatgaaaa ggcaaaaact tcaactttgg atgcttttta      3300
     cactccaaaa attattatcg atacaattta tcaagggctt aatcagttag gatttaataa      3360
     tgatggtcac accaaagaaa tatttgagcc aagtgcaggt ataggctctt ttttgtctta      3420
     tgcaaaaaat tatagcgata aatatcattt tacttgcgta gagcttgata ctataagtgc      3480
     aaatatatta aagcatttac acccaaatca aacaatttat aataaagcat ttcagcacca      3540
     tttatttgat aagccatacg atgcttttat aggtaatcca ccttttggtc aaaaaaagat      3600
     tttagattta aatgatacta cacttaataa aacaagtgtg cataattatt ttatcggtaa      3660
     cgcaattaaa aatttaaaag aagatggaat tgctgctttt gtagtatcaa gttatttttt      3720
     agattctaaa aatagcacaa taagaaatta tatagccgaa caagcaacat ttttaggtgc      3780
     tgtaagattg ccaaataatg cttttaaaaa acgagctaat acagaagtta ctaccgatat      3840
     tatctttttt aaaaaaggta aagatttaaa tatagataaa tcttggctgg aaagcgtaga      3900
     atactatgac gatcgttttg atgaagctga aaaaagaggt atgcaccctg atgtttttaa      3960
     tgactttaga ataaatgagt attttaaaaa taatccacaa aatatcttag gaaaaatgaa      4020
     tattaaaagc tctcaatatg gttatagttt agaatgcttg gatgatggaa gagatttaaa      4080
     aatcgcttta gaaaatttta caaaaacctt acctaaaaac atttataaat atcaagaaac      4140
     aaaaatcaag ctatcttatt acaggattga tagagaatcg cctgaatacg aaaaatatag      4200
     caaaactcta agtaagttaa aagatggaaa ttattttgaa tacaataatg aaatctacat      4260
     gaaaatcaga agcgatgatg agttagtctt ttcaaaacct gttttaaatg aacacgatac      4320
     aagaaggatt aaaaaactca ttgctcttag agatcaattt aatactctta ttgaatatga      4380
     aaaaaatgaa tctagcgatc ttttagtaga aaatcaaaga aaatatctaa acaagcttta      4440
     tgatgaattt gtagccaaag aaggatattt aaatagagat gcaaataaaa aagcctttag      4500
     agaagatgta gaagcaaaca aaattttagc actagaaaaa aattatagca gtggtatttc      4560
     aaaaagtgta gctttaaaag aaggtataga tcctattgca ccaagtgcaa caaaagcaga      4620
     tatttttttc aaaagaacta taaatgcaca aaaagaaatt aaaatctcga ctccaaaaga      4680
     agcattaatt gctagtatca atgaatatgg gagaattgat ttaaaatttt tagaaacgaa      4740
     tttaaatcag cctttagaag aaacccttaa atctttagag caagataaat taatctttaa      4800
     agatcacaaa aatcctgcaa attatgtttt ggctgaaaaa tatctttctg gcaatgttaa      4860
     agcaaagcat aaagaagtaa aaaaattagt agaagatggc tttaatgaat ttgttaataa      4920
     tttagaaagc ttagaacaag tcttgcctaa agatttaaaa gcggttgata tttcaataag      4980
     cttagggaca acatggatac ctataaaata ttacaaacaa tttatagaag aaaccttaca      5040
     aattactcct aaagattatg atttattttt aatggaaaaa acaggcgaat ggagtcttaa      5100
     aggttttggt cattctttaa gtccttacat cagatcacaa tatgctaccg agaaaatagg      5160
     ttgttttgat ttatttgagc atggattatt aagaaagcct attcgcattt atgataaaaa      5220
     actagatcca tcaggaaaag aaatcagaga attaaatcct aaagaaactg caatcgctaa      5280
     ttctaaatta gaaaatttaa aaaatgaatt tatagaatgg atttataaag actatgatag      5340
     acgcacagat ttggaaaata tctataatga aaggtttaat acaaatatag aaccactata      5400
     caatggagag catttagaac ttccaaattt caatgctaat atcaaactca aaaaacacca      5460
     aaaaaatgct atatataggg ctattcaaga aaatagtatt atttttgatc atcaagtagg      5520
     tgctggaaaa actttagtgg caatttgctc tgtgatggag caaaaaagaa tggggctttt      5580
     aaataaaccc ttaattgtag tccctaatca tttagcaaga caatggaatg atgagtttta      5640
     tcacgcctat acaaatgcaa acattttagt tgctacaaat gatgatttaa aaaaagataa      5700
     tagagaaaag tttttttcca aaattacaac aaataatttt gatgccatca ttatgacaca      5760
     ctcgcaattt aaattaatcc ccgcacctta tgaagttatc aaaaaacaat atgaagaaga      5820
     tattaatatc ttagaacaaa cattagaaaa aaaacaaaac gatgataatg ttatgcgata      5880
     ttctgtaaaa gacttagaaa aacgcattga aaattttaag gtgaaattga gtgatttgca      5940
     aactacacat aaaaaatcta aagcgataga tttttcagaa ttaggaattg atgcattaat      6000
     tattgatgaa gcacatgagt ttaaaaattt actcattaca acttcaatgg gtgatataag      6060
     tggtcttggc aatttaaaag gctcacaaaa agcctatgat ctttattcta aaacacaata      6120
     tattcacgag caaaataaaa aactctattt tttaacagga acgcctataa gcaattcaat      6180
     tacagagctt tatactttgc aaagatatat acaaccaaat atcttaaaag aaaaagggat      6240
     acaagctttt gattcttggg cttctacttt tggtgaagtt acaaacgctt gggagcttga      6300
     tagttctgga attaattata aaatcgttgc aagatttaat aaattcaaaa atgtccctga      6360
     actttctact atgtataaaa gtgtggctga tattgtaaca aataatgata ttatgaaata      6420
     tcaaaaagat tttgtgccaa agctttacaa tgataagcct attaatattg ttgcccctag      6480
     aagtgaagcg atagcagaat ttataggcat tcaagatgaa aatggggcat ggaataaagg      6540
     ctctattgta tggagaatgg aacaccaaca agaagatatt actagaaata acttacttgc      6600
     ttgcaccaca gatgctagaa aagctggact tgattttagg cttattgatc cacattgcaa      6660
     tgattatgca gattctaaaa ttaacaaact tattgaaaat gtttttaatg agtataacgc      6720
     ttggaatgat gataaaggca cacaattaat attttgtgat ttatccactc caaaacaaca      6780
     ctcgcaaaaa gtttctctaa atggcaatat tgctacacca aatttaaata aagaagaatt      6840
     tgtcaatatt aatgaagcaa tagaacaagc ggaagaagag aatagtaaaa gccttgatga      6900
     actcttagca gaacaagcaa aatttgatgt atatactgat attttaaaaa aacttgtcgc      6960
     aaaaggtatt ccacaaaatg aaattcgttt tattcatgat gcaaaaacag atttacaaaa      7020
     agggcaactt tttgctgata tgaactctgg aaaagctaga attttaattg gatcaacaca      7080
     aaaaatgggt gctggaacaa atgtgcaaaa aagaattgta gctttacacc atttagattg      7140
     tccttggcgt ccaagcgatt tagagcaaag aagcggtagg gttataagac agggcaatga      7200
     actctttatg agagatccgc aaaactttag agtaaaagag tttagatatg caaccgaaag      7260
     aacctatgat gctagaatgt ggcaagtcat tgaaagcaaa gcaagatcca tagaacaatt      7320
     tagaaaagct ggtgctgatg taagaacctt agaagatatt acaagtggtg cggcggatgc      7380
     tgcagaaatg aaagcagaag caacaggtaa tccactcatt ttactgcagg tgcaattaag      7440
     cagtgatcta aggcaagaag aaatgcttta tagtggctat aaaaggcaaa tacataataa      7500
     tgaagaaagc cttaaaaata atatctctaa aatcaattat ttaaaaaaga atacagaaat      7560
     atatactact ttaaaaacca ttgtggattc aaacactaat gaacattttc aaggaaaata      7620
     ctacgaaatt caaagtagca atgaagccat tgcgaaagat tttatcattt ttaaagatga      7680
     taatagcgat agcaataagg caaggcaaaa agaaatagaa ttggttttta ataaaaatat      7740
     tgaaactctt tctaaagatt atcaaaaaga atataaaatt tttgaatata aaggcttgct      7800
     cattagcgga gaaaaaacat cgctaaacac acttagcttc tatatttcaa ctttagatgg      7860
     aaagactttt gtagaacctg aaaatttagt atataagcaa gatagtcaac ttttatcctt      7920
     agcaaatgaa gtgaacttta gaggctttat gacaaaagtc aataactttt ataacaactt      7980
     ggataaattt atatctcaag aaaatgcaca aatccaaaaa ttagagttag aaattacaga      8040
     gctaaaaagc attacaggag ataacactcc aaaatacaaa agaaaagatt atttagaagc      8100
     attaagagaa gataatcgca ttgttatgga agaaatagaa aaaatgagta agcaaaaaga      8160
     ttataaaagc tcttttatgc caaaatccac aaagttctta gaagaattaa ataaacaaag      8220
     taaaactata aaagaaaatg caattgacta ttgataattg cttaaagttt ttattaacat      8280
     ttttataaaa tatactcgat agcatttatg gcaaaccctt aactatatga accgcacgat      8340
     ataaagatgt ctaagcggtt ctattcttcc tctctgaaat cttctcctgt agctgctggt      8400
     attcttcttc acttacccgg aatgatagct gctttggtct tgtcttgttc atacccttac      8460
     cactccatat ccatgacatc aagtaggtca aagaaacgct ccagcgtctt attttccttt      8520
     tctgccggat tctgttttac atatttatca attactttca tcagctcctg cacctcgtat      8580
     ctgtactcaa actgaatttt atccatatct tttttcatgc ctttgacctc tctttcttcg      8640
     gtgctaccac cgtcatatta tgagccttcc ggctcgttta aaagggggat tgaagggggg      8700
     cttgccaccc tcacaagttc taaagtggta acactttagg gaacttgcaa tatatccgct      8760
     acacatatta tagcatgata gacaccctat atcaagcgga tatattcgtg cgtatattct      8820
     gccaagaata tagtggagct tacttcctct tgggcgactt tggaagtgta ggagggagac      8880
     agtcaagggc ttgtttttta tctgcagtat gagcttcggc ttgccgatca gcgagtacag      8940
     cagataaaaa atggtcgcag accacccttt actttcttcc gccggaacgg acaatgtagg      9000
     acggattttg cggacattca aaataaaaaa gaatgtggag gtaacagaca atggcaaaat      9060
     cattatttga ggaactgggc ggcaaatacg aaaggcaagg ggattatttg ataccgtgct      9120
     taactgtacc cgccgaagaa gaacaggcaa taggcatctg ggggcaacgg catttagatt      9180
     atctaaaaca gtaccgtaaa gttacataca ccaatcttct tacaagcggc aggctaaacg      9240
     cctaccttgc cgacatcaac agacaggcac aggaacgctt tgaaaggctc atagagggta      9300
     tgaaacaggc acagggcata acggaacagc taaaggcaga aaacgcctta gaatggacag      9360
     gatgcctcaa taacataagg gcttgtgcga gggagattgt ggaaaaggaa attatttttg      9420
     cataaacaga tgattagtgg cagggggaaa tcctgccgct ttttctgctt tagtttgtca      9480
     gcttgacaaa taaagggtta aggaatataa ttagattcag tattatacaa ggagttaata      9540
     aatatgcggc aaggtattct taaataaact gtcaatttga tagtgggaac aaaaagtagc      9600
     agtcccgttt cacttttaat atggggctta gttttttgta cccagtttaa gaatactttt      9660
     atcatgtgat tttatatgcc cgaaaacata taagtgtttt ggggctattg gagttattta      9720
     cccagtgata ggagtattta tcactgggta tttttatgcc cttttttggg tgttgatagg      9780
     aggaaaatca catgaaaata attaacttag gcattctggc tcacgttgac gcaggaaaga      9840
     caacattaac ggaaagttta ttgtatacca gtggtgcaat tgcagaacta gggagcgtag      9900
     atgaaggcac aacaaggaca gatacaatga atttggagcg tcaaagggga atcactatcc      9960
     agacagcagt gacatctttt cagtgggagg atgtaaaagt caacattata gatacgccag     10020
     gccatatgga ttttttggcg gaagtatacc gttctttatc cgtattagac ggagcagtat     10080
     tattagtttc tgcaaaggat ggcatacagg cacagacccg tatactgttt catgcactac     10140
     agataatgaa gattccgaca atttttttca tcaataaaat tgaccaagag gggattgatt     10200
     tgccaatggt atatcgggaa atgaaagcaa agctttcttc ggaaattata gtgaagcaaa     10260
     aggttgggca gcatccccat ataaatgtaa cggacaatga cgatatggaa cagtgggatg     10320
     cggtaattat gggaaacgat gaactattag agaaatatat gtcagggaaa ccgtttaaaa     10380
     tgtcagaact ggaacaggaa gaaaacagga gattccaaaa cggaacgtta tttcccgttt     10440
     atcacggaag cgctaaaaac aatctgggga ttcggcagct tatagaagta attgccagta     10500
     aattttattc atcaacgcct gaaggtcaat ctgaactatg cgggcaggtt tttaagattg     10560
     aatattcaga gaaaaggcgg cgttttgttt atgtgcgtat atatagcgga acattgcatt     10620
     tgagggatgt tattagaata tctgaaaaag agaaaataaa aatcacagag atgtgtgttc     10680
     cgacaaacgg tgaattatat tcatccgata cagcctgctc tggtgatatt gtaattttac     10740
     caaatgatgt tttgcagcta aacagtattt tggggaacga aatactgttg ccgcagagaa     10800
     aatttattga aaatcctctc cctatgctcc aaacaacgat tgcagtaaag aaatctgaac     10860
     agcgggaaat attgcttggg gcacttacag aaatttcaga tggcgaccct cttttaaaat     10920
     attatgtgga tactacaacg catgagatta tactttcttt tttggggaat gtgcagatgg     10980
     aagtcatttg tgccatcctt gaggaaaaat atcatgtgga ggcagaaata aaagagccta     11040
     ctgttatata tatggaaaga ccgcttagaa aagcagaata taccatccac atagaagtcc     11100
     cgccaaatcc tttctgggct tctgtcgggt tgtccataga gccgctccct attggaagcg     11160
     gagtgcagta tgaaagcaga gtttcacttg gatatttaaa tcaatcgttc caaaatgcgg     11220
     ttatggaggg ggttctttat ggctgcgagc aggggctgta tggatggaaa gtgacagact     11280
     gtaaaatctg ttttgaatat ggattgtatt atagtcctgt aagtaccccc gcagactttc     11340
     ggctgctttc ccctatcgta ttggagcagg ctttaaaaaa agcagggaca gaactattag     11400
     agccatatct ccactttgaa atttatgcac cgcaggaata tctctcacgg gcgtatcatg     11460
     atgctccaag gtattgtgca gatattgtaa gtactcagat aaagaatgac gaggtcattc     11520
     tgaaaggaga aatccctgct agatgtattc aagaatacag gaacgattta acttgtttca     11580
     caaatgggca gggagtctgc ttgacagagt taaaaggata ccagccagct attggtaaat     11640
     ttatttgcca accccgccgc ccgaatagcc gtatagataa ggttcggcat atgttccaca     11700
     agttagctta acagcttgca aaagtcatat aaaatgagat ttgaaaggat tagagactaa     11760
     ttatgatgaa atgcgaatgg atattgtgtc ctgtttgtgg gagcaaaacc cgtaataaaa     11820
     ttaggatatt gctgattata agattttttt agatgatgca agaaatttta tgtatcgctc     11880
     tataattgat tttgagaatt ttgaaagaaa aactcaagcc taaaagcaaa tatgctataa     11940
     tatccattga agcaggtagc gattaagcaa cgccgctatc atcagcttgg ctgtgtgagc     12000
     gttgttaatt taaatcacaa aataaaatgt cgcacagcca cttgaatgct tcaaatctta     12060
     actttaatct tttagaatat cggtaaaaca agcactttgt gcttgtaatt ttattttact     12120
     tgggggtaag cccccaaacc cccttacacc aaaaaagaga aaaatcttat ttttgccact     12180
     ttagagagct gtgagagcct aaaaggcttt tagtgctatt tgggtattac tttttatttt     12240
     taaagcataa tagacccatt aaaatgcttt aaatggctag ttgatgttta agctgaaatg     12300
     aaattctagt ttttcttttt ggtgtaaaag ggcgaagccc taattttcat tggatggcta     12360
     gaatattata aaaattcatt tgacataatt agtatacgcg tgcgcgtggg ggacacacac     12420
     atagctaaaa aattaaaaat actatatatt taaatcatta taaaatcaat gttttagctt     12480
     atcctatgaa aaaatagcta agttttatct tttttgtaaa atattgattt ggatacttaa     12540
     ttgtagagtt atatttttta gagtttgttt tagtttttta taagtatttt attagaattt     12600
     tttatttata atagtccgag taattatttt gtttgggggc tttgggggat tttttaaaat     12660
     ctctcactct tctctatctt ttagagtaga tttaatgatg tttatacatt ctccaaaaaa     12720
     tccgccatat atttctttat tatcttccct taagtccaat aaatcaaaaa gcatataaga     12780
     tattttttca cgatctaaaa tattttttgg ataataattc ctagataaaa gcttcctata     12840
     atcatcttca ttaaattcta agcaagagat gttgcacttg aatttttgat aaaattcata     12900
     taaatcacaa agatcgctac attccctagc ctccattata aatttacttc ctatacaaaa     12960
     atcagtttga tacaaatcaa attcattatt ttgttttact acaattttag tatgcagaag     13020
     atcattacaa gtgatgatat atattttatc aaattctccc gcctcattta taaattgaga     13080
     attaaaattt gatttaataa gattatttgc aaacgaagaa ccttctcctg ttaataacca     13140
     atgatggtcg attttaaatg ttgatgcaaa tttttctaaa aaatcaaaat ctggataagt     13200
     tttaaaattt aaaatttgat taatttttgc aaaattattc tctcccattg ctcttgcaca     13260
     agttatttca cttaatttca gctcattaaa gatatgatta attctattaa ttaaatcgtt     13320
     atgatctttt gaagaagtat taatattgcc ctctaaatta tatgagttta gcaaagtaaa     13380
     tccatcctga aaattcttaa ttatacttct aagcttatga ttttcaagca ttaattctaa     13440
     ggctacttga gctgttttag atattcttga tttatcactc caagcatcta ttgtagtttt     13500
     tgataatcct aatttttcag ccaattctat cctatttatc cccaaagtgt tgcaaacttc     13560
     tttgaacatc aaaactcctt ttgaaaaata atttctgaaa ttaaagcata ataaaataaa     13620
     aaaataaagt atatacatat tacataatat tttatatttt ttatgtaata tattctaaca     13680
     ttgattctct tatattttac tcatctcttg taatctcatt attcctagca cttgtccatc     13740
     gcaagatatt atcggatcgt cctcgctctc cttgctgtaa ctgattgagt gcattgatgt     13800
     gcaaaagcat ttgagttcgt tttgtgttat gaaccatagg ctgttcggac aatattcgca     13860
     taaagtttct ttcttgggca acttctcttc ggatagttga tttattaccg agctcttgta     13920
     agactctctg tctatattgt tttgtataat ctctctcatt atttactcct ttatcgtgtg     13980
     tgatcttata ttttttggtt atctgtttta attctttttc tctaccaaca acagaaacat     14040
     cccaaacagg ttttttaagc gttttaacaa cttcttgcca tttgttgtta atttttgcct     14100
     ttctttttat ctcatattct tcttgcccta ctattttaaa tcttgcatat tcacccctta     14160
     aaactttatt ttcttttaca actctttcta aatcttgtcc ccaaattgtt gtgattcctt     14220
     ttttagtttt ataacttaca taataacttt ttttagcatt tttatctgtg ctaaattgat     14280
     aattcgcttc tccaaaatcc ataatctgat aataatgcat ttttattttt agtgcttgat     14340
     taatctcatt atttgtattt aatttaactg aaaattcttg atttatttct acttctcttt     14400
     gctttttagt agcttttgct tcaactccta actcatttaa tgcttttgca aattctgctc     14460
     ttaaatttgc taaatctgct ttttttggat taattctttt gccattttta tccgcaactt     14520
     tcaagcaaac atggcaatgc ggattatccg tatcattatg aaaagcaact ataaaaaaat     14580
     tatttggata cattcttttt aaagtagtaa ttacagattg ttgtaatttt tcttttggtg     14640
     ttgtagaatg ttctttcatg gaaaaaacca tattaatggt atgtcttttt tctttagcac     14700
     cttccttata caatggaata ggagatcctt catttttgaa aattctttta acttctaaaa     14760
     tctcatcttc tcccgcatat ctatcaaaat cgtttgtaat taattctaca tttccatcac     14820
     gagaaatata atcaagatgt tttgaaagtg cttgagaatt tttagaacct gaagtaattt     14880
     ttacaacgac ttctgtattt tttctaaaca tatttttact aataagctta cctgttttta     14940
     tatcttttgt gtatttatct ctatttttat tgatgtaatt tagtggtagc tttgaagcat     15000
     tttctatttt agtaaaaact tttttagcaa ttatttcatc atcaaatatt cttatactac     15060
     gcgacattaa attctttcat tatttttttc tattatagcc ccaagctgat cggataatat     15120
     atcaatttta tctctaatat tatccatagt tttatttaaa ttattttcat ttattttgac     15180
     agaatttcca cttctaagaa tcttcaataa ttgatatata tttttaccta ttgcattgat     15240
     ttctgttctt gtttttataa actcatctat ttctatatta gtaaaaagtt tttcattttt     15300
     tatggagttt aatagcaaaa attttgcttg ttttgtaata cttgaaaatc ctgtattttt     15360
     agaaatttct tttaaaatat ttacttcatt ttctgtaagt tttagtttga ttattttatt     15420
     ttcatcactt gtataaaatt tatttttaga tatttcatca ttgattttat tcttctcatc     15480
     tgtatcgcaa gaattaaact tttttaataa aatagatatt attttactat atgatgcgtt     15540
     tgtttctgat tttatatact ctaaaattat tttatcatct ttgctaactt ttatgacgca     15600
     attattgttt ttattcattc gcacttcctt agtgagcctc gcagagtttt tgccttttat     15660
     tttttaaaaa ggtaactttt tgagaaataa aaggctatcc tgcaatcatt aaattatttc     15720
     aattaatcgc tattctacat tattaagctt tataaaacat taagactact ttgcgataat     15780
     acatttacat aaatattata aaggagatgt tatgcttaaa gaaagcaaat tgatagaaga     15840
     attaaagcgt gagtatgatg aaaaattaaa aaaattacgc caaaaagaaa aagaaaataa     15900
     agagcgtata tataaaaaac tttcatcggc actatttaaa gattttgaaa taaatgaaga     15960
     ttttaaaaat gaatttaatt tattggtaga aaagtttgat tgtaaaaata ctaaaaatat     16020
     cttagataaa ataaataact tatatgattt taatcataga aacgataaaa tagatactgc     16080
     aaaaaaacaa taaaacaaaa acttatcata ggagaataaa aatggaaaaa gattacaaga     16140
     taaaagttac agatgtaagc gaacttaatg agcaatataa agaagctata caagagggaa     16200
     cttatgaagg tgaagatgta aataaatttt ttaatacaat aaaaactttt gatattgcag     16260
     aaagtttatt aaaaaaagat ttttcaaatc aatatattaa atttgatatt attactgata     16320
     aagaaaaaat accattaaat ataagacttg gtgataaaaa ttttgaaaaa ggtatcgaac     16380
     atttaattaa tattggtagt tctaaaatat ctaaagaaaa tataaatcct gaaataaaaa     16440
     aagatctcaa taatcaactt ggaacttata aaccaaaagt atatgatgaa atgctagatg     16500
     gaacttttaa ggctttaaaa aatttatctg aagtagctaa taaagatata ggagtaatga     16560
     tatcagaatt tgcaaattct tattcagaaa ctagagaaaa atttgaaaaa aaacaaatta     16620
     ataaaaaatc attttttaaa gaaaaaatga atgaattttt caaaaaaaaa ctaaataaaa     16680
     ttttaccaaa taaagaaatc agcaatgaaa aaacatattc tcgatcaaga taaagaaatc     16740
     aaaaggatat gcaatgccac aaaaaagaat ttatctttat gttccattta aagacaaaga     16800
     aaaagcaaaa tcattagggg caatgtggga tgataaagaa aaaaaatggt ttgctccaaa     16860
     aaccttagat aaaaatattt tctcacaatg gctttatcca caccaaaaaa aagaattttc     16920
     atttgatgaa aatgaagtct taacagcttt taaatctgct ttagaaaatc aaggtttaat     16980
     tattgatggt tcacctatca tggatggcaa aatccacaga gtaaaaacaa caacagataa     17040
     aggtagagaa atgagtggag cttatagtgg atttttagat gaataccctg ctggttttat     17100
     tcaaaatttt aaaacaggta ttaaagaaaa ttggaaaatg cccatagaaa aaaatcaaag     17160
     caataatata aaaaattctc aaaaattaca tgagcaaata aaaaaagatc aagagcttag     17220
     agaaaaagag attttaactt tgcaagaaaa aaccgcttta aaacttgaag atgagtataa     17280
     taatgcaaaa tgggctaatt ctaatcacgc ttatttaaag aaaaaaggct ttgatgaaaa     17340
     cttttatctt aaacaggata aaatgggttc tttgcttatt cctttaaaag acgagaatgg     17400
     aaaattatgg tctgtgcaaa gaatatttcc aaatggagat aagatcatag gagtcattaa     17460
     aactcaagaa gaaaaagatc aaggcgtaga atatcttgca aaaaaacaag gttgctttca     17520
     tataataggt gcaaaaagct tggaacattg caaagaattt atcataacag aaggctttgc     17580
     tactgctgca actatataca aggcacttaa taagcctgtg ataatgggtg ttgatgctgg     17640
     aaatttatcg aaaattgttg aaaccctaaa aaacaaattt gaaaatactc ctataacttt     17700
     aatagcagat aatgataaaa aaagagaatt gaaaggtctt tctaatgtcg gcgtggaaac     17760
     tgcaaaagaa attcagcaaa gattttcaga tattaaagtt attattccaa aaatcagcga     17820
     tcaagaagca ggacaaggcg tgagtgattt taatgatatc ttcttaaaca aaggacttga     17880
     tgaagtcaaa aaacaattaa attttattga ttttcataac aagcttaaag cttttaaatc     17940
     tatggaaaaa acacaacctg aaaaagagat aactagataa taatagttac tctttgtaat     18000
     tataatatat aaaaaatatt ttttatatat tattagttaa taatagtata ttataattac     18060
     tataaatata caaaaaagga ttaaaaatga aaaatacaat caaactagct ttattgggtg     18120
     cagttattac tggtgtcttt tctgcttgct cttcagagcc aaaaacagtg caatattacg     18180
     aagatccaaa aaatgctaca gaattagaag ctaaaatcaa agaatgcgat aaaaatgcta     18240
     attctgcgaa aactgacaca gaatgtgcaa atgcttatga agcaagatac tctaagtcgt     18300
     ttgattacaa accacaaata agcacaaaag aacttatgca aaaagctaga gagcagaata     18360
     aaaatatgga actaaaataa caaataaatt ttagttctga ttctttttca aaaaacaaaa     18420
     gtaaaaaata ttaaatatta gggctcttat tcttttaaaa taatgcctta atatttaaat     18480
     gaactcttct cttttattac tttttaaaat ttctttgtat tttctcaaac ctttacaaat     18540
     atgaaataaa cctatcattc caatgataaa aatcacagac attaaaaaac aatcttgaaa     18600
     gaaaacagca atattttcat aaatgaaaaa ttcaaaaaca agaaataaaa aacttaaaaa     18660
     agttacaatt aacataattg ttaaatcgaa atacagcttt tctagggtgt taagtctagc     18720
     ataatctaaa tatttaataa ttttacacat tctttcacct ctgcttccca tgcttatttt     18780
     ctattaaaac attatatcat aatttccatt tctatcagca acactttcta tttggagttt     18840
     tttaaaataa aagttcaaaa attttaattt ttgatttacc ttatttaata ttatagaatt     18900
     taataaattt aagaatttag aagtcattac atttaagtca attgtttttt taaagtccct     18960
     attttccata tgttattttc gtaaaaatgt caaaaattat tacatttaag tcaaaaatta     19020
     ttacatttaa gtcaatttta tttgaaaata agaggagcat ttagcaattt ttgttgactt     19080
     taatgtaagt gtatattaca tttaagtcaa tcttatttga aaaaaatcta aaattgctgc     19140
     ctattgacat agatgtgata ctttgatata atttatttcg aagattaaaa tatttgttac     19200
     atttaagtca atcttatcat cttttaatag aaggaatcaa gatgctatta aatattatta     19260
     ttgaaaaaga tcaggatgga tattttgcac gcattttaga gcttgaaggt tgtgtttcgc     19320
     agggaaatac ttatgaagaa gctttagtca atataaaaga agcaggagag ctttatttag     19380
     aaagtcttgc aaatgaagaa aaaagaatta ttgaaaataa gacaacttca attattccaa     19440
     tggttttagc aaatgcctga attgcctaga atgactgcaa aagaagcgga aaagctttta     19500
     ttgcaaaatg atttttcgat tgataggcaa aaaggcagcc atagaatcta taaaaaagga     19560
     ctttatagaa tggttattcc tcaccatagt ggagaaatat tgcaccctaa aatcataaaa     19620
     caactatttg agatcataga agtagcaaag gattaaaaaa tgccaaaaag aaatactatt     19680
     gaaactatta cactcggact ttttagcgat gaagatgttt ctataatctg cgaagatacg     19740
     attaaattag aaaggggttc tgtagctgta ttaagtggca atagtgaagt aggcaagtct     19800
     tttttagctt taaaggtatg tgctaatgct attaatgatg gcttaaaacc ttttttttgg     19860
     agcgtagaag ataaaaataa agcgatttta gaacgcataa aaaatattga aagtttttat     19920
     tcttttaata ctgcggaact tgaattttca aatgaactcc caaaaatcaa taaagaacct     19980
     ataaattgtt taaaagaaga gcttaatgag ttagcagatt gtgatttaat tgttcttgat     20040
     acctttagtg catttttctc aacattaggt tttaaagatc aaaacaatca aaacgatgtg     20100
     caaaatttct ttaatattct aacagatata gcaaaatcaa ataatcaagc tatcttatta     20160
     cttcatcact tagacaaaaa aggcgaaagt cttatgggta gctctgttat tatcaatgct     20220
     cctagacttg tttataaact ttcgttcgaa aagggagaag ataaaaattc taccacctat     20280
     cgcttgcttg aggtgctaaa ggataataat aatatcaatg ctggagaatt tcaaaaaacg     20340
     attaaagtat tgcaaaattc tagtattgat gagccttcaa ttgtaaatct tagggctaac     20400
     agcattgatt ctaatacttt ggagattatc aataaaaaag atatttctgc tgtaagtgtt     20460
     aatgaattag caaaaggcta tgtaacaatg aatgaaaata gaggtgtttt ttatttaagc     20520
     tcacgaaagc ttacagacac taatttttat aaagtattta aagaaaatga taataaaata     20580
     gattttaaaa tgacaggtgc gaatggctca tcatatgcca taagtttaaa gaactctttg     20640
     cttacgcaaa ctcataggaa tattttagat gctttatttt tatatatcaa aaaaaatgtg     20700
     gatacaagtg ttattaaaaa atatcaagaa aatttttggg atatggaagt aagattagag     20760
     ccctataaat tcttaaaaca atatcttaat aaaaattcta ataattattc ttggttaaaa     20820
     caaaaattta cagaaatctc tcgttttgca tatgatttgg ctttcactca aaatgtagaa     20880
     gataaagata aaaaaacaat cactcaaaga gataaaggca ttttaatgtt tgactctgta     20940
     gagcgtatca caaaagaaaa tggaacaatt gtatctgtat tcgtgctaac agttcgtagg     21000
     gaatatatta aaaaactcga aacagaatcc actctttctt atgatgatga tttatcaaag     21060
     attcttatta atttaaattc tttagtcgca caagatttga ttagattttt aacaagtttc     21120
     cctgataaaa aaattcttag ttatagtgag ttttgcgaga ttaaggcata taaattttat     21180
     aaagaaaatt ctatcatttc aagacaaaaa aaagaaatca ttaaattaaa agacaaactt     21240
     atagagtttg gtatcaatat ctatggcaaa ggcgtagaat ttgctgatta tgatgatgaa     21300
     ttttttcata ataagtataa aaatgaaaat gatttatttt tcatctatca aagcaataat     21360
     aaggtaaaaa gatatattaa gcgtgatgat ccaatgaatc aactaaacac caaagacaat     21420
     aaatttcttt tacaaaagtc cttatttggt tgatgatatg tgattttgga atattaaact     21480
     taattttata taattaaaat acttctttgc atttgattaa ttgtcgttaa attttattac     21540
     aaaatttttt atatttcact taaataaaaa atttattttt gttttaattt tcgtttttta     21600
     ataaaccata atagcccatc gtaagttttt ccactatctt tataaaataa tttccaaatg     21660
     cttctgatag ataaatcttt atcaagcaaa gtttgtattt tatctatatc cttatcataa     21720
     atactattta atgacccttt cgggcgtcct agttttttac cactagcctt agcattttca     21780
     agtcctgctt ttgttctttg gctgatcaga tccctttcat tttccgccaa gtaagcataa     21840
     attgacagaa tgagttttga agaaggattg ttaaaattgc tgagttctct ttgtcttaaa     21900
     aatagaaaat taatattatt tgcattaaat tcaagaacca aattaattat ttctagcata     21960
     cttctaccaa gtcttgaaag ttctgtcgct attaataaat cgcctgattg taatctttgt     22020
     tttaaatcct tgatttttcg tttttcttga gattttgtag agcttatttt tacttctaaa     22080
     atttcatcta aaatgatatt gtttttatga caatattcca taatttctaa cttttgagaa     22140
     tctaattctt gtttatttgt tgatactcta atatatgcta tattcatcgt tctaaatctt     22200
     ttaacttttg attttttggt gttttttgag taaattcttt aaatttgcca tgaaaatcct     22260
     tattgtaacc agcttgttta ttaatttctt tgatacatag attttgtata gtatctttta     22320
     agctgtattg ctctcctatt tcagtaatat caaattcttt aacacattcg ccaaaccaag     22380
     taaatttttt agcaagttta gtaactattc tagcaactcg tctttcatct attggttctt     22440
     ttgaagtata acctgaatat tgtctatgct caaaaccatt ttcgagcata aattttttaa     22500
     tcaaagaata gggttctctt gtgtctttaa aatatttttc aagacttttt gtagataaat     22560
     caaaattaat tgctttgcga tttattccca aattccttct ccttcggctt tacttgcaga     22620
     aatcaaatcg ctatttcctt ctttttcact gatccaaatc cattcttttg cattttttgt     22680
     aaaccattca gaatcaatca aatatttata tataaataaa gtcatacaac ctaaatcata     22740
     cttatcccct ttacaatgat aagtttcttt attaattttt atcattcctg attctttagc     22800
     atattcatct atcattttat acatatcttc taaattatat ttgccttctt ttaaaatctt     22860
     ttcttcatct aatactattc ttgtacctaa aagtgggtat gccatttttt tatcctttca     22920
     tcaaaaacct aacaaattct agtaaaaaat agctaatact taaataaaag cttttgaata     22980
     atattaatct aattacaaaa caaaaattaa attatttttt taactaataa taaaactaaa     23040
     atttaacgaa caattttttt aataaaggat ataaaatgaa aataaaatta ttgtcgttaa     23100
     ttttattaag ccctatattc gtatttgcgg ctggtggtat tgacaaagtt aataccttta     23160
     tgcaaaactt aagcattgct ttgtatgcac ttggtggagt tttactcaca attgcactta     23220
     tgtggtgtgc ttccagaatt atgtatcaag ggcaaactct tagagaagtt gcacctgttt     23280
     ttatcggtgg cgttattttt ggatcagctt cagcaattgc tggctatatc attacataaa     23340
     tataaatagg actaatcatg gagaaaaatc cactttttaa aggtttaacg cgtccaccta     23400
     tgatttttgg cgttccgatg acaccttttg ttatagcgat gggatgtatc attttaattg     23460
     cattttatag tcaaaacatt tttttagttg gcttttctat tcctgtgttt tttattatga     23520
     aagcaatgac aaaaaaagat gacttcattt ttagattaat gtttttaaaa atgagatttt     23580
     tatccaatcc tgcttccaaa aattatcata aggttaaaac ttacagcaca aactcttata     23640
     gacaaatgcc gccaaattct aattttccaa aaatatctgt gttcggactt aatgcagaac     23700
     ctagttttga aaaattaatt cctttttcat cgcttataaa tgattttgtg gtaattacaa     23760
     aagattattt tttaatgaca acttgggaga ttggaggaat tagttttgaa gcagaagaag     23820
     acgatgaact agatattaaa aatgatcttt tgaatatgct ttttaaatct ttttctaacg     23880
     aatctgtaag cttttatttt cataattgta gatattctat cgaagacaaa ttaacttcaa     23940
     aatttaataa tgctttttta gaagaaattg acagaaaata ttatgagagt tttaagcaag     24000
     gaactcttag aaaaaattct ttatatttaa ctcttatttt caatccttta aaagtgaaaa     24060
     tagaaaaaac aacttttatg aaaagttctt ttgaaaataa aagaaaaaca attaacctat     24120
     ttctagctaa atttagtgaa tttgctgata gactagaagc aaatattaaa gattttaacc     24180
     caaaaaggtt aaaaacatat tccaaagatg ataaaaccta ctctgaacaa ctagaatttt     24240
     ataattattt gattagcggt aaatttaatc ctataagagt attaccaagt cctatagatc     24300
     agtatcttaa tggtaattta caaaacatac aatttggaca cgatactatt caatttaacc     24360
     aaaatgatag cacaaaaaga tttgctagat gcattgaaat taaagactat acaaatgaaa     24420
     cttttgcagg aattttagat atcctaatgt atttagatgt ggaatacact ataactcaaa     24480
     gcttttctcc tattcctaga gtggatgcaa aatcagcaat atctaaacag aaaaaacaac     24540
     tcattgcaac cgaagatgat ggtttttcgc aagtagcaca aatcgacgaa gcactagatc     24600
     aacttacaaa tggagaaatc tctttcggta aatatcattt ttcaattctt gtgtatggaa     24660
     atactataaa agaatgtaaa gacaacacaa atgaagttgt tacaaagatg aacgaattag     24720
     gatttggagt aactttagca acgatcgccc tacctgcaac attcttttcg caactacctt     24780
     caaactttgc tatccgccca cgcattaatc tcatatcatc catcaatttt tcatcgctaa     24840
     ttgctttgca taatttttct atgggcaaaa gagataaaaa ttgctggggt gatgctgtta     24900
     gcattttgaa aacaccaaac aaacaacctt attattttaa ttttcaccaa agttctggtg     24960
     taaataaaaa tgattttgga gaactctttt tagcaaatac tttgatttta ggacaaagtg     25020
     gtggcggcaa aacagtgttt atgaacttta ttgtagatca aatgatgaaa tacgctagca     25080
     aagatacatt tcctgatgat attcctgaag aaaacaaaaa atttacagcc atttatttag     25140
     ataaggataa aggtgcgtta ggcaatatac tttgtgctgg cggtagatat attagtattg     25200
     aaaatggtaa gcctacagga tttaatcctt tcatggttga aagcacacaa gaaaatataa     25260
     gacaacttca atcgctaatg aaacttttag taactagaaa taatgaaatt cttacaacta     25320
     gagaagaaga aatgctcaat aatgctgtta attctcttat gaaaggtttt gagaaagagg     25380
     aaagaaaata tcctatttct ttattacttg aaaacttaac tgaaaatgta gatgatgata     25440
     attctcttaa atcaagatta gcacttttca aaaaaggcaa acaatttggc tgggtttttg     25500
     acaatgaata tgataattta gattttcctg atgatattaa tttatttgga atcgatggaa     25560
     ctgaatttct tgatgataaa gatgtatcag ggatattaag ctattacatt ctttggcgtg     25620
     taatgagttt agcagatggc agaagacttt gtattgatat tgatgaagct tggaagtggc     25680
     tagaaaatga aattgtgcaa gaagaagtta aaaacaaatt taaaactatt aggaaacaga     25740
     atggattttt aagacttgct acacaaagcg tagaagactt tttaaagctt aaaaatgcaa     25800
     caactcttat agaacaatca gcgacaatgg tttttttacc gaatccaaaa gccaaagaag     25860
     aagaatatgt taaaggagta ggtttaagct atgatgagta tatgatcatt aaaggtttca     25920
     atcctgcgaa aagacaattt ttaattaaaa gacaagatga aaaagtgatt tgcactcttg     25980
     atcttagctc attaggtaat gaaaatttaa aaatactatc aactggaaca gcacatatag     26040
     acactataga aaagattttt tcacaagaaa ataaaagtct tgatgaaaaa gtattagagc     26100
     tgaaagaatt ttataaaaac tcataggaga taaaaaatga gcaataaagt cattattaat     26160
     aaacaagaag tgcaatttgg cactcaaaat aatcaaattt tttgcacaag tttagatgtg     26220
     gctaaggttt ttgggaaaag acatgatcat gttttaaggg atattgagaa cattttaaat     26280
     gatttgcgag aaatagggac ttctcaagat ctcctcaatt ttggggaggt cgtgcgaata     26340
     tcgaaaacaa cgaatccaaa gaatggtaag cttgttaata gaaaaatgcc tatgtataac     26400
     ttaactcgcg atggattctc ccttttagca atgggcttta caggcaaaaa agctttacaa     26460
     ttcaaaatcg ctttcatcaa agcttttaat gaaatggaaa aacttttaca aaaagaaatt     26520
     aaaagcccta acaaatactt aacagatttg atggaactta tttatccaaa cttaccacaa     26580
     aacgattaca aagttagtgt gattatcaca gataaccctt attctaaaga agctaaaaat     26640
     gtattttctt taaattatct tgttgataat cgcacaccaa aagatccaaa gaagttgcaa     26700
     tgagtgataa agaattagaa atttttgaac tttgcgaaag attatcagag cttttaggag     26760
     ataaagaagc aattgcggat ttaaaaaaat tatatacaaa tcatcctgaa atgtttaagg     26820
     atatgcaaga agtcaaagaa gtaattaata aagtagtaag cgaacctgaa atcattgttg     26880
     atgcaaatag agataaaaga aattatgaaa ttattaaagc agcaaaaatc ataaatgata     26940
     aaaaaatggc tgatgtagtt ataaaaaacg aaagtggaac aaatgagata tttcatgcaa     27000
     ataaaaaaag aataaaagag tttaatagat taaacaataa agataatctg ttgcaggtag     27060
     agaccccaac actctctaca caccaactta atggattgga gctaatggat aaaaatccat     27120
     ctggtgcaaa tgcactttct gcaactatca atcaaactat accacaaaaa gacaaatctg     27180
     caaatgattt taaagcaaaa ttagaagaat ttagcaccaa aaaaacaaat gcaattaaat     27240
     ctataaataa ggagtttaaa agatgaaaaa atattacacc aacaaaaagg agttaaacaa     27300
     tgaataatgt aaatctaatc ggatacttag gaaaagattt tgaaataggc actacaaata     27360
     gcggaagagt ttatgcaaaa aattctcttg caattacaaa gcgatggaaa aatgaaagag     27420
     gcaatgaaga aagtagcacg acttggatac ctattgtttt atttggcaaa agtgcagaaa     27480
     gtgcatcaac gcacattaaa aaaggttcac agtttgcgtg tagtggagaa ttatcatcca     27540
     atcaatatca agatgaagat ggaaatacta gaacaatgct aagcgtgatt gtatctaaat     27600
     tttactggct tggcaaaaaa gataaagatg acactggaac acaaaatcca caagttccac     27660
     caaaagagcc aaatattgat tatgaaaaca caaatataga tgaagaaaca caagtatttt     27720
     aagatttaag gataaaaatg tctataaaaa atttaagtgt agaagaatta gcacaagaat     27780
     tagaaacttc aaatcatgaa aagctgatta aagctttgtt tttatttgaa aaaagttctt     27840
     caatggaaga tcttaattca gatcaaatag aaataatttt agatgaagta tatgaatttt     27900
     atatcaatca taaatccata tcttcttttt tacaagaaga tataaaccaa gcattagatg     27960
     aagctattga taaagagctt tgcaaaaaac aagaaaaatc atttgaaagg taaaaaatga     28020
     aaaaaaatat ctttggtgtt aataaagcca tagggaaatc tcatccccat gaaaatgggg     28080
     caagactaat aagccttgac tataattata caaaggagta taattataac tatgagattt     28140
     gtgtaactca atttaaccac ctcttttctg aggttaaatc tagccacagg gttgcagccc     28200
     tatggctaac cccacaaaat tatatccaaa aatttaaaaa atctattctt attcttactt     28260
     ccttattagt tttgcctaac ttagcattta gtgctggtat tcctgtagtt gatgcaacag     28320
     caaatcagca aatggctaca caaaacgcta aacaagtggc agaatgggct aaagatgctt     28380
     caagatggac tgaaacagta gcacactatc aaaaacaaat tcaagcttac aaagatgaac     28440
     ttttatcaaa aacaggcatt agagattcag taacttttct aaaagatatt aaacaaatat     28500
     attcagattt tgctgaagct gggcaaaata ttcaatcatt ttacaatgat gtattaagag     28560
     atccacaaaa atttttaagt gataaaggta atgaaatttt tggaaaatat acgagctttg     28620
     atcgatgtaa ttttgatttt ttaagtcaat cagaaaaaaa catttgcaaa atgaatttaa     28680
     tcacttatgc tgctcaagta gaaacctata atcaagcttc aaaacaaatg gatacaatta     28740
     gccaaacact ccaaaaattg caagataaat tagtaaattc caaagatatt aaagaaagca     28800
     cagatgtcgg caatgctatc caattagaag tagcaaaaat tcaaatggtt aaaaatcaag     28860
     ttgatttagc taattcaagc tatgaaaacc aaagaagaat ccaagaagat atggctatac     28920
     aagaatactc taagtcgttt gattacaaac cacaaataag cacaaaagaa cttatgcaaa     28980
     aagctagaga gcagaataaa caatgaatga tctttttcaa actctaggcg aaagtataca     29040
     gcaaatcatt gatgcaataa gacaagtggg cacgagtgat aaggttgctg agcttagtgt     29100
     attgctctcc ataatcatta ctttagttat tatgtataaa ggctatgaag ttttaatggg     29160
     aacaagccaa agccctatta gggaacttac ttgggatata gcaggaaaac ttcttgccat     29220
     tacttttgct ttgaatatcg gcggatggct taccttggtc attaatgcta tggatggaat     29280
     ttatgaatgg gctgggggtg gaacacaaat gtataaaaca ttagatgaaa tgtatgcgaa     29340
     cacagcacaa ctagcaaaca taatttgggc taaatcaagt ggtgttggag gtgctatttt     29400
     agccattgta gcaatgctgc tttgttatgt aggatttata atcgctgttg ctcctacatt     29460
     tgctatttta gtggttacaa ctttcacaca aaccctactt gtaataaccg ctcctatagt     29520
     cttttggctt ttgatattta aatccactaa aaatgttttc acgcaatgga taggactttt     29580
     actttcaaat actttagtga ttttacttgt aggattattt ttaaaaactt tcatgggaga     29640
     aataaacgga tggatagttt cattatcgca acatgtacaa tctggatctg aagtattagg     29700
     aacaagtatt ttcttcgtca ttgcttcctt agttcttgtc attatgatta tttctgcaaa     29760
     actttatgct gaaaaaatcg caaatgtttc aatggaagga gctatgggcg gagcaatagg     29820
     ttctgcttta aatcctgtta gtagattggc aggttggact gcaggaaaag ctgcaggaaa     29880
     aactggtgca aagttagctg ctaaaggtgc ttgggctggc actaaaggtg gttatagttt     29940
     tgcaaaaaaa atgtatgaaa gggctagaaa tgcaggctaa attaattttt attttatttt     30000
     gtggtgtgtt attttttagt gcttgtagca ctaaaaatca aggcaaatat gatgaatttt     30060
     ttaataatca aacagggtgg attcccatca atcaaaacaa agatttaaat aaaggaacta     30120
     tggatgaaaa atgagtttaa tactgcaata gattatgaag caagttttag atacttaatt     30180
     gaaaaaagta ataaaagagc ttggcttatt gcttttattt ctatttttat agccattatt     30240
     tccattatag ctgttgtttt acttactcct ttaaaaacaa tagaacctta tgtaataaga     30300
     gtagacaata ctacaggaat ggttgatatt ttaaccatgc ttgatgaaaa agaaattaaa     30360
     gcaaatgaag cattagataa atattttatt agcacttatg taaaagctag agaaggctat     30420
     tattatgatc ttttaaatca agattattta cttactcaat taatgagttc tgaaaaagta     30480
     gcaaatgaat atagggcttt atatgaaggt gataatgcaa gagatcaaat tctaaaaaac     30540
     tccaatgaag taagtgttca aattttaagt attgttttag gagaaagtaa cggagtgaaa     30600
     actgctacag tcagggcaat tattactaca aaaaatttaa cttccaaagg aacaactcaa     30660
     gcaacaaaag taataacatt aagttatgac tatatcttag caaaagctag cgaagaaaac     30720
     agatttttaa atcctttagg ttttaaagta ttaacttata gaattgatga cgaggtggca     30780
     caatgaaaaa aataatcttg ataaatttat tgttgtgtag ttttatttgg gctttaaata     30840
     ttccaaaaac ttctacattt gataaaagaa ttgcttatgc aatttataat gcaaacgatg     30900
     tatttcaaat taatgcaaaa aatggctatg ttagcgtttt agaatttggt accgatgaaa     30960
     gaattatcaa tactgctaca ggttttgcag aaggttggga tttaattgaa aaagacaatc     31020
     ttttatttat aaaacctaaa gcttataaaa cacaacttgt tcaacaagaa aacaataata     31080
     taggagagag tcaagcatca caagaattcg ttttagatcc aaatcctcat gattggaaaa     31140
     ctaacctaat tgttattaca aatctaaata cttatgtatt cgatttaaaa cttgtaaacc     31200
     aaaataataa cgctacctat aaactcagtt tttcttaccc taaaaaagat ttaaaagccg     31260
     ctaaagaatt tttagaagca caagaacaag aaaatatacg cagagattta aataaaaata     31320
     ccattcctag aaattgggat ttttatatga aaattaacaa aggcagcgaa gacataagtc     31380
     caaattttgc ttatgatgat ggtgttttta catatcttgg ttttgataat actaaaactt     31440
     ttcctgctgt tttcatgtat gataatggta aagaaagtat tttaaatact catattaaaa     31500
     aagatggcaa ttatgaagtt ttagtaattc aaaaaattac taaacaaatc ttgttaagaa     31560
     gtggcgataa agtcgttggt atttttaatc gtggctatgc aaaaaatcct ttagataaaa     31620
     caagagaaac ctccaatgaa aatattcaaa gagagataaa taaaaaataa aacgaatgaa     31680
     actaaaagga ataagtatgc aagataaaga acaagataat ttagacaatg attttgaaaa     31740
     tcatacaagt gatttacacg atcaaaaaaa tcatcttaga aagatacaag cttatgtaat     31800
     ttttgctgtg ggtgggttat tattagtttt aatattagtt tattttttaa aatcattttt     31860
     aagtagcaat acaactaccg aagaagtaca aaaagaagat aataaagatt tggcacaaag     31920
     tgttaaaaca aaggaattta ttccacctcc tccacaaaaa acatttgatg aactaattgc     31980
     acaagaatca ccaaaaccga cacaagattt aatacttgaa cccaaacctc caaagcctag     32040
     aattgttaaa ggtgcaggag ttactgttgt cgcttcatct aataatgatg gatttggaaa     32100
     taatggcaca ggaaacaggg aagaatttgg agaaaaacct aacacagtgt ttgagtttgg     32160
     acaaaatggt actttacaaa actctaataa tttacaaggt ggtagtggag attttgttgg     32220
     agaggtcttc actcccacaa tcgctaaagt tagcgaattt gatcaaaatt tactattgcc     32280
     taaaggaact tacataggct gtgctttaaa aacaagattg gtaagttcta ttaaaggtgg     32340
     aatcgcttgt attgtatcaa atgatgtcta ttctgctaat ggaaatactc ttttaattga     32400
     aaaaggtagc accattacag gaacttttaa tactggacaa atggatgatg gaatggatag     32460
     attatttgta atttggcaag aaattagaac accgaacaat atcattatcc ctgtttattc     32520
     aggtgctacc gatgaattag gtgcaagtgg cgttcaaggt tgggtagatc atcattactt     32580
     aaaacgattt ggctctgctg ttttactatc aatgatagat gattcactgg ctatcttagc     32640
     ggatcaaatt gcaggtaaag ataataaaaa taattatgcc aattacactg aaaatacaag     32700
     agattctgca aaagaaatcg caaatacagc actagaaaaa atgattgata ttaaacctac     32760
     actttataaa aatcaaggtg atttggtcgg tgtttatgtt aatcgtgata ttgatttttc     32820
     aaaagtttat aaacttacaa ggaaaaagaa tgtcaataac gctagataaa tatactcaaa     32880
     aattttttgg agaattttta aaagatgata atatcaatga aatctgttat aacggcgata     32940
     ataaaatttg ggtacaaaac tctaaaggat tatgggaatg tatagatact aaacttgatt     33000
     ttgaacaagc tggacatttt gcaactgctt cggcctcatt caaaaaagat aaaatagatg     33060
     tatcacgccc tattcttagt tgtattctag taggtggaga gcgtatgcaa attgttattc     33120
     ctcctgctac aaaaagcgaa cacatttcaa ttactattag aaagccaagc aaaactcgct     33180
     ttaaaatgga agatcatatt aaaagcggac tttttgaaga tttaaatcct gatgagaaga     33240
     ataaaatcaa accaagcgat gaagaattaa tcaagctata tgaagcaaga gattatcaaa     33300
     attttatatc caaagctgtt agctatggta aaaatattat tatcgctggt gaaacaggaa     33360
     gcggtaaaac tacctttatg aaaactctta ttgattttat aagccttgat gataggatta     33420
     tcacaataga agatgttgaa gaaatcaaat tctatgaaca caaaaatttc gtgcaattat     33480
     tctatcctag cgaagcaaaa agtacagatt ttttaaattc tgcaacactt ttaaaatctt     33540
     gtttaagaat gaagcctgat agaattttac tagcagagct tagaggtgct gaaacttatg     33600
     attttattaa tgttttagct agtggtcatg gtggaagtat cacaagttgc catgcaggaa     33660
     gtcctgaaga aacatttaca cgacttgctt taatgactct acaaaatcca caaggtcaat     33720
     gcgtgccttt tgaaattatc caaaaaacac ttaaagactt aatagatatt gtcgtgcata     33780
     tccatgccca tcatggaaaa aggcgtatta gcggcattta ttttaaagaa atggagagat     33840
     aaatgcaaaa taataaaagc attcaaatga tttttcttac tatagcgagt tttattctca     33900
     cttacttaat aacacccatt gtttttttct ttttaaataa agtaaaaata atgaaagcga     33960
     ttgaaattta taacataaat tttacgctac aagcaatctc taatggttat ccaaaaatat     34020
     ggctttcttt aggtattact tttggcattt gttttgttgt ttatcctgtc tcggtgttac     34080
     cttaaaagcc aaaaaatctc aatttggcga agctagattt gcgaatttta atgaaattaa     34140
     aaaaatgaat ttattttcag ataatggaat aattatcgga aaatacaagg ggaaagattt     34200
     taagatttag cggtcagcaa tttgtagcct taggagcacc cacaagaagt ggtaaaggcg     34260
     taggtatagt aataccaaac ttgttagagt ggcgagaaag tgctgttgtt caagatatta     34320
     aacaagaatg ttttgactac acaagcaaat atagaaaaga gattttagga caagaagttt     34380
     atttatttaa tccattttca agacaaacac atcgctataa tcctttaact tatattgata     34440
     tgagtgataa agagcattgc gatagtcaat taatggattt aggtaacata ctctacccac     34500
     aagatggaga ttctacctca aaatttttca atggcttagc acaaaactta tttattgggc     34560
     tttgttattt atggcgtgat ttacaattaa ccgattatgg aaaagaattt caaagtgcgt     34620
     ttgatattaa tgtaggagaa tttaactttt acaatatttt gcaactctca aaaggtttct     34680
     cacttaaaaa tgaaggaaaa actttaaaag gttttgatga tacatacaat ttcttatctt     34740
     attgtgaagt tttagatgaa gcaaccataa ggcgtttaga aacttatttt aatattaact     34800
     gcagatgcta ctaaatccgg tgtaatgagc tcttttaatg ctccgcttgt gccatttgaa     34860
     agtgaaacat taagattaag cacagaaaca agcgattttg atttgcgaga tttgcgtaaa     34920
     aagaaaatga caatttatat aggaattacg cctgatcaat tagcaaatgc acaatttatt     34980
     ttaaatattt tttggtcgca acttatttta ttaaacacca aagaattgcc acaaagcaat     35040
     aaagatttaa aatatacttg tttaatggtt atggatgaat ttactgcacc tggtagaatt     35100
     cctatctatc aatcagcaat cagttttatg gctggttatt ggttaagatc tttgatgatt     35160
     tatcaatcaa attcacaact tgaaacacaa ccacctttgg gctatggaaa agaaggagct     35220
     aaaacactct taacaaatca tgcttgtcag attttctatg caccaagaga gcaagaagac     35280
     gcagaagcta tctctaggat tttaggaaat actactttta aaacaaaatc aagaagtatt     35340
     aatacaggca ataatggagg tggatcacat agtattagcg aagcaagtag ggctttaatg     35400
     ttgccacaag aacttagaga aatgcctttt gaaaatgaac taattactat tgatagtgga     35460
     aaacctattt tatgcaataa agcattttat tattcaggat tcttatttta tggataaatt     35520
     taaagctgtt tcgaaaagtt tatcaacaat aagaaaaatc ccttcacgca aacaattaga     35580
     agatgcgatc ttaaagggag aatgtaaagt aaaaattcaa attataggag aaaacaatga     35640
     taaaaaaatc gcttgacaat ttagtcataa tggctttagt ttttataatg gtgggttgct     35700
     ctacagcccc aaaaccaaaa gaattggatg ataattctgc attgagtatc aataattcta     35760
     ttttggagaa aaaatatagc tttgttccta aagatcctta tttgagcgga tttaattgga     35820
     cttatcatat cgtggttgag aaaaaaacta tagatgatga ttttattaaa aatgatctta     35880
     ttactaaaac ttttttactc gcacacaatt ctacaaaaat cattttagta ggtagaaaag     35940
     atttaattga acaatataag caatactttg aaaaaaatca agttttagca cctatagaat     36000
     tacagcctgt caatcctatt gagcgtgatt ttaacaaagt taatatttta ttttttaata     36060
     aaacaaattt ttaaaggaga gaaaaatgaa aaaaatatta ttcccatttt gtgtttttgg     36120
     tgtaataaat agtgttaatg ctttagattt gcaattacta tctggtgata ctagaacttc     36180
     ttgcgaagta attctttgtt tagcaagtcc agttaaacca cctgaatgtg catcttcttt     36240
     agcaaaatat tttagcattc actttaaaaa accttggaaa actatccaag caaggaaaga     36300
     atttttaaat ttgtgtccta ttgacacaac aaatgatcca gaaatgtata aatataaaaa     36360
     tgatatttta gttaacttag atggagaatg ctctacaact gcattaaatc aaagaattga     36420
     aaaatcaaaa caacctttaa aagttgaaaa aatatgcact ggtggtgggc ataatggatc     36480
     aagagaatgc gtagaaataa aaacttatgg atttagaata aatcctgaac ttacaaactc     36540
     ttgcaaactt ttagcttcat ccaaatacac agattatcat ctaaaatata cctgcaatac     36600
     taaattttat gaaaaaaaag actgggaaag aggttatgag ttaaaagaag tatcgcaaga     36660
     aatttttaat gctttgccta tctcgcaaag agaacaagga gagaagttag ttcctgtaag     36720
     ttacgcagag tttgttagat tgcctgctga caaaagaaag caaggaggat ttggcaaata     36780
     ttacagagtt gatattgctt tttaccaaaa aataattatt aaaaaagatt gctggataaa     36840
     tgagaaataa tgatgaatga agaaattaat tctaatgaaa atagccttta tgaattggtt     36900
     aaagaagata attcaaccaa tatggttata caaaattata atgaactatt aagcaaattt     36960
     gaaaatctta tcaaaacaat tattgctaaa attgatattg gaaaacagaa ttcaagcagt     37020
     aatacagaag atggaatttt taaagattta gaaaaaaata ttattgagct agataatact     37080
     tttctagctc ttatttctta ttttaaaaat ccgccaagtg atgaagaaaa agaatttatt     37140
     aataaaacag cctctattaa aaaaacaatg gaagattttg cagagtttgc taacgaaatt     37200
     caaaaattat cgctggatga taaacttaaa aaatataatg aacaaatcaa caaattttgt     37260
     gaaatagtag aatataaact ttctcataat gcagaaaatt ataattcatt tctcgatcgt     37320
     ttcgttgaaa atggaaaact aaaattgaat acattttcag aaatttttac aaaaatgaca     37380
     aaaaatacaa aatggtatct tatatttttt agttttactt ctatagggtt aggtatggct     37440
     cttggcattt taattttgct tacttatata aaatattcag aatataacaa tttaaaagaa     37500
     agagtaagca caatcactca aggtttagcc actatctcta ttgatgaaaa tagcaaagga     37560
     agctttacct tgagctttgc aaaaaacaaa aaaactattt tcaatgagaa taaaaatagt     37620
     attcaaatca cactacaagg aggtgaatga acagagcaat tatatacaaa aaaaatgcaa     37680
     aaaacaaaaa acaaatcaca aatttattaa aaaaaggagc aaaaaatggc atttggaaaa     37740
     ttagttaatg ataaaattgt tatcgataca aacaatgctt taaattatag aggcaaggaa     37800
     ggtgatattc aacaaagaaa agtagatact gctctcatcg atgttattaa agaagctgga     37860
     caagttgctg caatggaaca cggagctgtg cttttttctg caaaagttaa tgaggtatgg     37920
     aaaaactatt ttgttaatag agatgaaaaa actcacaata tagttttaaa acctacaaat     37980
     tcacaaaata gagatgattt catttatatc aactctaata taaatgagca aggttatttt     38040
     tactacacaa ttaatcagaa gcgagaatct gcaaaagaat taattgaagg agttggaatt     38100
     gtagaacacc aaaatcaaga tggaactaaa agccactatt tagaaactaa tgtaaggctt     38160
     tataatgaag aattaaaaca agaacttaaa gaaaaaggga atgagtttat agctgtaatt     38220
     tcaaatgctg gaattaaagt tgttaatgaa gctgaaatga aagcacaaaa acaagaacaa     38280
     caaatacagc aaactcaaga aatcaaagag cctgaaaaaa ctcaaaacca agagtttgga     38340
     agataaaaat atgcacctta taaaggtgca tatttatagt tattattatt tattaatagt     38400
     aacttaaata ataaatttaa aagttataga atataaaagg aatacaaatg aaagcaaatt     38460
     atatagagct tgaaaaaaaa gaagggcaaa taagcgatat tccgtatact ataataaaag     38520
     ttgaatatcc gaatctaaaa aaattacaag acaatgatct tttaatggca aatgataaag     38580
     gacaatggct ttgcggtttt ataggtttaa aagaaaatca aaaagtagat tttaaagaat     38640
     tagataatgg atatatagtt cctcaatatt tatatttaaa ctcaaaagat aaaaaagaaa     38700
     ttgatttatt ttcgaataat ctagaaatta caaaagtttt gcaatttgat ttaaatcact     38760
     cttggaataa aaccgaaaaa aatactcaat tagatgaaga agaatgttta aaaatcatta     38820
     aaaacaccat agaatatatt aataatttca ataaaaatat cagtaaaaaa gaatttgaaa     38880
     agctaagcaa agaagaaaat attcataaaa ctaataaatt aattgaagaa cttataacgc     38940
     aagaagaagg agtaagtgga ttaatagaaa aagatttaaa agaaatgaaa aaggataaaa     39000
     gttatttttt tgacaagatg agtagtttta caaaaaatca aactacagaa aaatcgatag     39060
     caaaagaaaa tatcaatatc tttgaaaaat agtatattta aattaataat atataacatt     39120
     aataactatt attttctaat atttattaat aatatcgtaa acaataagat aaaatttttg     39180
     aaaggcgaag atgagattat ttatagcaga aaaacctgaa cttggtagag caattgcaga     39240
     aggattagat ggcaattata aaagcggaga aggatatata caaaaaggtg ataatattat     39300
     tacttgggct tttggacata ttttagagct tgctaaacct gaagaatatg atgaaaaata     39360
     taagttgtgg aaacttgaag acttaccact acccattaaa gaatttaaat atttgcccaa     39420
     aaaagaaagt aaaaaacaat taaaaattat ttgcgattta atccatagcg acaagattac     39480
     ttctattgta aattgtggtg atgcggatga tgagggtcaa attcttgttg atgaaattat     39540
     tcaatactcc aaaacttcta aacctgtatt tagggtttta atcaatgatt taacaccaaa     39600
     agcagtaaaa gaagaaatag caaaaattaa gtcaaatgca gattttaaag gaatgagcga     39660
     aagaggtttt gcaagaagtc aagcagactg gatagttggg ataaatctta ctagggctta     39720
     caccataatg gcacgaaaaa atggatatga gggtgtttta agcgtaggta gagttcaaac     39780
     acctattttg gctcttatag ttaatagaga taaagaattt gaaaatttta aaagtataga     39840
     ttatttttct ttgctaggtg attttaatat caacaataat actattaaag caagattaaa     39900
     aacagaagat aaaattttag atgaaaattt agctaaagag atcaaaaaat cttgcgaaaa     39960
     tcaaaatgca aaaattaatt taaaaataga aaacaaaaag gaatatccac cgctacctta     40020
     taatctactt gttttacaag ctgaatgtgc aaaacttttt ggttttagcc ctgataaaac     40080
     attagaaatc actcaaaatt taagagaaaa acacaaggct ataacttata atagatcaga     40140
     ttgtcaatat ttacctgaaa ccatgtttga acaagcacca aatattttaa atattataaa     40200
     ggaaaattta aattctaatg atgaaattca agctctcatt gctagcagtg atttaacaat     40260
     aaaaagcaag gcttttaacg atgctaacat ttcagcacac tatggaataa tccctaccca     40320
     aaacaaaatt tcatcgcaat taactcaaga tgaattagtc gtttacaatc taatcgctaa     40380
     aagatttatt atccaattct ttcatccgag agaatatcaa actactacaa ttaatttaga     40440
     agtaaatcaa agaattttta ccgctactca aaacaagaca acaaaaagtg gttttagaag     40500
     tctttggcaa aatgtagata gcgaagaaga acaagaaaat aatgagaatg atataaacga     40560
     tttatctatc ttaaaaaatg gtgatattgc aaaatgctct ttgatagaaa ttgaaaaaaa     40620
     gcaaacaaag ccacgccctt actacactat gacaacgcta cttaaagatt taaatagtgt     40680
     cgcaaaatat gtgtctgatg aaagaattaa aaaattgcta atggaaaaag ataaagacaa     40740
     aaagggtgaa agtggtggca taggaacacc tgcaacaaga tctaatcata taaaaacatt     40800
     aattgaaaga gagtatatag aagtaagtaa agataaaaaa caaattatca aatccactaa     40860
     aaaaggtaga gatttaatta aactttctcc aaaatcactt attactcctg acatgacagc     40920
     attgtggttt gagcaacaaa aaatgataga aatatcagaa ttaagaagag aacaattctt     40980
     agaagaaatc acaaaagaag taattagcga aattcaaaga attgataaaa atcaagagtt     41040
     taaaatacta gataatgaaa acaaaccaaa aattcaatgt ccgcaatgca ataaaggatt     41100
     tttaaccaaa cgaaaaggga aatatggaaa cttttggggt tgtagcgaat acatggaagg     41160
     ttgcaaagcc atttatcctg ataacaaagg cacaccaaac tttgaaacaa aacaagcaag     41220
     caagcaacga tactactcat aaatgtccgc aatgcaataa aggattttta caaagaataa     41280
     aaagtaaaaa tggtaatagt tggtggtggg gttgtagtga atttaaacaa ggttgcaagg     41340
     ctatgtatta tgacgataat ggaaaaccta aaataataaa tgtataatat taataaatat     41400
     aaatatatat taattaattt aaattaattt taataaataa tattttataa taatttaaat     41460
     aaagaagcca aaacaaggtt gtccgagttt aatcagaata aaaggagaaa attatgaata     41520
     acaaaagaaa agttagggaa tttctgtctt atacggagaa atatctgtct tatgtattat     41580
     ttatttgtat aggttcttgt ttcgttgctt taatactaag tgcgagcatt gatagtgatt     41640
     tttactcact ttttattatt ttagctttag gaactacgat cagtcctctt atttgtatcg     41700
     ggttggttaa attaatagaa aaattgataa aaataataaa aaaataaaaa caatgaaaat     41760
     tgcataaaaa aagagtataa atatttttgc aaagcaaata tctacgaaga ttatgaaatg     41820
     tttagagaaa aatacaatat tatgaaaaat ataaaattta aaggaaaaga aaatgagtaa     41880
     tttaatgatg gaacttgcaa tgatgagcaa gaaagactat tatttagtta gcaagaaaaa     41940
     aaggagttaa aatgctattt tttggagttt atacattatt tatatctatt ttgttatcta     42000
     ttttgttatc tattgaaagt ctaattccgt caaaatataa ttatgaaaaa caattagtta     42060
     atgtgatttt aaaacctata cttcttcttt tgtatggtgt aggtttgata tttttgttct     42120
     tcaacacaga agtagctaac tcattagcag ttgaaataat taatcgaatt aatcgttttc     42180
     ggataataga gagttttctt tcttctaaag aaatagggct ttatatttta gcttttatta     42240
     ttttgttaca agtagtattt atattttggg cagtttataa aggatttata gaaaatgaat     42300
     tataaaaaat ttcaaacaat gagcaaagaa gaatatttta aaaaatataa tgtcggaatt     42360
     aggtttttgt ttgggtgcga tctcaatcaa aaaaatgaaa ctgagatgat aagtcttaga     42420
     gtttttttgc caaaaaagca ctttcaagaa tacaaaaaca ttgatatttt taaaacaatg     42480
     gacttattta aaaaaacacc attatttaaa gaattaatag agcaaagcat taagattgat     42540
     tttgaaaaaa gagaatttgt aatgcctgat ttttttatta aacacgatat agaaatcatt     42600
     ccttatttta cgcaaggtgg cgaaaaagaa gaagaattaa gcaaagagaa attttttgaa     42660
     cttttaaagc aaaacaagat taaagaatta aactatttat gttttttgtt ttttggcttg     42720
     ttttgtgaag aagaatatga atatttttgt aaagcaaagg agttaaaatg ctattagaga     42780
     acatacaaga aaataatcaa tattcttttt attccttgca aaatgatatt gatgatattg     42840
     caaaaaaata tatggataaa ttttttgcaa ttttaaccct agcaagaaat gaaaatacaa     42900
     agtttgtaaa tttaaaacat ttccataatt taaaaaatgc tgaaatggaa atattttttg     42960
     ataatgtatt tagaaacaat gaatttaaaa aaaatataaa agataaatta gaattatttg     43020
     ataaaggtag gaagcattta aaaaaaggaa gttaccctgt gcttatttgt tttttaaatg     43080
     agttatataa aaatcttatc attaacgaca aacaatttga aaatttgtta gtttcaacaa     43140
     aaaaagaata tttcataaga ataattgata aaaaaagaaa aggaataatt aatatatatt     43200
     tccaaaaaga taaagaaaat gtatgggtag atagatttaa aattgtaaca gatggttttg     43260
     gaggcaatga ttatgatgaa aaaatgcttt attatggatt agaaaaagca aattatataa     43320
     aaataaatga aaaatttata gaagaagaac ttgaaaaatt aaatttactt aaatttattt     43380
     aaatacaagg atttaaaatg aaaaaaacag attattatga ttttttagaa gaagcagatt     43440
     gcttaatgaa aaaatacaaa gaagaacaaa aagaatatag ctttgataaa gaaagtcaaa     43500
     cgatcataca atctccctat tctcaagtag aattatcaca caaattagat tgcgattgca     43560
     attttcataa caaagcaaat gaaatttatt ttgaagttat cggcaatatc cacgagaatg     43620
     aagaaatctt aaaaaatacg gagttgctaa agtgaaagat gaaataatta atatcataaa     43680
     agaagctata ggagaaaact ataaaaaggt tttatggata tttcaagaac atattaaaaa     43740
     tttaatcaat tgttatccta gcaatgaaaa cggacttgtt tttgaatata aatcaagaat     43800
     atcttcaaat gatgttatat cgataataat gtttgaaaaa acagggcaaa aaattaatat     43860
     aagtttattt tttgaaaata caagaaaaaa agaaaaaatt ttagaattaa atccagaaga     43920
     aaaaaattca gaagagttaa tattaaaagc tttatttatc aaaaataaaa aagttttatt     43980
     gtcagattta tttatcttag acaaagtaag tatgtattat acccgaaaca aaatgtttaa     44040
     agaatttcaa aaactgatga tagataataa agaaaaagga atac                      44084
//

If you have problems or comments...

PBIL Back to PBIL home page