(data stored in SCRATCH3701 zone)

EMBL: CP002031

ID   CP002031; SV 1; circular; genomic DNA; STD; PRO; 3714272 BP.
XX
AC   CP002031;
XX
PR   Project:PRJNA39745;
XX
DT   19-JUN-2010 (Rel. 105, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Geobacter sulfurreducens KN400, complete genome.
XX
KW   .
XX
OS   Geobacter sulfurreducens KN400
OC   Bacteria; Proteobacteria; Deltaproteobacteria; Desulfuromonadales;
OC   Geobacteraceae; Geobacter.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-3714272
RX   DOI; 10.1371/journal.pone.0010922.
RX   PUBMED; 20544019.
RA   Nagarajan H., Butler J.E., Klimes A., Qiu Y., Zengler K., Ward J.,
RA   Young N.D., Methe B.A., Palsson B.O., Lovley D.R., Barrett C.L.;
RT   "De Novo assembly of the complete genome of an enhanced
RT   electricity-producing variant of Geobacter sulfurreducens using only short
RT   reads";
RL   PLoS One 5(6):E10922-E10922(2010).
XX
RN   [2]
RC   Publication Status: Online-Only
RP   1-3714272
RX   DOI; 10.1186/1471-2164-13-471.
RX   PUBMED; 22967216.
RA   Butler J.E., Young N.D., Aklujkar M., Lovley D.R.;
RT   "Comparative genomic analysis of Geobacter sulfurreducens KN400, a strain
RT   with enhanced capacity for extracellular electron transfer and electricity
RT   production";
RL   BMC Genomics 13(1):471-471(2012).
XX
RN   [3]
RP   1-3714272
RA   Nagarajan H., Butler J.E., Klimes A., Qiu Y., Zengler K., Ward J.,
RA   Young N.D., Methe B.A., Palsson B.O., Lovley D.R., Barrett C.L.;
RT   ;
RL   Submitted (05-MAY-2010) to the INSDC.
RL   Microbiology, University of Massachusetts, 639 North Pleasant St., Amherst,
RL   MA 01003, USA
XX
RN   [4]
RC   Protein update by submitter
RP   1-3714272
RA   Aklujkar M., Young N.D., Brown P., Butler J.E., Nagarajan H., Klimes A.,
RA   Qiu Y., Zengler K., Ward J., Methe B.A., Palsson B.O., Barrett C.L.,
RA   Lovley D.;
RT   ;
RL   Submitted (24-SEP-2010) to the INSDC.
RL   Microbiology, University of Massachusetts, 639 North Pleasant St., Amherst,
RL   MA 01003, USA
XX
RN   [5]
RC   Protein update by submitter
RP   1-3714272
RA   Aklujkar M., Young N.D., Brown P., Butler J.E., Nagarajan H., Klimes A.,
RA   Qiu Y., Zengler K., Ward J., Methe B.A., Palsson B.O., Barrett C.L.,
RA   Lovley D.;
RT   ;
RL   Submitted (04-OCT-2012) to the INSDC.
RL   Microbiology, University of Massachusetts, 639 North Pleasant St., Amherst,
RL   MA 01003, USA
XX
DR   MD5; 6293bfb92a4481408452417544a1ffe3.
DR   BioSample; SAMN02604215.
DR   EnsemblGenomes-Gn; EBG00001215260.
DR   EnsemblGenomes-Gn; EBG00001215261.
DR   EnsemblGenomes-Gn; EBG00001215262.
DR   EnsemblGenomes-Gn; EBG00001215263.
DR   EnsemblGenomes-Gn; EBG00001215264.
DR   EnsemblGenomes-Gn; EBG00001215265.
DR   EnsemblGenomes-Gn; EBG00001215266.
DR   EnsemblGenomes-Gn; EBG00001215267.
DR   EnsemblGenomes-Gn; EBG00001215268.
DR   EnsemblGenomes-Gn; EBG00001215269.
DR   EnsemblGenomes-Gn; EBG00001215270.
DR   EnsemblGenomes-Gn; EBG00001215271.
DR   EnsemblGenomes-Gn; EBG00001215272.
DR   EnsemblGenomes-Gn; EBG00001215273.
DR   EnsemblGenomes-Gn; EBG00001215274.
DR   EnsemblGenomes-Gn; EBG00001215275.
DR   EnsemblGenomes-Gn; EBG00001215276.
DR   EnsemblGenomes-Gn; EBG00001215277.
DR   EnsemblGenomes-Gn; EBG00001215278.
DR   EnsemblGenomes-Gn; EBG00001215279.
DR   EnsemblGenomes-Gn; EBG00001215280.
DR   EnsemblGenomes-Gn; EBG00001215281.
DR   EnsemblGenomes-Gn; EBG00001215282.
DR   EnsemblGenomes-Gn; EBG00001215283.
DR   EnsemblGenomes-Gn; EBG00001215284.
DR   EnsemblGenomes-Gn; EBG00001215285.
DR   EnsemblGenomes-Gn; EBG00001215286.
DR   EnsemblGenomes-Gn; EBG00001215287.
DR   EnsemblGenomes-Gn; EBG00001215288.
DR   EnsemblGenomes-Gn; EBG00001215289.
DR   EnsemblGenomes-Gn; EBG00001215290.
DR   EnsemblGenomes-Gn; EBG00001215291.
DR   EnsemblGenomes-Gn; EBG00001215292.
DR   EnsemblGenomes-Gn; EBG00001215293.
DR   EnsemblGenomes-Gn; EBG00001215294.
DR   EnsemblGenomes-Gn; EBG00001215295.
DR   EnsemblGenomes-Gn; EBG00001215296.
DR   EnsemblGenomes-Gn; EBG00001215297.
DR   EnsemblGenomes-Gn; EBG00001215298.
DR   EnsemblGenomes-Gn; EBG00001215299.
DR   EnsemblGenomes-Gn; EBG00001215300.
DR   EnsemblGenomes-Gn; EBG00001215301.
DR   EnsemblGenomes-Gn; EBG00001215302.
DR   EnsemblGenomes-Gn; EBG00001215303.
DR   EnsemblGenomes-Gn; EBG00001215304.
DR   EnsemblGenomes-Gn; EBG00001215305.
DR   EnsemblGenomes-Gn; EBG00001215306.
DR   EnsemblGenomes-Gn; EBG00001215307.
DR   EnsemblGenomes-Gn; EBG00001215308.
DR   EnsemblGenomes-Gn; EBG00001215309.
DR   EnsemblGenomes-Gn; EBG00001215310.
DR   EnsemblGenomes-Gn; EBG00001215311.
DR   EnsemblGenomes-Gn; EBG00001215312.
DR   EnsemblGenomes-Gn; EBG00001215313.
DR   EnsemblGenomes-Gn; EBG00001215314.
DR   EnsemblGenomes-Gn; EBG00001215315.
DR   EnsemblGenomes-Gn; EBG00001215316.
DR   EnsemblGenomes-Gn; EBG00001215317.
DR   EnsemblGenomes-Gn; EBG00001215318.
DR   EnsemblGenomes-Gn; EBG00001215319.
DR   EnsemblGenomes-Gn; EBG00001215320.
DR   EnsemblGenomes-Gn; EBG00001215321.
DR   EnsemblGenomes-Gn; EBG00001215322.
DR   EnsemblGenomes-Gn; EBG00001215323.
DR   EnsemblGenomes-Gn; KN400_C001.
DR   EnsemblGenomes-Gn; KN400_C002.
DR   EnsemblGenomes-Gn; KN400_C003.
DR   EnsemblGenomes-Gn; KN400_C004.
DR   EnsemblGenomes-Gn; KN400_C005.
DR   EnsemblGenomes-Gn; KN400_C006.
DR   EnsemblGenomes-Gn; KN400_C007.
DR   EnsemblGenomes-Gn; KN400_C008.
DR   EnsemblGenomes-Gn; KN400_C009.
DR   EnsemblGenomes-Gn; KN400_C010.
DR   EnsemblGenomes-Gn; KN400_C011.
DR   EnsemblGenomes-Gn; KN400_C012.
DR   EnsemblGenomes-Gn; KN400_C013.
DR   EnsemblGenomes-Gn; KN400_C014.
DR   EnsemblGenomes-Gn; KN400_C015.
DR   EnsemblGenomes-Gn; KN400_C016.
DR   EnsemblGenomes-Gn; KN400_C017.
DR   EnsemblGenomes-Gn; KN400_C018.
DR   EnsemblGenomes-Gn; KN400_C019.
DR   EnsemblGenomes-Gn; KN400_C020.
DR   EnsemblGenomes-Gn; KN400_C021.
DR   EnsemblGenomes-Gn; KN400_C022.
DR   EnsemblGenomes-Gn; KN400_C023.
DR   EnsemblGenomes-Gn; KN400_C024.
DR   EnsemblGenomes-Gn; KN400_C025.
DR   EnsemblGenomes-Gn; KN400_C026.
DR   EnsemblGenomes-Gn; KN400_C027.
DR   EnsemblGenomes-Gn; KN400_C028.
DR   EnsemblGenomes-Gn; KN400_C029.
DR   EnsemblGenomes-Gn; KN400_C030.
DR   EnsemblGenomes-Gn; KN400_C031.
DR   EnsemblGenomes-Gn; KN400_C032.
DR   EnsemblGenomes-Gn; KN400_C033.
DR   EnsemblGenomes-Gn; KN400_C034.
DR   EnsemblGenomes-Gn; KN400_C035.
DR   EnsemblGenomes-Gn; KN400_C036.
DR   EnsemblGenomes-Gn; KN400_C037.
DR   EnsemblGenomes-Gn; KN400_C038.
DR   EnsemblGenomes-Gn; KN400_C039.
DR   EnsemblGenomes-Gn; KN400_C040.
DR   EnsemblGenomes-Gn; KN400_C041.
DR   EnsemblGenomes-Gn; KN400_C042.
DR   EnsemblGenomes-Gn; KN400_C043.
DR   EnsemblGenomes-Gn; KN400_C044.
DR   EnsemblGenomes-Gn; KN400_C045.
DR   EnsemblGenomes-Gn; KN400_C046.
DR   EnsemblGenomes-Gn; KN400_C047.
DR   EnsemblGenomes-Gn; KN400_C048.
DR   EnsemblGenomes-Gn; KN400_C049.
DR   EnsemblGenomes-Gn; KN400_C050.
DR   EnsemblGenomes-Gn; KN400_C051.
DR   EnsemblGenomes-Gn; KN400_C052.
DR   EnsemblGenomes-Gn; KN400_C053.
DR   EnsemblGenomes-Gn; KN400_C054.
DR   EnsemblGenomes-Gn; KN400_C055.
DR   EnsemblGenomes-Gn; KN400_C056.
DR   EnsemblGenomes-Gn; KN400_C057.
DR   EnsemblGenomes-Gn; KN400_C058.
DR   EnsemblGenomes-Gn; KN400_C059.
DR   EnsemblGenomes-Gn; KN400_C060.
DR   EnsemblGenomes-Gn; KN400_C061.
DR   EnsemblGenomes-Gn; KN400_C062.
DR   EnsemblGenomes-Gn; KN400_C063.
DR   EnsemblGenomes-Gn; KN400_C064.
DR   EnsemblGenomes-Gn; KN400_C065.
DR   EnsemblGenomes-Gn; KN400_C066.
DR   EnsemblGenomes-Gn; KN400_C067.
DR   EnsemblGenomes-Gn; KN400_C068.
DR   EnsemblGenomes-Gn; KN400_C069.
DR   EnsemblGenomes-Gn; KN400_C070.
DR   EnsemblGenomes-Gn; KN400_C071.
DR   EnsemblGenomes-Gn; KN400_C072.
DR   EnsemblGenomes-Gn; KN400_C073.
DR   EnsemblGenomes-Gn; KN400_C074.
DR   EnsemblGenomes-Gn; KN400_C075.
DR   EnsemblGenomes-Gn; KN400_C076.
DR   EnsemblGenomes-Gn; KN400_C077.
DR   EnsemblGenomes-Gn; KN400_C078.
DR   EnsemblGenomes-Gn; KN400_C079.
DR   EnsemblGenomes-Gn; KN400_C080.
DR   EnsemblGenomes-Gn; KN400_C081.
DR   EnsemblGenomes-Gn; KN400_C082.
DR   EnsemblGenomes-Gn; KN400_C083.
DR   EnsemblGenomes-Gn; KN400_C084.
DR   EnsemblGenomes-Gn; KN400_C085.
DR   EnsemblGenomes-Gn; KN400_C086.
DR   EnsemblGenomes-Gn; KN400_C087.
DR   EnsemblGenomes-Gn; KN400_C088.
DR   EnsemblGenomes-Gn; KN400_C089.
DR   EnsemblGenomes-Gn; KN400_C090.
DR   EnsemblGenomes-Gn; KN400_C091.
DR   EnsemblGenomes-Gn; KN400_C092.
DR   EnsemblGenomes-Gn; KN400_C093.
DR   EnsemblGenomes-Gn; KN400_C094.
DR   EnsemblGenomes-Gn; KN400_C095.
DR   EnsemblGenomes-Gn; KN400_C096.
DR   EnsemblGenomes-Gn; KN400_C097.
DR   EnsemblGenomes-Gn; KN400_C098.
DR   EnsemblGenomes-Gn; KN400_C099.
DR   EnsemblGenomes-Gn; KN400_C100.
DR   EnsemblGenomes-Gn; KN400_C101.
DR   EnsemblGenomes-Gn; KN400_C102.
DR   EnsemblGenomes-Gn; KN400_C103.
DR   EnsemblGenomes-Gn; KN400_C104.
DR   EnsemblGenomes-Gn; KN400_C105.
DR   EnsemblGenomes-Gn; KN400_C106.
DR   EnsemblGenomes-Gn; KN400_C107.
DR   EnsemblGenomes-Gn; KN400_C108.
DR   EnsemblGenomes-Gn; KN400_C109.
DR   EnsemblGenomes-Gn; KN400_C110.
DR   EnsemblGenomes-Gn; KN400_C111.
DR   EnsemblGenomes-Gn; KN400_C112.
DR   EnsemblGenomes-Gn; KN400_C113.
DR   EnsemblGenomes-Gn; KN400_C114.
DR   EnsemblGenomes-Gn; KN400_C115.
DR   EnsemblGenomes-Gn; KN400_C116.
DR   EnsemblGenomes-Gn; KN400_C117.
DR   EnsemblGenomes-Gn; KN400_C118.
DR   EnsemblGenomes-Gn; KN400_C119.
DR   EnsemblGenomes-Gn; KN400_C120.
DR   EnsemblGenomes-Gn; KN400_C121.
DR   EnsemblGenomes-Gn; KN400_C122.
DR   EnsemblGenomes-Gn; KN400_C123.
DR   EnsemblGenomes-Gn; KN400_C124.
DR   EnsemblGenomes-Gn; KN400_C125.
DR   EnsemblGenomes-Gn; KN400_C126.
DR   EnsemblGenomes-Gn; KN400_C127.
DR   EnsemblGenomes-Gn; KN400_C128.
DR   EnsemblGenomes-Gn; KN400_C129.
DR   EnsemblGenomes-Gn; KN400_C130.
DR   EnsemblGenomes-Gn; KN400_C131.
DR   EnsemblGenomes-Gn; KN400_C132.
DR   EnsemblGenomes-Gn; KN400_C133.
DR   EnsemblGenomes-Gn; KN400_C134.
DR   EnsemblGenomes-Gn; KN400_C135.
DR   EnsemblGenomes-Gn; KN400_C136.
DR   EnsemblGenomes-Gn; KN400_C137.
DR   EnsemblGenomes-Gn; KN400_C138.
DR   EnsemblGenomes-Gn; KN400_C139.
DR   EnsemblGenomes-Gn; KN400_C140.
DR   EnsemblGenomes-Gn; KN400_C141.
DR   EnsemblGenomes-Gn; KN400_C142.
DR   EnsemblGenomes-Gn; KN400_C143.
DR   EnsemblGenomes-Gn; KN400_C144.
DR   EnsemblGenomes-Gn; KN400_C145.
DR   EnsemblGenomes-Gn; KN400_C146.
DR   EnsemblGenomes-Gn; KN400_C147.
DR   EnsemblGenomes-Gn; KN400_C148.
DR   EnsemblGenomes-Gn; KN400_C149.
DR   EnsemblGenomes-Gn; KN400_C150.
DR   EnsemblGenomes-Gn; KN400_C151.
DR   EnsemblGenomes-Gn; KN400_C152.
DR   EnsemblGenomes-Gn; KN400_C153.
DR   EnsemblGenomes-Gn; KN400_C154.
DR   EnsemblGenomes-Gn; KN400_C155.
DR   EnsemblGenomes-Gn; KN400_C156.
DR   EnsemblGenomes-Gn; KN400_C157.
DR   EnsemblGenomes-Gn; KN400_C158.
DR   EnsemblGenomes-Gn; KN400_C159.
DR   EnsemblGenomes-Gn; KN400_C160.
DR   EnsemblGenomes-Gn; KN400_C161.
DR   EnsemblGenomes-Gn; KN400_C162.
DR   EnsemblGenomes-Gn; KN400_C163.
DR   EnsemblGenomes-Gn; KN400_C164.
DR   EnsemblGenomes-Gn; KN400_C165.
DR   EnsemblGenomes-Gn; KN400_C166.
DR   EnsemblGenomes-Gn; KN400_C167.
DR   EnsemblGenomes-Gn; KN400_C168.
DR   EnsemblGenomes-Gn; KN400_C169.
DR   EnsemblGenomes-Gn; KN400_C170.
DR   EnsemblGenomes-Gn; KN400_C171.
DR   EnsemblGenomes-Gn; KN400_C172.
DR   EnsemblGenomes-Gn; KN400_C173.
DR   EnsemblGenomes-Gn; KN400_C174.
DR   EnsemblGenomes-Gn; KN400_C175.
DR   EnsemblGenomes-Gn; KN400_C176.
DR   EnsemblGenomes-Gn; KN400_C177.
DR   EnsemblGenomes-Gn; KN400_C178.
DR   EnsemblGenomes-Gn; KN400_C179.
DR   EnsemblGenomes-Gn; KN400_C180.
DR   EnsemblGenomes-Gn; KN400_C181.
DR   EnsemblGenomes-Gn; KN400_C182.
DR   EnsemblGenomes-Gn; KN400_C183.
DR   EnsemblGenomes-Gn; KN400_C184.
DR   EnsemblGenomes-Gn; KN400_C185.
DR   EnsemblGenomes-Gn; KN400_C186.
DR   EnsemblGenomes-Gn; KN400_C187.
DR   EnsemblGenomes-Gn; KN400_C188.
DR   EnsemblGenomes-Gn; KN400_C189.
DR   EnsemblGenomes-Gn; KN400_C190.
DR   EnsemblGenomes-Gn; KN400_C191.
DR   EnsemblGenomes-Gn; KN400_C192.
DR   EnsemblGenomes-Gn; KN400_C193.
DR   EnsemblGenomes-Gn; KN400_C194.
DR   EnsemblGenomes-Gn; KN400_C195.
DR   EnsemblGenomes-Gn; KN400_C196.
DR   EnsemblGenomes-Gn; KN400_C197.
DR   EnsemblGenomes-Gn; KN400_C198.
DR   EnsemblGenomes-Gn; KN400_C199.
DR   EnsemblGenomes-Gn; KN400_C200.
DR   EnsemblGenomes-Gn; KN400_C201.
DR   EnsemblGenomes-Gn; KN400_C202.
DR   EnsemblGenomes-Gn; KN400_C203.
DR   EnsemblGenomes-Gn; KN400_C204.
DR   EnsemblGenomes-Gn; KN400_C205.
DR   EnsemblGenomes-Gn; KN400_C206.
DR   EnsemblGenomes-Gn; KN400_C207.
DR   EnsemblGenomes-Gn; KN400_C208.
DR   EnsemblGenomes-Gn; KN400_C209.
DR   EnsemblGenomes-Gn; KN400_C210.
DR   EnsemblGenomes-Gn; KN400_C211.
DR   EnsemblGenomes-Gn; KN400_C212.
DR   EnsemblGenomes-Gn; KN400_C213.
DR   EnsemblGenomes-Gn; KN400_C214.
DR   EnsemblGenomes-Gn; KN400_C215.
DR   EnsemblGenomes-Gn; KN400_C216.
DR   EnsemblGenomes-Gn; KN400_C217.
DR   EnsemblGenomes-Gn; KN400_C218.
DR   EnsemblGenomes-Gn; KN400_C219.
DR   EnsemblGenomes-Gn; KN400_C220.
DR   EnsemblGenomes-Gn; KN400_C221.
DR   EnsemblGenomes-Gn; KN400_C222.
DR   EnsemblGenomes-Gn; KN400_C223.
DR   EnsemblGenomes-Gn; KN400_C224.
DR   EnsemblGenomes-Gn; KN400_C225.
DR   EnsemblGenomes-Gn; KN400_C226.
DR   EnsemblGenomes-Gn; KN400_C227.
DR   EnsemblGenomes-Gn; KN400_C228.
DR   EnsemblGenomes-Gn; KN400_C229.
DR   EnsemblGenomes-Gn; KN400_C230.
DR   EnsemblGenomes-Gn; KN400_C231.
DR   EnsemblGenomes-Gn; KN400_C232.
DR   EnsemblGenomes-Gn; KN400_C233.
DR   EnsemblGenomes-Gn; KN400_C234.
DR   EnsemblGenomes-Gn; KN400_C235.
DR   EnsemblGenomes-Gn; KN400_C236.
DR   EnsemblGenomes-Gn; KN400_C237.
DR   EnsemblGenomes-Gn; KN400_C238.
DR   EnsemblGenomes-Gn; KN400_C239.
DR   EnsemblGenomes-Gn; KN400_R0001.
DR   EnsemblGenomes-Gn; KN400_R0002.
DR   EnsemblGenomes-Gn; KN400_R0003.
DR   EnsemblGenomes-Gn; KN400_R0004.
DR   EnsemblGenomes-Gn; KN400_R0005.
DR   EnsemblGenomes-Gn; KN400_R0006.
DR   EnsemblGenomes-Gn; KN400_R0007.
DR   EnsemblGenomes-Gn; KN400_R0008.
DR   EnsemblGenomes-Gn; KN400_R0009.
DR   EnsemblGenomes-Gn; KN400_R0010.
DR   EnsemblGenomes-Gn; KN400_R0011.
DR   EnsemblGenomes-Gn; KN400_R0012.
DR   EnsemblGenomes-Gn; KN400_R0013.
DR   EnsemblGenomes-Gn; KN400_R0014.
DR   EnsemblGenomes-Gn; KN400_R0015.
DR   EnsemblGenomes-Gn; KN400_R0016.
DR   EnsemblGenomes-Gn; KN400_R0017.
DR   EnsemblGenomes-Gn; KN400_R0018.
DR   EnsemblGenomes-Gn; KN400_R0019.
DR   EnsemblGenomes-Gn; KN400_R0020.
DR   EnsemblGenomes-Gn; KN400_R0021.
DR   EnsemblGenomes-Gn; KN400_R0022.
DR   EnsemblGenomes-Gn; KN400_R0023.
DR   EnsemblGenomes-Gn; KN400_R0024.
DR   EnsemblGenomes-Gn; KN400_R0025.
DR   EnsemblGenomes-Gn; KN400_R0026.
DR   EnsemblGenomes-Gn; KN400_R0027.
DR   EnsemblGenomes-Gn; KN400_R0028.
DR   EnsemblGenomes-Gn; KN400_R0029.
DR   EnsemblGenomes-Gn; KN400_R0030.
DR   EnsemblGenomes-Gn; KN400_R0031.
DR   EnsemblGenomes-Gn; KN400_R0032.
DR   EnsemblGenomes-Gn; KN400_R0033.
DR   EnsemblGenomes-Gn; KN400_R0034.
DR   EnsemblGenomes-Gn; KN400_R0035.
DR   EnsemblGenomes-Gn; KN400_R0036.
DR   EnsemblGenomes-Gn; KN400_R0037.
DR   EnsemblGenomes-Gn; KN400_R0038.
DR   EnsemblGenomes-Gn; KN400_R0039.
DR   EnsemblGenomes-Gn; KN400_R0040.
DR   EnsemblGenomes-Gn; KN400_R0041.
DR   EnsemblGenomes-Gn; KN400_R0042.
DR   EnsemblGenomes-Gn; KN400_R0043.
DR   EnsemblGenomes-Gn; KN400_R0044.
DR   EnsemblGenomes-Gn; KN400_R0045.
DR   EnsemblGenomes-Gn; KN400_R0046.
DR   EnsemblGenomes-Gn; KN400_R0047.
DR   EnsemblGenomes-Gn; KN400_R0048.
DR   EnsemblGenomes-Gn; KN400_R0049.
DR   EnsemblGenomes-Gn; KN400_R0050.
DR   EnsemblGenomes-Gn; KN400_R0051.
DR   EnsemblGenomes-Gn; KN400_R0052.
DR   EnsemblGenomes-Gn; KN400_R0053.
DR   EnsemblGenomes-Gn; KN400_R0054.
DR   EnsemblGenomes-Gn; KN400_R0055.
DR   EnsemblGenomes-Gn; KN400_R0059.
DR   EnsemblGenomes-Gn; KN400_R0077.
DR   EnsemblGenomes-Gn; KN400_R0101.
DR   EnsemblGenomes-Tr; EBT00001784769.
DR   EnsemblGenomes-Tr; EBT00001784770.
DR   EnsemblGenomes-Tr; EBT00001784771.
DR   EnsemblGenomes-Tr; EBT00001784772.
DR   EnsemblGenomes-Tr; EBT00001784773.
DR   EnsemblGenomes-Tr; EBT00001784774.
DR   EnsemblGenomes-Tr; EBT00001784775.
DR   EnsemblGenomes-Tr; EBT00001784776.
DR   EnsemblGenomes-Tr; EBT00001784777.
DR   EnsemblGenomes-Tr; EBT00001784778.
DR   EnsemblGenomes-Tr; EBT00001784779.
DR   EnsemblGenomes-Tr; EBT00001784780.
DR   EnsemblGenomes-Tr; EBT00001784781.
DR   EnsemblGenomes-Tr; EBT00001784782.
DR   EnsemblGenomes-Tr; EBT00001784783.
DR   EnsemblGenomes-Tr; EBT00001784784.
DR   EnsemblGenomes-Tr; EBT00001784785.
DR   EnsemblGenomes-Tr; EBT00001784786.
DR   EnsemblGenomes-Tr; EBT00001784787.
DR   EnsemblGenomes-Tr; EBT00001784788.
DR   EnsemblGenomes-Tr; EBT00001784789.
DR   EnsemblGenomes-Tr; EBT00001784790.
DR   EnsemblGenomes-Tr; EBT00001784791.
DR   EnsemblGenomes-Tr; EBT00001784792.
DR   EnsemblGenomes-Tr; EBT00001784793.
DR   EnsemblGenomes-Tr; EBT00001784794.
DR   EnsemblGenomes-Tr; EBT00001784795.
DR   EnsemblGenomes-Tr; EBT00001784796.
DR   EnsemblGenomes-Tr; EBT00001784797.
DR   EnsemblGenomes-Tr; EBT00001784798.
DR   EnsemblGenomes-Tr; EBT00001784799.
DR   EnsemblGenomes-Tr; EBT00001784800.
DR   EnsemblGenomes-Tr; EBT00001784801.
DR   EnsemblGenomes-Tr; EBT00001784802.
DR   EnsemblGenomes-Tr; EBT00001784803.
DR   EnsemblGenomes-Tr; EBT00001784804.
DR   EnsemblGenomes-Tr; EBT00001784805.
DR   EnsemblGenomes-Tr; EBT00001784806.
DR   EnsemblGenomes-Tr; EBT00001784807.
DR   EnsemblGenomes-Tr; EBT00001784808.
DR   EnsemblGenomes-Tr; EBT00001784809.
DR   EnsemblGenomes-Tr; EBT00001784810.
DR   EnsemblGenomes-Tr; EBT00001784811.
DR   EnsemblGenomes-Tr; EBT00001784812.
DR   EnsemblGenomes-Tr; EBT00001784813.
DR   EnsemblGenomes-Tr; EBT00001784814.
DR   EnsemblGenomes-Tr; EBT00001784815.
DR   EnsemblGenomes-Tr; EBT00001784816.
DR   EnsemblGenomes-Tr; EBT00001784817.
DR   EnsemblGenomes-Tr; EBT00001784818.
DR   EnsemblGenomes-Tr; EBT00001784819.
DR   EnsemblGenomes-Tr; EBT00001784820.
DR   EnsemblGenomes-Tr; EBT00001784821.
DR   EnsemblGenomes-Tr; EBT00001784822.
DR   EnsemblGenomes-Tr; EBT00001784823.
DR   EnsemblGenomes-Tr; EBT00001784824.
DR   EnsemblGenomes-Tr; EBT00001784825.
DR   EnsemblGenomes-Tr; EBT00001784826.
DR   EnsemblGenomes-Tr; EBT00001784827.
DR   EnsemblGenomes-Tr; EBT00001784828.
DR   EnsemblGenomes-Tr; EBT00001784829.
DR   EnsemblGenomes-Tr; EBT00001784830.
DR   EnsemblGenomes-Tr; EBT00001784831.
DR   EnsemblGenomes-Tr; EBT00001784832.
DR   EnsemblGenomes-Tr; KN400_C001-1.
DR   EnsemblGenomes-Tr; KN400_C002-1.
DR   EnsemblGenomes-Tr; KN400_C003-1.
DR   EnsemblGenomes-Tr; KN400_C004-1.
DR   EnsemblGenomes-Tr; KN400_C005-1.
DR   EnsemblGenomes-Tr; KN400_C006-1.
DR   EnsemblGenomes-Tr; KN400_C007-1.
DR   EnsemblGenomes-Tr; KN400_C008-1.
DR   EnsemblGenomes-Tr; KN400_C009-1.
DR   EnsemblGenomes-Tr; KN400_C010-1.
DR   EnsemblGenomes-Tr; KN400_C011-1.
DR   EnsemblGenomes-Tr; KN400_C012-1.
DR   EnsemblGenomes-Tr; KN400_C013-1.
DR   EnsemblGenomes-Tr; KN400_C014-1.
DR   EnsemblGenomes-Tr; KN400_C015-1.
DR   EnsemblGenomes-Tr; KN400_C016-1.
DR   EnsemblGenomes-Tr; KN400_C017-1.
DR   EnsemblGenomes-Tr; KN400_C018-1.
DR   EnsemblGenomes-Tr; KN400_C019-1.
DR   EnsemblGenomes-Tr; KN400_C020-1.
DR   EnsemblGenomes-Tr; KN400_C021-1.
DR   EnsemblGenomes-Tr; KN400_C022-1.
DR   EnsemblGenomes-Tr; KN400_C023-1.
DR   EnsemblGenomes-Tr; KN400_C024-1.
DR   EnsemblGenomes-Tr; KN400_C025-1.
DR   EnsemblGenomes-Tr; KN400_C026-1.
DR   EnsemblGenomes-Tr; KN400_C027-1.
DR   EnsemblGenomes-Tr; KN400_C028-1.
DR   EnsemblGenomes-Tr; KN400_C029-1.
DR   EnsemblGenomes-Tr; KN400_C030-1.
DR   EnsemblGenomes-Tr; KN400_C031-1.
DR   EnsemblGenomes-Tr; KN400_C032-1.
DR   EnsemblGenomes-Tr; KN400_C033-1.
DR   EnsemblGenomes-Tr; KN400_C034-1.
DR   EnsemblGenomes-Tr; KN400_C035-1.
DR   EnsemblGenomes-Tr; KN400_C036-1.
DR   EnsemblGenomes-Tr; KN400_C037-1.
DR   EnsemblGenomes-Tr; KN400_C038-1.
DR   EnsemblGenomes-Tr; KN400_C039-1.
DR   EnsemblGenomes-Tr; KN400_C040-1.
DR   EnsemblGenomes-Tr; KN400_C041-1.
DR   EnsemblGenomes-Tr; KN400_C042-1.
DR   EnsemblGenomes-Tr; KN400_C043-1.
DR   EnsemblGenomes-Tr; KN400_C044-1.
DR   EnsemblGenomes-Tr; KN400_C045-1.
DR   EnsemblGenomes-Tr; KN400_C046-1.
DR   EnsemblGenomes-Tr; KN400_C047-1.
DR   EnsemblGenomes-Tr; KN400_C048-1.
DR   EnsemblGenomes-Tr; KN400_C049-1.
DR   EnsemblGenomes-Tr; KN400_C050-1.
DR   EnsemblGenomes-Tr; KN400_C051-1.
DR   EnsemblGenomes-Tr; KN400_C052-1.
DR   EnsemblGenomes-Tr; KN400_C053-1.
DR   EnsemblGenomes-Tr; KN400_C054-1.
DR   EnsemblGenomes-Tr; KN400_C055-1.
DR   EnsemblGenomes-Tr; KN400_C056-1.
DR   EnsemblGenomes-Tr; KN400_C057-1.
DR   EnsemblGenomes-Tr; KN400_C058-1.
DR   EnsemblGenomes-Tr; KN400_C059-1.
DR   EnsemblGenomes-Tr; KN400_C060-1.
DR   EnsemblGenomes-Tr; KN400_C061-1.
DR   EnsemblGenomes-Tr; KN400_C062-1.
DR   EnsemblGenomes-Tr; KN400_C063-1.
DR   EnsemblGenomes-Tr; KN400_C064-1.
DR   EnsemblGenomes-Tr; KN400_C065-1.
DR   EnsemblGenomes-Tr; KN400_C066-1.
DR   EnsemblGenomes-Tr; KN400_C067-1.
DR   EnsemblGenomes-Tr; KN400_C068-1.
DR   EnsemblGenomes-Tr; KN400_C069-1.
DR   EnsemblGenomes-Tr; KN400_C070-1.
DR   EnsemblGenomes-Tr; KN400_C071-1.
DR   EnsemblGenomes-Tr; KN400_C072-1.
DR   EnsemblGenomes-Tr; KN400_C073-1.
DR   EnsemblGenomes-Tr; KN400_C074-1.
DR   EnsemblGenomes-Tr; KN400_C075-1.
DR   EnsemblGenomes-Tr; KN400_C076-1.
DR   EnsemblGenomes-Tr; KN400_C077-1.
DR   EnsemblGenomes-Tr; KN400_C078-1.
DR   EnsemblGenomes-Tr; KN400_C079-1.
DR   EnsemblGenomes-Tr; KN400_C080-1.
DR   EnsemblGenomes-Tr; KN400_C081-1.
DR   EnsemblGenomes-Tr; KN400_C082-1.
DR   EnsemblGenomes-Tr; KN400_C083-1.
DR   EnsemblGenomes-Tr; KN400_C084-1.
DR   EnsemblGenomes-Tr; KN400_C085-1.
DR   EnsemblGenomes-Tr; KN400_C086-1.
DR   EnsemblGenomes-Tr; KN400_C087-1.
DR   EnsemblGenomes-Tr; KN400_C088-1.
DR   EnsemblGenomes-Tr; KN400_C089-1.
DR   EnsemblGenomes-Tr; KN400_C090-1.
DR   EnsemblGenomes-Tr; KN400_C091-1.
DR   EnsemblGenomes-Tr; KN400_C092-1.
DR   EnsemblGenomes-Tr; KN400_C093-1.
DR   EnsemblGenomes-Tr; KN400_C094-1.
DR   EnsemblGenomes-Tr; KN400_C095-1.
DR   EnsemblGenomes-Tr; KN400_C096-1.
DR   EnsemblGenomes-Tr; KN400_C097-1.
DR   EnsemblGenomes-Tr; KN400_C098-1.
DR   EnsemblGenomes-Tr; KN400_C099-1.
DR   EnsemblGenomes-Tr; KN400_C100-1.
DR   EnsemblGenomes-Tr; KN400_C101-1.
DR   EnsemblGenomes-Tr; KN400_C102-1.
DR   EnsemblGenomes-Tr; KN400_C103-1.
DR   EnsemblGenomes-Tr; KN400_C104-1.
DR   EnsemblGenomes-Tr; KN400_C105-1.
DR   EnsemblGenomes-Tr; KN400_C106-1.
DR   EnsemblGenomes-Tr; KN400_C107-1.
DR   EnsemblGenomes-Tr; KN400_C108-1.
DR   EnsemblGenomes-Tr; KN400_C109-1.
DR   EnsemblGenomes-Tr; KN400_C110-1.
DR   EnsemblGenomes-Tr; KN400_C111-1.
DR   EnsemblGenomes-Tr; KN400_C112-1.
DR   EnsemblGenomes-Tr; KN400_C113-1.
DR   EnsemblGenomes-Tr; KN400_C114-1.
DR   EnsemblGenomes-Tr; KN400_C115-1.
DR   EnsemblGenomes-Tr; KN400_C116-1.
DR   EnsemblGenomes-Tr; KN400_C117-1.
DR   EnsemblGenomes-Tr; KN400_C118-1.
DR   EnsemblGenomes-Tr; KN400_C119-1.
DR   EnsemblGenomes-Tr; KN400_C120-1.
DR   EnsemblGenomes-Tr; KN400_C121-1.
DR   EnsemblGenomes-Tr; KN400_C122-1.
DR   EnsemblGenomes-Tr; KN400_C123-1.
DR   EnsemblGenomes-Tr; KN400_C124-1.
DR   EnsemblGenomes-Tr; KN400_C125-1.
DR   EnsemblGenomes-Tr; KN400_C126-1.
DR   EnsemblGenomes-Tr; KN400_C127-1.
DR   EnsemblGenomes-Tr; KN400_C128-1.
DR   EnsemblGenomes-Tr; KN400_C129-1.
DR   EnsemblGenomes-Tr; KN400_C130-1.
DR   EnsemblGenomes-Tr; KN400_C131-1.
DR   EnsemblGenomes-Tr; KN400_C132-1.
DR   EnsemblGenomes-Tr; KN400_C133-1.
DR   EnsemblGenomes-Tr; KN400_C134-1.
DR   EnsemblGenomes-Tr; KN400_C135-1.
DR   EnsemblGenomes-Tr; KN400_C136-1.
DR   EnsemblGenomes-Tr; KN400_C137-1.
DR   EnsemblGenomes-Tr; KN400_C138-1.
DR   EnsemblGenomes-Tr; KN400_C139-1.
DR   EnsemblGenomes-Tr; KN400_C140-1.
DR   EnsemblGenomes-Tr; KN400_C141-1.
DR   EnsemblGenomes-Tr; KN400_C142-1.
DR   EnsemblGenomes-Tr; KN400_C143-1.
DR   EnsemblGenomes-Tr; KN400_C144-1.
DR   EnsemblGenomes-Tr; KN400_C145-1.
DR   EnsemblGenomes-Tr; KN400_C146-1.
DR   EnsemblGenomes-Tr; KN400_C147-1.
DR   EnsemblGenomes-Tr; KN400_C148-1.
DR   EnsemblGenomes-Tr; KN400_C149-1.
DR   EnsemblGenomes-Tr; KN400_C150-1.
DR   EnsemblGenomes-Tr; KN400_C151-1.
DR   EnsemblGenomes-Tr; KN400_C152-1.
DR   EnsemblGenomes-Tr; KN400_C153-1.
DR   EnsemblGenomes-Tr; KN400_C154-1.
DR   EnsemblGenomes-Tr; KN400_C155-1.
DR   EnsemblGenomes-Tr; KN400_C156-1.
DR   EnsemblGenomes-Tr; KN400_C157-1.
DR   EnsemblGenomes-Tr; KN400_C158-1.
DR   EnsemblGenomes-Tr; KN400_C159-1.
DR   EnsemblGenomes-Tr; KN400_C160-1.
DR   EnsemblGenomes-Tr; KN400_C161-1.
DR   EnsemblGenomes-Tr; KN400_C162-1.
DR   EnsemblGenomes-Tr; KN400_C163-1.
DR   EnsemblGenomes-Tr; KN400_C164-1.
DR   EnsemblGenomes-Tr; KN400_C165-1.
DR   EnsemblGenomes-Tr; KN400_C166-1.
DR   EnsemblGenomes-Tr; KN400_C167-1.
DR   EnsemblGenomes-Tr; KN400_C168-1.
DR   EnsemblGenomes-Tr; KN400_C169-1.
DR   EnsemblGenomes-Tr; KN400_C170-1.
DR   EnsemblGenomes-Tr; KN400_C171-1.
DR   EnsemblGenomes-Tr; KN400_C172-1.
DR   EnsemblGenomes-Tr; KN400_C173-1.
DR   EnsemblGenomes-Tr; KN400_C174-1.
DR   EnsemblGenomes-Tr; KN400_C175-1.
DR   EnsemblGenomes-Tr; KN400_C176-1.
DR   EnsemblGenomes-Tr; KN400_C177-1.
DR   EnsemblGenomes-Tr; KN400_C178-1.
DR   EnsemblGenomes-Tr; KN400_C179-1.
DR   EnsemblGenomes-Tr; KN400_C180-1.
DR   EnsemblGenomes-Tr; KN400_C181-1.
DR   EnsemblGenomes-Tr; KN400_C182-1.
DR   EnsemblGenomes-Tr; KN400_C183-1.
DR   EnsemblGenomes-Tr; KN400_C184-1.
DR   EnsemblGenomes-Tr; KN400_C185-1.
DR   EnsemblGenomes-Tr; KN400_C186-1.
DR   EnsemblGenomes-Tr; KN400_C187-1.
DR   EnsemblGenomes-Tr; KN400_C188-1.
DR   EnsemblGenomes-Tr; KN400_C189-1.
DR   EnsemblGenomes-Tr; KN400_C190-1.
DR   EnsemblGenomes-Tr; KN400_C191-1.
DR   EnsemblGenomes-Tr; KN400_C192-1.
DR   EnsemblGenomes-Tr; KN400_C193-1.
DR   EnsemblGenomes-Tr; KN400_C194-1.
DR   EnsemblGenomes-Tr; KN400_C195-1.
DR   EnsemblGenomes-Tr; KN400_C196-1.
DR   EnsemblGenomes-Tr; KN400_C197-1.
DR   EnsemblGenomes-Tr; KN400_C198-1.
DR   EnsemblGenomes-Tr; KN400_C199-1.
DR   EnsemblGenomes-Tr; KN400_C200-1.
DR   EnsemblGenomes-Tr; KN400_C201-1.
DR   EnsemblGenomes-Tr; KN400_C202-1.
DR   EnsemblGenomes-Tr; KN400_C203-1.
DR   EnsemblGenomes-Tr; KN400_C204-1.
DR   EnsemblGenomes-Tr; KN400_C205-1.
DR   EnsemblGenomes-Tr; KN400_C206-1.
DR   EnsemblGenomes-Tr; KN400_C207-1.
DR   EnsemblGenomes-Tr; KN400_C208-1.
DR   EnsemblGenomes-Tr; KN400_C209-1.
DR   EnsemblGenomes-Tr; KN400_C210-1.
DR   EnsemblGenomes-Tr; KN400_C211-1.
DR   EnsemblGenomes-Tr; KN400_C212-1.
DR   EnsemblGenomes-Tr; KN400_C213-1.
DR   EnsemblGenomes-Tr; KN400_C214-1.
DR   EnsemblGenomes-Tr; KN400_C215-1.
DR   EnsemblGenomes-Tr; KN400_C216-1.
DR   EnsemblGenomes-Tr; KN400_C217-1.
DR   EnsemblGenomes-Tr; KN400_C218-1.
DR   EnsemblGenomes-Tr; KN400_C219-1.
DR   EnsemblGenomes-Tr; KN400_C220-1.
DR   EnsemblGenomes-Tr; KN400_C221-1.
DR   EnsemblGenomes-Tr; KN400_C222-1.
DR   EnsemblGenomes-Tr; KN400_C223-1.
DR   EnsemblGenomes-Tr; KN400_C224-1.
DR   EnsemblGenomes-Tr; KN400_C225-1.
DR   EnsemblGenomes-Tr; KN400_C226-1.
DR   EnsemblGenomes-Tr; KN400_C227-1.
DR   EnsemblGenomes-Tr; KN400_C228-1.
DR   EnsemblGenomes-Tr; KN400_C229-1.
DR   EnsemblGenomes-Tr; KN400_C230-1.
DR   EnsemblGenomes-Tr; KN400_C231-1.
DR   EnsemblGenomes-Tr; KN400_C232-1.
DR   EnsemblGenomes-Tr; KN400_C233-1.
DR   EnsemblGenomes-Tr; KN400_C234-1.
DR   EnsemblGenomes-Tr; KN400_C235-1.
DR   EnsemblGenomes-Tr; KN400_C236-1.
DR   EnsemblGenomes-Tr; KN400_C237-1.
DR   EnsemblGenomes-Tr; KN400_C238-1.
DR   EnsemblGenomes-Tr; KN400_C239-1.
DR   EnsemblGenomes-Tr; KN400_R0001-1.
DR   EnsemblGenomes-Tr; KN400_R0002-1.
DR   EnsemblGenomes-Tr; KN400_R0003-1.
DR   EnsemblGenomes-Tr; KN400_R0004-1.
DR   EnsemblGenomes-Tr; KN400_R0005-1.
DR   EnsemblGenomes-Tr; KN400_R0006-1.
DR   EnsemblGenomes-Tr; KN400_R0007-1.
DR   EnsemblGenomes-Tr; KN400_R0008-1.
DR   EnsemblGenomes-Tr; KN400_R0009-1.
DR   EnsemblGenomes-Tr; KN400_R0010-1.
DR   EnsemblGenomes-Tr; KN400_R0011-1.
DR   EnsemblGenomes-Tr; KN400_R0012-1.
DR   EnsemblGenomes-Tr; KN400_R0013-1.
DR   EnsemblGenomes-Tr; KN400_R0014-1.
DR   EnsemblGenomes-Tr; KN400_R0015-1.
DR   EnsemblGenomes-Tr; KN400_R0016-1.
DR   EnsemblGenomes-Tr; KN400_R0017-1.
DR   EnsemblGenomes-Tr; KN400_R0018-1.
DR   EnsemblGenomes-Tr; KN400_R0019-1.
DR   EnsemblGenomes-Tr; KN400_R0020-1.
DR   EnsemblGenomes-Tr; KN400_R0021-1.
DR   EnsemblGenomes-Tr; KN400_R0022-1.
DR   EnsemblGenomes-Tr; KN400_R0023-1.
DR   EnsemblGenomes-Tr; KN400_R0024-1.
DR   EnsemblGenomes-Tr; KN400_R0025-1.
DR   EnsemblGenomes-Tr; KN400_R0026-1.
DR   EnsemblGenomes-Tr; KN400_R0027-1.
DR   EnsemblGenomes-Tr; KN400_R0028-1.
DR   EnsemblGenomes-Tr; KN400_R0029-1.
DR   EnsemblGenomes-Tr; KN400_R0030-1.
DR   EnsemblGenomes-Tr; KN400_R0031-1.
DR   EnsemblGenomes-Tr; KN400_R0032-1.
DR   EnsemblGenomes-Tr; KN400_R0033-1.
DR   EnsemblGenomes-Tr; KN400_R0034-1.
DR   EnsemblGenomes-Tr; KN400_R0035-1.
DR   EnsemblGenomes-Tr; KN400_R0036-1.
DR   EnsemblGenomes-Tr; KN400_R0037-1.
DR   EnsemblGenomes-Tr; KN400_R0038-1.
DR   EnsemblGenomes-Tr; KN400_R0039-1.
DR   EnsemblGenomes-Tr; KN400_R0040-1.
DR   EnsemblGenomes-Tr; KN400_R0041-1.
DR   EnsemblGenomes-Tr; KN400_R0042-1.
DR   EnsemblGenomes-Tr; KN400_R0043-1.
DR   EnsemblGenomes-Tr; KN400_R0044-1.
DR   EnsemblGenomes-Tr; KN400_R0045-1.
DR   EnsemblGenomes-Tr; KN400_R0046-1.
DR   EnsemblGenomes-Tr; KN400_R0047-1.
DR   EnsemblGenomes-Tr; KN400_R0048-1.
DR   EnsemblGenomes-Tr; KN400_R0049-1.
DR   EnsemblGenomes-Tr; KN400_R0050-1.
DR   EnsemblGenomes-Tr; KN400_R0051-1.
DR   EnsemblGenomes-Tr; KN400_R0052-1.
DR   EnsemblGenomes-Tr; KN400_R0053-1.
DR   EnsemblGenomes-Tr; KN400_R0054-1.
DR   EnsemblGenomes-Tr; KN400_R0055-1.
DR   EnsemblGenomes-Tr; KN400_R0059-1.
DR   EnsemblGenomes-Tr; KN400_R0077-1.
DR   EnsemblGenomes-Tr; KN400_R0101-1.
DR   EuropePMC; PMC2882325; 20544019.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01733; atoC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; CP002031.
DR   SILVA-SSU; CP002031.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3714272
FT                   /organism="Geobacter sulfurreducens KN400"
FT                   /strain="KN400"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:663917"
FT                   /culture_collection="ATCC:PTA-10251"
FT   gene            30..1367
FT                   /gene="dnaA"
FT                   /locus_tag="KN400_0001"
FT   CDS_pept        30..1367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="KN400_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82864"
FT                   /protein_id="ADI82864.1"
FT                   /translation="MEEVWLQAQSNLAKVLTHQTFNTWIEPIKYLGSKKNVLLLEAPNQ
FT                   FVRDRVSESYLPMILESVQSLTDSQTKIELLIAKPKTEKPKQPAASEVTAAEPEACSGP
FT                   DHSTNLNPKYTFDTFVCGGSNQFAHAAAQSVANSPAGKYNPLFIYGGVGLGKTHLLNAI
FT                   GNHVLSVNRKARICFYTSEKFMNELINCLRYQKMDQFRNKFRKMDILLIDDIQFIAGKE
FT                   RTQEEFFHTFNSLYESHKQIVVTSDKFPKDIPGLEERLRSRFEWGLIADIQAPDTETKV
FT                   AILRKKADADHISLPDDVALFLASSSTTNVRELEGMLIRLGAVSSLTGKNITLDMAREV
FT                   LKDIIVDKSKEITVEMIQKFVAEHFSLKVADLKSDKRLKALVIPRQIAIFLCRDLTKSS
FT                   YPEIGERFGGKDHSTIIHSVKKVEKLLSQDFELRNTVDTLRKGLLS"
FT   gene            1594..2712
FT                   /gene="dnaN"
FT                   /locus_tag="KN400_0002"
FT   CDS_pept        1594..2712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="KN400_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82865"
FT                   /protein_id="ADI82865.1"
FT                   /translation="MEFTIDRDTFSRALQKIQGIVEKRNTMPILSNVLIEALEDRIELT
FT                   ATDLEVGMKSSYPTTVASQGKITVSAKKLYEIVKELPDETISFLTKANDYVEIRCGKAK
FT                   FTIVGLSSEEFPYFPKVNEESFIRIESGLLADMIEKTSYAICFDETKYNLNGTFVKASE
FT                   EDGRSILRMVATDGHRLSITQREFNGAVSPEMAKGVIFPKKGIFELKKMCEEESTQLSL
FT                   GFLDNSAVIVKGNTVVVMRLVDGEFPDYTRVVPVANDRIVTVARDPFFHSLRRMSILSS
FT                   EKFKGIKMDIQESGMVISSSNPELGEASEELDAVFAGDAISIRFNAKYLIDVLAVLDES
FT                   SVALHLKDELSPAIVRPADGDGFTAVIMPMRL"
FT   gene            2793..3890
FT                   /gene="recF"
FT                   /locus_tag="KN400_0003"
FT   CDS_pept        2793..3890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="KN400_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82866"
FT                   /protein_id="ADI82866.2"
FT                   /translation="MHLNAIAISAFRNIDHVEISFDRRFNVLHGANGQGKTSVLEAIYL
FT                   LGTMKSFRMAKAHDLIAWNAPHSLVRGDIDKAGVRREIALYLGREGRKARIDRKPVTKL
FT                   ADFFGAVNAVVFSPEEIGMARGGPELRRRYLDRAIFNGDLGYLLLHHEYHRLLKQRNAL
FT                   LRRGERDGLEVWTIQLAEAGARLMVKRRAYLSQIEPLVRQFYRDIAGAGQEVGLAYRCH
FT                   GLASAEGERDCAAALRELMAAHEAEELRRGATGVGPHRDDVDFILNGRVIRHHGSQGEQ
FT                   RSFVLAVKMAEIEYLERLNGAPPVLLLDDISSELDPERNANLMTFLRGKRMQVFITTTD
FT                   VSTLRLEGIDTHASFRVSRGTVTPV"
FT   gene            3901..6288
FT                   /gene="gyrB"
FT                   /locus_tag="KN400_0004"
FT   CDS_pept        3901..6288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="KN400_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82867"
FT                   /protein_id="ADI82867.1"
FT                   /translation="MTDEQNYDYGADKIKVLEGLEAVRKRPAMYIGSTAAQGLHHLVYE
FT                   IVDNSIDEALAGYCNEVNVTIHLDGSLTVVDNGRGIPTDIHPTEGKPAAEVALTVLHAG
FT                   GKFDNTSYKVSGGLHGVGVSVVNALSRKLELEIRRDGKVYRQSYACGDPQTPLEVMGET
FT                   KKRGTKITFLPDDTIFETTEFSFDVLSQRLRELAFLNAGVRITITDEREEGKHHDFHYE
FT                   GGIVSFVEYLNRNRTALHPKPIYFKGEKAGVEMEVALQYNDSYDEKVFSFANNINTHEG
FT                   GTHLVGFRAALTRTMNTYAAANELLKKEKVAISGEDLREGLTAVISVKIPQPQFEGQTK
FT                   TKLGNSEVKGYVESLMNEKLAVFLEENPKIAKDIIGKSIEAARAREAARKARELTRRKG
FT                   ALDISNLPGKLADCQERDPALCELYLVEGDSAGGSAKQGRDRKFQAILPLKGKILNVEK
FT                   ARFDKMLSSQEIGTLITALGTGIGKDDFDIAKLRYHRIIVMTDADVDGSHILTLLLTFF
FT                   FRQMPEVVERGHLYIAQPPLYKVKRGRKELYLRNEAAMQAYLLEEGTEDMLLFLESGEK
FT                   TYSGKQIIPILKQLVEYRTILDKVVRKGINEELIRVFLRLGVKGGIEDMEQLVPFLTNI
FT                   SRVYDGGDFSPLDDGRVIVRLGNLRIALDQHTLDLIGSYEYGLLVESYRKVRDIFGDGR
FT                   AVVSSEGKELFATTIGLDLLSFFMDSAKKGLSIQRYKGLGEMNPEQLWETTMEPVNRTL
FT                   LQVKIEDAIEADTIFTILMGDQVEPRRDFIEQNALNVSNLDI"
FT   misc_feature    6300..6341
FT                   /note="palindrome; KN400_R0106"
FT   gene            6416..8989
FT                   /gene="gyrA"
FT                   /locus_tag="KN400_0005"
FT   CDS_pept        6416..8989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="KN400_0005"
FT                   /product="DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82868"
FT                   /protein_id="ADI82868.1"
FT                   /translation="MLEQSLNKTAVNIEDEMKRSYMDYAMSVIIGRALPDVRDGLKPVH
FT                   RRCLYAMYDMGNDYNKPYKKSARVVGDVIGKYHPHGDAAAYDTIVRMAQDFSLRYPLVD
FT                   GQGNFGSVDGDSPAAMRYTEIRMEQLAHELLNDLEKETVDLGPNYDGSLTEPLVLPSKF
FT                   PNLLVNGSSGIAVGMATNIPPHNLTEVINGIIATIENPNISFEELLALIPGPDFPTGGF
FT                   IYGREGILQGYRTGRGIVQMRARASIETHKKTERQSIIVTEIPYQVNKANLITKIAELV
FT                   REKKLEGISDIRDESDRDGMRIVIDLKRDENPQVILNHLYKQTQMQTSFGINMLAIVAG
FT                   RPRVLTLRDAIGHFIDHRREIVTRRTIFDLKKAEARAHILEGYKIALDWLDAVIELIRG
FT                   SKTPAEAKEGLMSGLFSDEEWLRKMGLPLPAIHSQYQKPVRLTEVQAQEILNLRLHRLT
FT                   GLERDKILQEYDDILKYIARLKEILASEAEILKIIVGELRELKEKFGDERRTEIVDRSA
FT                   EISLEDTIVEEDVVVTVSHTGYIKRTAVSQYRSQRRGGKGKTGMKTKEEDFVEHLFVAS
FT                   SKDFMLFFTDAGKVYQIKVYEIPEGGRATRGKAIVNLLNLQENEQITAILSVKGFDDDR
FT                   NIIMATRLGVVKKSPLREYANIRSGGIIAVNLDDGDKLIAVALTDGRQDVLLASKNGKS
FT                   IRFHEDDARPMGRVSRGVRGMSLEDDDVVIGMEIINPNATGSTIFTVTENGFGKRTELD
FT                   EYRVQSRGGKGIITIKTTERNGCVVDIMQVTDENDLMLITDQGKILRIPVAQFSVIGRN
FT                   TQGVRLMTAEQNERIVAVAKLAEKDEGDDGADGGDDLPDAEVVEE"
FT   gene            9060..10628
FT                   /locus_tag="KN400_0006"
FT   CDS_pept        9060..10628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82869"
FT                   /protein_id="ADI82869.1"
FT                   /translation="MERHRTIDMSLRERRDILDLLERLKKEDLSPAEMDEIGSSLRKEG
FT                   RRALSPLFRCLRRETDPEMIARYAALLEFFEDDAWLDQLVAITLARRDLDDEGKSALLS
FT                   ILNEYGVDVSSPLFAPITDRAGGLRLTLPRLLDRGERGLVTFMEGLVTYTPEAQQAVVR
FT                   ELPLVDDRRVVELFRVLLGFDEPETLPTVIETLGRVRYPEAADLLRDFLAAAPDAYRAP
FT                   AERSLRRLAFLGFTPAGETPAPLPFAAAFTGTADASGYSCVMVARWTGPGIIDTLFMEL
FT                   HESEGMRDAWGWSGLSSEGFQDLLREHHVEDTLVAVDPAFAVLLVRDAIQRSIGSGFYL
FT                   PPEFYVRRSIFAEVDLTPVAYEPPFGEDEVAKACTPSRIAVGDDLIRDWFFDGWFIFNE
FT                   RVRLLADDLDRLEGDPFGRGDEAAVDRFLENWCRRYVAPRRERLVRRLLLAADLMVRSG
FT                   RECSLVEQSLAAARSIREELVPLHRQPFIRRWLLDLIEMVREARAEGYEFPPTRRDEEY
FT                   EGEWD"
FT   gene            10673..11680
FT                   /gene="gpsA"
FT                   /locus_tag="KN400_0007"
FT   CDS_pept        10673..11680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="KN400_0007"
FT                   /product="glycerol-3-phosphate dehydrogenase,
FT                   NAD(P)-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82870"
FT                   /protein_id="ADI82870.1"
FT                   /translation="MSERIGVIGAGSWGTTLANLLARKGLDVTLWAYEAELVEEMRATR
FT                   VNSLFLPGIELAPALSFTNSLEEAATGKDFLVLVSPSQVMRGVLAQLAPLLRPGVVLVN
FT                   ASKGIELDTLMTMDQVCAAVLPPEVARCFSVLSGPSFAREVSLEMPTAVVAASGDPAVA
FT                   AAVQRLFTTPSFRVYTNTDVVGVEIGGALKNVIAVAAGISDGLGLGHNTRAALITRGLA
FT                   EMTRLGLSMGAQPETFAGLAGMGDLVLTCTGDLSRNRTVGMKLGQGMKLADVLGEMRMV
FT                   AEGVKTAESAYRLARRTGVEMPITEKVYQVLHEDKPARQAVMELMTRDLKAERW"
FT   gene            11778..14066
FT                   /locus_tag="KN400_0008"
FT   CDS_pept        11778..14066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0008"
FT                   /product="sensor histidine kinase, HAMP and PAS
FT                   domain-containing"
FT                   /note="domains: HAMP, PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82871"
FT                   /protein_id="ADI82871.1"
FT                   /translation="MKSLLAIRTKIFLAILLILLVSYSFLVVITIRTVDSSLEAELSRK
FT                   LAEQVRYAKDQYTDRAEQIQYSLMHPASAPPVRERMVARDSLWLRDAARRWMMILPFVE
FT                   LIVFVDSRGTVITGGNQYRMDRTFELTPVVERALRERHPIVSTELVTTEFLCSEGLVNY
FT                   CRGGDAGNTGEVMMQTVVVPVVDTRGAMVGAFVAGDILETDTRLPSQVQEVFGRQVYVT
FT                   ITRKEIIPPDSFGKNGPQAIPARILGGLRQGLPFRGDAEIGGKVFTAAFDPLTNSRGDF
FT                   VGALVVALSRDDYKGVLQGSLGNIVASAILGLVLSFVTAYWVSLRLTKPVRELADGVRR
FT                   IEEGELQQRVAVTSSDEIGELAEAFNRMAAAIDERDRTIRTKAHDLENLNLKLTDMNEF
FT                   LERRVEERTAALQVEMGRLEAILTSMAEGIAVTDRDGRVILFNPAAQQLFEMVPHRVVG
FT                   QPILDICNQGEFCRLVEHITSMGENRDQATVREVDLDARGKKLKVTLAPLVDGDGHFAG
FT                   VVMSVRDVTAEEEVDRMKTEFISTVSHELKTPLTSIKGSLQLIVDKSRGFTDVEKELLG
FT                   VCLRNTERLIRLVNDILDIAKIESGKMEFALSPHSPAELVEWSVRELEGFAREHGVTVV
FT                   NEVSADLPAIYGDGDRLGQVLTNLIANAVKFSPRGAVVTISAEQSDNFVAVSVKDRGRE
FT                   IQWADRGKLFKRFQQIDSGDRRQHGGTGLGLAICKEIVERHHGRIFYSEGIGGGNVFTF
FT                   TVPIHEGEP"
FT   gene            14063..15613
FT                   /locus_tag="KN400_0009"
FT   CDS_pept        14063..15613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0009"
FT                   /product="response receiver sensor histidine kinase, PAS
FT                   domain-containing"
FT                   /note="domains: REC, PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82872"
FT                   /protein_id="ADI82872.1"
FT                   /translation="MSGYKVFIVDDEADIALILKLQLEDAGYRTMRARDGIEALDALER
FT                   ESFDLVLLDIRMPRMDGIEVLERIRDRWPDLVVIMMTAHGSEDIAVEAMKKGAVDYISK
FT                   PFSSDDMKKRVERAIQFNRTRLENERLQRVLDEERRKMGAILRGMADLLVAVDREGRII
FT                   TINRAAEERFGIAADGVQNQPVELLLKTDIPGERLPCRVVLATGDPCLDVTYAVQAGGG
FT                   MIPVLSSATPLKGAGGEMMGCVEIIRDISTLKALEREREDFVSMLSHDLKTPITAVVGS
FT                   IDLVREGRIGPVNAEQRSYLDSAMESCAEMVDMIDTLLDVHRFEAGRMVMAARLEDLGP
FT                   LMARTLGRFDSVARRAGIALVLTLPDYPLALSLDRNQFARLMGNLIANAIKFTQEGGEI
FT                   EVSARLLNDPAELVGRIPRESYPDVPLPPLNPHLLITVRDTGVGIPADSLVSIFDRFVQ
FT                   ARNRRLGKSTGTGLGLAFCRKVMDAHHGYIWAESVEGEGSSFNMLFPLTNEAYAATGG"
FT   gene            15618..17117
FT                   /gene="fgrK"
FT                   /locus_tag="KN400_0010"
FT   CDS_pept        15618..17117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fgrK"
FT                   /locus_tag="KN400_0010"
FT                   /product="sensor histidine kinase of FgrL, PAS
FT                   domain-containing"
FT                   /note="domains: PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82873"
FT                   /protein_id="ADI82873.1"
FT                   /translation="MGNEHRRAPHQIAAIYLVVGMFWILFSDRILTGIAPEAAQLTRLQ
FT                   TAKGWFYVAATAGLLYWLVRRYALSAERAEDELRARNEELCMVEEELRQQLDEYEKSQF
FT                   ELHETNQALRASEERYRVLFASNPHPMWVCDLDTKAFLEVNDAAVTHYGYSREEFLAMT
FT                   MRDIGPAAGSPAPGEGAAQARECPCLKPTGIQCHRKKDGTLIAVEITSHTLDFGGRPAE
FT                   VVLASNVTERIKADEEVRRLNAELEERVEARTQELQRANRELESFSYSVSHDLRAPLRH
FT                   IDGFSRMLVEDYGERIDAAGKGYIQRIRSAAQRMGCLIDDLLQLANVSRSELEKRQVNL
FT                   SALAQVIGLGLKQIEGREDVTLRITEGVMAFGDPRLLRVVLENLLSNAWKYTGKRADAV
FT                   IEFAVEEQGSGRPVYLVRDNGVGFDMTFAGKLFTPFQRLHSADEFEGTGIGLATVRRIV
FT                   ERHGGTVWVEAAPDHGATFYFTLGEEEHLARNSDKEDGTTQ"
FT   gene            17114..19297
FT                   /gene="fgrL"
FT                   /locus_tag="KN400_0011"
FT   CDS_pept        17114..19297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fgrL"
FT                   /locus_tag="KN400_0011"
FT                   /product="flagellar biogenesis master response receiver
FT                   sensor histidine kinase, PAS and GAF domain-containing"
FT                   /note="domains: REC, PAS, GAF, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82874"
FT                   /protein_id="ADI82874.1"
FT                   /translation="MTEKKLRLLLVEDSEDDALLLLNDLKRGGYSVEHERVETAAAMRE
FT                   ALVKREWDIVISDYRLPQFTAPAALQILKRSGLDLPFIIVSGKIGEDMLVDAMRAGAHD
FT                   YLMKGNLSRLIPAVDREIREASERRTRRRAERSIRQGKIEWEAAFDAVSDIVVLTDPTG
FT                   TIIRCNSKLIQYFDTTYNDVIGTNITELFYGNDPAGESIFGLCADLKADEDDVRFPRLP
FT                   GWYNAACYPMHPTENEHGYVYVIKDITKRKRMEEEKKLTDRELLTLYAVAFRLNSQRGS
FT                   KRIMVDLLSQLHQMLQIDWSCIHLMEKGSLNLSAWLGLSREFAESFGSLSRSLPWVKDV
FT                   LDGKSFKAAEIAGHFGPEAEAAAEAMGMGAWCALPLKIGSGVLGTLFVAHRPNREYTDR
FT                   EVFLLNSIANQMAVLIENHTLYDRMKEKNEELVRSRKALKENLEEVKRANIELGRLNAS
FT                   KNSFIGMASHELKTPLTSIIGGLQFLLFYSDIPMTPEQKEMMQSVYEGVTQLKGIVDDL
FT                   LSISRIEAKGFAVHTRPVKLSDLCQEVRQTLLLPLSERDIRLEIADDPCRVPADEGFCR
FT                   LAVRNLMENAIKFTPDGGRIAITGRLVTMEELTADEELLRPFYRDFPANIAGHPGFYRL
FT                   DVADTGIGIPPDEAVRIFEKFYGVGDIEYHSSGKTGFMSKGSGLGLSIVKGIMDAHGGM
FT                   VWVTSGEGGGGSVFSLLFPMDNTCVVPLRGEAR"
FT   gene            19305..20231
FT                   /locus_tag="KN400_0012"
FT   CDS_pept        19305..20231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0012"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82875"
FT                   /protein_id="ADI82875.1"
FT                   /translation="MPAALSLHELTKHYGTLTAVDRFSLKVDRGTIFALLGPNGAGKTT
FT                   IIRILTTVLRPDSGTARVEDFDVQRQGREVRRLIGVVPQDNNLDRYLTARENLVMQARL
FT                   HGMPSAETNRRVDELLELVGLSGRRNDFPDTFSGGMQRRLVVARALVHRPKVLFLDEPT
FT                   TGLDPQSRRAVWDYVASLKDTMTIFLTTHYMDEADALCDRIVIMDHGRLLVDGSASQLK
FT                   ERMAHAHHYELQFRAHADRYEKMLKGFPFVRSLQRTGDLFRLSLAGEEFLKPLMDAIGT
FT                   EDIRKVCLREPTLEDVFIELTGRDVRE"
FT   gene            complement(20295..21704)
FT                   /gene="hemY"
FT                   /locus_tag="KN400_0013"
FT   CDS_pept        complement(20295..21704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemY"
FT                   /locus_tag="KN400_0013"
FT                   /product="protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82876"
FT                   /protein_id="ADI82876.1"
FT                   /translation="MKKAIVAGGGISGLATAYLLKTRAAEEGLELDVTLVEREERLGGK
FT                   IWSIKEEGYLCEWGPNGFLDSKPQTLDLCRELGASDLLLRSNDNARKRFIYTGGALNRL
FT                   PENGPMFLKSGLISWPGKLRLAMEPFIPKKAGDEDETLAAFGRRRLGDEALRKLIAPMV
FT                   SGIFAGNPETMSLRSCFPRIAELEDEYGSLVRAMIRLAKKKKQEVAQGKAVASAAGPGG
FT                   VLTSFRDGIQALTDILAERLGPDTIVSGQEVLEVSRGGSLPWRVRTGSIDMDADLVILA
FT                   TPAYATASIIQGVDSDMAGILRQIPYATMTVVCFGYDRERIAHDLNGFGYLIPKEEGMN
FT                   TLGTLWDSSIFENRAPEGQVLLRSMMGGACFPEYVNLTDEEVTGRVKNDLATIMGITAP
FT                   PSFVRIFRHHQAIPQYTVGHSTRVAALEQRAASLPGLFLTGNSYRGIGLNDCVAAANRT
FT                   AGEAIAQVTSR"
FT   gene            complement(21746..22174)
FT                   /locus_tag="KN400_0014"
FT   CDS_pept        complement(21746..22174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0014"
FT                   /product="winged helix-turn-helix transcriptional
FT                   regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82877"
FT                   /protein_id="ADI82877.1"
FT                   /translation="MEQIERIAQLYPVIMRVMGRIRSLVHDGMDLTYNQYKMLLTIYDK
FT                   GSCPLNLLARELGIAMSSASEMVERLVNLGIVYRAVDEDNRRQVIIYTTDRGEELIREL
FT                   RHGIVENYRQLFARLPEGDQERLATAFETIADVLGKLE"
FT   gene            22321..23205
FT                   /locus_tag="KN400_0015"
FT   CDS_pept        22321..23205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0015"
FT                   /product="DnaJ-related molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82878"
FT                   /protein_id="ADI82878.1"
FT                   /translation="MAQHDYYETLGLKKGATEEEIKKAYRKLAITYHPDKNPGDAAAEE
FT                   KFKEINEAYAVLSDPQKRAQYDQFGSNGFHQRFSQEDIFRGFDVGDMFKDMGVGTDDIF
FT                   SRIFGGGFRQGGFSFTGTRQRGGDFTMELPVTFREAYAGCEKRVAYRRDGMREEISVKV
FT                   PAGVETGARLRVAGKGGVGSGGTGDLYLVVKVGGDPQFHREGDDIVVEREIKFTDAALG
FT                   ASLDVPTLEGTKRVKVPAGIQSGTKIRLKGLGFPHMGKTAKGDLYVHINVSVPRSLSAD
FT                   QKAILEKLREAGL"
FT   gene            complement(23310..24275)
FT                   /locus_tag="KN400_0016"
FT   CDS_pept        complement(23310..24275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0016"
FT                   /product="peptidylprolyl cis-trans isomerase, PpiC-type,
FT                   SurA family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82879"
FT                   /protein_id="ADI82879.1"
FT                   /translation="MIKRLIPLSLAVVLTLPSLSSAEVVSRILAVVNDEIVTSYAVDKE
FT                   KRALLKEAERQQPPPDPKSLANLDEVALNRLIDKKLVEQKIRELDIRVGEEEVRQAIED
FT                   VKRQNKLSQEALVAALANQGLSFDQYKAQIKEQLERLRLVSQEVRSKIQVGEREMREYY
FT                   EANKAKFGAEDIFRARNIYFKLDDKMSAEQVKKVMTTAMTVLHEAQSGKDFAELARQYS
FT                   DDPAAKGNGGDLGTFRKGDILPEFEEQLTRMQPGEVSDLIYTATGLHIVKLEERSLGTP
FT                   KPFEQVKAEVEDLVYRKKSEDRFNQWVADLRKGAAIELRQ"
FT   gene            complement(24353..25294)
FT                   /locus_tag="KN400_0017"
FT   CDS_pept        complement(24353..25294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0017"
FT                   /product="peptidylprolyl cis-trans isomerase lipoprotein,
FT                   PpiC-type"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82880"
FT                   /protein_id="ADI82880.1"
FT                   /translation="MKRHTIVTILSVSLCLAALGGCKGKTESGTTAAPAKKAGQVLVEV
FT                   NGDAITVENFNKELEGLPPYLKPMADTPEGKKELLDTMVVRELLYQQAKKDGVDKSAEI
FT                   ADRVEELKKRVVVEAYLKKKVEEQVQVSDEELKKFYDQNKDKFKSGAQIKASHILVRDE
FT                   KLAQEIVKELKGGANFEELAKKHSIDSAAAKGGDLGWFSKGNMVPEFEKVAFGLKEGET
FT                   SGIVRTQFGYHIIKVTGKRPAGERTFEEVKDQIKAAVLPGKQQEVFQKLKEDIKKGATI
FT                   SIKEDVLKGLGGQSAAAEHPAPAQPAAAPAAK"
FT   gene            complement(25355..28828)
FT                   /gene="mfd"
FT                   /locus_tag="KN400_0018"
FT   CDS_pept        complement(25355..28828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="KN400_0018"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82881"
FT                   /protein_id="ADI82881.1"
FT                   /translation="MTQTDTDLFKRLTDRLTPPAARLTLAGLRGSSPAYLLARLIGEAG
FT                   APFLVVVPDAEAAAELTTELRFFTGRPGDILLFPAWDTSPFEKASPHADVTAQRLAVLR
FT                   RLADRRAAAVVTTPEALRQRVVPRSLLDSASLYFLPGEESDRDDLLSRLVTLGYLNVPL
FT                   VEDRGTFAVRGGIVDIFPPGFDLPVRIEFFGDFVDTIRSFEPLSQRSLQPLEELLLLPS
FT                   RELLLTADTLQGAASRIKTRCDDLEISPLVRRELLEQLQNGLYPAGVEWLLPLFHQNLE
FT                   TLLDYAGDAVRVLVDPAAQEEEGERLSRELEEASDRARERGELFPAPESLFLAPADTAA
FT                   ALAAGRLVTIPFLHLNEGDSPETIDIATETNADLKVDISPDSEGVLRPLAARLTGWIEE
FT                   RQRVIIACHQRGQAQRLYELLAHYPVPLTVSDRPFPAERERDDGRVDIVIGEISRGFRL
FT                   PEGRLVVIAEEEIFGKRQKRRGITELRKKQIMTSLAELKPGDHMVHLDHGVGIYRGLQH
FT                   LSLSGCAGDFLLLEYAGGDKLYLPVDRLSLVQRYVGSEGIEPRVDRLGGTSWEKAKGKA
FT                   RAAVQEMAEELLRIYAARQLHEGHRFSPPDDLYREFEASFAYEETSDQLAAIEDVIADM
FT                   TSNRPMDRLVCGDVGYGKTEVAMRGAFKAVMDGKQVAVLVPTTVLAQQHLETFRARLGA
FT                   YPVTIEMVSRFRTPKEQKDILERVKKGTVDVIIGTHRLLQNDVTFKDLGLLIVDEEQRF
FT                   GVTHKEKLKKYKAAVDILTLTATPIPRTLYMSLMGIRDLSIIDTPPVDRLAVKTFVART
FT                   SDELIREAVLRELRRGGQVFFVHNRVQSIGAWYEHLRRIVPEAKIAVGHGQMDEGELEK
FT                   VMLGFMHGETNLLLCTTIIESGLDIPSANTLIVDRADTFGLAQLYQLRGRVGRSRQRAY
FT                   AYLLIPGEGAISSDARERLRIIQELNELGAGFRLATHDLEIRGAGDLLGAKQSGNIAAV
FT                   GFDLYTELLEEAVQKLKGEEPVERVEPEINLRVPAFIPEDYVREPNQRLVIYKKLTQAT
FT                   AEEEVGEVMEELVDRFGTLPLAASYLLDVMKLRIMLKHFLVRMAEFDGKRLCLSFHEKT
FT                   PVSPDTIIGLIKANPKRYQFTPDFRLVAELADTSFEGVLAEARNLLKRLG"
FT   gene            complement(28903..30339)
FT                   /locus_tag="KN400_0019"
FT   CDS_pept        complement(28903..30339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0019"
FT                   /product="helix-turn-helix transcriptional regulator with
FT                   aminotransferase domain, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82882"
FT                   /protein_id="ADI82882.1"
FT                   /translation="MNTVKSGGKIPLYESVAGRVAQLIGEGTFRAGDRIPSVRALGRQF
FT                   QVSLTTVMEAYTLLEDRGLIEARPQSGYYVRARFPGSTAEPEMTAPPLKPTTVGTAELS
FT                   MMVMRDTRNPDLVPLGAAIPNPELLPVDRLNRMLATESRKHAVASVSYDMPPGCERLRV
FT                   QIARRMLAVGCALAPDQIVTTSGCIEAVVLSLRAICRPGDTVAVESPVYYNFLQAIDLM
FT                   GLKALEIPTHPRTGISLDALRYALDHTPIRACLVVANFNNPLGSLMPDDHKRELVAMLA
FT                   ARRIPLIEDDIYGDLSFSPERPRAAKAFDEAGLVLYCTSVTKTVAPGYRVGWVAPGIFQ
FT                   KEIERLKAVTTIACSTPTELAVAEFLANGGYDHHLRRIRRIYARQMSLMAEAVGQAFPV
FT                   GTRVTRPEGGFVLWVECPERVDSLVLYEQALTRGITIAPGPIFSATGKYRNCIRLNAAW
FT                   WDDRVERAIHTLGELAAAMM"
FT   gene            30585..31475
FT                   /locus_tag="KN400_0020"
FT   CDS_pept        30585..31475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0020"
FT                   /product="pentapeptide repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82883"
FT                   /protein_id="ADI82883.2"
FT                   /translation="MLRSSLQTHEKEAYPTMLRYLLRPFLSLMAVALICGPAVESVASA
FT                   SGNGGKKRPLDYEEYVRLITGGPRKVARKESRKESRKESRKSKVEVAAAEKPAAVQQPV
FT                   VMAATPAPRRAVTPSPGRDGWRPSPEQVHEILRTSRNLAGAVLRGAVLAGFDLRGVTLA
FT                   GADLFGANLAGANLDGANLRGTSLEMVNLRGASLRGANLAGAGLFKADLEGADLQGANL
FT                   SGVYAVCANLRGASLAGVTTVGGHFAQATFDDRSQGAAVAQAQNATRNDIVPVVGGEKA
FT                   LPSGGEKGRILLLNF"
FT   gene            complement(31544..32083)
FT                   /gene="yrdA"
FT                   /locus_tag="KN400_0021"
FT   CDS_pept        complement(31544..32083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrdA"
FT                   /locus_tag="KN400_0021"
FT                   /product="protein of unknown function YrdA, isoleucine
FT                   patch superfamily of carbonic
FT                   anhydrases/acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82884"
FT                   /protein_id="ADI82884.1"
FT                   /translation="MIRPFKGMSPQIDPSAFIADTAVVIGDVTIGPESSIWYNVVARGD
FT                   VNFIRIGARSNIQDLSMLHVTHKKHADDPGAPLVIGDDVTVGHSVTLHGCTIGNGAFIG
FT                   MQAMVMDKAVVGEGALVGARALVTEGTVIPPHTLWVGAPAKYKRDLTPDEIAWLKRSAG
FT                   NYVRYSREYLEEDADR"
FT   gene            complement(32117..33031)
FT                   /gene="nadA"
FT                   /locus_tag="KN400_0022"
FT   CDS_pept        complement(32117..33031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /locus_tag="KN400_0022"
FT                   /product="quinolinate synthetase complex, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82885"
FT                   /protein_id="ADI82885.1"
FT                   /translation="MHANDIRQDIRKLLKERNAVLLAHNYMRDEVQEIADITGDSLALS
FT                   QEAARTDADVIVFCGVHFMAESASILSPDKTVLLPRMDAGCPMADMVTAEALLEMKARH
FT                   PDVPVVTYVNSSAAVKAVSDICCTSANAVKVVNSLPDPEVIFVPDRNLGQFVAKQSDKT
FT                   FHFWDGFCPTHERLKPADVQRLKEAHPDALFICHPECNPLVVALADHVCSTSGMYDFCR
FT                   TNPAKRFIIGTEAGILYRLRLENPDKEFILASPALVCPNMKLTSLEDVLASLQTMSPVV
FT                   KVPEEIRVPAKLALDRMIAIPRD"
FT   gene            33263..33598
FT                   /gene="tatB"
FT                   /locus_tag="KN400_0023"
FT   CDS_pept        33263..33598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /locus_tag="KN400_0023"
FT                   /product="twin-arginine translocation pathway protein TatB"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82886"
FT                   /protein_id="ADI82886.1"
FT                   /translation="MFGIGMPELIVILVIALIVIGPQKLPDIARSLGKGLAEFKRASDD
FT                   FQRNLAEEVRTLDEKEKAEKGEAAAEPVKRDLAAEVKAYEDQAASGVHQGEPAPVAGSP
FT                   ESEKKSA"
FT   gene            complement(33656..34492)
FT                   /locus_tag="KN400_0024"
FT   CDS_pept        complement(33656..34492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0024"
FT                   /product="TPR domain lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82887"
FT                   /protein_id="ADI82887.2"
FT                   /translation="MKQLTMPLTALALFTLGGCVTNSDLDVVRRDLDELKNRQFQVEKE
FT                   VGGVRTEATARIESSFKDLDTERAGVRKGLADLQAAMDGIKVDMQVLAGKVDDVGLAAK
FT                   KPGDDLILLREDLERRLTAFDQRLAKAETGIEALQKKVAEQAPSPKETEKPTPEALYQK
FT                   GLDAYRAGNYGVARESFTRFLEQHPKHELAANARYWTGETYYSEKKFEQAILEFQEVIK
FT                   NYPGKEKVPAAMLKQAAAFSEIGDAKSARFVLRKLADDYPSSEEAKRAKDRLKELK"
FT   gene            complement(34584..35168)
FT                   /locus_tag="KN400_0025"
FT   CDS_pept        complement(34584..35168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0025"
FT                   /product="peptidoglycan-binding outer membrane lipoprotein
FT                   Pal, OmpA family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82888"
FT                   /protein_id="ADI82888.1"
FT                   /translation="MYSRTLGVVALACFALSLVGGCAKKEMVKPDQAAPTTAAAPVSPA
FT                   PQPAQPKEEPVKAQTITEAPVAVASQASDTAGRAEAAETSLERIYFDFDAFVLSQTARD
FT                   TLSRNAEALLKKMPNAKVSIEGHCDERGSDEYNLALGEKRAKTAMNYLITLGVPAARLS
FT                   IISYGEEKPLDPGHTEEAWAKNRRDEFVIVK"
FT   gene            complement(35298..36596)
FT                   /locus_tag="KN400_0026"
FT   CDS_pept        complement(35298..36596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0026"
FT                   /product="biopolymer transport periplasmic beta-propeller
FT                   repeat protein, TolB-related"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82889"
FT                   /protein_id="ADI82889.1"
FT                   /translation="MKHVRIFATLLALLVISVTPAVIHSEDVYREVTASGAHNLTLAVD
FT                   NPRNLGGADDAALARDVAEVLRFDMTLAGPFSVMAPPAGTSPGGIRPGEFDLDSWRNAG
FT                   VDLLVKSGYTITGDSVTMEFRLYNATQGRELAAKRYTGKRSDLRRITHTFSDDIMQTMT
FT                   GERGPFTGKIAFVSTESGNKEIYLMDYDGHNVQRLTKNRSINLNPDFSPNGRELAYTSY
FT                   RRGNPDLFRREIFTGTEAVVSSHRGINVTGTWSPDGKQLALAMSRDGNSEIYAISRDGR
FT                   DPRRLTTHQAIDVSPAWSPDGKRIAFVSDRLGKPQVFIMNADGSDVRRLTTSGAYNVSP
FT                   RWSPKGDRLVYCRQEGGFQIYSIATDGTGDTRLTSEGSNEHPRWSPDGRFLTFSSTRDG
FT                   GEAIYVMRSDGSGQTRVYRSKGKASHPTWSPRW"
FT   gene            complement(36596..37336)
FT                   /locus_tag="KN400_0027"
FT   CDS_pept        complement(36596..37336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0027"
FT                   /product="periplasmic energy transduction protein,
FT                   TonB-related"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82890"
FT                   /protein_id="ADI82890.3"
FT                   /translation="MNRSIAHREPGLGWGLAASAMLHLALAALALVAQFNVPRYTEAPV
FT                   YYVDVVNLPVASPRAGSPTVGGAPPELPPPASQAMATPRLTPHTPAAVGKKSPTAADTG
FT                   KEFEDRLSALQRNVDERRQEAALDALRRKVNGSGRAEPAGMPSATGTQAGSDYAAYIQS
FT                   RLRDAFRYTIAHQAKTPEVVIRLTIDPRGRVTRQRIERSTGDRIFEESVMKAIAMAEKT
FT                   FAPPPSGGEFETGFIFRPEGVGKR"
FT   gene            complement(37333..37752)
FT                   /locus_tag="KN400_0028"
FT   CDS_pept        complement(37333..37752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0028"
FT                   /product="biopolymer transport membrane protein,
FT                   TolR-related"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82891"
FT                   /protein_id="ADI82891.1"
FT                   /translation="MEVGSRNSGDRGTMSQINVTPLVDVMLVLLIIFMVTAPMMQQGVQ
FT                   VNLPKAETKAMTAQDEAVVVSIDRAGKVFVNSTEVASGDLTAKLTAMVANRAKKEVFLK
FT                   ADRDVPYGQVVKTMAEIKGAGIERLGMVTEPAPGK"
FT   gene            complement(37762..38439)
FT                   /locus_tag="KN400_0029"
FT   CDS_pept        complement(37762..38439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0029"
FT                   /product="biopolymer transport membrane proton channel,
FT                   TolQ-related"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82892"
FT                   /protein_id="ADI82892.1"
FT                   /translation="MTLFAGTGLVVKLVLVVLIFFSVVSWAIIFFKLLQINRANGESDR
FT                   FLDFFWKTKRFDAISSQLDRFGNSPLSVLFNEGYAELRRLLDKGGEQRDEPGVVSTDLG
FT                   GIDNIARALRRATTSEITRLEKYVTFLATTGSTAPFIGLFGTVWGIMNAFKGIGETGSA
FT                   SLAVVAPGIAEALIATAIGLVAAIPAVMAYNHFQHKIKVLIASMDNFSTEFLNIVQRTF
FT                   AGK"
FT   gene            complement(38533..39312)
FT                   /locus_tag="KN400_0030"
FT   CDS_pept        complement(38533..39312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0030"
FT                   /product="nitrilase/amidohydrolase superfamily protein,
FT                   class 5"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82893"
FT                   /protein_id="ADI82893.1"
FT                   /translation="MNRTVKAGAVQFTVRLGDIDANVAYVQKALRRLASQGCRLAVLPE
FT                   MWSTGYAYKELNELAKRTPEVVAELGRLSRELEMVIVGSMPEPHGEKVFNTAYVLDRGE
FT                   LLGSYRKIHLFSLMGEDRSLDGGDRWLVVDTHVGRLGVFICYDLRFPELARRLAVEGAE
FT                   IIVVPAEWPKPREEHWRALLRARAIENQLFVVAANCCGVQGKLDFFGSSLIIDPKGELL
FT                   AEGGYDPCEPMATLDFQVMETWRDQIPCFADRRPSCY"
FT   gene            39439..40596
FT                   /gene="hemN"
FT                   /locus_tag="KN400_0031"
FT   CDS_pept        39439..40596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="KN400_0031"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82894"
FT                   /protein_id="ADI82894.2"
FT                   /translation="MNEPLHLYVHIPFCLKKCRYCSFVSRSDAPLAIDDYASLVAREME
FT                   MRVAAANPLPLSPATTLYLGGGTPSLLSPAALERIIDAAARSYGLGPGAEITLEANPGT
FT                   VTFQRLADFRSAGVNRLSLGVQSFDDGMLVLLGRLHTARQAREAVAATRRAGFDNIGID
FT                   LIHSLPGQTPDQWREQLACAVALNPDHVSAYGLTVEEGTPFAAMEERGELVLPDEEQSA
FT                   LMFEATTDVLVSAGFEHYEIANFARPHRRSRHNQVYWLRRNYLGFGAGAHSFLRAPAFG
FT                   VRWKNTDDLELYRDTLAAAELPGEERTVLSRADAMAEFFFLGLRLLDGVREEDFVREFG
FT                   DTMENVYGREMERLCSAGLLMREGGRLKLSRRGVILANRVFASFL"
FT   gene            40732..41760
FT                   /gene="hrcA"
FT                   /locus_tag="KN400_0032"
FT   CDS_pept        40732..41760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="KN400_0032"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82895"
FT                   /protein_id="ADI82895.1"
FT                   /translation="MTDISERNKLILEAIIEDYITTAEPVGSRAVTKRHGLTLSPATVR
FT                   NVMADLEEMGYLVSPHTSAGRVPTDKAYRLYVDSLLAVRRIDKVERERIRKRYAEAGRD
FT                   IGAVLHETSRLLSSVSHYTGIVLAPRFSATIFRHIEFVKLGGRRILVILVADNGTVQNR
FT                   LIESDEEFSSEELIRMSNYLNELLVGVPVGQVRTRILEEMRNEKVLYDKLLARALQLSE
FT                   QSLNDDGAQIFIEGQTNILEQPEFADSRRMRDLFRAFEEKNQLVGLLDRCLNAQGVQIF
FT                   IGAETHLSQMEGLSIITSTYLTGKNTLGVLGVIGPTRMGYAKVIPIVDYTAKLVSRLLE
FT                   GE"
FT   gene            41800..42402
FT                   /gene="grpE"
FT                   /locus_tag="KN400_0033"
FT   CDS_pept        41800..42402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="KN400_0033"
FT                   /product="DnaJ adenine nucleotide exchange factor GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82896"
FT                   /protein_id="ADI82896.1"
FT                   /translation="MDKKKHGTVQSADETIAAAGFAGEAAQGKGEDVQSVAAEERIRQL
FT                   ETELAAKEAEAAANWDKFVRERADLENYRRRTQKEKEELLKYGNESLLQDILPVVDSME
FT                   RALGHADSESLSAVIEGIRMTHGMLLGTLKKFGVVAVEAERGTVFDPAYHQAMCQVEVS
FT                   ELPPNTVVEVFQRGYLLNERLLRPAMVSVATVPKDAA"
FT   gene            42484..44394
FT                   /gene="dnaK"
FT                   /locus_tag="KN400_0034"
FT   CDS_pept        42484..44394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="KN400_0034"
FT                   /product="chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82897"
FT                   /protein_id="ADI82897.1"
FT                   /translation="MSKVIGIDLGTTNSCVAVMEGGEPVVIANAEGSRTTPSMVAFAES
FT                   GERLVGQQAKRQAVTNPENTLFAIKRLIGRKYDTEEVRKDISISPFKIVKADNGDAWVE
FT                   ARGKMYSAPEISAMVLQKMKQTAEDYLGETVTDAVITVPAYFNDSQRQATKDAGKIAGL
FT                   NVLRIINEPTAAALAYGLDKKKDEKIAVFDLGGGTFDISILELGDGVFEVKSTNGDTFL
FT                   GGEDFDQRVIDWIADEFKKDQGIDLRGDKMALQRLKEAAEKAKCELSTSMETDINLPFI
FT                   TADATGPKHLTMKLSRAKLEALCADLLNKLEGPCRTALKDAGLSPSEVDEVILVGGMTR
FT                   MPAVQKRVQEIFGKVPNKGVNPDEVVAIGAAIQGGVLRGDVKDVLLLDVTPLSLGIETL
FT                   GSVMTKLIEKNTTIPCRKSQVFSTASDNQPAVTIHVLQGEREMAIDNKTLGNFELTGIP
FT                   PAPRGVPQIEVTFDIDANGIVHVSAKDLGTGKEQSIRITASSGLSKEEIDKMVKEAEAH
FT                   SAEDKKKRELVEARNHADTLSYSTEKSLKEYGDKIGADEKAKIEECLANLRKAMEGSDV
FT                   EVLKKATDELTQASHKLAEAVYAKAQAEGAQPGGEAAGEASAKDEKVVDADFEEVKDDK
FT                   K"
FT   gene            44507..45628
FT                   /gene="dnaJ"
FT                   /locus_tag="KN400_0035"
FT   CDS_pept        44507..45628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="KN400_0035"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82898"
FT                   /protein_id="ADI82898.1"
FT                   /translation="MAADKRDYYEVLGVHKNASDTEIKKAFRKLAIQYHPDKNPDDKEA
FT                   EEKFKEITEAYEVLSDPQKRAQYDQFGHAGVGAGGFSGGGFGGFGAGTPFGDIFGDIFG
FT                   DIFGGRPRGSRGRRGDDLQYNMELSFEEAAFGAEKEIQVPYGKRCGDCGGSGAKPGTEP
FT                   KVCPTCRGAGQVRFQQGFFSVSKTCNHCNGEGRVVENPCTSCRGSGMIRDTKTLSVKVP
FT                   AGVETGTRLKLSGEGGQGIKGGGNGDLYVAIAVREHPIFTREDNDVLCEIPVSFVQAAL
FT                   GCEIEVPTLDGKVSMKIPEGTQSGRIFRLRGKGVPQLQGYGRGDQLVIIKVETPSNLNK
FT                   RQRELLEEFARISGEDVHPMKKSFFDKVMDFIS"
FT   gene            complement(45718..46257)
FT                   /locus_tag="KN400_0036"
FT   CDS_pept        complement(45718..46257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0036"
FT                   /product="2',5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82899"
FT                   /protein_id="ADI82899.1"
FT                   /translation="MYRLFVAIDLPGSVRAQLADLGRELDGVRLVPPDQLHLTLRFIGN
FT                   ADDECFQRIKDSLATVTSPPFTLALAGVGCFPSPRRPRVIWAGITPNERLTLLQRAVEK
FT                   AVAAAGIPPEERPFCPHITLARLKEAIPKGFPAFQSRHGGLSAEPFTVEEFLLYSSTLT
FT                   AGSALHRREASYRLTG"
FT   gene            complement(46270..47325)
FT                   /locus_tag="KN400_0037"
FT   CDS_pept        complement(46270..47325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0037"
FT                   /product="poly-gamma-glutamate capsule biosynthesis
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82900"
FT                   /protein_id="ADI82900.1"
FT                   /translation="MTIFPAALTLVLVLLAVPAGALAERISLSFVGDVMLAGSATDTLQ
FT                   RYGYSYPFSATAAELRRSDLVVGNLEAPLTDGGREFRAKRFRFKASPVAAAALKRAGFS
FT                   VMTLANNHMMDFGADGLSDTIHHLNRNGIAFAGAGPSIADARREASVTVRGQTVAFLAY
FT                   SLTQPIEFFATEGRPGTAPGYAGHYLADIRRVRSSADHVVVSFHWGQERAALPSPYQIE
FT                   TAHRAIDAGADIVIGHHPHVLQGIEIYRGSPIFYSLGNFAFGSRSPSADRSIIARVTLG
FT                   EGPPIVEVIPLNVLFREVRFQPAILTGRKAADVVDRLNRLSAPFSTVITSTAGSHLVAP
FT                   AEANARLARRQ"
FT   gene            47417..48685
FT                   /gene="serS"
FT                   /locus_tag="KN400_0038"
FT   CDS_pept        47417..48685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="KN400_0038"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82901"
FT                   /protein_id="ADI82901.1"
FT                   /translation="MLDAKYLRENLEEVEARLATRGSEVSLGRFRELDERRRALLTESE
FT                   SLKALKNSVSEAISKVKDKSQIQDKIAEMREVGVRIKGLDDELRGIEDELQMVLLTVPN
FT                   VPHPTVPVGASEADNRQVRTWGEPPCFAFDPKPHWEIGEGLGILDFERGAKLTGARFTL
FT                   YRGAGARLERALVNFMLDLHTERHNYLEMLPPFVVNRESMTGTGQLPKFEDDLFHLEGV
FT                   DYFLIPTAEVPVTNIHRAEILKAADLPLSYTAYTPCFRKEAGSYGKDVRGLIRQHQFNK
FT                   VELVKFVHPATSYDELEKLLSNAEEVLRQLGLAYRVVELCTGDMGFSAAKTYDIEVWLP
FT                   GQETYREISSCSNFEDFQSRRASIRFREDEKSKPEFVHTLNGSGLAVGRTLVAILENYQ
FT                   QEDGSVVIPDVLRPYMGGLQKIG"
FT   gene            48692..48777
FT                   /locus_tag="KN400_R0001"
FT   tRNA            48692..48777
FT                   /locus_tag="KN400_R0001"
FT                   /product="tRNA-Ser"
FT   gene            48797..48890
FT                   /locus_tag="KN400_R0002"
FT   tRNA            48797..48890
FT                   /locus_tag="KN400_R0002"
FT                   /product="tRNA-Ser"
FT   gene            48944..49432
FT                   /locus_tag="KN400_0039"
FT   CDS_pept        48944..49432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0039"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82902"
FT                   /protein_id="ADI82902.1"
FT                   /translation="MKVLFRLVVVALTVMVAVAGCSKKEEQKAGGDAGAQHGQAAKKES
FT                   VVVVPDNVKGKWKSVKIAVTDKAANKESVYTINVGAELAIPESNLTIAVDNFLPHFTMD
FT                   GTTLTSQSNEPKNPAAQIRILEGGKEVFKGWLFSLYPTTHAFNHPKYGFTLVDFIPAN"
FT   gene            49437..49513
FT                   /locus_tag="KN400_R0003"
FT   tRNA            49437..49513
FT                   /locus_tag="KN400_R0003"
FT                   /product="tRNA-Arg"
FT   gene            49614..50153
FT                   /gene="tadA"
FT                   /locus_tag="KN400_0040"
FT   CDS_pept        49614..50153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadA"
FT                   /locus_tag="KN400_0040"
FT                   /product="tRNA (adenosine-34) deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82903"
FT                   /protein_id="ADI82903.2"
FT                   /translation="MSSLKKTPIRDDAYWMGKAIREAAKAAARDEVPIGAVIVRDGAVI
FT                   GRGHNLREGSNDPSAHAEMIAIRQAARRSANWRLTGATLYVTLEPCLMCMGAIILARLE
FT                   RVVFGCYDPKGGAAGSLYDLSADPRLNHQVRLSPGVCQEECGTMLSDFFRDLRRRKKAK
FT                   ATPALFIDERKVPPEP"
FT   gene            50214..50303
FT                   /locus_tag="KN400_R0004"
FT   tRNA            50214..50303
FT                   /locus_tag="KN400_R0004"
FT                   /product="tRNA-Ser"
FT   gene            50471..50683
FT                   /locus_tag="KN400_0041"
FT   CDS_pept        50471..50683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82904"
FT                   /protein_id="ADI82904.1"
FT                   /translation="MLIRVRYENDTYDMLKAWRLQEYLDDGKVVAFLRSDGWAVVGRDP
FT                   LRRSMGRGYPGPERRRIENNLHRAA"
FT   gene            50755..51462
FT                   /locus_tag="KN400_0042"
FT   CDS_pept        50755..51462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:51028..51030,aa:Sec)
FT                   /locus_tag="KN400_0042"
FT                   /product="peroxiredoxin-like 2 family protein,
FT                   selenocysteine-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82905"
FT                   /protein_id="ADI82905.1"
FT                   /translation="MAIDEQKPVYELQKELDALREDYLAGMSPEHAATLQRTATELVLS
FT                   GIVGHAATIGDRAQDFTLPNAVGRQIRLSEVTAQSTAVVTFYRGAWUPYCSLQLRAYQA
FT                   VLPRLRELGGELLAISPQTPDKSQATLLKNFLQYEVLSDVGNLVARSFGLVYPLGEEMR
FT                   RIYLGFGVNLADYNGDESWELPLPGTFVIDGTMTIRYSFVDADYTRRLEPATILDVLER
FT                   IREERGRDDNQAS"
FT   gene            51443..52090
FT                   /gene="can-1"
FT                   /locus_tag="KN400_0043"
FT   CDS_pept        51443..52090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="can-1"
FT                   /locus_tag="KN400_0043"
FT                   /product="carbonic anhydrase, beta-family, clade B"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82906"
FT                   /protein_id="ADI82906.1"
FT                   /translation="MITRLLEGNRRFVAEVFEKERETFATLARGQRPTVLWIGCSDSRV
FT                   PVNTITQTKAGEVFVHRNVGNVVSVNDWNLSAVLEFSINHLCIPDIVICGHYGCGGIQA
FT                   LDEERADDKYIPIWLINAYKAKERVDEKIRALHIGLPPEQRMKLIVEENVRLQLEHLRE
FT                   YPFVRTAMRQGKLSIHGWIYDMESGEIKILSTERPGEGAAVSSRATEYCPLP"
FT   gene            52195..52677
FT                   /gene="cbcS"
FT                   /locus_tag="KN400_0044"
FT   CDS_pept        52195..52677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbcS"
FT                   /locus_tag="KN400_0044"
FT                   /product="menaquinol oxidoreductase complex Cbc4,
FT                   cytochrome c subunit, putative, 4 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82907"
FT                   /protein_id="ADI82907.1"
FT                   /translation="MKSHVWRPLYVALSVAGALLLARSFLVPNDFGVHEQGYMYGWHRK
FT                   GNENEWKQVPVKYRTKAYCVGCHAAKVASIDRSPHGVIPCENCHGPALGHPKDPPTLTI
FT                   DHSRRLCLRCHAKLVTPSSGRSQIRGIDPDTHNPQAECRLCHDPHHPNLEELKRYE"
FT   gene            52670..53443
FT                   /gene="cbcT"
FT                   /locus_tag="KN400_0045"
FT   CDS_pept        52670..53443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbcT"
FT                   /locus_tag="KN400_0045"
FT                   /product="menaquinol oxidoreductase complex Cbc4,
FT                   iron-sulfur cluster-binding subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82908"
FT                   /protein_id="ADI82908.1"
FT                   /translation="MNRREFLRRSMVVVAGLAVPAAALELVDPKRLLAARPELRWAFLV
FT                   DTYKCVGCGFCVKACKVENEVPYEANVTRTWVERYVVKPDGEVLIDSPRGARDGFTDKR
FT                   IEVGTGKPRDVGDEEVEKAFFVPKLCNQCDNPPCVQVCPVGATYKTVDGVVLVDRSWCI
FT                   GCGYCIMGCPYGVRFFHPVHKVAEKCNFCYHRISQGQATACVDACPFGARRIGNLRDPH
FT                   DPITKIIMAGRVGILKEEYGTKPQVYYVGLSKEVR"
FT   gene            53446..54699
FT                   /gene="cbcU"
FT                   /locus_tag="KN400_0046"
FT   CDS_pept        53446..54699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbcU"
FT                   /locus_tag="KN400_0046"
FT                   /product="menaquinol oxidoreductase complex Cbc4,
FT                   cytochrome b subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82909"
FT                   /protein_id="ADI82909.1"
FT                   /translation="MVHGEAWTVKELFVYPNEYIYWTIQIVMYPFLTGLVAGAFVLSSL
FT                   YHVFGVKQLKDIARFSLVFSFALLPCAPLPLLLHLQQPLRNHHVLMTPHFTSAIAAFGI
FT                   VFLTYGMIVASELWFVYRGYFAATARQLKEQREHTRAETIKMRLYSVLVLGAWDVSHRA
FT                   LEQDERAVKILAAVGIPVACFLHGYAGFIFGSVKANALWMTPLMPVIFICSAVVSGIAL
FT                   CILTYIVTMELRKFVAAWRRRDNPGLPAPAEHGGEEANVVRMTSRYLIMFLILAITLEL
FT                   LDLIFRGYTAVKSWDILRSVIYGKDFVAIFVLQYGLGNLVPFILFLLPGLTVRRAVAGT
FT                   LLVLFGVFMMRWNVVIGGQAFSASFAGFMHYHLPIIPHDLETFKEGLFGALAVGSVPFV
FT                   LFWFLSRIFPVFGSDERH"
FT   gene            complement(54770..55219)
FT                   /locus_tag="KN400_0047"
FT   CDS_pept        complement(54770..55219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82910"
FT                   /protein_id="ADI82910.1"
FT                   /translation="MDTTVIDEAIDKYVHERMEKGKTRAAERFLSYAYLKYAGDEVGEF
FT                   LRKAKGLTRYYVDFLTLMENPFKGPELAWFASMIVVGIVSCVMLSEEQTRLAGIFILSG
FT                   TLVHAWSLLRMVAKKWREIGVMIAIYREIIEIIERETSSLPSSAR"
FT   gene            complement(55665..56267)
FT                   /locus_tag="KN400_0048"
FT   CDS_pept        complement(55665..56267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0048"
FT                   /product="outer membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82911"
FT                   /protein_id="ADI82911.1"
FT                   /translation="MKRLIALLCLTLTVAAGSGTALAENIKGRLGITGKIGFYLPGDSD
FT                   FDNYKLETDAGFLGGGGLIYGVTDNLAAEVDVTYTKFGAELVSGLDQGDFSVTNIAMGV
FT                   QYRFDTPQPKLSPYAGGGIDILISDYDRPGGADVDPTVGVHLCGGLDYFLTKHLVLNAE
FT                   VRGVVAPEVDIDAPGGKSGNFDPSGVAATFGVRLFFN"
FT   gene            complement(56321..56974)
FT                   /gene="elbB"
FT                   /locus_tag="KN400_0049"
FT   CDS_pept        complement(56321..56974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="elbB"
FT                   /locus_tag="KN400_0049"
FT                   /product="isoprenoid biosynthesis amidotransferase-like
FT                   protein ElbB"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82912"
FT                   /protein_id="ADI82912.1"
FT                   /translation="MKKIGVVLSGCGVYDGSEIHEAVLTLLAIDRNGAEAVCMAPSMEF
FT                   REVNHLTSQETGATRNALVEAARIARGKIRDVKDVSAVELDAVIFPGGYGAAKNLCTFA
FT                   EKGAAATINPEVARLIREMAVAKKPIGAICIAPALIAATLGRDYKPKVTIGTDAGTAAA
FT                   ITETGSEHVSCPVAEFVVDRENKIVTTPAYMLANRISEAAEGIEKAVKAVVEMA"
FT   gene            complement(57047..57964)
FT                   /locus_tag="KN400_0050"
FT   CDS_pept        complement(57047..57964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0050"
FT                   /product="SDR_a2 family oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82913"
FT                   /protein_id="ADI82913.1"
FT                   /translation="MNPGEGIVLVTGATGFIGKRLVSALLAGGHRVRCLVRRPDAPLPD
FT                   GAERVVGDILTREGLDAALAGIDTAFYLVHSMAGGRAGFERRDREAAEHFVAAGNRAGL
FT                   RRAIYLGGLGETGDHLSEHLASRLEVAAILRRGSFRTTFLRAAIIIGAGGASFEMIRAL
FT                   VERLPVMITPRWVSTRCQPIAVGDVISYLTGCLEDERTTGETFDIGGPDILTYREMMER
FT                   LAGVEKTFTMILSVPVLTPRLSSYWVGLVTPVRPSIAIPLIEGLKNEVVCRENRIRDFI
FT                   PFPLTTYERAVTIALAEDKGNDYN"
FT   gene            58076..58675
FT                   /locus_tag="KN400_0051"
FT   CDS_pept        58076..58675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82914"
FT                   /protein_id="ADI82914.1"
FT                   /translation="MRKTEGPFTREIACQQILMEDSSVFSVQWTTVPSDLRPRLSAEFL
FT                   LERYLAYIRRFTLTLIRPMVAADGIAFRLAGTRRSLILFTPPARREGPGHESLSLRICG
FT                   GFLVQGRQCDRGELSFMLDDDVSGVRLTLRLTDYCPLLLGSSEPSRLRKWLYRFTQAYI
FT                   HKVVTVRFLARVYADLAGGGGCVRVVRARVREGEDL"
FT   gene            58757..58954
FT                   /locus_tag="KN400_0052"
FT   CDS_pept        58757..58954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82915"
FT                   /protein_id="ADI82915.1"
FT                   /translation="MKEQDRTAVCNRTEHKEENVRVRNVKTGEIGFTFGCTEEGGTIQV
FT                   RLTNGQLDSWVAADCEEAPE"
FT   gene            58964..59305
FT                   /locus_tag="KN400_0053"
FT   CDS_pept        58964..59305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0053"
FT                   /product="PilZ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82916"
FT                   /protein_id="ADI82916.1"
FT                   /translation="MEGRKSKRLSVEVGCWLVEMDGATCLYTFDLSDEGVAVITEDPLP
FT                   VGRSVILQFFTPRSASAVTLKAQVVWSRLEPEGAMGLRFVEMDVRGRETLREFMRLLLE
FT                   QRQRERPVR"
FT   gene            complement(59324..59914)
FT                   /locus_tag="KN400_0054"
FT   CDS_pept        complement(59324..59914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0054"
FT                   /product="helix-turn-helix transcriptional regulator with
FT                   cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82917"
FT                   /protein_id="ADI82917.1"
FT                   /translation="MDDIKSQIKELRLGAKIRKLRQDRRLTLQELSELSGLSKPLLSQI
FT                   ENDQVTPPIATLLKISKGLKVGIHYFFEEEEDQQKVVLTRAAQQQPTRRRSGNDAPHGY
FT                   IYRSLAPGIRHKPMEPFLVEFELTDWSDSFFYRHDGFEFIYLLDGELEFHYGSDVMRLL
FT                   PGDSIYYDSSEPHGYVSVGEERARAVAVLYTRD"
FT   gene            60096..61502
FT                   /gene="degQ"
FT                   /locus_tag="KN400_0055"
FT   CDS_pept        60096..61502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degQ"
FT                   /locus_tag="KN400_0055"
FT                   /product="periplasmic trypsin-like serine protease
FT                   lipoprotein DegQ"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82918"
FT                   /protein_id="ADI82918.1"
FT                   /translation="MFVRRLLLISLVFVTTLTACSKKEEKLFYESGRADAPVKEVPRDI
FT                   LATQQAFVELVKKVTPSVVNISTVSRRKIEQPFFEFSPFFNDFFDNRPRFRREQSLGSG
FT                   FIINREGYIVTNDHVVRDAESIKVKLSNENVYDGHIVGSDPKTDIAVIKIDSREELPVA
FT                   VLADSDKLQVGQWAVAIGNPFGLDRTVTVGVVSATGRSNMGIETYEDFIQTDASINPGN
FT                   SGGPLLNVHGEVIGINTAIVAAGQGIGFAIPVNMAKQIVTQLITKGKVTRGWLGVTIQP
FT                   VTDDLAKEFGLKKAQGVLVSDVVKGSPAAGAGIRQGDIILRFAGKEIKDAQHLQRVVGD
FT                   TAPGTKVPVVVFREGKEVQLSLATASSDSAQARPQGGAPDTLGLAVEELPREYRQEGFT
FT                   GVLVVQVDDGSAAGEAGIREGDVIVAVNRRPVANLAEYDRVMREAARRGSVVLLVRRGE
FT                   ASIYFSLRLR"
FT   gene            61546..61809
FT                   /locus_tag="KN400_0056"
FT   CDS_pept        61546..61809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82919"
FT                   /protein_id="ADI82919.2"
FT                   /translation="MTMIDNPDQARRLARAIISDIAIYNREKVEQGIKNDTIFDLLAEE
FT                   IEEGRQHFASRVAPELAGAGIFDLALVDVLIKRAGKIESAIW"
FT   gene            61894..62862
FT                   /gene="rluD"
FT                   /locus_tag="KN400_0057"
FT   CDS_pept        61894..62862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluD"
FT                   /locus_tag="KN400_0057"
FT                   /product="23S rRNA pseudouridines 1911, 1915, 1917
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82920"
FT                   /protein_id="ADI82920.1"
FT                   /translation="MERQDERYDLSVPTEGEAERLDQFVARSVQGITRSAAQRLIEEGR
FT                   VTVDDRLEKPSLKLRGGERVVVTVPPPAPAVPEAEEIPLVVLHEDGDVVVVDKPAGMVV
FT                   HPAAGNPGGTLVNALLAHCTDLSGIGGEIRPGIVHRIDKDTSGVLVVAKSDRAHESLSR
FT                   QFHDHTVKRVYLALVYGSPREDKGRIEGAIGRHPTDRKKMSGAARHGKHAVTHWRVAAR
FT                   FTGVTLLRLRLETGRTHQIRVHMAEAGFPLVGDEVYGGAGRINNLRDPVLRKLIRELGR
FT                   QALHAKTLGFVHPVTGEYLEFDTELPEDMARIIDYLERQGA"
FT   gene            62865..63665
FT                   /locus_tag="KN400_0058"
FT   CDS_pept        62865..63665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0058"
FT                   /product="laccase family multicopper oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82921"
FT                   /protein_id="ADI82921.1"
FT                   /translation="MEMKRADKVHYVEPSLLAAAGVAVQGFTTRHEGVSRTPYNSLNLG
FT                   TGTADASHSVEGNRSILARAFGGTVERLVTVTQVHGTDLLVIDAPNPDYGYFQRLEADG
FT                   IITNQPGVMIGVCVADCVPVLLLDPVKGVAAALHAGWKGTASGICRKGVDAFVSVFGSD
FT                   PRDILAAVGPAIGPCCYEVDTPVFQAFRQAGCEWDEVATLSGVARWHLDLARANARQLA
FT                   ASGIAERNIETSGQCVCCSPEQFFSYRRDKGDTGRQMGFIMLKG"
FT   gene            63679..64854
FT                   /locus_tag="KN400_0059"
FT   CDS_pept        63679..64854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0059"
FT                   /product="amino acid aminotransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82922"
FT                   /protein_id="ADI82922.1"
FT                   /translation="MKFPISDQIRSVQCAPIAEVKSWLAHREPDPERPLVDLCQAVPDY
FT                   PPARQLTDYLAALLDDPLVSKYSPDEGLPEVREGVCARYGRVYGAAMNPDQLCLTIGAS
FT                   QAFWLAMVTLCRAGDEVIVPLPAYFDHPMALDILGVRPVYLPFDEERGGVPDPAAVERL
FT                   ITPRTRAILLVTPSNPTGVVTPPETIQELHGVARRRGIALVLDETYADFIPGGERPHDL
FT                   FLDPRWGDHLIHLMSFGKTYALTGYRAGCLAASKEFIGHALKAQDTMAVCQPRITQYAV
FT                   LYGVSHLDGWVEENRLMMTRRHDLFRSLFTRPGNPFSLVASGTFFAWVRHPLQEGTGRE
FT                   AARRLAVEAGIICLPGEVFGPGLEPYLRLAFGNIRDEAIPGAVERFRAFAL"
FT   gene            complement(64953..65795)
FT                   /gene="hdrF"
FT                   /locus_tag="KN400_0060"
FT   CDS_pept        complement(64953..65795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrF"
FT                   /locus_tag="KN400_0060"
FT                   /product="heterodisulfide oxidoreductase, NAD(P)H
FT                   oxidoreductase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82923"
FT                   /protein_id="ADI82923.1"
FT                   /translation="MCDHKNIYLPHLATIEEIVDETPDIRTFRLVFQDERVREHFTFRA
FT                   GQFAEYSAFGAGEATFCIASAPTRQGYIECCFRAVGRVTEALRSLETGDTIGVRGPYGN
FT                   SFPVEEFFGKNLVFVAGGIALPPLRTLIWQCLDWREKFGDITIVYGARTEADLVYKREL
FT                   REWEERSDVRLVKTVDPGGNSPSWDGQVGFVPTVLEQAAPAADNTIALVCGPPVMIKFT
FT                   LPVLEKLGFADTAIYTTLENRMKCGLGKCGRCNVGNVYVCKDGPVFTAAQVKAMPQEF"
FT   gene            complement(65808..66176)
FT                   /locus_tag="KN400_0061"
FT   CDS_pept        complement(65808..66176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82924"
FT                   /protein_id="ADI82924.1"
FT                   /translation="MERFINIDRVVAVQMTTPEDNPLVTDASRIMDVWFDGPAIRKQLF
FT                   KKVSRTEQEQFAANLLKRGFVQSGNLLINPRAVLFAEMENHLLGGVITIGFGDNNRPVE
FT                   LKVKGQAFSDLAAKLAEG"
FT   gene            complement(66188..67192)
FT                   /gene="hdrE"
FT                   /locus_tag="KN400_0062"
FT   CDS_pept        complement(66188..67192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrE"
FT                   /locus_tag="KN400_0062"
FT                   /product="heterodisulfide oxidoreductase, iron-sulfur
FT                   cluster-binding subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82925"
FT                   /protein_id="ADI82925.1"
FT                   /translation="MPKIITDQNLRLLIDTLVGEGKRVIGPKAAGTLTLYEPLASAEEL
FT                   SLGELPRRSAKETFFPLCENILTYEKSSSGTTVHDIDPARFPETVLIGARPCDVAAAPV
FT                   LDAIFSWDFKDEFFLERRRKTTIIGLACTTADDACFCTAVGLSPADTRGSDLFLTPLAG
FT                   GSYRCDVISDKGEALLAAHAGLFAETDTAEPVSLAEPQLGPLDLDRIKAWLDTHFEDPL
FT                   WEEIAARCAGCGACAFLCPACHCFDISDEGSEKQGARRKHWDACGFGKFTYHASGHNPR
FT                   EVQPHRYRNRIMHKFKYYHDKFGQRLCTGCGRCIRACPVGIDIAQIIDDINRK"
FT   gene            complement(67236..68165)
FT                   /gene="hdrD"
FT                   /locus_tag="KN400_0063"
FT   CDS_pept        complement(67236..68165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrD"
FT                   /locus_tag="KN400_0063"
FT                   /product="heterodisulfide oxidoreductase, iron-sulfur
FT                   cluster-binding subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82926"
FT                   /protein_id="ADI82926.1"
FT                   /translation="MTNTAHTIDTALYDAVTDALRAEAKKVLESGTAAAVIGWQAGRRR
FT                   GSAVPAIVTDPADAEKLIFSPSCVNNLALYLTKAKKEVREKGKLAVVAKGCDMKALAGL
FT                   MGENQLKRDDVYIIGVACAGVYGPAIRGNAPLDDGTLARKCRECAAELPEGADVSLGTV
FT                   PRRPAFTPHEAAELARLEAMTPAERWAFWKEHFSRCIRCYACRQVCPFCYCEQCLCDRN
FT                   RPQAVETTPRPAGNMAWHMVRAMHLAGRCAGCAECERACPMDIPLNLLNRKMAKELKEL
FT                   YGHEAGFQAKEKGPLAEYREDDNQSFIK"
FT   gene            complement(68199..68699)
FT                   /gene="hdrG"
FT                   /locus_tag="KN400_0064"
FT   CDS_pept        complement(68199..68699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrG"
FT                   /locus_tag="KN400_0064"
FT                   /product="heterodisulfide oxidoreductase, iron-sulfur
FT                   cluster-binding subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82927"
FT                   /protein_id="ADI82927.1"
FT                   /translation="MHIHKEKHAFEPKIVAFVCTWCTYAGADLAGTSRMHYPANVRVVK
FT                   FPCTGRIDPVFILRAFQKGADGILVSGCHPGDCHYMAGNFHARRRFAVFRQLLDFIGVD
FT                   LQRLQFSWVSAAEGGKWVEVVTELTERVRAQGPMPEFKELEAEEHWSGAIDTPELNVAY
FT                   NDI"
FT   gene            complement(68699..70696)
FT                   /gene="hdrA"
FT                   /locus_tag="KN400_0065"
FT   CDS_pept        complement(68699..70696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrA"
FT                   /locus_tag="KN400_0065"
FT                   /product="heterodisulfide oxidoreductase, FAD-binding and
FT                   iron-sulfur cluster-binding subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82928"
FT                   /protein_id="ADI82928.1"
FT                   /translation="MSRIGVFVCHCGENISRTVDVERVAGELAKVPGVAFATDYKYMCS
FT                   DPGQGLLKKAVAEHRLDGVVVAACSPRMHEKTFRTAAKAAGLNPFLCEMANIREHCSWV
FT                   HEDRDEATAKAISIVEMMVARVKKDRRLVPITVPVTKRALVIGGGIAGIQAALDIADAG
FT                   HKVVLVEREPSIGGHMAQLSETFPTLDCSQCIMTPKMVDVANHPNITLHTYSEIESVDG
FT                   YIGNFQVTIRKKARSVDESKCTGCGVCMAKCPQKKIPNSFDKNLGMRPAIYVPFPQAVP
FT                   NTPVIDRENCTYFKSGKCGVCAKVCGPRAVDYEQQDQLIVEPAGAIVVATGFSLYDIGP
FT                   KPAGSPIEGYGEFGYGTIPDVIDGLTFERLASASGPTGGKIVRPSDGKEPKQVVFVQCV
FT                   GSRAREKGISYCSKICCMYTAKHTMLYKHKVHDGQAYVFFMDARTPGKNYDEFWRRAIE
FT                   EEEAVYIRGMVSRLYQKGDKVVVMGSDVHVGVQVEIEADLVVLATAVQAREGADSLAQK
FT                   LGISYDNYNFYSEAHAKLKPVECATAGVYLAGACQGPKDIPDTVSQASAAAAKVMTLFA
FT                   RDELEREPIVAKVDERRCVACLYCKKICPYGAVEEKEIRDRQGNLIRVVAYVNPGVCGG
FT                   CGTCQATCPSKSVELDGYTDEQIMAMIEVL"
FT   gene            complement(70697..71587)
FT                   /gene="hdrB"
FT                   /locus_tag="KN400_0066"
FT   CDS_pept        complement(70697..71587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrB"
FT                   /locus_tag="KN400_0066"
FT                   /product="heterodisulfide oxidoreductase, CCG domain
FT                   pair-containing subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82929"
FT                   /protein_id="ADI82929.1"
FT                   /translation="MTPAKNLLNYSYYPGCSLHASAKEYDESTRGLFRALKIGLHEVPD
FT                   WLCCGATPAHNVDELLSLSLCAKNLSLAEEVGGDLAVACAACFSRLKVTQHRLADNEEK
FT                   RRQVEYAIDGKVSFDNKVKHLLEILAKDFGLDRLTAAVRKPLEGLKVACYYGCLLTRPP
FT                   EVPELDDCEAPTIMERVIGAAGAETVTWSHRMECCGANFTLSRPGVVLKLSGDILASAK
FT                   AAGANCILVACPLCHGNLDIRQKEIEEASGQWFGMPVFYMTQLLALAVGVAPAKLGFDS
FT                   MIVNPLPLLKEKGLV"
FT   gene            complement(71584..72168)
FT                   /gene="hdrC"
FT                   /locus_tag="KN400_0067"
FT   CDS_pept        complement(71584..72168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrC"
FT                   /locus_tag="KN400_0067"
FT                   /product="heterodisulfide oxidoreductase, iron-sulfur
FT                   cluster-binding subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82930"
FT                   /protein_id="ADI82930.1"
FT                   /translation="MKHSKMRLSTETMNLGFVRKVEALSGSSVRRCFQCGKCSAGCPMR
FT                   SFMEHPPNRIVRFLQLGQYERVLAGRSIWYCASCETCTTRCPNKVDLAAIMDALRKCSW
FT                   DAKGPSKESLVQLANRLFIENIRTYGRQYEMRLAAVFNVKSGQFLKDLMLGPKLITKGK
FT                   LRMFHQKNRNIAEIENIFARIEALRKKGEAP"
FT   misc_feature    complement(72382..72449)
FT                   /note="conserved nucleotide sequence; KN400_R0107"
FT   gene            72820..74592
FT                   /locus_tag="KN400_0069"
FT   CDS_pept        72820..74592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0069"
FT                   /product="ABC transporter, ATP-binding/membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82932"
FT                   /protein_id="ADI82932.2"
FT                   /translation="MRPCWRTYLLGALCLVGTNGCALLIPWLLKLAVEGLRSPGQATRS
FT                   PDWYGGVIIGAALVQGVIRIFSRTKLLHAARRIEFAIREDLFAKLLSLDMPYFSGERTG
FT                   DLMSRFANDLTNIRMLLGFGVLNVINTVVIYGAALVLMANIDVTLTVLAVAPFPLMILV
FT                   VKGLTRRMYHCSRRAQEELAKLSSQAEENVSAAVVVRAYRREAAAVNAFRRASLDYFAS
FT                   NMAMARLRGLMLPLMAATSALGTLVVLFVGGSRVIEGILTLGDFVAFSGYLAMLVWPTV
FT                   IFGWILNLIQRGGASMARLNEIFDARSLVADPEAPAPIAAIRGEIELRGLRFSYNGGEV
FT                   LRGVSLRVQAGKRVGIVGGVGSGKTTLVRLLARLYPVGDGQLFIDGTDINQIPLEVLRR
FT                   GVGFVPQESFLFSRTIGENIACGRDGATEHEVMEAARLASLDGDLARFPRGLATVVGER
FT                   GVTLSGGQRQRVAIARALLRNPSVLVLDDPLSAVDARTEEEILRSLAGYYGDRTVVIIS
FT                   HRLSAVRTCDVIVLLKDGVIAEQGSHDELVARGGAYAALWHEQQLRDEIAGFREDGVEK
FT                   EGEKGALQTENAVL"
FT   gene            74604..74691
FT                   /locus_tag="KN400_R0005"
FT   tRNA            74604..74691
FT                   /locus_tag="KN400_R0005"
FT                   /product="tRNA-Ser"
FT   gene            74784..74885
FT                   /gene="ffs"
FT                   /locus_tag="KN400_R0055"
FT   ncRNA           74784..74885
FT                   /gene="ffs"
FT                   /locus_tag="KN400_R0055"
FT                   /product="signal recognition particle, RNA component"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            74963..76702
FT                   /gene="dnaX"
FT                   /locus_tag="KN400_0070"
FT   CDS_pept        74963..76702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="KN400_0070"
FT                   /product="DNA polymerase III, gamma and tau subunits"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82933"
FT                   /protein_id="ADI82933.1"
FT                   /translation="MSYLVLARKWRPQTFSDLTGQEHVSRTLQNAIDSGRIAHAFLFTG
FT                   ARGVGKTSSARILAKALNCEQGMSPEPCNVCPACTEITAGTSVDVLEIDGASNTGVDDI
FT                   RELRENVKYLPSRLRYKIFIIDEVHMLSTNAFNALLKTLEEPPPHVKFIFATTEPHKLP
FT                   ITILSRCQRFDFRRIPLAKVVARLRYIVDREGISISDESLAVVARKGDGSMRDSLSVLD
FT                   QVLAFCGETVNDDDVVSLLGVVDRRLLLEASAAVLGRDTRSVLGVVARVDEFGYNMRQF
FT                   CGELIDHFRNLTIMRAVGDAGDLLDLSEAELQSVREQASSALLEDLQRHMTILLRADGE
FT                   LAHSGYPRLVLEMALVRMATLAPLVPVGELLDRLGRIEERGSGVAADARASWRPSPPPE
FT                   AGVAPVPRPAPSALAEQRPRPVPAGAEAKPPPSRSDSPVQEPRRTGDEWADFVAFVKGA
FT                   KPRIGTSLEYGSPLHIAADRLEIGFPENSFALSSLRDGDAQASLKALAERFFSAPMTVA
FT                   LKVLTGEGHAPPNLLEKKRAEDEQRRTGLKRSAESHPAVSSALEVFDGTLAEVAPLGTR
FT                   GKL"
FT   gene            76773..77087
FT                   /locus_tag="KN400_0071"
FT   CDS_pept        76773..77087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0071"
FT                   /product="DNA-binding protein, YbaB/EbfC family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82934"
FT                   /protein_id="ADI82934.2"
FT                   /translation="MSKGLAGIMKQAQMMQQKMAKLQEEAANRTAEATAGGGAVTAVVS
FT                   GKNQIVSLAIKPEAVDPEDVEMLQDLVVTAVNEALKKVQSQFAEEMSKVTGGLNIPGLF
FT                   "
FT   gene            77276..77869
FT                   /gene="recR"
FT                   /locus_tag="KN400_0072"
FT   CDS_pept        77276..77869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="KN400_0072"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82935"
FT                   /protein_id="ADI82935.1"
FT                   /translation="MVHFSDSLSRLLAELQKLPGVGEKTALRLAFHLLKSPDNAAALAD
FT                   SLRDVMSRVRFCSVCFGITEDDPCRFCSDARDDGAICVVEEPQDLLAVERTRAFRGRYH
FT                   VLQGALSPLNGVTPDRLRVAELMKRLEGGGVREVVIATNFTVEGEATALYLARMIKPLG
FT                   VRVTRLAHGIPLGSDLEFVDAATVQRALEGRSEL"
FT   gene            77934..81521
FT                   /gene="por"
FT                   /locus_tag="KN400_0073"
FT   CDS_pept        77934..81521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="por"
FT                   /locus_tag="KN400_0073"
FT                   /product="pyruvate:ferredoxin/flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82936"
FT                   /protein_id="ADI82936.1"
FT                   /translation="MSRKMVTIDGNTAAAHVAHATNEVIAIYPITPSSVMGEISDIKSA
FT                   MGEKNIWGTVPSVVEMQSEGGAAGAVHGALQAGALTTTFTASQGLLLMIPNMFKIAGEL
FT                   TSTVFHVSARAIAAQALSIFGDHSDVMSCRSTGWAMLCSNNSQEVMDFALIAQSATLRS
FT                   RVPFLHFFDGFRTSHEVLKVEELTFDDMRAMLDDELIAAHKARGLSPDHPVMRGTAQNP
FT                   DVYFQGRETVNPFYPKCIEIVAEEMDKFAKITGRQYKLVDYVGAPDADRVIVIMGSGAD
FT                   TVQETVEHLNTKGEKIGVVKVHLYRPFPIDAFIAALPKTVKKIAVLDRTKEPGALGEPL
FT                   YLDVRTAIGEAMADGKCQFDGYPVIVGGRYGLGSKEFTPAQAKAVFDNLATAKPQNKFV
FT                   VGITEDVTNSSLPCDPSFFNPMEGAYQAMFFGLGSDGTVGANKNSIKIIGEMTDNNAQA
FT                   YFVYDSKKAGSMTTSHLRFGKKYIRAPYLVQEADFVACHNFAFVEKYDMLAKAKQGATF
FT                   LLNAPYDHNEVWDRLPADMQQQIIDKKLKFFVIDGVRLGNEIGLGPRINVIMQTAFFKI
FT                   SNIIPLDQAIDEIKDAIKKTYGKAGEKVVEMNYKAVEAGLNNFYEVTVPATATSTLQKP
FT                   PVVSARAPQFVQETTAPIIAGLGDDLPVSKMPADGTFPTATSQFEKRNIAVEIPVWDEQ
FT                   LCIQCGICSFVCPHATIRMKAYDASALAGAPAAFKSVDCKIPEFKGQKFTIQVAPEDCT
FT                   GCGACVHNCPAKSKEDPNHKAINMAYQPPLRSQEVENWDFFLTIPDVDPTVAKLDTVRG
FT                   SQLVRPLFEFSGACLGCGETPYLKLLTQLFGDRTVIANATGCSSIYGGNLPTTPYAQRA
FT                   DGLGPAWSNSLFEDNAEFGYGMRLAVDKFNAMALELVDKLSSSCSCSSCTSAVPLMNEI
FT                   KGADQSSQAGIEAQRARVAELKKTLASCPEPDAKRLLTVADYLVKKSVWCIGGDGWAYD
FT                   IGYGGLDHVIASGKNINLLVLDTEVYSNTGGQASKSTPLGAVAQFAAGGKPVSKKDLGM
FT                   MAMAYGSVYVATVSLANPAQCIKAFLEAEAYDGPSLIIAYAHCIAHGIDMTSGVDAQKR
FT                   AVQSGYWPLYRYNPQLAAECKNPLQLDSKAPTIAFEEYVNSENRYRVLKKNNPKGYEDL
FT                   MRKAAAWSKAHFSYYQKLAALNFEDTCEK"
FT   misc_feature    81729..81751
FT                   /note="conserved nucleotide sequence; KN400_R0108"
FT   gene            81788..82279
FT                   /gene="mglB"
FT                   /locus_tag="KN400_0074"
FT   CDS_pept        81788..82279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mglB"
FT                   /locus_tag="KN400_0074"
FT                   /product="cell polarity determinant GTPase-activating
FT                   protein MglB"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82937"
FT                   /protein_id="ADI82937.1"
FT                   /translation="MSYPQMVMYDEEFKLINAVIEKLLREANAKVIFLVDKNGQLISGV
FT                   GETERFDTTSLASLTAGNIAATGGLAKLIGEKEFSILFHEGEKDNLHISIVGGRVILVV
FT                   LFDNRSSLGLVRLRVKKASDELTTVFDRLMKKAEEKERSGIQEFPFAEITDDDIDNLFS
FT                   "
FT   gene            82298..82885
FT                   /gene="mglA"
FT                   /locus_tag="KN400_0075"
FT   CDS_pept        82298..82885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mglA"
FT                   /locus_tag="KN400_0075"
FT                   /product="cell polarity determinant GTPase MglA"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82938"
FT                   /protein_id="ADI82938.1"
FT                   /translation="MSFINYASREINCKIVYYGPGLCGKTTNLQYVYQKTAPEAKGKMI
FT                   SLATETERTLFFDFLPLALGEIRGFKTRFHLYTVPGQVFYDASRKLILKGVDGVVFVAD
FT                   SQEERMDANIESLENLAVNLKEQGYDLEKIPFVIQYNKRDLPGIVPVEELRRELNHRNV
FT                   PDFEACAATGEGVFETLKAVAKLILIDLKKGR"
FT   gene            83036..84814
FT                   /locus_tag="KN400_0076"
FT   CDS_pept        83036..84814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0076"
FT                   /product="ABC transporter, ATP-binding/membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82939"
FT                   /protein_id="ADI82939.1"
FT                   /translation="MHYGSAYEDEIVGKAYDRGLMLRFIRYVHPYRWLALAALVLLPLS
FT                   AAARLAQPLVLKAAIDDHIVTGRLEGLPLVAAGFLLLIVAESLITFLEVWLLQYLGQRV
FT                   MLDLRLELFAHVQRLPVSFFDRTATGGLVTRLTSDVEVLGEMFAAGIITVVGDILFLAG
FT                   IVGVMLWLNPPLSLITFSVLPLLVWVAFTFRIRMRKAFREVRARLANLNTFLAETIGGM
FT                   SVIQLFNRQAGERAEFSRLNGSYRDANLPVITWDASLYALVETLSSVAVGLIIWYGGGE
FT                   VLRGALTFGALVAFIQYIEKFFGPIRDLSAKYSIMQGAMAALERIFGLLDTAPDHDAGV
FT                   SGPAVSAGAPPIETIRFRNVWFAYQEDDYVLRGIDLTIRRGETVALVGETGGGKTTVTR
FT                   LLSRFYDVNRGDILFNGDDVRSIPLSELRRRIGVVLQDPYLFTGTVGFNIHLGDERARA
FT                   RMDDAARLVGADRFIRLLPGGYDEQVRERGSNLSAGERQLISFARAVAFDPEILVLDEA
FT                   TASIDTESERLIQDGLAALMAGRTSIVVAHRLSTVQGADRIVVIHRGEKVEEGTHGELL
FT                   AQGGIYARLYQLQFRD"
FT   gene            84845..86755
FT                   /gene="selB"
FT                   /locus_tag="KN400_0077"
FT   CDS_pept        84845..86755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selB"
FT                   /locus_tag="KN400_0077"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82940"
FT                   /protein_id="ADI82940.1"
FT                   /translation="MKHLILGTAGHIDHGKTSLVRALTGIDTDRLPEEKARGITIELGF
FT                   AHLELPGGLQFGIVDVPGHERFVRTMVAGVGGMDLVMLVIAADEGVMPQTREHLEICQL
FT                   LGVKKGLVALTKSDMVDPDWLELVVEEVRDYLAGSFLEEAPIVPVSSRTGAGIEAVKAE
FT                   LARLAGQVDEKKTEGPFRLPVDRVFTVTGFGTVVTGTLLSGAISVGDEVELLPSGLSAR
FT                   VRGVQTHGRRGDAASAGQRVAVNLQGVEHTEVGRGDIVVPRGVYRTTRAVDARLDYLPS
FT                   APRELRHRSTLRLHSATYEVPAQVILLDRDVLAPGDSTFVQLRLRHPVLLLPGDPFVLR
FT                   SYSPQATLGGGKVLDPMPPRRRRRSDEALALLEALGERSESDTVRLLVSGSLLTGICFE
FT                   DIVVRGGLSARRAEATMATLLSSGEVVQMVREPRIFLSRASFVSLKGGLLSEVEGYLRD
FT                   NPLREGLGKEELKTRLPRRSDPRFFTPLLTSLEKEGKIVVDRDLVKLPGRKGTITVDQA
FT                   DLQVRLEKALQRGGYEPPTIKEMCDSLRCAEKMLLEHLNILAREERAVKVKSDIFYAPE
FT                   PVADIREKLMAYLREKGEIMPPEFRELTGLSRKFMIPLLEFFDQEKITIRVGDKRVLRR
FT                   G"
FT   gene            86903..89014
FT                   /locus_tag="KN400_0078"
FT   CDS_pept        86903..89014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0078"
FT                   /product="sensor histidine kinase"
FT                   /note="domains: HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82941"
FT                   /protein_id="ADI82941.1"
FT                   /translation="MDNALTLQPLERIVTEHEGWLAARALGYAKSCGYTRYTSTLEEAW
FT                   RISIAGLSASLIHALRAKEPIPELSPDYDSVADPVTLFGIEEARRHRMRGVTLGMFLGL
FT                   MKYYRRSYQDLVRGSGVDEKTLESGRLFIDRFFDRVEIGFTTEWSSVSDPQRLAELEEA
FT                   NRSITNEKNRLLTLFESIPSPVMLLGADGRPVLMNHAAVELFAGPTPPGTHYYRESGSP
FT                   GLEVAVPRWSRLKRFLKGKAREARFEESIDTAAGCRYFLVTVQRMLDVSEKFCGTTIIL
FT                   SDFTGRKLAEDELQHLVAEMEDRIRSRTAELLDANTRLLEEIEERRRSERFFHATIDSL
FT                   TAPVAILNGEGDIVTVNRAWRKFADENGGLHPNHFIGYNYLGLCDNVKGDDAVTASAVA
FT                   RGIRELIAGRINEFHVDYPCHSPDEQRWFQVRVTRLENGSRGRVAVVHENISEVKKAQE
FT                   EILSLNRSLEERIRHRTQQLECSNRELEGFCYAVSHDLRSHLARLEGLGRGLLEDCFAG
FT                   LDNQARHYAERICRISMDLRRAIDSLLDLSRLARCELSNVTVDLSGVAERVAEELHQLQ
FT                   PLRRVSFSLEPGVIVRGDPQLLETVMRHLMGNAWKFTSRREDAEIAFGSTMLHGMKTCF
FT                   VRDNGVGFDMRYAGTLFQPFQRLHGPAEFDGAGIGLATVQRIIQRHGGRIWAEGESGKG
FT                   AVFFFVFPD"
FT   gene            89032..89421
FT                   /locus_tag="KN400_0079"
FT   CDS_pept        89032..89421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0079"
FT                   /product="response regulator, putative"
FT                   /note="domains: REC"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82942"
FT                   /protein_id="ADI82942.1"
FT                   /translation="MDTKTILLVEDNPDDEFLALRALRRHGLQDVVVARDGEQAVGQLF
FT                   EAAPPLDPWLVLLDLKLPKMNGLEVLRTIRSEERTRHTPVIVISSSQEETDVVKCRELG
FT                   VLAYLTKPIDGEKIMALLATAGLSF"
FT   gene            complement(89482..89763)
FT                   /locus_tag="KN400_0080"
FT   CDS_pept        complement(89482..89763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0080"
FT                   /product="cytochrome c, 3 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82943"
FT                   /protein_id="ADI82943.1"
FT                   /translation="MNMHLVLAMAMVWFLAGDISLAGAFECNVCHSKNPAMVKMHEAVR
FT                   GRGCFGCHKVGERLMGKGQPKDKASLMERRVKDAACLECHKVKPQAGE"
FT   gene            89951..90724
FT                   /locus_tag="KN400_0081"
FT   CDS_pept        89951..90724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0081"
FT                   /product="chromosome partitioning ATPase Soj"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82944"
FT                   /protein_id="ADI82944.1"
FT                   /translation="MAKIICIANQKGGVGKTTTAVNLAASLAAAEKQTLLVDMDPQGNA
FT                   GSGVGVDKAGLEESVYDAIINDVDPSGLIVGTDLAHLDLLPSTTDLAGAELELVSMPER
FT                   ERRLKAALARLSQRYDYIIIDCPPSLGLLTVNAMTAADSVLIPLQCEYYAMEGLSQIIK
FT                   TIKLVQKGLNPGLAIEGIVLTMYDGRNNLSRQVSEEIRGHFADIAFQTVIPRNVRLSEA
FT                   PSHGRPVILYDITSRGAVSYMELARELMTREVRRG"
FT   gene            90717..91556
FT                   /locus_tag="KN400_0082"
FT   CDS_pept        90717..91556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0082"
FT                   /product="ParB-like nuclease domain protein, putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82945"
FT                   /protein_id="ADI82945.1"
FT                   /translation="MVKKTGLGKGMAALLPVVEEEGKRYFSCPIEDIRPHKNQPRKTFV
FT                   PEKLEELAASIREKGIIQPLVVRKKGDHYELIAGERRWRAAQKAGLREVPVVIQDVSED
FT                   TALEMALIENIQREDLNAVEEAEAYHALMENFGLTQEELAKRVGKDRSTIANSLRLLKL
FT                   PVELKRDIVEERLAMGHARAVLALDSDAQIKEARDAIIKGNLTVREAEGLVKRLKAGAR
FT                   TGAKAKTADVHSADLVEQLQRRLMTRVVIRRGGRGGKIEIAFGNQEELSRIVDMLIA"
FT   misc_feature    91685..91708
FT                   /note="conserved nucleotide sequence; KN400_R0109"
FT   gene            91735..92160
FT                   /gene="atpX"
FT                   /locus_tag="KN400_0083"
FT   CDS_pept        91735..92160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpX"
FT                   /locus_tag="KN400_0083"
FT                   /product="ATP synthase F0, B' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82946"
FT                   /protein_id="ADI82946.1"
FT                   /translation="MISLDLAFVIQVINFLVLMIILNVFLFKPIRKVIADRKAQIDGSR
FT                   ERAAVVDKEVQEKMALYEARLRDVKAKAGAEREVLRKEAQQEESAILEKARKEAADSLA
FT                   SIKSRVAKETVDAKEFLKEQSRPLSLEICQKVLGRSL"
FT   gene            92163..92783
FT                   /gene="atpF"
FT                   /locus_tag="KN400_0084"
FT   CDS_pept        92163..92783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="KN400_0084"
FT                   /product="ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82947"
FT                   /protein_id="ADI82947.1"
FT                   /translation="MAYAFKKNGLLKPFVSTAAICLLVAGTVVLCHASGGGEGAHHVDT
FT                   GKQMKDFMWRVIDFIALAGVIVWALKKANAKGALADRSANVEKALREAEEARTAAEKKF
FT                   AEYSEKLEKANQEIDGIYAAIRKEGELEKERIIAEARITAEKIREQATATATQEVLKAR
FT                   AELRDEAARLAVQMAEQALREAIKKDDQDRLVSEYLTKVENLH"
FT   gene            92780..93322
FT                   /gene="atpH"
FT                   /locus_tag="KN400_0085"
FT   CDS_pept        92780..93322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="KN400_0085"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82948"
FT                   /protein_id="ADI82948.1"
FT                   /translation="MISNAIARRYAKALVQLGAEEGAVDRFGVELGQFTALLDGNADLA
FT                   SVLKSPAYRIEAKREILRDVLAKLNLSGTVSNFLQVLLDRGRIGFTPQIAHSYAVFADE
FT                   LSGIVRPVLTSAFPLDDAQVEGMKSALAKATGKRVELSAQVDSALIGGVVTKIGDKVFD
FT                   GSVRTQLNRIQDILQKG"
FT   gene            93331..94842
FT                   /gene="atpA"
FT                   /locus_tag="KN400_0086"
FT   CDS_pept        93331..94842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="KN400_0086"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82949"
FT                   /protein_id="ADI82949.1"
FT                   /translation="MEIRAEEISEIIRKQIKEYGKEVEVAETGTIISVGDGIARIHGLD
FT                   KAMAGELLEFPGGVSGMVLNLEEDNVGAAILGEDNENIKEGTTVKRTGRIVEVPVGEAL
FT                   IGRVVNAIGQPIDGKGPINTTTFGKVEVKAPGIVKRKSVHQPMQTGLKAIDSMVPIGRG
FT                   QRELIIGDRQTGKTAVAIDTIINQKGGDLICIYVAIGQKRSTVAQVVSKLQEYGAMDYT
FT                   IVVSASASEPAPLQFIAPYTGVTMGEYFRDNGKHALIIYDDLSKQAVAYRQLSLLLRRP
FT                   PGREAYPGDVFYLHSRLLERAAKLSDDCGAGSLTALPIIETQAGDVSAYIPTNVISITD
FT                   GQIYLESDLFYSGVRPAINVGLSVSRVGGSAQVKAMKQVAGTLRLNLAQYREMAAFAQF
FT                   GSDLDKATQMQLARGERLVEILKQPQYRPIPNEKQVLVIFAANNGFVDEYPVSSLRRYE
FT                   SELYSFFDSRKADILAELRDKKAIDDDLKAKMIAALEELKKEFTA"
FT   gene            94864..95727
FT                   /gene="atpG"
FT                   /locus_tag="KN400_0087"
FT   CDS_pept        94864..95727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="KN400_0087"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82950"
FT                   /protein_id="ADI82950.1"
FT                   /translation="MASLKSIKKRIVSVKNTRQITKAMKMVSAAKLRRAQENVVAARPY
FT                   AKKLGEVLQRLAKSQDESGSPLMQQRLSQKALLIVVTSDRGLCGGFNANICKAAERFIK
FT                   EKKAEFAEISVTTVGRKGYEFLKNRQKIHKNYGNVLANLSYPAAALLAQEMIEGYIAEE
FT                   YDEVYILFNAFKSVMSQDITLEKLLPIAPEAASTEEYAPEYIYEPSKGELLAELLPKHI
FT                   EVQVFKALLESVASEHGARMTAMDSASKNATEMIGKLTLQYNRARQAAITTELMEIISG
FT                   AESIKG"
FT   gene            95785..97197
FT                   /gene="atpD"
FT                   /locus_tag="KN400_0088"
FT   CDS_pept        95785..97197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="KN400_0088"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82951"
FT                   /protein_id="ADI82951.1"
FT                   /translation="MSQNFGKISQVIGAVIDVEFEPGKLPPIYNALRVTNPAIDDKEYN
FT                   LVLEVAQHLGENAVRTIAMDSTDGLVRGQAVLDTGKQISVPVGRKTLGRILNVIGEPVD
FT                   EMGPVNAEKEYGIHREAPAFVDQSTKVEAFTTGIKVVDLLAPYARGGKIGLFGGAGVGK
FT                   TVLIMELINNIAKQHGGFSVFAGVGERTREGNDLWMEMKESGVLDKAALVYGQMNEPPG
FT                   ARARVALSALSIAEYFRDEEGQNVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLA
FT                   TEMGELQERITSTTKGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIY
FT                   PAVDPLDSTSRILDPQVIGEEHYSIARQVQYVLQKYKDLQDIIAILGMDELSEEDKLVV
FT                   ARARKIQRFLSQPFHVAEAFTGSPGKYVELKDTIKGFQEIVAGKHDDVPEQAFYMVGTI
FT                   EEALEKAKKLAA"
FT   gene            97258..97674
FT                   /gene="atpC"
FT                   /locus_tag="KN400_0089"
FT   CDS_pept        97258..97674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="KN400_0089"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82952"
FT                   /protein_id="ADI82952.1"
FT                   /translation="MAEKLKVDLVTPYKKILSEEVDEITATGALGEFSVLPGHAPFLTS
FT                   LKIGELTYKKSGQIVHLALNWGYFEVEDDKVTVLVETAERADEIDLERAKAALGRAEAA
FT                   LKKLSPEDKDYRVMEAALERALIRMQVAGKAARK"
FT   gene            97761..98780
FT                   /gene="pdxA"
FT                   /locus_tag="KN400_0090"
FT   CDS_pept        97761..98780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="KN400_0090"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82953"
FT                   /protein_id="ADI82953.2"
FT                   /translation="MQMKKPRIVITMGDPTGVGPEIIAKALADPAVRECCRHLVVGDEF
FT                   AMSRGIALTGTGFRIETSESVPFEEPADGVITLRKVTSLSAEDLCYGQPTIASGDAVFR
FT                   SICHAADLCLKGEADGMATAPINKGALNRAGHRYPGHTELLAELTGADRVVMMLAGARL
FT                   RVALVTIHEALVRVPALVTFEQVLETIRITHRDVHRYFTRNPRIAVLALNPHCGEGGMF
FT                   GDEESRIIAPAVQAARQEGIDATGPLSADTLFHFAVHGAYDAVVCMYHDQGLIPLKLLH
FT                   FDDGVNVTLGLPIIRTSVDHGTAYDLAGTGKASAESMKAAIMMAAAMAGSRREESGAP"
FT   gene            98777..99736
FT                   /locus_tag="KN400_0091"
FT   CDS_pept        98777..99736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0091"
FT                   /product="biosynthetic peptidoglycan transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82954"
FT                   /protein_id="ADI82954.1"
FT                   /translation="MRMKKLLYLAIGAVVAYGIYIAISLMFLPSVAELKNRRTTMTIQV
FT                   KDWHGEYHPFTVGPKNRYWTPSGSIPPEMKWAVILAEDANFYKHEGIDVKAIKNAIKYD
FT                   LEKKSFARGASTITQQVAKNLFLSREKTISRKIKEIVLAKRMEEELTKGRIIELYLNVV
FT                   ELGPMVYGIGHGARYYFGKPASALTPRECAFLAAMLPGPRVAYNPYKNLGKVLKRSDMI
FT                   LRLLRGKGVLSDDEYRQALAQTPNIAGLQRKVDASIEKEETTFENRTGATVPLEPQSTT
FT                   APDEQAPEEVPAASSQPAANGEPAAGDGGEQQSPPPAR"
FT   gene            complement(99851..101155)
FT                   /locus_tag="KN400_0092"
FT   CDS_pept        complement(99851..101155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0092"
FT                   /product="amino acid aminotransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82955"
FT                   /protein_id="ADI82955.1"
FT                   /translation="MRNELVTPGAGELTYEIRNIVNVAEKLQKHGVKINWENIGDPIVK
FT                   KEEIPRWMKEIVAAAVMENDTWGYCHTRGVLETREFLCGLTNNRGGAQITPDDIIFFNG
FT                   LGDAISTVYGNLRHESRILMPSPTYTTHSIGEAAHAQAAPVCYRLKPEDNWFPDVEDLE
FT                   NHVKYNPQISGILLINPDNPTGMVYPREILEQIVAIARRYDLFIIADEVYNNITYNGQT
FT                   TVPISDVIGEVPAIAMKGISKEIPWPGSRCGWIEVYNGNRDEQFHKFLNSILTAKMNEV
FT                   CSTTLPQKCIPAIMKHPEYQTYLRERIACYERMSTITYDCLKQVPGLMVNRTNGAFYMS
FT                   VAFRDGLLTDRQSLPIESVEVRELVEKLVNAPGVSPDKRFVYYILASTGICIVPLSSFN
FT                   TPLQGFRVTLLEKDENECMRIYRTLAERIKEYLNS"
FT   misc_feature    complement(101191..101396)
FT                   /note="conserved nucleotide sequence; KN400_R0110"
FT   gene            complement(101434..102039)
FT                   /locus_tag="KN400_0093"
FT   CDS_pept        complement(101434..102039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82956"
FT                   /protein_id="ADI82956.1"
FT                   /translation="MWFLRTGVLLWLLSTVAIGTVSAAPPPARPETGKGVLLVKNSLAH
FT                   DNAGGGSFVVIYREPGIGRIGELRVASLPALAGVVKTPPGVLALAVTATKGEWLRVHYD
FT                   DAGRSGWLEPRRTWTYLTWEEYLRGKTARLLRGLRKEFYLARSGPDGSAPELPPLTPER
FT                   SMRILDVDGDRARVLVDLSVMAWLRWRDPDGRLLITVE"
FT   gene            complement(102057..102407)
FT                   /locus_tag="KN400_0094"
FT   CDS_pept        complement(102057..102407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0094"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82957"
FT                   /protein_id="ADI82957.1"
FT                   /translation="MIEAMKNVVVFVRDLEAAKRFYSEQLKLPLAQAGMTMMEFFSGGT
FT                   TLGVAQALTPDALVFVGRHTGITFRVKDIDSFCKELVQAGVRFDQPLEQSPWGKMAVVS
FT                   DPDGNLFALVDR"
FT   gene            complement(102565..103035)
FT                   /gene="hyaP"
FT                   /locus_tag="KN400_0095"
FT   CDS_pept        complement(102565..103035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyaP"
FT                   /locus_tag="KN400_0095"
FT                   /product="periplasmically oriented, membrane-bound
FT                   [NiFe]-hydrogenase maturation protease"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82958"
FT                   /protein_id="ADI82958.2"
FT                   /translation="MSILVLGIGNLIMSDDGAGVRAVELIRELHPLPAGVTLLDGGTLG
FT                   LDLLPRFDGVDRLLVVDAIDTGAPAGTLVRLEGEDIPTALRTKVSPHQMGLQDLLAVAD
FT                   LQGNLPGEMVLWGIQYCSVEPGTDLSAPVSRALPLLVDQVLAELAAWGIHPV"
FT   gene            complement(103039..103707)
FT                   /gene="hyaB"
FT                   /locus_tag="KN400_0096"
FT   CDS_pept        complement(103039..103707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyaB"
FT                   /locus_tag="KN400_0096"
FT                   /product="periplasmically oriented, membrane-bound
FT                   [NiFe]-hydrogenase, cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82959"
FT                   /protein_id="ADI82959.1"
FT                   /translation="MARNRNCLYEEYVWEVPVRVTHWVNMLAIVVLSVTGIYIGSPKTL
FT                   GLSASDYVMGWVRVIHFTAGYTFAVSVASRMWWAFAGNRHAGWCEFVPFLYPEGRRNMW
FT                   RMFTYYTFLSRKVPHPIGHNALAGATYLLVFLLYLTMIFTGLALYAEHRPGGAMHVLLS
FT                   PLYWLFSNQGMRLTHHMVMWLLIAFAIHHVYSAWLMDVKERGGVMSSIFGGYKPVKRRE
FT                   "
FT   gene            complement(103717..105417)
FT                   /gene="hyaL"
FT                   /locus_tag="KN400_0097"
FT   CDS_pept        complement(103717..105417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyaL"
FT                   /locus_tag="KN400_0097"
FT                   /product="periplasmically oriented, membrane-bound
FT                   [NiFe]-hydrogenase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82960"
FT                   /protein_id="ADI82960.1"
FT                   /translation="MAMIVVDPITRIEGHLRIQAEVNGGRITDAWSSCTMFRGIEKILK
FT                   GRDPRDAWYFTQRFCGVCTTVHSIASIRAVENALNVKIPLNAELIRNLIIGSQVVQDHV
FT                   IHFYHLHALDWVDVVSALKADPSKTATLAASISDWPLNSPTYFKSIQDRLAAFVNKGRL
FT                   GPFGNAYWGHPAYKLPPEANLMATAHYLEALDWQREIIKIHAILGSKNPHPQTFLVGGM
FT                   AVPIDPNSQNALNADKIAEIGQLLKKTRAFVEKVYIPDLLAVASFYTEWAGIGGGVGNY
FT                   LSYGEYPLDNSGKPEKLWLPQGIILNRDLSRVYPIDQRKITESVAHSWYEGEAAGVHPY
FT                   DETTEARYTGPTPPYEMLDTDGKYSWVKSPRYDGKPMETGPLATILVAYAAGHPGARGA
FT                   VDMVLGKLGAGPEALFSTLGRTAARGIETLLVARELSSWLDMLVANIAGGDLTIHNGEK
FT                   WDPATWPREAAGYGWHNAPRGALGHWIRIKDQKIENYQAVVPSTWNASPRDEKGQLGPY
FT                   EAALVGTPMADPGRPLEILRTIHSFDPCLACAVHVVDPKGGELVSVKVL"
FT   gene            complement(105421..106536)
FT                   /gene="hyaS"
FT                   /locus_tag="KN400_0098"
FT   CDS_pept        complement(105421..106536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyaS"
FT                   /locus_tag="KN400_0098"
FT                   /product="periplasmically oriented, membrane-bound
FT                   [NiFe]-hydrogenase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82961"
FT                   /protein_id="ADI82961.1"
FT                   /translation="MAGNDDGNDLVKQHCKSSGTWEEQGISRRDFLKFCTAMSAVLALP
FT                   VTLVPRIAEALEDDKRPSVIWLEFQSCTGDTEALLRAANPTVADIVLDVLSVDYAETIM
FT                   AAAGFQAEAARHATMKARSGTYIAVVEGAIPTGANGAYCCIGGRSALDITREVCGGAMA
FT                   TITVGTCASYGGIPAAAPNPTGAVGVKDAVPGATVINLPGCPVNTDNLVATVVHLLTFG
FT                   SPPATDGKGRPLFAYGKRIHDNCERRPHFDAGQYVEQWGDQAHRAGHCLYKMGCKGPET
FT                   FHNCPSQRYNEKTAWPVSAGHGCAGCSEPHFWDSMTPLYKRLPNVPGFGIEATADQIGL
FT                   GIAAATAAAFGIHGVVSALRKGNDSDDEKEG"
FT   gene            complement(106695..107411)
FT                   /locus_tag="KN400_0099"
FT   CDS_pept        complement(106695..107411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0099"
FT                   /product="amidophosphoribosyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82962"
FT                   /protein_id="ADI82962.1"
FT                   /translation="MIVRALLDILFPPLCHLCRAPIPGAEKLHLCPACLARAKPIGSPL
FT                   CTVCGVPFATEGGIDHRCGDCIVSPPPYEGARAAYLFEGPVQELVHRFKYGHKAHLRRP
FT                   LALLAAERLSSFVAESASDLIIPVPLHRSRLRERGFNQAILMGELLARRWRIPLHRATL
FT                   GRVRATAPQVGLTSAQRRENIRGAFAVPSPAAVAGRRVLLLDDVFTTGSTIAECALVLR
FT                   KAGAAAVHAATVARTP"
FT   gene            complement(107415..108068)
FT                   /locus_tag="KN400_0100"
FT   CDS_pept        complement(107415..108068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0100"
FT                   /product="protein of unknown function DUF162"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82963"
FT                   /protein_id="ADI82963.1"
FT                   /translation="MSLTTELVDWTHEQKCRKAVAALEKNGFTAVYCPSGREAFDYILT
FT                   EAVDARSIGFGGSLSVVDLQVIDRLREMDKELLIHGLPGLSLEERVAIMRRQLTCDLFL
FT                   TGTNALTLSGWLVNIDATGNRVASMFFGPRTVIVVAGRNKIVDGGVTEAIARVKEWASP
FT                   PNARRLSYKTPCATTGFCSDCNSPDRICRITTVIDRNPRLTDLRVLVVNEDMGL"
FT   gene            complement(108093..109070)
FT                   /gene="yccM-1"
FT                   /locus_tag="KN400_0101"
FT   CDS_pept        complement(108093..109070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccM-1"
FT                   /locus_tag="KN400_0101"
FT                   /product="iron-sulfur cluster-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82964"
FT                   /protein_id="ADI82964.2"
FT                   /translation="MSNRYMQPLRIAIQLGFLVFMLYLGVRLYLFVQHFRTGGATPFVP
FT                   RPDGVDGFLPISGLLGLKDWFAGGTINPVHPAAVVVFVTVVAVSLLLKRSFCSWICPVG
FT                   TLSELLWKRGFTLFRRNLRPPRWLDVALRGLKYLLLAFFLYSILWVMPPPAVKAFIFMD
FT                   DHLIADVKLLNFFLHLSGIPLVVILVLLVLSLPVRNPFCRYLCPYGALLGLVSLLSPVK
FT                   VTRERTVCVSCGVCTQVCPAYIPVMAKERVHSEECIGCWRCVSHCRAQGALSMKLTGRR
FT                   VAVSGTVFAVLVVVIFVGGSVAGRATGHWKSQIPYAEYMRLLGP"
FT   gene            complement(109277..110050)
FT                   /gene="ttcA"
FT                   /locus_tag="KN400_0102"
FT   CDS_pept        complement(109277..110050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttcA"
FT                   /locus_tag="KN400_0102"
FT                   /product="tRNA (2-thio-C32)-thioltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82965"
FT                   /protein_id="ADI82965.1"
FT                   /translation="MEFIDNIRYKKIKNAVGRAVADFGLIRDGDRIAVAVSGGKDSYTL
FT                   LHILEGLRRRAPVKYELVAVTIDSGYPGFRSDVIASYLREQGFAHHLETTDHYDIIREK
FT                   RRPGSSYCSICARLKRGVLYTLAQKLGCNKLALGHHLDDFVETLLLNQFFVGTLKAMAP
FT                   RMLADNGETTVIRPLVYVEEREIIPFARENRFPVVCCSCPVCGTADLQRRRMKKLLTEL
FT                   EKENPAVKRSLLRALGNVQPRYLLDLELQRLCDVP"
FT   gene            110173..112428
FT                   /gene="priA"
FT                   /locus_tag="KN400_0104"
FT   CDS_pept        110173..112428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="KN400_0104"
FT                   /product="primosomal protein N', ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82967"
FT                   /protein_id="ADI82967.1"
FT                   /translation="MSSFPVNERQTVIVHVAVPLPLDAPFSYRVPAPLAPAAAVGRRLL
FT                   VPFGRRKVTGYVLEVADDDGRELRDVLEFLDDGPLFTPGELALYRWASSYYLHPLGEVI
FT                   KAALPAGINVQSRRGAGLDEGELTGGRSVKTERVYRAVAEVPDTVPPPGKASELLAHLA
FT                   EREEESASELRRLFGECSVQLRRLRELGFVEMAEREIYRDPFRMEAVGHDRPLELNERQ
FT                   SAALVRLRAALDAGRFTPFLLRGVTGSGKTEVYLQAIAHCLEQGRSALVLVPEIALTPQ
FT                   LVSRFRRRFRCGVAVLHSGLSDGERFDEWRRIRRGEAAIVIGARSAIFAPLADLGMIVV
FT                   DEEHEGSYKQGEGFRYNARDMALVRGKMAGACVVLGTATPQVTTWYAVAGGKLECLDLP
FT                   ERVNGLPLPSAEIIDVRGARGHVLHPRLAAEVEANLARGEQTLLFLNRRGFSTWLTCEE
FT                   CGHVLRCPNCQVTLTYHQGRNRHICHYCDYAVPAPSMCPGCGCGRIIHLGLGTEQVEAY
FT                   VREHFPHARVDRMDRDTTARRGGHARILRKVAERQTDILIGTQMVAKGHDFPGITLVGI
FT                   LSVESTLNIPDYRSAERTFQLVTQLIGRAGRGDDPGRVLIQSLNPDHYALAHAVAGDMD
FT                   GFYGAELAFRQETGYPPFAHLAALCLSGTAASAVERTSELLAARLRELRRDGGGRVEIL
FT                   GPAPAPLAKLRGRFRRQILLKAAGRTALHRLVCRARESFQPQAGVRLLVDIDPVDLM"
FT   gene            112516..113019
FT                   /gene="def-1"
FT                   /locus_tag="KN400_0105"
FT   CDS_pept        112516..113019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def-1"
FT                   /locus_tag="KN400_0105"
FT                   /product="polypeptide formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82968"
FT                   /protein_id="ADI82968.1"
FT                   /translation="MVRTILTYPDPVLKKKAVPVTIINDATRELVRDMAETMYDAQGVG
FT                   LAAPQIGVSQRVIVIDVSQRDERPELIVCINPVIIHGEGESYEEEGCLSVPKYSANVHR
FT                   HERVVVKSLNLEGEEVVHRAEGLLAIAFQHEIDHLDGVLFVDHLSALKKEMFKKKYRRM
FT                   TEEE"
FT   gene            113030..113983
FT                   /gene="fmt"
FT                   /locus_tag="KN400_0106"
FT   CDS_pept        113030..113983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="KN400_0106"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82969"
FT                   /protein_id="ADI82969.1"
FT                   /translation="MAGLRIIFMGTPEFACPTLRKLIERGEEVIAVVTQPDRPKGRGQK
FT                   LVPPPVKALAQEHDIPVLQPLKVRTPESVDEIRRLAPDLIVVVAFGQILPQSLLDIPKH
FT                   GCINIHASLLPRYRGAAPLNWCLINGETETGITTMMMDAGLDTGDMLVKRAIPIGPDED
FT                   AQSLHDRLSQLGAETIDETLDLLLAGKLVREKQDDSLTCYAPMLKKEDGLVDWTREPVQ
FT                   VKNQVRGFTPWPGAYTFLDGKTLKLYRVAVAGETGEPGEILRVGREGILVGCGSGSILI
FT                   QELQLEGRKRLPTAEFLAGFRLEPGTRLGEAGSVEH"
FT   gene            113986..114741
FT                   /locus_tag="KN400_0107"
FT   CDS_pept        113986..114741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0107"
FT                   /product="protein of unknown function DUF116"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82970"
FT                   /protein_id="ADI82970.1"
FT                   /translation="MAEHPPQKRLFIALMGLTCLLIVGGIYLLWWVPTTGLANIHPSLP
FT                   RVVGIVLGGLSLLALLGTAVLVLTTALGKDMYFTRFLRGVVIKFLLPVIELLGRAFGIS
FT                   TDTIRQSFIAMNNSLVLSQRYKVKPDRILILLPHCLQLFDCEIKVTGDINKCIRCGRCD
FT                   IKGLAELAEKYRIDISVATGGTLARKVIIEKRPKLVVAVACERDLTSGIKDCYPLPVIG
FT                   VLNDRPFGPCFNTSVDIAKIDESLQVIMG"
FT   gene            complement(114899..115405)
FT                   /gene="cheX40H"
FT                   /locus_tag="KN400_0108"
FT   CDS_pept        complement(114899..115405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheX40H"
FT                   /locus_tag="KN400_0108"
FT                   /product="protein phosphoaspartate phosphatase CheX
FT                   associated with MCPs of class 40H"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82971"
FT                   /protein_id="ADI82971.1"
FT                   /translation="MALSFTVKEATFKEADLVGHIVESVKKIFSTMIFIDDIVDEYPLA
FT                   KPESHFIASISGMVGLGGDFSGMVGIHIPIEFAKEATASMLGMELDELEGEDDIHDAVG
FT                   EITNMLAGEIKMLFSANNLTVGLSTPSIISGSDYTVEVVSSGAAVVVPFNRNEHRFLAT
FT                   LQIEA"
FT   gene            115682..116848
FT                   /locus_tag="KN400_0109"
FT   CDS_pept        115682..116848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82972"
FT                   /protein_id="ADI82972.2"
FT                   /translation="MGILSTTTAICQFRVAGDLPAGDLYPWIAEHLARQAFQSIDQGVA
FT                   EQSVGWVHLDDHRQMSFDIPAAFWRDHYVAFTLRRDQRKLPAALVKAYLQVAEHEYLSA
FT                   HPGLNRVPKQKREELKEAVRLNLLAKTLPVPSTWDAVWDTRTGIVTFTSLSAPIIELFE
FT                   TQFKKTFEGTRLVAIHPYARAEAVGGEGLKPALEQANLATSDAAIDLIRSNQWLGWDFL
FT                   LWLLHRTMTDSSEYCVGQPGPALAGEPFVAYLNDRLVLVSAGEAGTQKITVAGPQDHFR
FT                   EARTALAHGKRITESTLYLEKEEHVWKLTLKGELFHFASLKSPKVAIEKGEHVDEGSER
FT                   EAAFYERMYVLEQGLQLFDSLYGEFLTVRLGAGWGEELARIEGWLAGE"
FT   gene            complement(116857..117957)
FT                   /locus_tag="KN400_0110"
FT   CDS_pept        complement(116857..117957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0110"
FT                   /product="ribonuclease Z-related hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82973"
FT                   /protein_id="ADI82973.1"
FT                   /translation="MKSRLPFRYLEPTFCAGLLDDPVLLVNVRPLGRSILVDCGQIHHL
FT                   AKRVLKSIDAVFVSHAHMDHFMGLDTLVRHIHVSPRTVELFGPPGIARKVAAKLAGYDW
FT                   NLTESYWCTFRVSEVHPERIVRFTFPGSEGFPCLPEEETTREGTEIFRNDFLAVDADLC
FT                   DHNTLPTLVFRITERPTFWIDEAKVDQEGLVPGEWLRELKHRFYRGRLDGKTITVPVRT
FT                   AGDTVAQRIREGRELFEAIRRSQEPASIGYLTDIGAGDTNLATVRRLLAGVTLLACECS
FT                   FLAADVAKARTSHHLCTADVSALAREIRPGWLLPMHLSKSYNTKGHLLYRELTLAPETR
FT                   LIRLPEHLTPRPLLPGEFPGLWKIAE"
FT   gene            complement(118036..119013)
FT                   /gene="hemB"
FT                   /locus_tag="KN400_0111"
FT   CDS_pept        complement(118036..119013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="KN400_0111"
FT                   /product="porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82974"
FT                   /protein_id="ADI82974.1"
FT                   /translation="MFYPTFRARRIRGKEVFRRMVSETTLSATDLIYPMFSAFGTGIRK
FT                   EISSMPGIYQQSIEHIVAEAQEVHELGVPAVILFGIPETKDAVGSDAYAEHGIIQETIR
FT                   ALKKQVPGLAVITDVCMCEYTDHGHCGIIKDGDVDNDETLELLAREALSHAEAGADMVA
FT                   PSDMMDGRVMAIREILDNNGYKNIPIMSYAVKYASGYYGPFREAAESTPQFGDRRSYQM
FT                   DPGNRREAIREARMDVEEGADIIMVKPGLPYLDIVRDLREEFDLPVAVYNVSGEYSMIK
FT                   AAGRAGWIDEERVMMETLLSFKRAGADLILTYHAKEAARVLKRG"
FT   gene            119248..119685
FT                   /locus_tag="KN400_0112"
FT   CDS_pept        119248..119685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0112"
FT                   /product="DoxX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82975"
FT                   /protein_id="ADI82975.1"
FT                   /translation="MAKSNMGAVADSLALLMIRVPLGAIFIAHGSQKLLGAFGGQGLTA
FT                   TFRVFEEKLGIPPIFTLLAIIAEFGGGVGVLCGFLTRLSGFGIASTMAVAMYKVHWANG
FT                   FFLNGPRGNGIEYNLALLGMALALVFAGGGAWSVDRYLFKR"
FT   gene            complement(119836..120534)
FT                   /locus_tag="KN400_0113"
FT   CDS_pept        complement(119836..120534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0113"
FT                   /product="PilZ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82976"
FT                   /protein_id="ADI82976.1"
FT                   /translation="MHDYYQLVTVADLPQDNRQILDTLTAIGAGKLPNDLRLLNYYRSI
FT                   PVNYGATVESVERGSVELTVNQQQAIVMQLEKQVFLKSGHFPKDVLAAVTYVNIDKSVA
FT                   ILANFAYAVIRSERRQFVRVEVKDKIEASFSGDGFTVAGLLNDISLGGVAISATIPTHP
FT                   DAGIKGKVTLRLPGGPFEMPAQVLRVIPAKQTDLCIIEIQPDNRTEKGISQYIFQRQVE
FT                   IIRELKDSIF"
FT   misc_feature    120618..120655
FT                   /note="conserved nucleotide sequence; KN400_R0111"
FT   gene            120684..122264
FT                   /gene="prfC"
FT                   /locus_tag="KN400_0114"
FT   CDS_pept        120684..122264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="KN400_0114"
FT                   /product="peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82977"
FT                   /protein_id="ADI82977.1"
FT                   /translation="MKYNEQEVDRRRTFAIVSHPDAGKTTITEKLLLFGGAIQQAGEVR
FT                   ARKAARHATSDWMEMEKQRGISVTSSVMKFTYRDYEVNLLDTPGHNDFSEDTYRVLTAV
FT                   DSALMVIDSVKGVESQTIKLLDVCRLRHTPIMTFINKLDREGRDPFELIDEIEKVLRIQ
FT                   CAPMTWPIGMGKRFRGTYHLYTKELVIFDAEAERGTGGVISMTGLDDPQLDELLGSQAD
FT                   ELRADVELLEGAAHPFEEEAYHAGLQTPVFFGSAINTFGVQQLLDTFVDHAPAPLPREA
FT                   VSRTVSPYEEPFTAFAFKIQANMDPAHRDRIAFFRICSGKFTRGMKVRHVRLGREVAIN
FT                   NATIFMAQDRTHVDEAFPGDIIGIHNHGTIKIGDTFTLGEDIKFTGIPNFAPEHFRRVR
FT                   LLDPLKSKALEKGLTQLAEEGTTQVFRPLMGADWVVGAVGLLQFDVVMHRLEHEYNVKA
FT                   TYEPVSYVTARWVTGEKKKVEEFQKKEVMNCYIDGEGDLAYLAGSQWRLDNTMDNWKDL
FT                   TFHATREHS"
FT   misc_feature    122371..122398
FT                   /note="palindrome; KN400_R0112"
FT   gene            122492..123106
FT                   /locus_tag="KN400_0115"
FT   CDS_pept        122492..123106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82978"
FT                   /protein_id="ADI82978.1"
FT                   /translation="MRYQASPQTRLLLKYIHTFSAMMWIGGAQAILILLYKDRLATNGD
FT                   ELFAVNDAIRSLDNWLIGPGVAGSILSGALISLTTHWGFFRHRWVSVKWVVTVVATLFG
FT                   IVFLGPWLQDLSEITGLNRLAVFDNLAYVQTYRLGVIFGVAQMVVLLVLVLISIFKPEL
FT                   EPCSPAARQLERRLAVLLRPVVAPFMGLQGQICNLLRLERD"
FT   gene            123313..124062
FT                   /locus_tag="KN400_0116"
FT   CDS_pept        123313..124062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0116"
FT                   /product="phosphoribosylaminoimidazole carboxylase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82979"
FT                   /protein_id="ADI82979.1"
FT                   /translation="MDPRELKTILRSFKDGALSEDEMLERLRHLPYEDVGDALVDHHRG
FT                   LRQGFPEVIFGAGKSAGQVERIMASLAAKGNNILVTRLDEAKALAVKEAFPSAMWHADA
FT                   RCLTLEQRPIEKRGLGTVLVLSAGTSDLPVAAEALVTLRMLGNEASHLYDVGVAGIHRL
FT                   LARRDVLFSARVLIVVAGMEGALPSVVGGLVDRPVIAVPTSVGYGASFGGIAALLGMLN
FT                   SCAAGVTVVNIDNGFGAAVAASKINRE"
FT   gene            124070..125236
FT                   /locus_tag="KN400_0117"
FT   CDS_pept        124070..125236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0117"
FT                   /product="protein of unknown function DUF111"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82980"
FT                   /protein_id="ADI82980.1"
FT                   /translation="MKILYFDCFAGIAGDMTVAALLDLGVPFEVVRDAVGCLRLPHSSY
FT                   SLATERTSRKGITATRFVVHVEEHQPNRHYGDIAAMIEESPLADGIKEKAQRIFFRLAE
FT                   AEAKVHGVELGRVHFHEVGAVDSIADIVGAAAAIDWLGIESIHGGALPLGSGFVETAHG
FT                   RLPVPAPATAELLRGIPVHGEAGPGERVTPTGAAILAALAAGFGPIPPMTVTGVGCGAG
FT                   TRDFADIPNILRVFQGEIDRGFERDDVVVIEAHIDDTSPEILGYVMERCLAAGALDAAF
FT                   SPLQMKKNRPAVRLTVVVHPEQRDELAALILRETSAIGVRFHPAGRLKLRRLVEERDTT
FT                   LGRVRVKVINGDGVARVAPEYDDCCRIAAERGMPLMEVYRIVERECGQ"
FT   gene            125233..125685
FT                   /gene="pgpA"
FT                   /locus_tag="KN400_0118"
FT   CDS_pept        125233..125685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="KN400_0118"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82981"
FT                   /protein_id="ADI82981.1"
FT                   /translation="MTRRFVVIAATWFGTGLSPVAPGTVGTLGAIPLYLALARLPLWLY
FT                   LATLVPFFFLSSWVAGRAQEEFGQKDPGKVVIDEVIGYLITMAGVTADWRSILAGFLLF
FT                   RFFDVVKIWPARYFDRRMKNGYGVVLDDVAAGLYACAALHLLLGYL"
FT   gene            125682..126923
FT                   /gene="cinA"
FT                   /locus_tag="KN400_0119"
FT   CDS_pept        125682..126923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cinA"
FT                   /locus_tag="KN400_0119"
FT                   /product="molybdopterin-binding domain nicotinamide
FT                   nucleotide amidohydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82982"
FT                   /protein_id="ADI82982.1"
FT                   /translation="MKIATLSIGDELLRGEVVDTNAARIAARLADAGLAVGRHLTVGDD
FT                   EGEIEAALGMLAPAHDAVIVTGGLGPTDDDVTARAAARATGRRLVLNEAALDRLRDFFS
FT                   RRGRELYPANERQCLLPAKAGLIPNALGTACGFHLLHGECFLVFLPGVPAEMARMLEES
FT                   VVPLVLDRRSGPEVTRTAVLTLFGLSEAEIGGRLSGLERSRGGLGIAYCVDFPVVQVKL
FT                   RATARSEEEAAEIIAGGLPLVRERLGDVIVAEGDNTIDTAVARLFREKGLTLALAESCT
FT                   GGLIAKRITDVAGSSAYFFMGLVTYANEAKERLLGVPTALLAEKGAVSADVARAMARGA
FT                   RHVAGSDLALAVTGIAGPDGGSDDKPVGTVYLALADRAGCSVKSYRFAGERDAIRTVTA
FT                   VTALDWLRRRLLTA"
FT   gene            126967..129096
FT                   /locus_tag="KN400_0120"
FT   CDS_pept        126967..129096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0120"
FT                   /product="sensor histidine kinase, PAS and GAF
FT                   domain-containing"
FT                   /note="domains: PAS, GAF, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82983"
FT                   /protein_id="ADI82983.1"
FT                   /translation="MSLRNDRVYLIVVSVSALLVLGVLAASFVVYRRHDFPLLDFLTLV
FT                   LFLLVSCIIFMVVSYRKTRSVNELAHLHELMQYQRELDKIARRYRSLLEGAGNAVFVFN
FT                   ADTGLLVEVNRRGTELLGYSKEEMVTLKGKDLVPEEDQEKFSLLVLRVVRRGRGRTDGI
FT                   AFRRRGGDRFLGEVEARLIDLGDEKVVHATIRDITFKHRAEREMRQRNRELASLVNIIT
FT                   RANQEMELETVLDVTLRETIEVFGVDGGGIHLRERDGTLRPAATCFVPDRLREALDAGA
FT                   DGGLLGRVAATRGPFALDDLAMEGCMAGLSDESAGWKGFAAVPLFAKNRVTGVMYLLNR
FT                   QMRSFTDEELKLFFSIAGQMGIIIENARLFNELKWKSDELMGSFRLLEKSSHELALSQH
FT                   RLRTNLTLVERANQELERIDRMKNNFLGMISHEFRTPLTSVISGTDFLRSSSSLAGDPD
FT                   SRQVLDMIHEGGERLFEIVNDILKVARLEAKSATVARRALHISQVFSQVVTKLEPLLAE
FT                   RSLRIVFNNLEGLPHCIGDQECFEEIFSELLENSVKFTPDGGTIIISARVVDRRALAPK
FT                   REILARFNADFPSQIGDRCYLEVAVRDNGIGVSHDEQVKIFDKFYEIGDIRHHSSGKFK
FT                   FQGKGTGLGLAIVKGMVEAHGGMVWVESPGVDPEARFGSAFLVLLPLEESLRTPVIPLA
FT                   APRDPLAGDIPGEGA"
FT   misc_feature    129207..129227
FT                   /note="conserved nucleotide sequence; KN400_R0113"
FT   gene            129229..130245
FT                   /gene="recA"
FT                   /locus_tag="KN400_0121"
FT   CDS_pept        129229..130245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="KN400_0121"
FT                   /product="recombinase A"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82984"
FT                   /protein_id="ADI82984.1"
FT                   /translation="MTQEREKAIELALSQIEKQFGKGAIMRLGADEALPDVAAIPTGSL
FT                   SLDLALGVGGVPRGRIIEIYGPESSGKTTLALHIAAEAQKMGGIAAFVDAEHALDIGYA
FT                   RKLGVKTDDLLVSQPDTGEQALEIAEMLVRSGAVDVLVIDSVAALVPKAEIEGEMGDSH
FT                   MGLQARLMSQALRKLTGIISKSNCCVIFINQIRMKIGVMFGNPETTTGGNALKFYASVR
FT                   LDIRKIASLKQGQDVIGSRTKVKVVKNKVAPPFKEVEFDIYYGEGISREGDILDLAVEK
FT                   GIVDKSGAWFSYGGDRIGQGRENSRLFLKERPELVNEIEGKVYDVAGIPRKGAKEAA"
FT   gene            130249..131409
FT                   /gene="pilT-1"
FT                   /locus_tag="KN400_0122"
FT   CDS_pept        130249..131409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT-1"
FT                   /locus_tag="KN400_0122"
FT                   /product="twitching motility pilus retraction protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82985"
FT                   /protein_id="ADI82985.1"
FT                   /translation="MELNDILTVAVRAKASDVHIKTGLPPVVRIDGRLRPIPNAPRLAP
FT                   DQVRAMALAIMNDRQKRLFEEHFECDTAYGVPGLGRFRVSVYSQRGTVAMVFRFIPFGI
FT                   PSMENLTLPPVIKKLAMEERGLILVTGTTGSGKSTTLAAMIDYINEHRTCNIITVEDPV
FT                   EFLHRDKKSILSQREVGFDTVSFATALKGALRQDPDVILVGEMRDLETIETAMHAAETG
FT                   HLVMSTLHTLDATETINRIISVFPPYHQRQVRIQLAGVIKGVVSQRLVPRADGKGRVPA
FT                   VEIMIGTARIKEYIDDKDKTKLLPEAIAQGYTSYGMQTFDQSLMLLYTQKLITYEEALR
FT                   QSSNPDDFALKVSGISSTSDSTWDDFVHDEAPPAEGEGSVEGIEKF"
FT   gene            131438..131917
FT                   /gene="recX"
FT                   /locus_tag="KN400_0123"
FT   CDS_pept        131438..131917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recX"
FT                   /locus_tag="KN400_0123"
FT                   /product="recombination regulator RecX"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82986"
FT                   /protein_id="ADI82986.2"
FT                   /translation="MHSRPERRRDPLSTALDILSRRDHSEAELARKLRSRGIDAGEIDR
FT                   IVARLREFGYLNDRRVACRLAESALAQGKMVGARLRVELRRRGIPPELAEEALAQAAAG
FT                   CDERALVGDLLARKFPGFDPAVADPREKRRVVGWFQRRGFGLSAILEALRCPVDE"
FT   gene            131989..134616
FT                   /gene="alaS"
FT                   /locus_tag="KN400_0124"
FT   CDS_pept        131989..134616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="KN400_0124"
FT                   /product="alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82987"
FT                   /protein_id="ADI82987.1"
FT                   /translation="MTGKEIRARFLKFFADRGHAVVPSSPLIPHNDPTLLFANAGMNQF
FT                   KDCFLGLEKRDYVRACSSQKCVRAGGKHNDLENVGRTARHHTFFEMLGNFSFGDYFKKE
FT                   AIAFAWEFLTKDLGLDKDRLYVTVYTDDDEAADIWHLQEGVPRERIYRFGEKDNFWAMG
FT                   DTGPCGPCSEIFWDNGPEVGCGSPDCAVGCDCDRYMEIWNNVFMQFNRSADGVLTPLPK
FT                   PSVDTGMGLERISTVMQGVKSNYDTDLFQGIIGHVEKLSGKRYRHSEKDDVSMRVMADH
FT                   VRATTFLICDGVLPSNEGRGYVLRRIMRRAARHAKMLGFAEPVICRMVEAVNAMMGDAY
FT                   PELLEREEYIRKVIRAEEERFAETLDRGLAILNEAVADLKNEGRTVIPGETLFRLYDTF
FT                   GFPTDLTADIVRSEGFTIDEDGFEACMERQREQAREHWKGSGEEGIAEVHKTLHSRGVR
FT                   SRFTGYEARTAYSPVTVLLKGGAEVAEATAGDRVEIITDATPFYGESGGQVGDTGTIST
FT                   GSAHVEVTETLRPFPDLIVHRGTVVEGTIRQGDACDLKVAPGRDATARNHTATHLLQSA
FT                   LRQVLGDHVKQSGSLVGPDRLRFDFTHFAAMTPEEIRRVEEIVNSCIMANDDVHAREMA
FT                   LDEAMEIGATALFGEKYGDTVRVVRVGEVSMELCGGTHVHAAGDIGFFKILSEAGIAAG
FT                   VRRIEALTGMGALRHVQQLEDERKEIAALIKAEGGDNVERLQRLLTRQKDMQREIETLE
FT                   SRLNAARSADLLADVREVNGVKVLATLAEVDDPKKLRELADTLKDRLGSGVVALGCVKE
FT                   GKANLLVAVTKDLTGRVKAGDLIRQLSPIIGGSGGGKPELAQAGGTLPDKLGEALGKVC
FT                   ELVP"
FT   gene            134639..135754
FT                   /locus_tag="KN400_0125"
FT   CDS_pept        134639..135754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0125"
FT                   /product="motility response receiver histidine kinase"
FT                   /note="domains: REC, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82988"
FT                   /protein_id="ADI82988.1"
FT                   /translation="MDIVTKMQSERGLKSILVVDDESVIRDLCAKALKGYRVLQAGDGE
FT                   EALRLFERGGIDVILTDVMMPKLNGIELLRRLKEMEPTLVVIVMTGYAEKDIILNALKA
FT                   DADDFITKPLNLLQLKTAVDRALDKKVLKEEIANLKSMDRLKSNFLSLISHKFRTPLTA
FT                   ISLFLQNLACGVYDPEDPESRRNLELIFGQSRYLESLVSELLAFSRFMDAEAGLQLEPC
FT                   LLQDLIPKLVTSSREAVAKPGIVTSFDLAPLPPISLDREKITFAIGQIIDNAYKFSRER
FT                   GKITITLRESGDEYLLAVEDTGVGIPRDEIPKIFEKFYQVDPEGTGQIRGFGLGLFYAR
FT                   EFVKLHDGTISIESEAGAGTRVTIALPSAAT"
FT   misc_feature    135803..135843
FT                   /note="conserved nucleotide sequence; KN400_R0114"
FT   gene            135888..136766
FT                   /gene="argB"
FT                   /locus_tag="KN400_0126"
FT   CDS_pept        135888..136766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="KN400_0126"
FT                   /product="acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82989"
FT                   /protein_id="ADI82989.1"
FT                   /translation="MQHLIDKANTLMEALPYIRRFSGKTIVIKYGGHAMADEALKESFA
FT                   LDVIMLKSLGINPVVVHGGGPQINETLKRYGIVSEFVKGMRVTDAATMQVVEMVLTGQV
FT                   NKEVVGYLNQHGGRAVGLSGKDGNLLLCRKLLQEVRQDDGTVESVDIGFVGDVVKVNQE
FT                   LIQTLEHGKFIPVIAPVGVGEQGESYNVNADLVAGRVAGALRAEKLILLTDVAGVKDKA
FT                   GALLSSIRLDTVPGLIDDGVITGGMIPKVTCCVDAIEEGVRKASIIDGRVLHAVLLEIF
FT                   TDVGVGTEIHR"
FT   gene            136847..138046
FT                   /gene="argD"
FT                   /locus_tag="KN400_0127"
FT   CDS_pept        136847..138046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="KN400_0127"
FT                   /product="acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82990"
FT                   /protein_id="ADI82990.1"
FT                   /translation="MNTTQWIAKADKYIMKTYGRYPLVPVRGEGCRVWDADGKEYLDFL
FT                   AGVAVNNLGHCHPKVVEALRKQAAEIIHCSNYYHIPNQIELAELLCAHSFADKVFFCNS
FT                   GAEANEAAIKLARKHAREKTGDAERYGIITALASFHGRTMATISATGQEKVQKFFDPLL
FT                   HGFTYVPFDDAAALEAAVTPTTCAVMLEPIQGEGGVVVPSADYFRKVREICDRHGLLLI
FT                   FDEVQVGIGRTGKLFAHEHFDVTPDIMTLAKALAGGAPIGAMLARDEIAASFSPGTHGS
FT                   TFGGNPLVTAAGLAAVRAVLEEGLLNRAEEMGEYLVGELERLKGKYDIITDVRGIGLMV
FT                   GMELSVPAGDIVLKGLERGVLLNVAQDRVLRFVPPLVVTKQEVNDMIAVLDGILEEMTK
FT                   "
FT   gene            138043..138954
FT                   /gene="argF"
FT                   /locus_tag="KN400_0128"
FT   CDS_pept        138043..138954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="KN400_0128"
FT                   /product="ornithine carbamyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82991"
FT                   /protein_id="ADI82991.1"
FT                   /translation="MIRHFLALNQFTKEELDGLFTLSRELKDKQKQGVPHRLLEGKSVA
FT                   LIFEKSSTRTRVSFEVGVAQLGAHPLFISSATSQMGRGEPIKDTARVMARYCDGVMIRT
FT                   YGQEIVEEFARYSSVPVINGLTDLFHPCQIMADLFTVIEYKGGYQGLKFAWVGDGNNMA
FT                   NTWIEAAAILGFDLALACPTGYEPDRQVWDWAQQRATSSITITEDPEEAVRDADVVNTD
FT                   VWASMGQEQEQKEREAAFQGYCLDDALVALARPDCMVLHCLPAHRGEEITDSVIEGPRS
FT                   AVWDEAENRLHIQKAIMASLMK"
FT   gene            138987..140207
FT                   /gene="argG"
FT                   /locus_tag="KN400_0129"
FT   CDS_pept        138987..140207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="KN400_0129"
FT                   /product="argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82992"
FT                   /protein_id="ADI82992.1"
FT                   /translation="MAKAHKDVKKIVLAYSGGLDTSIILKWLKNEYGCEVIAFSADLGQ
FT                   GDELAPIRDKAIATGADKVYIDDLKEEFVKDFVFPMFRANAIYEGHYLLGTSIARPLIA
FT                   KRQMEIAKIEGADAVSHGATGKGNDQVRFELAYYHFDPAITVVAPWREWKLNSRQALVN
FT                   YARKNGIPIPVTKKRPWSSDRNLLHISFEGGILEDTWAEPPENMYVLTKAPEKAPNKPQ
FT                   FVEIEFKNGNAVAVDGEKMSPAQLLAHLNYIGGEHGIGRVDLLENRSVGMKSRGVYETP
FT                   GGTILREAHSAVEQITMDREVMRIRDSLIPEYARQVYAGYWFSPEREMLQTLIDDSQKC
FT                   VNGVARVKLYKGHCRTVGRKSETNSLFNLDFATFEKDQVFNQADATGFIKINSLRLRIR
FT                   SLMQGKK"
FT   misc_feature    140339..140373
FT                   /note="conserved nucleotide sequence; KN400_R0115"
FT   gene            140374..140817
FT                   /locus_tag="KN400_0130"
FT   CDS_pept        140374..140817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0130"
FT                   /product="NUDIX hydrolase, type 15"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82993"
FT                   /protein_id="ADI82993.1"
FT                   /translation="MADKTFKKDHIVTSVVAVIVDDDGQVLLTKRNVTPFKGEWVMPGG
FT                   KIDLGEPIVAALQREVMEEVGLQVEVEDLIDVFEHVTPGEDNYHFIILYYLCHPIYCDI
FT                   DHNRDEVEEARWVPRGELAGYKMPEGTRFILGKVFPELCSCET"
FT   gene            140828..141991
FT                   /locus_tag="KN400_0131"
FT   CDS_pept        140828..141991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82994"
FT                   /protein_id="ADI82994.1"
FT                   /translation="MVQIIDKKVNLEYPLGHHLHCMIAQVPNHLRGAEKGFAIEEPDRQ
FT                   WERVRSILDLVAAGEGNLKKLHFLMFPETHVPVGRFDEMLTAISGTFRPNTVTMFGVEH
FT                   VSLKAYREMLERFREDNAEAIELVDRDIDSGDVLEMPVNWCCIAVKEATGKLRVFLEAK
FT                   SHPFHGEEFLDKFHDLYRGRHFYLFRSRPSCFNFMVLICLDYLYRDLYSSNIKQIIDHA
FT                   NQLYFSTRQTLDTIFVVQCNPKPEHRAYRDVLAGFYGEYLEDTPGVRETVTVFGNTSEE
FT                   TRIEDVPGGHAFGTSSVVINSSHRLARVQLSEFATDDFDGAPICRLRFGTGTRLYYFNL
FT                   PLHHEIDPRTTRVPLKVHTIMRPSRDGGWVKISGDELVAGFEIAQDA"
FT   gene            142096..143472
FT                   /gene="argH"
FT                   /locus_tag="KN400_0132"
FT   CDS_pept        142096..143472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="KN400_0132"
FT                   /product="argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82995"
FT                   /protein_id="ADI82995.1"
FT                   /translation="MAHEKLWGGRFSEPTDQFVEEFTASIDFDKRLYHQDIRGSIAHAR
FT                   MLGKQGILPMAEVEKIVAGLQEVLARIEAGKFDFSVALEDIHMNIEARLTEKIGEAGKR
FT                   LHTGRSRNDQVALDIRLYLRDEIVEISAYLDMLVDSLIYQAEANLGVIMPGYTHLQTAQ
FT                   PILFSHHMMAYVEMFTRDKGRMEDCLRRMNVLPLGAGALAGTTFPIDREHVAELLDFPS
FT                   VTRNSLDSVSDRDFALEFMGASSILMMHLSRFSEELILWSTSEFKFVELTDSFCTGSSI
FT                   MPQKKNPDVPELVRGKTGRVYGNLMALLTVMKALPLAYNKDMQEDKEPLFDTIDTVKGS
FT                   LKIFADMVREMRINAGNMRAAAAKGFSTATDVADYLVRQGMPFRDAHEVVGKTVAYCIA
FT                   NGKDLPDLTMDEWQGFSDKIGEDIFDAITLEASVNARVATGGTALERVKAEIERAKVGR
FT                   "
FT   gene            143511..144284
FT                   /locus_tag="KN400_0133"
FT   CDS_pept        143511..144284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0133"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82996"
FT                   /protein_id="ADI82996.1"
FT                   /translation="MGGNHRIVVKLVAGIALAAALAGCGRKGPLVPPESFVPASVSTLT
FT                   VEQKDDAFYVSWPAPEKDEGGRPLKDLAGFRVYRRPVLPPGQDCEECPTAYTLIRTVDL
FT                   EYPQDVRSYDGRYVLADRGLTNGATYQYKVISFKKDGSESGASNRARRTMVAAPPAPRL
FT                   AASSSATGVALQWEPSPPATGEPVGAYIYRRRGDDLASLVLLTPSPVTGTSYEDQRLER
FT                   GVTYVYLVRQVVAVDGQLVEGAASNTVRGALTEPE"
FT   misc_feature    144329..144380
FT                   /note="conserved nucleotide sequence; KN400_R0116"
FT   gene            144422..145675
FT                   /gene="lysA"
FT                   /locus_tag="KN400_0134"
FT   CDS_pept        144422..145675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="KN400_0134"
FT                   /product="diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82997"
FT                   /protein_id="ADI82997.1"
FT                   /translation="MNHFQYKGNELHAEEVSLKEIVARVGSPVYVYSHATLTRHFTAFD
FT                   EAFAGVPHTICYSVKANSTQAVLRTFITLGGGADIVSGGELYRALQAGVDPKKVVYSGV
FT                   GKKDDEIEYALNTGILMFNVESEQELTRISEIASRMGKKAGIAIRVNPDVDPQTHPYIT
FT                   TGLKNAKFGITIDRAMAEYARAKTLPGIDVIGIDMHIGSQLTKVTPFVDSIEKLKTMIA
FT                   NLRGQGIDLQYFDCGGGLGIQYSTEEPPLPADYGKEIVAATKELGMHLLFEPGRNIVGN
FT                   AGILVATCLFTKERDEKNFIMIDAGMNDLARPALYGSFHGVQPVVKDQDGMIVADIVGP
FT                   ICESGDFLVKDREVPMFRQGDLMAFMSAGAYGFAMSSTYNSRPRVAEVMVKGNQFEVVR
FT                   ERETVEDLIRGERVPSFL"
FT   gene            145709..146581
FT                   /gene="dapA"
FT                   /locus_tag="KN400_0135"
FT   CDS_pept        145709..146581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="KN400_0135"
FT                   /product="dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82998"
FT                   /protein_id="ADI82998.1"
FT                   /translation="MFKGSIVAIVTPFTNGAVDQEKLRELVEFQITNGTDAIVPCGTTG
FT                   ESSTLDYDEHMDVVKIVIEQVNKRVPVIAGTGSNSTAEAIELSRKAKEAGADGVLLVTP
FT                   YYNKPTQEGLVRHYTAIADAVAIPQILYNVPGRTGVNMLPETVARLAPHKNIVAIKEAT
FT                   GSLQQASEILALCGDQIDVLSGDDFITFPMMACGAKGVISVLANIMPKAVADLTDAFFA
FT                   GDLETARRLHLNTLKISNAMFIESNPIPVKTALGLMGKCSDEVRLPLCPMSEGNKAKLT
FT                   AIMKEYQLI"
FT   gene            146603..147403
FT                   /gene="dapB"
FT                   /locus_tag="KN400_0136"
FT   CDS_pept        146603..147403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="KN400_0136"
FT                   /product="dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82999"
FT                   /protein_id="ADI82999.1"
FT                   /translation="MTKIAVCGAAGRMGQRIIVAAREAGCTISGALERPGHEMVGQDAG
FT                   LIAGCGALGVAISDDLNAVVEGCDVLIDFTTPKVSLKNLEVCAIKKKSIVIGSTGFTPE
FT                   ERALAVELAREIPAVLAPNMSVGVNVCFKILKDVAKTLGDDFDVEIVELHHNKKKDAPS
FT                   GTAVRMGEVVAEALGRDYNKVATYHREGICGERTKEEIGMQTVRGGDIVGEHTVYFIGM
FT                   GERIEISHRAMTRDMFSRGSVRAAQWVVGKAPGLYDMQDVLGLK"
FT   misc_feature    147404..147523
FT                   /note="conserved nucleotide sequence; KN400_R0056"
FT   gene            147605..148837
FT                   /gene="dapL"
FT                   /locus_tag="KN400_0137"
FT   CDS_pept        147605..148837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapL"
FT                   /locus_tag="KN400_0137"
FT                   /product="L,L-diaminopimelate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83000"
FT                   /protein_id="ADI83000.1"
FT                   /translation="MAKINDHYLKLKAGYLFPEIGRRVREFAAANPSAKVIRLGIGDVT
FT                   RPLAPAVIKAFHEAVDDLATTENFAGYGPEQGYDWLINAIIEKSYKPLGVDLKTEEMFI
FT                   SDGSKCDCANILDIFALDNVVAIGDPVYPVYNDTNVMIGRTGEADDKGYYKGIVYMPCT
FT                   EENGFIPSLPTEKVDIIYLCFPNNPTGTVATKAELKKWVDYAIANDAVIFFDAAYEAFI
FT                   TDPAIPHSIYEIEGAKKCAIEFRSFSKTAGFTGVRCGLVVVPEEVMGTTPTGEKYSFNK
FT                   LWLRRTTTKFNGASYPVQKAAAAVYSDEGWQQNKEIIDYYMENARIIREGLAAAGLTVY
FT                   GGVNAPYIWLKTPGGMSSWDFFDKLLNECNVVGTPGSGFGPSGEGFFRLSAFGHRENVI
FT                   EAVERIKKNLK"
FT   gene            148959..149246
FT                   /locus_tag="KN400_0138"
FT   CDS_pept        148959..149246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83001"
FT                   /protein_id="ADI83001.1"
FT                   /translation="MGATLVLRNKKVREGIIIELAVWILDAPVDGCSHRFKYRLFCGVL
FT                   ETGSSLVRYDNERGKGDHRHVVDGEQPYVFTSLEKLFADFEGDVREVLKK"
FT   gene            149243..149605
FT                   /locus_tag="KN400_0139"
FT   CDS_pept        149243..149605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83002"
FT                   /protein_id="ADI83002.1"
FT                   /translation="MKRDIKIGIKSDDEFFSEARDLARSIDNGWRPEQPVERLYFEDLP
FT                   TLLKYLTPKRFELLNTLHAMGHVSINALAKKLHRQYRNVFDDVKTLERLGLVEKDEESR
FT                   FFVPWDEIDATFRLAA"
FT   gene            149673..151028
FT                   /locus_tag="KN400_0140"
FT   CDS_pept        149673..151028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83003"
FT                   /protein_id="ADI83003.1"
FT                   /translation="MKTSVKTISKKLQHSLQKGITELSVAGYKSIGRLQTIDLKPLTIL
FT                   SGSNSSGKSSIMQPLLLLKQTLEAGYDPGPLLLNGPNLKYNSASDILTQCKNNKLNSFS
FT                   VGIRVAKNELLTTSYKKQINKGFKIDEMTYGDKNEIHFNQSMSASDTERIVPNEFKDLY
FT                   KVLPKKYRPEIEWHITRNRCFLEAVPKSKDGSQMGPNVSPSSIVANAIRNIIHLPGLRG
FT                   NPARTYPITAVGRSFPGTFETYSASILADWQDSKNNKLRELCADLERLGLTWKVAASRI
FT                   NDTQVELKVGRLPHATRGGAMDLVNIADVGFGVSQTLPVVVALHVAAPGQTVYLEQPEI
FT                   HLHPRAQAVMAEVITDAVNRGVKVVVETHSSIFLLTMQSLVAEEKLPSDVVSLHWFSRD
FT                   DDGLTIVTSASLDSSGSFGQWPEDFGAVNLEIESRYLDAFESKLGVDSSGCK"
FT   gene            151015..151566
FT                   /locus_tag="KN400_3414"
FT   CDS_pept        151015..151566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_3414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_3414"
FT                   /db_xref="EnsemblGenomes-Tr:ADN78310"
FT                   /protein_id="ADN78310.1"
FT                   /translation="MAANKSRIFVVDTCVVRSAGGEDAVFPTSKHCRDFLKNILTICHR
FT                   VVLTSEIGTEWHKHASGFARKWRVQMESRKKICRPIVASRPELLKKIKDLPFSEAEREA
FT                   LEKDFMLIEAALSTDCCISSMDEIVKQLLVKAASNVGELKQIIWVNPDKSPQELTDWLA
FT                   EGALPSKGPTLGEGKGDVAC"
FT   gene            151594..151899
FT                   /locus_tag="KN400_0141"
FT   CDS_pept        151594..151899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0141"
FT                   /product="transposase, Y1_Tnp domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83004"
FT                   /protein_id="ADI83004.2"
FT                   /translation="MPRQPRLDIPNILHHVIVRGIERRDIFDDNHDRARFVSRLSELLT
FT                   QSGTRCFAWALMSNHFHLLLMPTTVPLAQTMRRLLTGHAVYFNRRHKRTGHLFQNR"
FT   gene            152145..153311
FT                   /locus_tag="KN400_0142"
FT   CDS_pept        152145..153311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0142"
FT                   /product="Fic family protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83005"
FT                   /protein_id="ADI83005.2"
FT                   /translation="MFTEVSPRGGRLVVQQKGAEGYSAFVPHPLPPNPPLQIDDEMGWL
FT                   MERANRALGRLDGCTYTLPNPDLFLYMYVRKEAVLSSQIEGTQASLDDLLEYEGEIEGK
FT                   SSPDDINEVSNYVDAMNYGLERLQELPLSLRLIKEIHARLMAGIRGGHKSPGEFRTSQN
FT                   WIGGTRPGNAAFVPPPANEVVTCLGDLEKFLHDESVPPLLKAGLAHAQFETIHPFLDGN
FT                   GRMGRLLIAFILCHDQVLEKPLLYLSLFFKKHRQEYYERLNAVRRDGDWEGWIKYYLQG
FT                   VYEISKQATDAAKAIMDLMARDRQKVTGLGKAAPTALALLEMLYRKPYVTIPYVARELR
FT                   ISSPAASKAVNNLAALGILIEVSGKKRDRVFLHESYLSIIREGTELYR"
FT   gene            153433..155070
FT                   /locus_tag="KN400_0143"
FT   CDS_pept        153433..155070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0143"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83006"
FT                   /protein_id="ADI83006.1"
FT                   /translation="MISTSNISLAYGKRVIFKDVNIKFVPGNCYGLIGANGAGKSTFLK
FT                   ILAGLSEPDSGTVSVGPRERISFLKQDQFAFDEHTVFNTVIMGNPRLYEVMHEREAIYA
FT                   KAEFSEEDGIRSAELEAEFAEMDGYEAESEAAVLLNGLGIPEELRHKQMKELEGGEKVR
FT                   VLLAQALFGNPDVLLLDEPTNHLDLKTITWLEDFLARFNNTVIVVSHDRHFLNQICTHV
FT                   ADIDFGRIQVYVGNYDFWYQASQLTLKQKQDESRKIADKAAELKEFIQRFSSNASKAKQ
FT                   ATSRKKLLEKLTVEEMPVSSRKYPYVVFKPERPCGDVILEISGLSKEIDGVQVFKDLDL
FT                   IVGKGDKIAFVGANSLAKTTLFQILAGELEPDAGSFRWGVTITSAYFPKENGSYFDNDL
FT                   NLIEWLGQFAPPTEGESFARGFLGRMLFSGDEATKKASVLSGGERVRCMLARMMLLGAN
FT                   ALVLDEPTNHLDLESITALNNGLIAFSEVVLFSSHDHEFVNTLANRIVEFTPGGIIDRK
FT                   MTFDDYLESAEVAEERDRLCQGHCDLTL"
FT   gene            155100..155582
FT                   /locus_tag="KN400_0144"
FT   CDS_pept        155100..155582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83007"
FT                   /protein_id="ADI83007.1"
FT                   /translation="MTKQHLVATIIARLEADLALFTAAALHAHAAATHEECQPDNKYDT
FT                   TALEASYVAQGQANRAQEIRQSLEAYRSLELQEFDAGAPVRLSALVTLEDEAGRTRRLF
FT                   IGPQAGGMKLADPAGEIVVITPASPLGNRLLGLAAGDEVQGVDAGKGKFYTIVAVT"
FT   gene            155603..156058
FT                   /locus_tag="KN400_0145"
FT   CDS_pept        155603..156058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0145"
FT                   /product="protein of unknown function DUF188"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83008"
FT                   /protein_id="ADI83008.1"
FT                   /translation="MKIWIDADACPRAVKEILFRASTRLRVPLCLVANRSLAKHAGPLV
FT                   ESVVVADGFDVADDYIAEHAAPTDLVVTADVPLAARIVAKGGVALDPRGELYSEESIGE
FT                   RLAMRDLLSELRDTGMIQGGGPAPFSMSDRNRFASALDSLLHRMLRR"
FT   gene            156263..156640
FT                   /locus_tag="KN400_0146"
FT   CDS_pept        156263..156640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83009"
FT                   /protein_id="ADI83009.1"
FT                   /translation="MTNNPIVWFEIYVQDMERAKKFYESVLGLSLTQLESPIPGMEIWS
FT                   FPMLENAPGASGALVRMEGKPSGGNGTLVYFSCADCSVEASRVVASGGQIFREKFPIGQ
FT                   YGFIALVIDTEGNMIGLHSME"
FT   gene            156887..157618
FT                   /locus_tag="KN400_0147"
FT   CDS_pept        156887..157618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0147"
FT                   /product="cupin superfamily barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83010"
FT                   /protein_id="ADI83010.1"
FT                   /translation="MYQEPEPGLYRHYKGGEYRVVGTARHSETDEPMVVYRCLYDNNSL
FT                   WVRPLAMFLGTVAVDGAERPRFSLVAPDRSGGPAAAELIAGLGLERHPEGGWYRETYRA
FT                   AGTIPGTLLPGQVGGERSFSTAIYFLLERGDISALHRIRSDELWHFHAGAPLIVHVITP
FT                   AGGSYALTLGSDPASGETFQAVVPAGCWFGAETTGDYSLVGCTVAPGFDFADFEMGSRA
FT                   DLLGRFPTHAGIIRRLTRDGD"
FT   gene            complement(157815..159377)
FT                   /gene="ato-2"
FT                   /locus_tag="KN400_0148"
FT   CDS_pept        complement(157815..159377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ato-2"
FT                   /locus_tag="KN400_0148"
FT                   /product="succinyl:acetate coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83011"
FT                   /protein_id="ADI83011.1"
FT                   /translation="MSELHRRIRKTNLHERIRTVEEVIPLFQDGMNLGWSGFTPAGYPK
FT                   AVPIALADHVEKNGLQGKLRFNLFIGASVGVETEDRWASLDMIDRRWPYQTGKNIQAGI
FT                   NSGRIRMGDRHLSMFAQDLGYGFYTKENGGRLDLAIIECSAITENGGLVLTASCGAVPE
FT                   IVQIADKIIIEINTAIPNYEGLHDIIEPVSPPNRLPYLISRVDDRAGSPYVRVDTDKIV
FT                   AIVESTHPDNGRAFAEQDDTSEAIANNILDFFQAEVKAGRLPKNLLPLQSGVGSIANAV
FT                   IGGLAKGPFSGLRVWTEVLQDTMLDLFDSGKLDFASTVSLSFSVDGFKRFYGDWDKYSD
FT                   KVIMRPLSIANHPEPIRRLGCIAMNTPVEFDIYAHANSTLVGGTRMINGIGGSGDFLRN
FT                   AYLSIMHTPSARPTKTDPTGITCVVPHVPHVDHTEHDLDVLVTEQGLADLRGLAPKDRA
FT                   REIIAKCAHPDYKPLLTEYLEMATRDCMARKAGHEPQLLDRVFKMQVNLAKNGTMKIDN
FT                   WDI"
FT   gene            159611..160222
FT                   /locus_tag="KN400_0149"
FT   CDS_pept        159611..160222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0149"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83012"
FT                   /protein_id="ADI83012.2"
FT                   /translation="MTRADCRSRLMEVATELFAQKGFYGVSIRELAQAAGASISMISYH
FT                   FGGKEGLYAAVLQEQFACFGQLDDIRGQAGDPLAVMTAYLRWTIQRHRNNPQLLRFYTS
FT                   ELTNPTPCFAAIVSPAIASVIRLLAESIEAGMTRGLFRRDLHAVNSALALAGMVNYFFL
FT                   STLATEGLTSHSPDQDEELIRQYVAIFTRGIMADGGAAPA"
FT   gene            160344..160718
FT                   /locus_tag="KN400_0150"
FT   CDS_pept        160344..160718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0150"
FT                   /product="protein of unknown function DUF1992"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83013"
FT                   /protein_id="ADI83013.1"
FT                   /translation="MDILATMAERKIQEAMARGELSNLVGAGKLLAMDEDLSGVPAELR
FT                   MAYRILKNAGFVPPEVELRKEIVSLRELVNSLEESEERRQRRRELDFKLLKLAMMRNRP
FT                   MNLDDFPEYRDKVAAKLGGE"
FT   gene            160728..161249
FT                   /locus_tag="KN400_0151"
FT   CDS_pept        160728..161249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0151"
FT                   /product="acetyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83014"
FT                   /protein_id="ADI83014.1"
FT                   /translation="MKIQKPAIEARPKIYALLRSSFPGSEYEAALVQKLHENDRSIHEW
FT                   ACIIGGKVIAYIAFTNAYHGRDVCGLHLAPMAVAPEFQGRGVGLELLRFALRQEAISSR
FT                   TLFVLGEPAYYSRFGFEPCSTPICPFDKNNEHFLGMRNTATDSFVVGYEPEFTTAAPTA
FT                   ATKGRKRGRR"
FT   gene            complement(161355..161699)
FT                   /gene="hxlR"
FT                   /locus_tag="KN400_0152"
FT   CDS_pept        complement(161355..161699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hxlR"
FT                   /locus_tag="KN400_0152"
FT                   /product="helix-turn-helix transcriptional regulator HxlR"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83015"
FT                   /protein_id="ADI83015.1"
FT                   /translation="MSTTSSDRLVYRGKEYTCGIDVTLAVVGGKWKASILWHLAQQTMR
FT                   FSDLQRQFSDTTRKMLTQQLRELETDGLVHREVYPQVPPKVEYSLTPKGMSIYPILQQM
FT                   CSWAREHLRD"
FT   gene            161854..162489
FT                   /locus_tag="KN400_0153"
FT   CDS_pept        161854..162489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0153"
FT                   /product="flavodoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83016"
FT                   /protein_id="ADI83016.1"
FT                   /translation="MKVVAFNGSPKADGNTWHALKMVTAELESEGIETEIVHVGNKVVR
FT                   GCIACGQCAKNKNERCVLPGDEVNEWIQKMKQADGIIISSPVYYSAIAGTMKSFLDRAF
FT                   YVTGVNDGMLRHKVGASVVAVRRSGGIPTFNQLNNFLTYAEMLVPTSNYWNVIHGRAPG
FT                   EATQDEEGVQIMRVLGKNMAWLLKLVEHGKGAVTPPERETKTYMSFIR"
FT   gene            162645..163154
FT                   /locus_tag="KN400_0154"
FT   CDS_pept        162645..163154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83017"
FT                   /protein_id="ADI83017.1"
FT                   /translation="MHHLKYLTGYPPQLTAQVAQLVTENRLGEVLVQRYPTVHDVRTDR
FT                   ALYDFTVAVKNEFMRTAQPLSRVLYDGKIHAIKNALGTHTFVSRVQGGKLKAKHEIRIA
FT                   SIFREAPLEFLKMIVVHELAHLKEKEHNKAFYQLCEYMEPRYHQLEFDTRLFLTQVEIA
FT                   GSPYLP"
FT   gene            complement(163200..164129)
FT                   /locus_tag="KN400_0155"
FT   CDS_pept        complement(163200..164129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0155"
FT                   /product="peptidoglycan L,D-transpeptidase lipoprotein,
FT                   YkuD family, TPR domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83018"
FT                   /protein_id="ADI83018.2"
FT                   /translation="MTFTRHRMAARFFPVCICCMLLLCGCSHHRAASIFQEANDLFSQG
FT                   NYSASLDAYTRIGETHPAAKDRVLFEKGFIHAYPRNEHKDYQKALECFEQLVREFPESR
FT                   YRQDSERMIFGINTVVLKDGTIAAQQARIEALRQDLDDRNKDIAALRETIKILEQKVFA
FT                   IATRKGAVDKILIEKKDRRLSLLSMGEVIRTYKVALGGNPVGPKERQGDNKTPEGSYVI
FT                   EGRNKGSRYHLSLRISYPNEKDKKRAREMGVSPGGDIMIHGIKNGLSQVGAAHAEVDWT
FT                   QGCIAVTDEEIEEIAEAAPNGTVVEIRP"
FT   gene            complement(164285..164587)
FT                   /locus_tag="KN400_0156"
FT   CDS_pept        complement(164285..164587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0156"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83019"
FT                   /protein_id="ADI83019.1"
FT                   /translation="MKTRLSVISVTLILAAALAGCATSREMEQVQADQRLLDAKIEQAL
FT                   QEAQAAKAAADAAKLEAQDATTRAESAEKAAQERERLADEKAKKADAVFQKSMRK"
FT   gene            complement(164686..165993)
FT                   /locus_tag="KN400_0157"
FT   CDS_pept        complement(164686..165993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0157"
FT                   /product="peptidoglycan L,D-transpeptidase lipoprotein,
FT                   YkuD family, SPOR domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83020"
FT                   /protein_id="ADI83020.1"
FT                   /translation="MRRIVTLPTVAYWLRSAVLGICVIALTGCAATRQAWFSPVHPESE
FT                   LERNRFQVAPGTDVIGRLGLVKLEEGDTLPDVARHFSVGINAISAANPGVDVWLPKAGQ
FT                   RITLPLNFILPDAPRKGIVINLATMRLFQFKENGGALAVSTYPVGIGTKERPTPQGPTR
FT                   VARKASRPTWYVPASIAEDHRKKGDILPARVPPGPENPLGDYALYLSRSGYLIHGTNKP
FT                   ASIGLKASNGCMRLYPEHIEVLFRDTAVNTPVLIVNQPYLIGQRDGVLYMEAHTPLEDS
FT                   GTSELARIHAKLKSFESASARTLDWDKIKQVQAEARGIPVPILELRPGAEQEAASPLRI
FT                   EHPAALYGRPELPALKLDAWYVMVGDMRDEMEARRMAAIINHQGPPIPARVLSKDSSYR
FT                   IIAGPFSDDGKARDAAKRLKIDLDIDGIVIEPGRTI"
FT   misc_binding    complement(166024..166138)
FT                   /bound_moiety="cyclic diguanylate"
FT                   /note="cyclic diguanylate-responsive riboswitch;
FT                   KN400_R0057"
FT   misc_binding    complement(166224..166337)
FT                   /bound_moiety="cyclic diguanylate"
FT                   /note="cyclic diguanylate-responsive riboswitch;
FT                   KN400_R0058"
FT   gene            166578..167225
FT                   /locus_tag="KN400_0159"
FT   CDS_pept        166578..167225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0159"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83022"
FT                   /protein_id="ADI83022.1"
FT                   /translation="MFDGIFWDNDGVLMETEHLYYRANAEALARVGVELSLDDFCRISL
FT                   RRGESVLDLAAGPGRDDRAADDLRLVRDEIYFRLLGEEARVMPGVLDTLERLHGRLPMA
FT                   IVTSCRRVNFLQMHRGSGLLHYFDFILTREDYGASKPDPEPYLAACARAGLDPGRCLAI
FT                   EDSERGVTSAARAGLAVAAIPGTMNQGGDFGAARWLLDGIHQLPPLLNLDEE"
FT   gene            complement(167251..168456)
FT                   /locus_tag="KN400_0160"
FT   CDS_pept        complement(167251..168456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0160"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83023"
FT                   /protein_id="ADI83023.2"
FT                   /translation="MTSLRRNIPLLYAFSFLQMTLFPMAVITLFWKDQIGLSLSEILLL
FT                   QSIFAVAMAVMEYPSGYISDRIGYRAALTAASALGIAGWAVYTAATSFRDVLIAEILLG
FT                   IATSFISGTDSALLYESLKEQGEETAYARHEGRSTFFGQTGEAAGALFAGVLYARYPLL
FT                   PFFLQVGVWVLALFLTRRLTEPARERHHQASHLKEALASASYVFVRNRRLRATILLSIA
FT                   LGLASFYPVWLIQPYMRDSGVPLASFGPIWAGANLVVALFAVLSHRVRAGLGDRPMLLL
FT                   LVLLVWVGYLGLGWTAGAWSFLFYYLLTAMRGMRGPLLLHLVQDEIPSANRAGMLSLQS
FT                   LCFRLLFACTAPLVGRYADAAGAGGTFRLLAAAYLLVLPPLVYLFFRHLHADGSSACKG
FT                   GT"
FT   gene            complement(168631..169113)
FT                   /locus_tag="KN400_0161"
FT   CDS_pept        complement(168631..169113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0161"
FT                   /product="protein of unknown function DUF1579"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83024"
FT                   /protein_id="ADI83024.2"
FT                   /translation="MQAEPQQEHLWLQQLVGDWTYEAEALIEPDKPSETCTGSETVRPV
FT                   GGLWILAEGTGGMPGGGDATMLLTLGYNPQKQRYVGTWVGSMMTHLWVYDGELDKDGKT
FT                   LTLNSEGPDCSAEGKMTAFRDVIELKSRDERTLTSYMLTGDGTWLRVMTARYRRVA"
FT   gene            complement(169214..169561)
FT                   /locus_tag="KN400_0162"
FT   CDS_pept        complement(169214..169561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0162"
FT                   /product="helix-turn-helix and zinc ribbon transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83025"
FT                   /protein_id="ADI83025.1"
FT                   /translation="MNRRARKPAVPRPAQETARRAVITLIRNHPLSARDISGQAHMTEK
FT                   DVYSHLEHIRLSIHATGEFLEITPAECRSCGFVFSKRDRLTPPGRCPVCRDEFIFEPLF
FT                   AIRRREDRSRE"
FT   gene            complement(169558..169902)
FT                   /locus_tag="KN400_0163"
FT   CDS_pept        complement(169558..169902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83026"
FT                   /protein_id="ADI83026.2"
FT                   /translation="MSGKKLHHEHDSGINDLHQERPCHHPHAPEPHRTTREPGTAMTSL
FT                   RRNISLLYAFSFLQMTLFPMAVITLFWKIGQSLSEILLLQGIFAVAMVVIECPSGYFRD
FT                   RISYRRSKAP"
FT   misc_feature    170164..170187
FT                   /note="palindrome; KN400_R0117"
FT   gene            170218..171600
FT                   /gene="dbpA"
FT                   /locus_tag="KN400_0164"
FT   CDS_pept        170218..171600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dbpA"
FT                   /locus_tag="KN400_0164"
FT                   /product="ATP-dependent RNA helicase DbpA"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83027"
FT                   /protein_id="ADI83027.1"
FT                   /translation="MNPKAFSSLRLKAPMLRNLASLGYAEMTPIQAHSLPLILAGKDVI
FT                   ARAKTGSGKTAAFGIGLLSRLDALSFRVQALVLCPTRELADQVGKELRRLARFTDNIKI
FT                   LTICGGVPFGPQLGSLEHGAHVVIGTPGRLLDHLRRGSLDLSALRTLVLDEADRMLDMG
FT                   FQDDISALIAAAPPKRQTLLFSATYPDSIAAMSAGVQREPVEVSVDEVHGEGAIEQVFY
FT                   EVDSGQRIEAVERILGHYRPESALIFCNTKLECQEVANALAVRGYAALAIHGDLDQRER
FT                   DRVLVRFANRSASVLVATDVAARGLDIKELSAVINYELTRNPEVHTHRIGRTGRAGERG
FT                   LAVSLVTPRESRLIETIADVPGSTIVRGDLSTLAPLTAKPPLPPMVTLCIDGGRKNKLR
FT                   PGDILGALTGEGGMPASEVGKIDVFDFFTYVAIARQSSEQALNFLRGHRIKGRFFKVRK
FT                   AV"
FT   gene            complement(171732..171881)
FT                   /locus_tag="KN400_0165"
FT   CDS_pept        complement(171732..171881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83028"
FT                   /protein_id="ADI83028.1"
FT                   /translation="MAKPNFQFQKRQKELERKKKMEEKQQRKLAKKDRLPGSIESTSPG
FT                   GETE"
FT   misc_feature    complement(171972..172011)
FT                   /note="conserved palindrome; KN400_R0118"
FT   gene            complement(172027..172227)
FT                   /locus_tag="KN400_0166"
FT   CDS_pept        complement(172027..172227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0166"
FT                   /product="cold shock DNA/RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83029"
FT                   /protein_id="ADI83029.1"
FT                   /translation="MVNGTVKWFNDSKGFGFLEQENGEDVFCHFSAISGDGFKSLTEGD
FT                   RVTFEITKGPKGLQAANVTRA"
FT   misc_feature    complement(172233..172278)
FT                   /note="conserved nucleotide sequence; KN400_R0119"
FT   gene            172630..172872
FT                   /locus_tag="KN400_0167"
FT   CDS_pept        172630..172872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83030"
FT                   /protein_id="ADI83030.1"
FT                   /translation="MTIKVGNIVSHTGGLGWGSGKVLEVTATLAMIQFSDGKSRKIAAS
FT                   YFCTLEPAAPDSYVPPPEAAVVAKPSRPPRMTKKK"
FT   gene            complement(173113..174252)
FT                   /locus_tag="KN400_0168"
FT   CDS_pept        complement(173113..174252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0168"
FT                   /product="glucose/sorbosone dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83031"
FT                   /protein_id="ADI83031.1"
FT                   /translation="MHPIKTLRFLLAHLFLLAAATGCNAARTLPAAITLPPGFSIAVYA
FT                   DNVPGARSMALGAKGTLFVGSRGEGKVYALADRNSDQVADEVITIAKGLQMPNGVAFRN
FT                   GSLYVAEVSRVLRYDAIEERLKNPPPPVVVNDSFPDRTHHGWKFIRFGPDGRLYVPVGA
FT                   PCNVCEEKDPRFATIMRMNPDGTGLEIFANGVRNTVGFDWHPRTGELWFTDNGRDWLGN
FT                   DLPPDELNRAPRSGLHFGFPYRHGRDIPDPEFGAKRKPDQLVAPEMELGPHVAALGMRF
FT                   YNGTMFPERYRNQIFIAEHGSWNRSERIGYRVVLVRLEGNRAVSYEPFAEGWLDNDKVW
FT                   GRPVDVQVMPDGSLLVSDDKAGAIYRISYRQQPLAHGAQ"
FT   gene            174422..175504
FT                   /locus_tag="KN400_0170"
FT   CDS_pept        174422..175504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0170"
FT                   /product="ADP-ribosylglycohydrolase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83033"
FT                   /protein_id="ADI83033.1"
FT                   /translation="MSEATTIRDRAAGAVMGAFVGEALGLGPHWYYDLDEMRRDFGPWI
FT                   SDYTDPRPDRYHAGLKAGQLSQAGYILKLLLRSLVACGGYDEADFCRRLDEELLPLLDG
FT                   TPVCGPGGYTSQSIRELWRQRVELKLPWGRTGGHADTTEAAERTLALAVRYACEPARLA
FT                   AAVAGNCVLTQIDDTVVSMTTAYGAVLGMLVRGHPLDADLSARLMALVARGELPFHAVT
FT                   TGNLQPPRPGEPDPPRAGKFASPDALLTPSYMAAAAADPQVRIEPAWKVSVVYGMPCAI
FT                   YHILPAVYYLAARFRDDFEAAVLHAVNGGGQNQARAMLAGALVGAQVGLSRIPWRFIDS
FT                   LEESATLCRLADDLAAQVCA"
FT   gene            175559..175777
FT                   /locus_tag="KN400_0171"
FT   CDS_pept        175559..175777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0171"
FT                   /product="flavin and coenzyme A sequestration protein
FT                   dodecin"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83034"
FT                   /protein_id="ADI83034.1"
FT                   /translation="MYGKDRIYKKVEIIGVSGVSIEGAIETALVRARNSLDKLSWFEVQ
FT                   EVRGHIGADGKVAEYQVVLKVSFELKD"
FT   gene            complement(175871..176359)
FT                   /locus_tag="KN400_0172"
FT   CDS_pept        complement(175871..176359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0172"
FT                   /product="acyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83035"
FT                   /protein_id="ADI83035.1"
FT                   /translation="MSETSPQQGAESICPPVDLSGDAGWVPFDAPSLVGESLRFVSGEP
FT                   DGNRFRVRYYRDSEQHLHARIWFGPETEGPPGHAHGGAVSAVMDEALGLAAWAAGYPIV
FT                   VGNLNISFRTMLPLQKVVTVESRVVSAQGRKVMVHGRLFCGDAVYAEGECLCITLPGR"
FT   gene            complement(176440..177204)
FT                   /locus_tag="KN400_0173"
FT   CDS_pept        complement(176440..177204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0173"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83036"
FT                   /protein_id="ADI83036.1"
FT                   /translation="MSRTVFITGASAGFGAACARLFADRGDRLVLAARREEPLLALRDE
FT                   LAPRTEVHAVTLDVRRRKAVQDAIEGLPDAFSQIDILVNNAGLALGLEPAHETNPDDWD
FT                   AMVDTNIKGLIYCTRFLLPGMVARNRGHIVNIGSVAGSWPYPGGNVYGGTKAFVEQFSR
FT                   NLRADLLGKQVRVTCLAPGMAETEFSMVRFKGDAERAAQVYAGTQALTAEDIAGIVAWV
FT                   TELPPHVNVNALEVMSIYQSWGPLAVHRDGAN"
FT   gene            177387..177917
FT                   /locus_tag="KN400_0174"
FT   CDS_pept        177387..177917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0174"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83037"
FT                   /protein_id="ADI83037.3"
FT                   /translation="MKRILLLSMVMLALAGCISGKDWRTASREPAGIAPDPAVTKEAVL
FT                   QVYGARAWGWRGWFAIHTWIAAKGTGEPGYTVYEVVGWRLHRGQPVVRIEKDLPDRFWF
FT                   GEKPRLLKEHRGAGVDELIDAVDRAARSYPWAGTYQAFPGPNSNTFTAWISRQVPQLDL
FT                   DLPFSALGSGYGD"
FT   gene            177994..178203
FT                   /locus_tag="KN400_0175"
FT   CDS_pept        177994..178203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83038"
FT                   /protein_id="ADI83038.2"
FT                   /translation="MLDTRKTTTGSPSTERCDIKTWSGACGHDSYTAIGDKYRCDLCGT
FT                   IADLSHEVKHDTFPYTSGDYDNLS"
FT   gene            178440..178910
FT                   /locus_tag="KN400_0176"
FT   CDS_pept        178440..178910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0176"
FT                   /product="aerobic-type carbon monoxide dehydrogenase, small
FT                   subunit-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83039"
FT                   /protein_id="ADI83039.1"
FT                   /translation="MIVFLVNGKEQRVDVSPDTPLLWVLRDKLGLTGTKYGCGEGLCGA
FT                   CTVHIDGRPERSCITPVGDVQGKKVVTIEGIPENHPVKQAWLAQEVSQCGYCQPGQIMS
FT                   AVALLASKPRPSDADIDTAMSGNLCRCGTYGRIRRAIHAAGGRRAQKGGNRS"
FT   gene            178907..181078
FT                   /locus_tag="KN400_0177"
FT   CDS_pept        178907..181078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0177"
FT                   /product="aerobic-type carbon monoxide dehydrogenase, large
FT                   subunit-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83040"
FT                   /protein_id="ADI83040.1"
FT                   /translation="MSNGNGMSRRQFMKTSAMAAGGLLLACHLPLGRRDAVAGTGDAFA
FT                   PNAFLHIGTDERVTVIVNKSEMGQGVYTSLPMLVAEELCCDWKRVTFRASPVASEYNHT
FT                   QFGPIMVTGGSTSVRSEWSRLSQAGAAAREMLIAAAAQEWRVEPAACRAEKGFVLGPGG
FT                   RKLSFGTLAPKAAALPVPKEPKLKQGAKTLLGKPLKRLDSPAKINGTAVFGIDVRAPGM
FT                   LTALIARPPVFGGTVKRFDVAKAKAVPGVRDVVAVDAGIAVVGEGFWPALKGREVLEIA
FT                   WDEGEGARVSTAAMSEEYARLAATPGAVARKDGDAPAELAKAARRFEAEYEVPYLAHAT
FT                   MEPLNCFVDLRSDSCLIRTGSQFQTGDRNAAARVAGLKPEQVTLETTFLGGGFGRRACP
FT                   ASDFVIEAVQVAKAVGKPVMVIRTREDDMRAGFYRPLWRDCVAACLDERGYPLAWHHRI
FT                   VGQSIMIGTPFEATIKNGIDDTSVEGAADTPYAIPNLQVELHSPRNPVPVLWWRSVGHS
FT                   HTAFVVESFLDELAHAAGKDPYQYRRALLAKHPRHLKVLETAARKAGWGKPLPKDRGRG
FT                   IAVHESFGSFIAQVAEVSLAGDGQVKVHRVVCAVDCGRIVNPDTIEAQMESGITFGLSA
FT                   ALHGAITLRNGRVEQGNFDDYPPVRMAEMPKVEVHIVLSGEDPGGIGEPGVPPIAPAVT
FT                   NALFAASGIRMRSLPLTPEAVKRAGGRAA"
FT   gene            181114..181881
FT                   /locus_tag="KN400_0178"
FT   CDS_pept        181114..181881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0178"
FT                   /product="dehydrogenase molybdenum cofactor insertion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83041"
FT                   /protein_id="ADI83041.1"
FT                   /translation="MTDLELYEEIARLARLGEPFALATVVASSGSSPRKAGAKMLIRGD
FT                   GSALGTVGGGHVEQDTLAAARASLAEGAPRTLEFVLTEEHGYACGGSMSVFIEPQGRRP
FT                   LLVMFGAGHVGRAVTALAHGCGFRVVVIDERPEYAVPALLPGADEIVCAPVDAAFARLT
FT                   LDRESFAVIATPGHVHDFDAVRGCLATEVGFIGLLGSRRKREALMKALTEEGYEAVRQA
FT                   RVVTPVGLDIGAQTPEEIAVSIVGQLVKLRRQA"
FT   gene            181878..182489
FT                   /locus_tag="KN400_0179"
FT   CDS_pept        181878..182489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0179"
FT                   /product="MobA-related glycosyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83042"
FT                   /protein_id="ADI83042.1"
FT                   /translation="MRGSVAALLLAAGRSSRMGRCKQLLPLGNTTVLGRCLDTLRRGGV
FT                   GEIAVVVSADGEQVARAAAGHGARVVVNPDREGDMASSVRAGRDAFGSAVGGVIVSLCD
FT                   QPLVAAGTVARLRDRHATEPGRIIIPTHGGRRGHPLLFPLPVLTELEDGLTLRDLVVCD
FT                   PTRVCCVAVADPGILIDMDTPEDYRHVCRLMAPQEGLSLR"
FT   gene            182554..183912
FT                   /locus_tag="KN400_0180"
FT   CDS_pept        182554..183912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0180"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83043"
FT                   /protein_id="ADI83043.1"
FT                   /translation="MKILLIQPPSHYPLMDQVYLFEPLALEYLGAGARLDGHEVYLLDA
FT                   RLEPDISRVLGEFRPDVVGVTAFTSQVTIAHRIAKEARELLPDAFLVVGGHHATVRPTD
FT                   FNDSAFDAVVIGEGVAALRELLAARERGAPLKDIAGLGVPSPGGMLFTPPRSYTPLDEL
FT                   PLPARDLTARYRAGYFSEWFTPLASIRTSLGCTARCTFCALWSITGGAYLRRDPDRVVE
FT                   ELKGIAEPNVFFCDDESMCDTKRMALLADRIRAAGIRKNYFLYARVDTIVRHPELFRAW
FT                   ADIGLKQVFVGMEDFSDARLAAMKKGVTTDQQARAATILRDLGVMMYASFMVDPDYSRD
FT                   DFRALVAYIRKLRLTYATFTVMTPLPGTELHAAREAELLSTKPELYDMLHALLPTRLPL
FT                   PEFYEEMAGLYGKAVPIHRSLPTLLKFGLHGLLLRMRLFGTFLTRLRAAHLDY"
FT   gene            183937..184563
FT                   /locus_tag="KN400_0181"
FT   CDS_pept        183937..184563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0181"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83044"
FT                   /protein_id="ADI83044.1"
FT                   /translation="MTTRERIIETAIALFNEKGTKAVTTNHIAAAMEISPGNLYYHFRN
FT                   KEEIIRAIFDQMDAVGFEDYEQIIAEHPAGSLAAMEETFLMIQRFNWRYRFFKRELTSL
FT                   ILSDPLLREKHLRVHQAMLRLVRHSIESSIAQGVLRPMEEDELGLFAEEIWLLTLFWLN
FT                   YLEVGGEAVTDSTLRRGNELVRRTVCCRLTEEGARMLGRSGPAAS"
FT   gene            184560..185462
FT                   /locus_tag="KN400_0182"
FT   CDS_pept        184560..185462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0182"
FT                   /product="transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83045"
FT                   /protein_id="ADI83045.1"
FT                   /translation="MNPVLLALGLTLFAGMATGIGSAIAFFAKRTNYRFLSVATGFSAG
FT                   VMVYVSFVEILPKGLDSLVRSCGEPWGHWLNAASFFGGMLCIGLIDAVIPAAKNPHEIH
FT                   ADQEIAPLHDRSAPLPDFGSLAAEPRYAPTGTHDHRPPQRHLLRMGLFTALAITIHNFP
FT                   EGMATFLAALENPRVGAAIAVAIALHNIPEGVSVSVPIFYATGNRRKAFALSLLSGMAE
FT                   PVGATIGYLALLLFSGGASGAIPDQVTGALFGGVAGIMVYISLDELLPASRAYGKGHDS
FT                   LLGLVGGMAVMALSLLLMK"
FT   gene            185658..185858
FT                   /locus_tag="KN400_0183"
FT   CDS_pept        185658..185858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0183"
FT                   /product="cold shock DNA/RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83046"
FT                   /protein_id="ADI83046.1"
FT                   /translation="MVNGTVKWFNDSKGFGFLEQENGEDVFVHFSAINGNGFKSLAEGD
FT                   RVTFEVTKGPKGLQAANVTRI"
FT   gene            186030..186830
FT                   /locus_tag="KN400_0184"
FT   CDS_pept        186030..186830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83047"
FT                   /protein_id="ADI83047.1"
FT                   /translation="MSRLPGKRIVALFLVLGALLCAGIPAWGAAPLVMVDQGHGQRFVI
FT                   EQEGELQLSRFGAILGEEGLRVATSRERLTDESLRQATGLVISGPFAPLAPAEVDAVIR
FT                   FIERGGRVALMLHIGHPVGALMQRVGIAFSNGVLHEQHNLVGTDDISFQVRDLTAHPLF
FT                   AGIDHFSLYGGWALNGQAPLARTSAETWVDLNGDQQLTERDAMDRFTVVAEGNVGAGLI
FT                   LVFGDDAIFQNRYLDEANSRLARNLAQWLGGGKLPGGKDRGRDM"
FT   gene            186988..187182
FT                   /locus_tag="KN400_3415"
FT   CDS_pept        186988..187182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_3415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_3415"
FT                   /db_xref="EnsemblGenomes-Tr:ADN78311"
FT                   /protein_id="ADN78311.1"
FT                   /translation="MSPVCLTTKRENARRTSKAATVPPCFVFEVVSGLRLESWLDLLTA
FT                   YMSMLQIMALVCLTIYNIP"
FT   gene            187306..188298
FT                   /locus_tag="KN400_0185"
FT   CDS_pept        187306..188298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0185"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83048"
FT                   /protein_id="ADI83048.1"
FT                   /translation="MRKFGFLAVFMSLSLVLLSTAMAAPPGGKVLIGVSKIVSHPALDA
FT                   VEKGLQDELAALKINAQYDLQNANGDANTAASIANKFQSEKVTLAVGIATPTAQSLVNT
FT                   LKTTPVVFSAVTDPVKAGLVKSLAKGEKYVTGVSDMTPVKQQIELLLKIKKVKRLGHIY
FT                   TSSEENAVVLAGVVKKACQDLGIQYVETTVSKSAEVKQATQSIIRRVDALYVSTDNTVV
FT                   SAMSALTDVAMKNKVPVMSADPSSAESHPVLAAWGFDYYKMGRATGKMVAEILKGKKPE
FT                   QLPTRFMTKASDVDLLVNLDVAKKLGLTVPAAIVKSANKVVENGKLTKK"
FT   gene            188315..189226
FT                   /locus_tag="KN400_0186"
FT   CDS_pept        188315..189226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0186"
FT                   /product="ABC transporter, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83049"
FT                   /protein_id="ADI83049.1"
FT                   /translation="MIEGIFVEGLIYGIMVLGVFISFRILDFPDLTVDGSFPLGAALMA
FT                   QCIMMGVNLWLALLIAFAGGVIAGVVTSLIHNHLKVPNLLAGILTMTMLYSVNIRVLGN
FT                   RANVPLLNQETILSQVTERLTGIIPDEYILLVFFAVVTLVIKLLLDLFFRTDLGLTIGA
FT                   MGNNEQMVISQGVNPQTLKSIGLGLSNGLVALSGAFAAQYLGFADVGLGQGIIISGLAS
FT                   VMIGEFLIMKSNRIGVLTLCAVLGSICFYAVMYVGRYYGYVINMTPNDLNLIKGILIIA
FT                   LLVLTQSKKLKKFAVKAVVKND"
FT   gene            189219..190016
FT                   /locus_tag="KN400_0187"
FT   CDS_pept        189219..190016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0187"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83050"
FT                   /protein_id="ADI83050.1"
FT                   /translation="MIELKNVSMIFNPGTVNENQAISNINLKVREGDFITVIGSNGAGK
FT                   STLFNLIAGTITPSSGSIFLNDRNITRDPEYKRAKYIGRIFQNPLLGTASTMSLEDNMM
FT                   ITYKKGFKWLKRSLNHKMREFFRSELVQLKMGLEDRMKENLALFSGGQRQALTLLMMVL
FT                   SRPDLILLDEHTAALDPKNAQIVLELTDKFIREYNLTAMMITHNMSHAIEYGNRLLMMD
FT                   KGEIIFEAEGEEKRALTVEKLIDKFHQIRHTSFENDRTLLSDD"
FT   gene            190058..191566
FT                   /locus_tag="KN400_0188"
FT   CDS_pept        190058..191566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0188"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83051"
FT                   /protein_id="ADI83051.1"
FT                   /translation="MLLIHPPVAKPGEPPAGIARLAGELRAHGLHCRVLDASLEGLLWL
FT                   LEQPSPATDTWTRRASRSRADHVATLRGMDAYRSPDRYRRAVSDLNRLLAAAGRECGAV
FT                   PGLADYRQDGFSPVSSADLLRAAEEPERNPFHPWFSQRLPELLDGVRVAGLSLNYLSQA
FT                   VSAFAMIGFLRTRFPGLTLVLGGGLVTSWLRRPGWRNPFGGLVDHLVDGPGELPLLRLL
FT                   GAEEPLCRDVPPVYDPLPLHDYLSPGLVLPYSAAGGCYWNRCSFCPERAEGNAYRPRAV
FT                   QRVLADLETLVSRHQPALLHLLDNAVSPSLLQGMAAAPPGVPWYGFARVDEQLADPGFC
FT                   RTLRRSGCVMLKLGLESGDQGVLDRLHKGIDLATAARALRSLRAAGIAVYAYLLFGTPA
FT                   ETEEAARRTLAFVAEHREEIGFLNLAVFNMPISGDEADAYGTAPFYEGDLSLYTAFRHP
FT                   RGWDRKQVRRFLDREFTRHPAVAPILRRDPPVFTSNHAPFFAGG"
FT   misc_feature    191703..191853
FT                   /note="conserved nucleotide sequence; KN400_R0120"
FT   gene            191934..192821
FT                   /locus_tag="KN400_0189"
FT   CDS_pept        191934..192821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0189"
FT                   /product="ATPase DUF815, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83052"
FT                   /protein_id="ADI83052.1"
FT                   /translation="MFNLKPELVARLERVLTSVEMLLPRPTAPVDWSVCHAASWRRHSF
FT                   SGYLEPVRQTDTVTLPELLGIEKQKEVMTNNTLQFLRGLPANNALLWGSRGTGKSSLVK
FT                   ALLNEYAAQGLRIVQVEKEDLIYLSEIFAAVENEPYRFILLCDDLSFEVGELSYKMLKS
FT                   ALDGSVYSAPENVLIYVTSNRRHLIPEYESDNVGWKYVNGELQQSEAMEEKISLSDRFG
FT                   LWVAFHVFSQDRYLEAVRLCIEREARQRKVEILWTKEIEREAIQWSHDKSKRCGRTAFQ
FT                   FSRHWVGRYLLGGR"
FT   gene            192986..193858
FT                   /gene="folD-1"
FT                   /locus_tag="KN400_0190"
FT   CDS_pept        192986..193858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD-1"
FT                   /locus_tag="KN400_0190"
FT                   /product="5,10-methylenetetrahydrofolate dehydrogenase and
FT                   methenyltetrahydrofolate cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83053"
FT                   /protein_id="ADI83053.1"
FT                   /translation="MNLLDGKKCAESLVAEIARKVAGYTESGLRTPHMTIILVGEHAPS
FT                   ESYVKSKIATSGLAGFESTLLRFPETIRESELLAKIKEVNEDPTTDGLIVQLPLPKHIN
FT                   QQHVINAIAPEKDIDGFHPANFGRMTLGQKAFRPATAYGICKLLQFYEVPVKAKHCVVI
FT                   GRSNIVGKPISIMLSNDFDIGNATVTLTHIETPRELLLDETRRADIVIVAVGIPGFVTA
FT                   DMVKDGVVLIDVGINRLESGKIVGDVDFENVAQKCSWITPVPGGVGRMTVAALMINTLM
FT                   AYQNNFNLA"
FT   gene            complement(193942..194157)
FT                   /locus_tag="KN400_0191"
FT   CDS_pept        complement(193942..194157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83054"
FT                   /protein_id="ADI83054.1"
FT                   /translation="MKCPVCKAHGQQVAIDLHSEGFSEDIVTCDICGTVWAVNHGAMEI
FT                   ITDPQENSFLEAVTECVEAHDYSFAA"
FT   gene            194685..195251
FT                   /locus_tag="KN400_0192"
FT   CDS_pept        194685..195251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0192"
FT                   /product="nitroreductase-like family 3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83055"
FT                   /protein_id="ADI83055.1"
FT                   /translation="MDTLEAIRTRRSVRAFSDRPVEPEKLQTVLEAARQAPSWANMQCS
FT                   RFVVVQDAEIKAKISELSFVEAFFAPLGYRTNPAQKALAEAPVVIVACGVPGESGDLRG
FT                   QQYYMTDVGIATENLMLAAHAVGLGSVFVGVFDEEQLGDLLDIPPEIRIVGLFPLGYPR
FT                   DEAPAKSGPARKPLDEIVFQGKWKS"
FT   gene            195347..196183
FT                   /gene="sco"
FT                   /locus_tag="KN400_0193"
FT   CDS_pept        195347..196183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sco"
FT                   /locus_tag="KN400_0193"
FT                   /product="cytochrome c oxidase, coo3-type, synthesis
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83056"
FT                   /protein_id="ADI83056.1"
FT                   /translation="MLRYLVVLCLALVLPLHCGAATDGSTPTEEHHHHAAPSAAEAAGV
FT                   GVAERLGEKIPLDLTFNDEAGRPVRLADLVTGPTIILPVYYRCTNVCNFLQNGMAAVIP
FT                   EIRRKPGEEYRVISVSFDETEPPDLAARYRRIYQGAITTPFPENGWRFLTGDATTIRQL
FT                   TDAIGYRFQRKGRDFVHPVASVVIAGDGTIIRYLYGTAFLPKDVTLALLEAREGKVGKT
FT                   IRTVVGYCFSFDPKQKTYVFNLLRVSATVVILTAGAFLAFLLTTGRTGARQRKGGS"
FT   gene            196180..197805
FT                   /gene="coxA"
FT                   /locus_tag="KN400_0194"
FT   CDS_pept        196180..197805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxA"
FT                   /locus_tag="KN400_0194"
FT                   /product="cytochrome c oxidase, coo3-type, cytochrome o
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83057"
FT                   /protein_id="ADI83057.1"
FT                   /translation="MNRSERTGSAAGFWSDTEKGGIGAWLLSTDHKRIGLLYFWSVFGF
FT                   FLVGVVLGLILRLELMAPGRTIMGPDAYNAFFTVHGVVMIFLFIIPGIPGAFGNMLMPI
FT                   QIGARDVAFPRLNLLSWWLYATGAGVILLSLVTGGGPPDTGWTFYLPFSGRTATNVSLA
FT                   VFGVFIVGFSSILTGINFVTTIHRLRAEGMSWGRLPLFVWSLYATAWVQILATPILGIT
FT                   LVLIIAERILGVGLFDPSRGGDPLMYQHLFWIYSHPAVYIMVLPAMGVVSEIIPVFARK
FT                   PIFGYKMIAFSSLAIAAAGSLVWGHHMFTSGISDTAVLVFSFLTFIVAIPSAIKVFNWV
FT                   STLYRGSISLDPPMLFALSFILLFSIGGLTGLILGAAATDVHVHDTHFVVGHFHYVMFG
FT                   GAGFAFFAAMHYWLPKFYGRMYARRPAVIAWILMFVGFNILYFTMKVLGIKGMPRRYYD
FT                   YLPEFATLNLVSTIGSWILALGLAVMLVNLFRGLWKGEPVTEANPWGGATLEWTIPTPP
FT                   PTENFAEEPVVTHGPYDFRGAGTP"
FT   gene            197802..198404
FT                   /gene="coxC"
FT                   /locus_tag="KN400_0195"
FT   CDS_pept        197802..198404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxC"
FT                   /locus_tag="KN400_0195"
FT                   /product="cytochrome c oxidase, coo3-type, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83058"
FT                   /protein_id="ADI83058.1"
FT                   /translation="MSHATHRDYAGAKLGMWLFLFTEMLLFGGLFILYAVYLHRYPAEF
FT                   AAAGHRLDLVLGTANTVILLTSSLLAALAVTAVQRDEGRVALRALGGTILCAGLFLVIK
FT                   YAEWSAKISHGIYPGSPDLAAGPPGESVFFGLYYLTTGLHGLHVLIGGILLTVVARRVK
FT                   GGRVHAGDYIWLENGALYWHLVDLVWIFIFPLYYLML"
FT   gene            198421..198711
FT                   /gene="coxD"
FT                   /locus_tag="KN400_0196"
FT   CDS_pept        198421..198711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxD"
FT                   /locus_tag="KN400_0196"
FT                   /product="cytochrome c oxidase, coo3-type, subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83059"
FT                   /protein_id="ADI83059.1"
FT                   /translation="MTSDSTTHRPVGYGTLASVWVALLILTAATVFVTRLDLGGYKVVA
FT                   ALTIASVKGGLVIAVFMHMKYEGWLLRGLLFLALVTLALFIGLTFFDVLYR"
FT   gene            198721..199635
FT                   /gene="coxB"
FT                   /locus_tag="KN400_0197"
FT   CDS_pept        198721..199635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxB"
FT                   /locus_tag="KN400_0197"
FT                   /product="cytochrome c oxidase, coo3-type, cytochrome c
FT                   subunit II, one heme-binding site"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83060"
FT                   /protein_id="ADI83060.1"
FT                   /translation="MRDFPTTTTEAVDPVFMFILGACILLLTGITVVMVAFVIRYHRSR
FT                   SPEPTSQAATNLWLEIIWTALPTVLVLAMFYYGWSSYLSLRHVPPGAMEVTAVARMWSW
FT                   SFEYQGGKTSPRLYVPVGKPVRVDLVSKDVLHGFYIPAFRVKRDVVPGMKNHVWFVAPK
FT                   AGSYDIFCSVYCGTGHSAMITTVEAVPETEFQAWLSHGEEGEKEKEGHGRELLEKHGCL
FT                   GCHSLDGSPRVGPTFKGIWGHQVTVTEGGVERTLSVDEAYLVRSIRQPAAQVVKGFPPV
FT                   MPPYQGLSDEEVEEMVEFIRELK"
FT   gene            199632..200444
FT                   /gene="ctaB"
FT                   /locus_tag="KN400_0198"
FT   CDS_pept        199632..200444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaB"
FT                   /locus_tag="KN400_0198"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83061"
FT                   /protein_id="ADI83061.2"
FT                   /translation="MTRWDLVLFRPRLALLNGIAAVAGHALVPDAAHATLWAALAGVTL
FT                   LAAGGSALNQVLERDLDRLMERTRHRPLPRGDLSPAMATALGCACIGAGLLVLAAGGPI
FT                   PPLLGAVALTWYLAVYTPLKRRTSLALAIGAVSGALPPVIGWALAGGAPGDYRIILLAG
FT                   IFFLWQVPHFWLFQRRHADDYRRAGIPLFIPGAGRLGPSFHVRLWLGALAASVLLLPAF
FT                   GLMGPRMAPWIAAVPLLLLPVCRPRSEAVLFSCLNAFPPLMALALLLQ"
FT   gene            complement(200465..200797)
FT                   /locus_tag="KN400_0199"
FT   CDS_pept        complement(200465..200797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0199"
FT                   /product="cupin superfamily barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83062"
FT                   /protein_id="ADI83062.1"
FT                   /translation="MSTGNETLAGRAIGMSELAQYQPGSVVSRTLIDKKIGTITLFAFD
FT                   EGQGLSEHTAPYDAFVQIVDGVADITIDGQVHRVAAGQMIIMPADRPHALRAVERFKML
FT                   LVMIRA"
FT   gene            complement(200870..201010)
FT                   /locus_tag="KN400_0200"
FT   CDS_pept        complement(200870..201010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83063"
FT                   /protein_id="ADI83063.1"
FT                   /translation="MTTSELIVTATIWALTAVGGFFALRGIWRRRQHGAAVAAKNRNRL
FT                   P"
FT   gene            201191..202816
FT                   /locus_tag="KN400_0201"
FT   CDS_pept        201191..202816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0201"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83064"
FT                   /protein_id="ADI83064.1"
FT                   /translation="MFLEVIPLTLSLLLTLLPIAVILVMLLVFRKAADVSGIIGWLAIS
FT                   VVAWLGFQTAPEVILRSTAAGFIRSFSVSLIVATSLLQMALMEKTGALRRITIFIRTIA
FT                   SDNRAVQIMMINIGFGTLMVAVGATPVSILPPILLAMGYSTYVAIALPAIGYDSLCTYA
FT                   LLGAPIVVFVDIANSFLGKGNEIALHQAGMVFFMFLPVVSTMIGFCMLWIVGKWQAIRE
FT                   GWLPCLLTGAVIGVVARFTNQYDNLVVLTGVLCGIAVIAAMAAYLVVTGGTVIDRSLLT
FT                   AEEREFAAVMPLWRAFMPWTLLVVLILVLNVPQDLFSWLYRTMKLPITGLTADGKPLDT
FT                   RALWQAYTWILVSTILATPFLKPTGEQLRETLRVWARRAPRPVFAAAIFFAIGEIMNMA
FT                   GYDMAAGRFVVPSMVKVLADSSALAFQGMYGEVVAFIGLFGGFITGSEASTIAMFAKYT
FT                   MTTAKNLDMPLSGLIIVTAGLAFGGGLASVISPAKLQNAAAAIDRIGEEGKVIRIAFVF
FT                   ALLLTLVTSLFVVVLLTVNGMGRV"
FT   gene            202836..203753
FT                   /locus_tag="KN400_0202"
FT   CDS_pept        202836..203753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0202"
FT                   /product="DNA methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83065"
FT                   /protein_id="ADI83065.1"
FT                   /translation="MRAVELFCGIGGFAAAVEGTGVHVVAALDQDDAALATYRLNFPGH
FT                   GARKVDLERVSAWELTAGGVDLWWLSPPCQPYCERGVRRDLADPRARSLVHILDLAARM
FT                   SDEALPRHLALENVAGFVGSEAHGRLTEVLALRGYRLQERLLCPTELGIPSRRPRYYLA
FT                   ASRQALAPVETSSPLPRKPLAEYLDLLPANGQPAELLLSPSIVERFGAGFRILDPADSD
FT                   AYTTCFTSGYGRSLTASGAYLRCNDGVRRFSPEEIARLLHFPPSFRFPEEVPLRKRWQL
FT                   VGNSLSVAAVREVLRALPLPAEEG"
FT   gene            complement(203817..204320)
FT                   /locus_tag="KN400_0203"
FT   CDS_pept        complement(203817..204320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0203"
FT                   /product="peptidylprolyl cis-trans isomerase, FKBP-type,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83066"
FT                   /protein_id="ADI83066.1"
FT                   /translation="MAQAQKGDRVTIDFTGTLEDGTVFDSTLEGAGCDTDDCESDDCGD
FT                   GSCGCGCEESGPMTLTIGGGEFFEKIEEALIGMAPGEKKTVVIPAAEGFGEYDEEKVFT
FT                   VGRSDLPPDLIPEVGQELVISNENDEDFGVTVVEVTDESVTFDANHPLAGEDLTYEFQL
FT                   VEIL"
FT   gene            204489..206141
FT                   /locus_tag="KN400_0204"
FT   CDS_pept        204489..206141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0204"
FT                   /product="acyl-CoA synthetase, AMP-forming"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83067"
FT                   /protein_id="ADI83067.1"
FT                   /translation="MTDTLIPRTPSAYDYPLLIKNLLRNPVVDNPDQEIVYRGVIRHTY
FT                   RDLRERVRRLANVLTGLGVKAGDTVAVMDWDSHRYLELFFAVPMIGAVLHTINVRLSPE
FT                   QILYTIDHAEDDLLLVNSEFLPILEQIRGRIDTVRGYVLLTDEEKMPESHIPFVGEYEA
FT                   LLAASSGEYDFPDFDENTRATTFYTTGTTGLPKGVYFSHRQLVLHTMGVMASLGTVFAH
FT                   GRLHQGDVYMPITPMFHVHAWGVPYLATMLGIKQVYPGRYSPDLLLDLIEKERVTFTHC
FT                   VPTILHMLLKHPHAKRVDLAGLKMIIGGAAMSRALCCEALERGIDVFTGYGMSETCPIL
FT                   TISRLTPEMLAGSPAEQAEIRCLTGLSLPFVDLRVVDPETGAEQPRDGRSAGEIVVRAP
FT                   WLTQGYLKDHRTSEKLWEGGFLHTGDVAVRDERGYVRITDRTKDVIKVAGEWVSSLELE
FT                   DILAHHPAVAEVAVIGQPDEKWGERPLALVVLKPEEVGRVGEKDLAHFVREYADKGMIS
FT                   KQVVLLKVRLVDAIDKTSVGKISKVTLREKYLA"
FT   gene            complement(206150..207220)
FT                   /gene="pilT-2"
FT                   /locus_tag="KN400_0205"
FT   CDS_pept        complement(206150..207220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT-2"
FT                   /locus_tag="KN400_0205"
FT                   /product="twitching motility pilus retraction protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83068"
FT                   /protein_id="ADI83068.1"
FT                   /translation="MDMNLLSQILGIAFEKRVSDLHFEVDNPPFFRAKGQLLRSKLPKL
FT                   SPQDTEFIARAVMEQNHRTLPDELRELDASYSLPNGGRFRVSIFRQRGSIGIVMRVIPP
FT                   HVGTFEELNLPPVLGEIAKAPNGLVLVTGPTGNGKSTTLASMIRHLNETCTFNIITIED
FT                   PIEFLFTSDKSCIIQREVGIDTVDFSAALRSSLRMDPDVIMVGEMRDLETIDACIKAAE
FT                   TGHLVFSTLHTQSAVSTINRLIGHFPPDAQEVLRQRLADILVATVSLRLIKDKSGENIL
FT                   PVVEVMRATTTIQACIREGRLDEIEKHIENGRSLYQMQTLDQHLLELCEKDVITFDQAK
FT                   QITRSMDLERKLAFTE"
FT   gene            complement(207266..209041)
FT                   /locus_tag="KN400_0206"
FT   CDS_pept        complement(207266..209041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83069"
FT                   /protein_id="ADI83069.1"
FT                   /translation="MSFTGDLEHLSIVDVIQLLHATRKSGTLTVRGRKGESQLVFNDGY
FT                   IISANHFDNSVRIGNILVEAGVISKEVLEQALQEQEEAGAGRKPLVATLLERGSVRKED
FT                   AYRGLEALIELTVVEILTWRRGTFDLDVNRVSVSDEYRYFPEKLHEEITLHTENVLMDA
FT                   LRIYDEKKRDGLLVEEEFAIEAPIPDLSGDEAADFNISADDLGLGDLDQIERKIPQVFL
FT                   GLEDRSPSLQRKIQELGADLSDKEQEELFAFLGRLGNTAPAAGAPTLSAILFSPDDLFS
FT                   YCVTTVCRQAGISVFTTNDEQDLAPLAQQFASRGGQTTLILDSPASPGFTLPAEDAARL
FT                   LRRVREHHPSLALIQLASPLEPAFALQALKDGAVAVFPRPVREVSGDTFLEDTLRLLDA
FT                   LPLYLRRRGSDGGEAAMAQLGKTLMELRALREPPEIALTLLSTVAGTFERALTLIVREE
FT                   ELIAERSIGIRSPRGACVSPSFGTRIPLDRPSVLRDAIEKRAAFYGETDDEILKGHLFP
FT                   IIGAPLHPTVILLPLVCGGKVIALIYGDFGHKGAAPVRTELLELVTGEAGLVLETALYR
FT                   RKRERKAPEGTACDR"
FT   gene            209297..209956
FT                   /locus_tag="KN400_0207"
FT   CDS_pept        209297..209956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0207"
FT                   /product="protein of unknown function DUF480"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83070"
FT                   /protein_id="ADI83070.1"
FT                   /translation="MEILLNDVEVRVLGCLIEKELATPEYYPLTLNSLTTACNQKSNRD
FT                   PVMALEESEVVRALDGLKMKHVAIQAADSGRVPRYRHILSERLRFSPAELAILAELLLR
FT                   GPQTLGELRTRAERMHPFADLAAVEQVLGELAERTPPLVMRLPRQPGRKESRFAHLLAG
FT                   EPDLSAEERTAPPEGARLQVMAENERIAALELEVATLRAEVGELRQVMEEFRSQFE"
FT   gene            209971..210783
FT                   /gene="fdhC"
FT                   /locus_tag="KN400_0208"
FT   CDS_pept        209971..210783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhC"
FT                   /locus_tag="KN400_0208"
FT                   /product="bidirectional formate transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83071"
FT                   /protein_id="ADI83071.1"
FT                   /translation="MTDKRFLTPAEALNATVENGRRVLTQSLARTVLLSLLAGFYIAFG
FT                   AQLATVVTQDAALHVGQGVARLLGGSVFSVGLMLVVICGAELFTGNSLLTVALLHGEIT
FT                   WVKMLENWGVVLLGNLAGSLFFAWLMVESRLWENGAVGDQAVRIAAAKCAIPFGAALIR
FT                   GILCNWLVCLAVLMATAARDVGGKMLACYVPIMTFVTSGFEHSVANMYFIPTGLLVAGA
FT                   RGTTEPDLSWGAFMGNVVPVTIGNVIGGVIFVAIAYWFIHLKKEGKQA"
FT   gene            complement(210787..213072)
FT                   /gene="tex"
FT                   /locus_tag="KN400_0209"
FT   CDS_pept        complement(210787..213072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tex"
FT                   /locus_tag="KN400_0209"
FT                   /product="S1 RNA-binding domain-containing transcriptional
FT                   accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83072"
FT                   /protein_id="ADI83072.1"
FT                   /translation="MALSDQTLQDILRYLTEETGLAPFQVANTVELLREGGTVPFIARY
FT                   RKERTGELDEVGIRGIEERLAYFTELEERKLTVLKSIEEQGKLTPELADRIRTSRQKTE
FT                   VEDLYLPYKPKRRTKATIARERGLEPLADLMAAQELTAGTPEEATLPFVDPAGEVPDAA
FT                   AALEGAGHILAERLGGDADARAFVRRLTADQGIFCSRVAADRKGAVTKFEMYYDHREPL
FT                   KSVPSHRMLAMRRGEKEEVLVLTIEAPTEEILAGLRARIAGRASIFRQLLEGAAEDAYK
FT                   RLIAPSIEVELRLEAKQRADEAAITVFAQNLRNLLLAPPAGGKRVLGVDPGLRTGSKLA
FT                   AVDGTGRFLEHVTIYPHAGGEGKVAAAKREFLRLVECHGIEMVAVGNGTAGREMEQFAK
FT                   ETLAEGGKRIPVVMVSEAGASVYSASEIAREEFPDLDLTVRGAISIARRLQDPLAELVK
FT                   IDPKSIGVGQYQHDVDQRALKKSLDAVVESCVNYVGVDLNTASWALLSYVSGVGPSLAR
FT                   AIVRHRDEHGPFPARRALMKVPRFGDKAFEQAAGFLRIRGGEHPLDATAVHPERYPVVE
FT                   AMATDLGVSLSQLAADPALPARIDLKRYVTDAVGLPTLRDIMEELKKPGRDPREEFRTA
FT                   AFRDDVTEIGDLKEGMVLQGVVTNVTAFGAFVDVGVHQDGLVHVSHLSVKFVKDPAEAV
FT                   RVGQVVQVKVLSVDVQRKRISLSIREAAPGGAPRSTEKPARKEEPRKTGGGLDLGGLER
FT                   AGFRVKKR"
FT   gene            complement(213153..213569)
FT                   /locus_tag="KN400_0210"
FT   CDS_pept        complement(213153..213569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0210"
FT                   /product="protein of unknown function DUF393"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83073"
FT                   /protein_id="ADI83073.1"
FT                   /translation="MPTPPAFPLTVFYDGACSVCAAEMAVYRRKNHGGRLVFVDISDPA
FT                   FDPSPWGITLEAFMAQMHAIDRDGRAYRGVEGFWAIWQAFPASTFYGLLGTLVMLPGFN
FT                   LLARLGYRGFARIRRYLPKRASRCDGGTCRMDRH"
FT   gene            complement(213581..214057)
FT                   /locus_tag="KN400_0211"
FT   CDS_pept        complement(213581..214057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0211"
FT                   /product="dehydratase, NodN/MaoC domain-containing,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83074"
FT                   /protein_id="ADI83074.1"
FT                   /translation="MSAADDLIAFLAPKLGTETHVGPWLTVDQERIDRFAHVTGDIQWI
FT                   HTDPERARRESPYGATVAHGFLTLSLLPCLTEANHPDFFQRNYPGMRLRVNYGLNRVRF
FT                   PQPVIVGSRLRARTLLKAVEPLAGAVQITYEITVEIEGKDKPACVAEQVVRVYP"
FT   gene            complement(214119..215504)
FT                   /locus_tag="KN400_0212"
FT   CDS_pept        complement(214119..215504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0212"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase with cobalamin-binding-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83075"
FT                   /protein_id="ADI83075.1"
FT                   /translation="MRLLLVSANRERSPYPVFPLGLACLVPSLEAAGHELRALDLCFEA
FT                   DPEEAVTAALADFTPQAVIISVRNIDNVTWPGSRSYVAGVKAIVDRCRGIATTILGGSG
FT                   FSLMPAELLAFTGGDLGVAGEGEEILPELLACIERGESPAGLPGVVAGAGAFAPPRPVE
FT                   RIAAPDRRLFALARYRREGGMANIQTKRGCPFGCIYCTYPLLEGRRMRLRPTAEIVAEL
FT                   RELADAGIDYVYFVDDIFNYPPDFAEELCRAMIASGLTMGWSAFINPQFITPRLMESMV
FT                   AAGCDAVEFGTDSGSPAMLRNLGKSFGVAQIRESSRICRELGVDFAHYILFGGPGETPA
FT                   TIAESFALMDEVAPTAVIAMTGIRIFPGTPLFERAVAEGMVTPDEPLLEPTFYLAPAIR
FT                   DVLGELVTDGAMTRRNWVAPGLEINMSDAMLEAMRHFPVRGPLWKLIKRLGRSHAKPLS
FT                   QPQ"
FT   gene            complement(215501..215923)
FT                   /locus_tag="KN400_0213"
FT   CDS_pept        complement(215501..215923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0213"
FT                   /product="acyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83076"
FT                   /protein_id="ADI83076.1"
FT                   /translation="MREHETPLTVRFNEVDSYGVAWHGHYVAWLEVGRNDLAGRFGLDA
FT                   AQIGELGYLAPVVDLELSYRRPARFNEELRIMTTARRTETATIEFATRILGADGTLYAR
FT                   GRTVHALTDRDGVLQYRLPPAVGERLERLLAWTEGA"
FT   gene            complement(215925..216767)
FT                   /gene="fabD-1"
FT                   /locus_tag="KN400_0214"
FT   CDS_pept        complement(215925..216767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD-1"
FT                   /locus_tag="KN400_0214"
FT                   /product="malonyl-CoA--acyl carrier protein transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83077"
FT                   /protein_id="ADI83077.1"
FT                   /translation="MICFMFPGQPLAPPVEFPEDADFEAIALLTRQRASFDLHTFSWTG
FT                   EPSSDTVALQAYGVAMGLYRTRRLRAEGIAPRLIAEHSMGIYPALAAAGALDEGDALEL
FT                   AVRLGRTMAAMGRQRTYALGCMVGLTLEPLLVIAENNGVYLANHNTSRHFLLAGERGAM
FT                   EDACAEALARGAFSARLFPCDAPLHTPLMAEVAEELAAVAGDYRYREPSVPLVDHIDQD
FT                   FLAAADLPVFMVRDLMEPVRWERTYRALRAAGVDRLYEVGAGDSLRKYNRWIESERGR"
FT   gene            complement(216770..218062)
FT                   /locus_tag="KN400_0215"
FT   CDS_pept        complement(216770..218062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0215"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase with cobalamin-binding-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83078"
FT                   /protein_id="ADI83078.1"
FT                   /translation="MKILFVAPGWPRGRLWGELGFKFPSLALAALAAVTPPEWDAALCD
FT                   ESRETIDFNAPCDLVAITAMTPQAPRAYEIAAGFRARGKTVVMGGFHASNLPDEALGHV
FT                   DAVVVGEGELSWPLLLADFQAGRLQRLYRSPGLLPMASIPVARREIFAGKGYLLTNTLQ
FT                   TTRGCPFDCEFCSVTAFYGRKYRERPVEAVLAELETLRKANSFAFFVDDNLVADRRYAL
FT                   PLFRGMKGMGFKWLSHAPIDFAGDEELMRAAGESGCIGMFVGFESLDQEALAAMGKVTN
FT                   SSSAFLDQARKFRDHGIGILGSFVLGYDGDTPDSFGRILRFCEEARIEAAIFPILTPYP
FT                   GTAVRRRLEAEGRITSNDWRDYDMGHVTFRPTGMTARELQDGHDWLNRSFYSFGSMWRR
FT                   IGKLHRSVQVFGPMNLGFRSAIRKSDKTKAS"
FT   gene            complement(218059..218316)
FT                   /gene="acpP-1"
FT                   /locus_tag="KN400_0216"
FT   CDS_pept        complement(218059..218316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP-1"
FT                   /locus_tag="KN400_0216"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83079"
FT                   /protein_id="ADI83079.1"
FT                   /translation="MSDQLIVQVKQMIIDALRIEGMSPDDIDTDAPLFGEGLGLDSIDA
FT                   LQLVVAMEKDFGVVVPDAATGTKVFASVRSMADHIAANRK"
FT   gene            complement(218321..219220)
FT                   /locus_tag="KN400_0217"
FT   CDS_pept        complement(218321..219220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0217"
FT                   /product="acyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83080"
FT                   /protein_id="ADI83080.1"
FT                   /translation="MPLHNRINLFLINLFTLLVPRTVHAPFAFLTGLILYLAIPGPRRG
FT                   VRANLRAVTGRRNVERLVLSTYYKCSRNWTDIMLMMRRRGERLFALIGRQEGHGILDRV
FT                   LAEGNGAIIVSPHLGNWELGGLGLAERGYRLNVMTFREPDERVNDLRERVREERGIRFI
FT                   YVDRHDTSPLAAVEAVNALRRNEVVALLVDRDGSSQTMELEFFGRPTPIPVGAAYLALA
FT                   TGAPVMPVFVPLEGSRYATIMEEPIRFVGGRGRNAEAIRRGMEQVLGVFERYIRCYPDQ
FT                   WYNFFDFWNNEHNETVKG"
FT   gene            complement(219312..220688)
FT                   /locus_tag="KN400_0218"
FT   CDS_pept        complement(219312..220688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0218"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83081"
FT                   /protein_id="ADI83081.1"
FT                   /translation="MLQSLKNYTTEKIVSLLLSMATNASNENLARMTHLMELIPKKEYY
FT                   KERIRWIRRLIRENHPSIEFPRRILREIHPNQREKWITNLAVNHLLSGTNKRKAWQERE
FT                   GYYPPSTVVISTTMKCNLSCYGCYAGDYAKALELTNDEIDSILTQMKEMGVYFAVISGG
FT                   EPFFKEDIFEIFKKHSDMAFLVFTHGGLIDEAMVRKLVEVGNVMPAFSLEGYEQETDER
FT                   RGPGHFRKVMRAMDLLREAGLSFCGSFTQTSRNTDIITSDEYIDMLVAKGVFALWLFTY
FT                   VPVGREPDLELMATPEQRDALRRRIVDFRAAKPMLFVDFWNDGPIISGCIAGGRKYFHI
FT                   NANGDIEPCVFCHFAVDNIRRTTLREALRSPLFRKIRQVQGEHDNLLRPCMLIDHPDVG
FT                   RELFQSAGAYPTHEGADAIFTALADNMDDYARRYAEFADPAWEQEFGAGQGKRPKGVTR
FT                   "
FT   gene            complement(220738..221400)
FT                   /locus_tag="KN400_0219"
FT   CDS_pept        complement(220738..221400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0219"
FT                   /product="undecaprenyl-phosphate glycosyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83082"
FT                   /protein_id="ADI83082.1"
FT                   /translation="MGYCIIIPAYNAARTLPAVVREVLGLGMPCLVVDDGSTDGTSATV
FT                   EGLGVHLLRHDGNRGKGAALRTGFEWALAHGYSGVVTLDADGQHDPTAIPLLAATARER
FT                   NVDILIASRDTQFREMAGLRSVWNRFGVWCMRKRTGFTITDSQSGFRWYSARLLKGVSL
FT                   EASGYHLEMEILMKAWRGGFAIDSLPVAARVADGRATSHFRPVRDTWNICMTFLRHM"
FT   gene            complement(221385..222215)
FT                   /locus_tag="KN400_0220"
FT   CDS_pept        complement(221385..222215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0220"
FT                   /product="polysaccharide deacetylase and DUF3473 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83083"
FT                   /protein_id="ADI83083.1"
FT                   /translation="MPVLNALTIDVEDWYHVCGLPGEPVVSPDTERVVPAVGRLLALLA
FT                   GRGCRATFFLLGSVAERHPGLAPSIAEAGHEIASHGWSHRLVTGLSPEEFRTELRRTGD
FT                   LLERQTGRRPVGFRAPQWSLCRRRTPWAFPILRDEGYRYDSSLSPLPFVGDRRGPRGPF
FT                   RIDTPAGPLVEVPPLVTRTPLGNLPTGGGWGFRFFPLGLIGASVAGLNRRGMPAVLYVH
FT                   PREVDPEGPRLALPPLRSFVAYGPRSDAAPRLDALLERFSFTTLDQLVDRWDTV"
FT   gene            222398..223861
FT                   /locus_tag="KN400_0221"
FT   CDS_pept        222398..223861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0221"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase with cobalamin-binding-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83084"
FT                   /protein_id="ADI83084.1"
FT                   /translation="MNILLLRPHPGNDRFGLGPFFRVEPLGLEYIGAALRAHGHTVSAA
FT                   DLRFRPGAATWVRRTRPRLVGISCLHALEYERVVETAREVRRASPDAFIFVGGHAAAAF
FT                   PAPLECDAVDAICRDDGEEIVPLVAAALAKGGRLDEVPGLRLREPDGWRDTPCLDRQTC
FT                   LDLVPLPARDLVDRHRSGYHCLLFKPVWLVETARGCPHRCSFCSVWQLYGRSCRERSIA
FT                   AVVEDFATAGDSIFVADDLFWHNPARSLELADALKKRRIFKRWILVQTRTDLICRSADL
FT                   MAAWRPLAKDFDIFLGLEAATDKGLAGITKDSGVAESVEAVRLARELRYGINGNFLIDP
FT                   DWDEDDFRDLWGFVARYGLQRAGFTILTPLPGTDFFREVAPRIARQPWSNFDMHHLLWD
FT                   PRVGAPRFFELYAETWRRSILNTSGDKSLVDWMKQVRPSQIPYIARVLWRTQRMMKPEA
FT                   YLREYEATRPRTTEPLVDFSAGACCGGAA"
FT   gene            223861..225147
FT                   /locus_tag="KN400_0222"
FT   CDS_pept        223861..225147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0222"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase with cobalamin-binding-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83085"
FT                   /protein_id="ADI83085.1"
FT                   /translation="MSRSPRLLLIYPATHKLGWARYFQLPSHSLQMVAAATPRHWEVIL
FT                   ADEVHDEVPFDGTFDLVGITAMTHQATRAYEIADRFRARGVPVVMGGIHPTVLPDEALE
FT                   HADAVVVGEAEPVWAHLLDDLLAGRLAPVYRAPVPTDEILSAPWPRREILAGRRYLTTQ
FT                   TVQASRGCPYDCSFCTVTPYFGRTFRYRDPDDILAEIRSFRRKLVVFLDDNLLGDPIKA
FT                   RPILRGLAEMDVRWGSQTNLRFAEDPELLKLVADSGCIGLFVGIESVTGSHANMAKSGT
FT                   RYSQTDLMKRVRDAGIILETSIIFGFDDHDESVFETTLRFLEECSPSVPTFHILTPYPG
FT                   TALFRQFQEEGRLLTTDWSRYDHSTVVFRPRLMSPERLHRGWLEARREAYSWRAIATRV
FT                   MRNPGRRLTNLAYNMLRKGPNDLLEDGAP"
FT   gene            225208..226185
FT                   /locus_tag="KN400_0223"
FT   CDS_pept        225208..226185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0223"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83086"
FT                   /protein_id="ADI83086.1"
FT                   /translation="MTRLIVFGILAAFFFSSTFVFNRAMSLEGGHWAWTASLRYGYMLL
FT                   LLCTWLLLKGRRGVVVAAWDAFRRNWLFWTTAGSVGFGAFYALISFSASFAPGWVVATT
FT                   WQITILATPVVLLLFGRRVPARGVLFTAMIFLGIVLVTLEQATAAPLGDILRGIVPVVA
FT                   AAFAYPLGNQMVWEARHGTSSLLPAITDPVVDDSFGRVLLMVLGSIPFWVVLLIVAAPP
FT                   PPSPGQLVNTALVAVFSGVIATSLFLHARHCASTTYELAAIDATQSTEVIFSLLGEIVF
FT                   LHGLLPGSSGTAGLVLVVGGLMLYVRAQTAGQLKEKIHSRAEKG"
FT   gene            226227..226667
FT                   /locus_tag="KN400_0224"
FT   CDS_pept        226227..226667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0224"
FT                   /product="protein of unknown function DUF2721"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83087"
FT                   /protein_id="ADI83087.1"
FT                   /translation="MQPEPVVSNIAHVIQMSVAPVFLLTGVGAILSVLINRLGRIVDRA
FT                   RVIEQHLADVASDGRALARLELTTLGRRMRLINWAISSCTISALLVCVVIALLFVGAFL
FT                   HVNVSDVAALLFVFAMLALIGGLLGFLREIYLAIATARLGMR"
FT   gene            complement(226858..227037)
FT                   /locus_tag="KN400_3416"
FT   CDS_pept        complement(226858..227037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_3416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_3416"
FT                   /db_xref="EnsemblGenomes-Tr:ADN78312"
FT                   /protein_id="ADN78312.1"
FT                   /translation="MRGDSTPTVTVTAEATVREAAGAVRTEPLNLVAEARVEKDCLEYR
FT                   LSRDQESPSQFAIC"
FT   gene            227485..229977
FT                   /locus_tag="KN400_0225"
FT   CDS_pept        227485..229977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0225"
FT                   /product="sensor histidine kinase, PAS, GAF, PAS and PAS
FT                   domain-containing"
FT                   /note="domains: PAS, GAF, PAS, PAS, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83088"
FT                   /protein_id="ADI83088.2"
FT                   /translation="MIHRYLQHSPFPVLLVEPQGHIVQASPASLEFLGIDSRHSAPRAL
FT                   VDIMHAEQCEAVLRTGAALTDTGFWEGECSLLGRDEQPVRAFLRVARADDDRLVIYLRD
FT                   SAGRRRSEELLRIRLQLSERARCESLDELLRSALDAAERLTDSSIGYLHVVAPGREQAS
FT                   LQAWSSNTLTTMCRVRGGKEHHPARRVGIWGDCCRERTAVIHNDYAGLPHKKELPEGHP
FT                   PIVRVMGVPIIHGDKVLAIIGVGNKTTEYTREDAAALHELASMIMDLVERKQAEAQLLA
FT                   SEKRFRTVFEQAAVGVALVDPLTGRFVRVNAKYGDIVGYSPETMLTMGFQELTHPDDLA
FT                   VDLECISRLLKGEIRTFTREKRYLHRDGCNVWVRLTVSPLWADGEEPSFNIAIVEDITA
FT                   RKAAEAALREAKEQLELRVRERTADLEQANRALQEEVAARSQAEESLRASESRFRRLVQ
FT                   MAPLPLCFADANGTLRYVNDRFTRLFGYAPEDIPMQEEWWSRICPDGRCRGETVDSWQA
FT                   SVQRVPHGAGDIEPAEFRVECKNGDIRLVEVSGITIEGTVLATFIDITERRLAEDELHR
FT                   HRELLEELVHQRTAELKLRNMELATEIAERRRAEAALRCYTRRLTEMEEDLRKKLAAEL
FT                   HDEIGRDLTALNLNFTVIGNLAVQGPDGGLRARIEDTERLIEDISRTVRGLTAKLRPPV
FT                   LDDYGLPAALRWHADLFSRRTGIDVAVQVADSIPRMPAEKEIALFRIVQEALTNCSKHA
FT                   NAGNVKVSLDHGDGRVRLSVVDDGTGFAIESASPTPAGSGWGLTIMRERAELIGGTFRL
FT                   DTAPGKGTVLTVEIDEDS"
FT   gene            229978..230622
FT                   /locus_tag="KN400_0226"
FT   CDS_pept        229978..230622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0226"
FT                   /product="helix-turn-helix transcriptional response
FT                   regulator, LuxR family"
FT                   /note="domains: REC, HTH_LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83089"
FT                   /protein_id="ADI83089.1"
FT                   /translation="MIKVLIVDDHAVVRDGLTMILESQSDIAVIGQAGDGREAIAMAGS
FT                   LKPNVVVMDITMPELNGIEAARLIAREQPATKIVILSMHDTLEHVYRALQAGARGYLLK
FT                   ESAGAEVTDAVRTVMRGHRYFGRGSRLPSDMHRSACADLPKSPLDSLSQREREVLQLVV
FT                   EGKKSSEIAEILSLSPKSIETYRSRLMIKLGITNIPSLVKFALLHGVTPAK"
FT   gene            230825..232675
FT                   /locus_tag="KN400_0227"
FT   CDS_pept        230825..232675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0227"
FT                   /product="sensor histidine kinase, PAS and PAS
FT                   domain-containing"
FT                   /note="domains: PAS, PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83090"
FT                   /protein_id="ADI83090.1"
FT                   /translation="MAGSNQNVALRITAIYALVGVSWILFSDWLLYLAVGDPHLLTRLQ
FT                   MGKGWVYVAATAMLLYWLVHRDTAQISRSEEDLRVRNEELTVVEEELRQQNEELIVAEE
FT                   ELRQQLTENYESQKKLFEAHQAMAAILQASPVAIVALDREDKVVVWNRAAERLFGWLEG
FT                   EVRGTPFSLLHPDDTKDEERVCGSACQEAVLHDIEGVRMKKNGELISVSISTAPLHDPA
FT                   GLNAGVIAMFTDITDRKSAAKSLRKSNEKYVELVNAISGIVWELDVESFCFTFVSRRSE
FT                   DILGYPAEAWLAEPGFWERCIHPDDRAWVLAACRTAHGEGTSHELEYRGLAADGHIIWL
FT                   RNSFVVVEDTNGHVKLRGVMTDISRRKNAEDELSRLNAELEQRVAQRTSELAALNRELE
FT                   AFSYTVSHDLRAPLRHIEGFGRALQEDYYEAFDDTGKLHLARLCSAARKMGQLIDDLLR
FT                   LAMVSKGEINRRPTNLSTIAHGIVQDLTLSQPERAVAFRITDGIEVNGDPRLLQVVMEN
FT                   LLSNAWKYTGKRQDAVIEFGVGEDRGRTVFFVRDNGVGFANEHAEKIFKPFLRLHSAED
FT                   YEGSGVGLATVRRVVERHGGRVWAQGREGHGAVFFFTLDN"
FT   gene            232781..233218
FT                   /locus_tag="KN400_0228"
FT   CDS_pept        232781..233218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0228"
FT                   /product="hemerythrin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83091"
FT                   /protein_id="ADI83091.1"
FT                   /translation="MGTADSSASNSNKASQKFIVWQDSYSVGVPKLDGQHKKIIDLINE
FT                   VYDYLQGRTGLLDLGRILDDLSTYTQNHFADEEQLLRLAKYPEYEEHKKHHDWMMQRTR
FT                   SIRSEYREKREDLSWELMDFLKKWWLSHIQSNDARYVPYVK"
FT   gene            complement(233306..233596)
FT                   /locus_tag="KN400_0229"
FT   CDS_pept        complement(233306..233596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0229"
FT                   /product="antibiotic biosynthesis monooxygenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83092"
FT                   /protein_id="ADI83092.1"
FT                   /translation="MPTVTVIAEVRAREEAVDAVRVELLKLVSETRQEEGCLEYRLHQD
FT                   GDDPALFIFYENWQSPACLERHLGSGHFRAYLAAVEGMIAGKTVRRLSELT"
FT   gene            complement(233584..233790)
FT                   /locus_tag="KN400_0230"
FT   CDS_pept        complement(233584..233790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83093"
FT                   /protein_id="ADI83093.1"
FT                   /translation="MTPEVSALDKALAKVCELCPVCLHARYHQQGVVFEFVRNVERDIC
FT                   PFCKAYERVHGKKSHERRQPCRR"
FT   gene            complement(233787..234356)
FT                   /locus_tag="KN400_0231"
FT   CDS_pept        complement(233787..234356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0231"
FT                   /product="flavoredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83094"
FT                   /protein_id="ADI83094.1"
FT                   /translation="MKQSLGARTLLVPTPVLMVGTYGPTGTPNLMNAAWGGICCSDPPC
FT                   VTVSVRTSRLTYDNIVQRKAFTVSVANEATMVEADYVGIASGRDADKFAVAGLTHVAGE
FT                   YVDAPYAEEFPLVLECRLLHTQELGLHTQFIGEIVDVKADEAILGEDGLPDILKIRPLV
FT                   YDTAHKGYHAVGQLVGKAFSAGKKLL"
FT   gene            complement(234563..235030)
FT                   /gene="usp-3"
FT                   /locus_tag="KN400_0232"
FT   CDS_pept        complement(234563..235030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="usp-3"
FT                   /locus_tag="KN400_0232"
FT                   /product="universal stress protein Usp"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83095"
FT                   /protein_id="ADI83095.2"
FT                   /translation="MRILLAVDGSPGSDAAVAEVCRRPWPAASEVRIVTVLSPLESLPL
FT                   RNSSHIPLSYDEIFEQQGWDAAKRLKDAAETLQQRAPDLHVTPVLLEGRPKNAILDEAE
FT                   RWCADLIVVGSQGSGALKRFFLGSVSLAVALHAPCSVEIIRRSPDQPDPAA"
FT   gene            complement(235091..236857)
FT                   /locus_tag="KN400_0233"
FT   CDS_pept        complement(235091..236857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0233"
FT                   /product="monovalent cation/proton antiporter family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83096"
FT                   /protein_id="ADI83096.1"
FT                   /translation="MHDLGLIMTITGSFTAALLLGYLTHRLGMSSIVGYLLAGIAVGTH
FT                   TPGFVADLGMAEQFAEIGVILLMFGVGLQFHVKELLDVRRVAIPGAVCQSAVATLLSCL
FT                   LARWLGWSWSAGIVFGFAVSVASTVVLLRVLVDNNELHTPTGHIAVGWLVVEDIFTVFL
FT                   LVILPIFFGSGVAGSDSLPLATGLSVVKIALLVALTFFVGSRLIPRLLWHVAATRSREL
FT                   FTLTVLVLALGIAVGSAKLFGVSMALGAFLAGMVVRQSDFSFRAASEALPMRDAFAVLF
FT                   FVSVGMLFNPTYLMEEPGLVLATLVIILVGKPLAALVIVLVLGYAPRVALSIAVALAQI
FT                   GEFSFILATVGKDLGVLGEGGANTLVAASIISISLNPLLYRLIGPLEKKARHWRLWRML
FT                   DERAKSRTTGSAEDAGSHVLTSRNRAIVVGYGPTGRTLARLLSENGIDPVIIEMNLHTV
FT                   RQLNADGTLAIYGDATREETLKGAGVESAVAFILTSAGMQGSDEAIRLARELNPNLRII
FT                   ARAAYLRDIPALRRAGADAVFSGEGEIALNMTEHMLNKLGATPEQIDRERERVRSELLG
FT                   GTPAVTPLATDH"
FT   gene            complement(237269..237664)
FT                   /locus_tag="KN400_0234"
FT   CDS_pept        complement(237269..237664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83097"
FT                   /protein_id="ADI83097.2"
FT                   /translation="MAHNFNLYQPATMYYGPHMQTGLKKFSGTPLRITVIATIFVVLAL
FT                   NGVASSGFLEHGGSLQPKCAISKSQSATAHSTTLKHVQIVVLGQRLFEFHSPVSFLLNG
FT                   HQDPRPQTSLTASIVFTRAPPARSSLS"
FT   gene            complement(237788..239023)
FT                   /locus_tag="KN400_0235"
FT   CDS_pept        complement(237788..239023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0235"
FT                   /product="transporter, Bcr/CflA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83098"
FT                   /protein_id="ADI83098.1"
FT                   /translation="MEITSTAPAFQPADMTRRELARLVLILGALTAFSSMSIDMYLPAF
FT                   PQIARDLGVPLGTVQLSISAFLFGSAAGQLVYGPLADRWGRRTPLLGGLALYVAAAFGC
FT                   AAVHTGEGLLFWRVVMALGGGAGMVISRAVVRDLYDTAEAARMFSLLMLVMGAAPILAP
FT                   IAGGQLLLITGWRGIFGFLGIFGILSLAAAAACLPESLPPERRSTRGVAEMAAIYGHLL
FT                   RNRRYLRYAIALGCVAGVNFSYISGSPFVFIELNGVSPQQFGLFFGANAFGLIGASQVN
FT                   RRLLRRFSAQRILNVAFTVNAAAALLLTVAGFTGVGGFPAQVVLLFVCLCMTGFLYPNV
FT                   TALAMAPFDKAAGSASALLGTIQYTLGASAGALVGMLHNGTAVPMTAAMAACGLLGWCA
FT                   AVAGIPRAQVDH"
FT   gene            complement(239081..239983)
FT                   /locus_tag="KN400_0236"
FT   CDS_pept        complement(239081..239983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0236"
FT                   /product="membrane transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83099"
FT                   /protein_id="ADI83099.1"
FT                   /translation="MHNFLIIGAFISLGILLRRFKALPEHTPFVLNKIAINVCLPALIL
FT                   LNAPKIAFTRDAVTAAIIPWALLALSVGLVLLGAKIWQWPRPVVGVLFLIVPLGNTSFL
FT                   GVPIIRTFFGADGLPHLIVYDQIGTMMIFATYGSFILSLYGQDGTLSVSAVVRKMLLFP
FT                   PSLALAAGLALKSWSYPDGLSLALHYLALPLVPVVMTAIGLQLRLRLPPHLAAPVGIGL
FT                   GIKMLAAPLAVLVACRLVDMNGLAVGVSVVEAGMPPMVTAGALAVVAGMEAELAIALVG
FT                   IGILCSFGSLPALFWLVSL"
FT   gene            240378..241301
FT                   /locus_tag="KN400_0238"
FT   CDS_pept        240378..241301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0238"
FT                   /product="helix-turn-helix transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83101"
FT                   /protein_id="ADI83101.1"
FT                   /translation="MDIRQLQFFVAIVRFGSFTKAAERLRVAQPAVSMAMKRLEEELDL
FT                   VLFNRQERKVSLTAEGEIFLRHAEKILEEVASTETEMEELRGLAKGEVRVGIPPMMSAY
FT                   FFPQIIRDFSNRYPELHLSVSGEGASKIQKMILDGELDMGVIAGASFPDTLELRRFLRE
FT                   EVIVCVPKNHHLAEMERLPLQEFARHPLIFYKEGYYLRELVFDVMRGAGLNPAIRFETN
FT                   LYTLVKSLIRKGMGISVFLRMVVEEDDDLEAIPLDPPLYLDLQIAWKKYGYLSRANRAF
FT                   VDFLLEQSARAHQPVGSCPARLVPAG"
FT   misc_feature    241584..241605
FT                   /note="conserved nucleotide sequence; KN400_R0121"
FT   gene            241631..242377
FT                   /locus_tag="KN400_0239"
FT   CDS_pept        241631..242377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0239"
FT                   /product="helix-turn-helix transcriptional regulator, UTRA
FT                   domain-containing, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83102"
FT                   /protein_id="ADI83102.1"
FT                   /translation="MLDPHSRMPLYHQIESHLREVIRSGKWQAGEAIPPERLLIEQYGV
FT                   SRITIRQALANLVAAGLLYRKHGRGTFVAGAKERPITESLANLTGHLEELQLRGLDPRV
FT                   RVLALETRPMIAEVAEALQRSPGAEGWYLYRIVTVEQQPLMLSTVWLPCDLGVELNEEL
FT                   LKQHGMALLLTHNGIAPLRGSQRIGAMSAGPEEARLLGVRAGEAVLRVSRVIHGAADRP
FT                   LVWFRTLYRSDRYEYEVELKRGRPHA"
FT   gene            242374..243207
FT                   /locus_tag="KN400_0240"
FT   CDS_pept        242374..243207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0240"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83103"
FT                   /protein_id="ADI83103.1"
FT                   /translation="MIMTTLEIFLIAITAGVAGAILGLGGGIIIVPALTLLFGIPIRTA
FT                   VAASTVSIIATSTGAAVAYLNDRLSNVRVAMWLEMGTATGALTGALVAGYLNQRVLFLM
FT                   FGVLLAYSGYNMFKARKAELPGEVLPDKVSQRLGLAGSYHDHVLNARVDYQVTRSILGL
FT                   IIMYFSGAAAGLMGIGAGIFKVPAMDQVMRMPFKASTATSNFMIGVTAASGAVVYFVRG
FT                   DVNPLITGPVVLGVLLGALVGARLMVRMKTTTIRKLFIPLIIYTAVMMMYKGVSP"
FT   gene            243204..243518
FT                   /locus_tag="KN400_0241"
FT   CDS_pept        243204..243518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83104"
FT                   /protein_id="ADI83104.2"
FT                   /translation="MTSPNQPENEGVVPIELILARLLRIGSIIAAILLAIGIAATLLTG
FT                   AAYAPRFITAGLVVLLATPIMRVLVAGLVFFRERDWLFTLFCLVVLCSLAAGVLLGQVG
FT                   "
FT   gene            complement(243617..245446)
FT                   /gene="glmS"
FT                   /locus_tag="KN400_0242"
FT   CDS_pept        complement(243617..245446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="KN400_0242"
FT                   /product="glutamine--fructose-6-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83105"
FT                   /protein_id="ADI83105.1"
FT                   /translation="MCGIVGYIGAQEATPIILDGLKRLEYRGYDSAGICTLLEGKADKR
FT                   RSEGKLINLERLIQSTPLAGRIGIGHTRWATHGPPSERNAHPHQAGSIIVVHNGIIENY
FT                   LELKQRLVTSGRVFNSDTDTEVIAHLIDDKFAGTGDFERAVREALAEVRGAYALCILCE
FT                   REPGVLIAAKQGSPMVVGLGEGEFFVASDIPAILSHTREMVFMEDGEMVVFRDGHPTFS
FT                   TVAGAPLDKKSRHIDWSPLMAEKGGYKHFMLKEIFEQPRAVQDTITGRLLEEQGDVRLE
FT                   EMKLADEQLRGIGRICIVACGTSWHSALVGKFLMEEHCRIPVEVDIASEFRYRNPVIDS
FT                   KTLLLVISQSGETADTLAALREAKARGAMTAAICNVVDSSIAREAHGVLYTHAGPEIGV
FT                   ASTKAFVTQLVALYLFTIRLGRAVGTIDCEQGRTMIGGLLKVPALLEQALETNEQVERI
FT                   ARRYMNARDFLYLGRGMNYPIALEGALKLKEISYIHAEGYPAGEMKHGPIALIDENMPV
FT                   VVLVPKNSTYEKVLSNMEEVIARGGRVIAICSAGDEEIAKKAEETLQVPSDGEELAPII
FT                   LSVPLQLLAYHVAVLKGTDVDQPRNLAKSVTVE"
FT   gene            complement(245512..246942)
FT                   /gene="glmU"
FT                   /locus_tag="KN400_0243"
FT   CDS_pept        complement(245512..246942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="KN400_0243"
FT                   /product="glucosamine-1-phosphate N-acetyltransferase and
FT                   N-acetylglucosamine-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83106"
FT                   /protein_id="ADI83106.1"
FT                   /translation="MDNLAAIILAAGKGTRMKSGIVKVMHPLAGAPMVAWPVAVARQAG
FT                   AGRIVAVVGHQAERLREHFSNDADITLAVQEEQLGTGHAVACAAGDLSGFSGKVLILCG
FT                   DVPLIRTETLRAMVTAHEATGAVLTVLTARQENPHGYGRIIRGFDGRVIRIVEEKDATP
FT                   DERSRTEVNAGIYCAEASFLFDAVKRIGNDNAQGEYYLTDIITMANDRGLRCTAHPVAD
FT                   PVEVMGINDRVQLAEAARHARRRIAEEHMLNGVTLVDPAATYIDQGVVIGADTTIQPGV
FT                   QIAGGCRVGEGCTIEAGAIIKGSELGDRCVVESRAVIRGCRLGSDVVIKAGTVMEDSTV
FT                   MDHAAIGPMAHLRPGSELGAHVKIGNFVETKKIVMGEGSKASHLTYLGDATIGRNVNVG
FT                   CGTITCNYDGVNKHRTVIGDDVFVGSDVQFVAPVTIGSNTLIAAGTTVTRDVPADSLAI
FT                   ARTPQINKEGWKLRKRDQ"
FT   gene            247103..247648
FT                   /locus_tag="KN400_0244"
FT   CDS_pept        247103..247648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83107"
FT                   /protein_id="ADI83107.1"
FT                   /translation="MGIPEDIHLFEQSLNELVIKYEQYFLGIEKREPLRLRETVDRLAR
FT                   KHSAVKIVNTMLNFKYTSLVSRYASYRQYWDRILRLMEEGKYSRDRFRMAIHERSSPEV
FT                   RQHEPPPPKDEAEELYRQFVEARRSCNLSTDKVSRDQVAAAIERQKPVIKAKYGTDQVE
FT                   FRVVVEDGVPKIKARPRR"
FT   gene            247681..249561
FT                   /locus_tag="KN400_0245"
FT   CDS_pept        247681..249561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0245"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase with cobalamin-binding-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83108"
FT                   /protein_id="ADI83108.1"
FT                   /translation="MKVVLVAIHPYPSPQAVPLANACLAAYLATDEELSARVRAVLCDF
FT                   FTGTAVGTCVDDILANAPDAVGFSVYLWNRDDARAVADELRRRAPGLTLFAGGPEATAD
FT                   PAGLLTGSSFDFLIQGEGEIPFLDVMGRLEIGEPGRGAVGTAWLDNDTLKHTPARPIRL
FT                   IDTAPSPLLTGIIDPSGYPGILWQLARGCDFSCEYCFDDKGERGVRRYSLERIDAELDV
FT                   IVRSGVPQVFVLDSTFNQDRERAKKVLKMIRARARHVHFHFEVRSEFIDREMAKLFAGI
FT                   TCSLQIGLQSADPKILRRIRRHLDPDDFRERIGLLNESGAIFGFDLIYGLPGDSLAAFR
FT                   RSLDFALELYPNHLDIFPLAILPGTILANRASSEGLEHLTAPPYTLTGSPTFTPSDLER
FT                   AARLAEACDIFYTRGKAVAWFNSVASALRLSPAALLDEFAAWLDDTRQKGERGTDLGDQ
FT                   DIWLMQREFLDRIFRRRKRAALLPLALDLVDYHYYFAAALVAPPPPLPTDRELSGRDLL
FT                   GAVFSLAPTARLAHFSYEIVDILEAGEVDLAAFRDCFAPSGSWAVIYPRGGDVYTEPLL
FT                   ESYAKFLQGLDGTGQAGAAASRAGLTRAEAREFLDFAAAEGIVVLATQAQ"
FT   gene            249862..251721
FT                   /gene="cbcY"
FT                   /locus_tag="KN400_0246"
FT   CDS_pept        249862..251721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbcY"
FT                   /locus_tag="KN400_0246"
FT                   /product="cytochrome c, 9 heme-binding sites, and
FT                   cytochrome b"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83109"
FT                   /protein_id="ADI83109.1"
FT                   /translation="MLSTFLRLFPAFLLFVTLAGTAAAESGMAIDPATCLGCHSNKISA
FT                   AAFSASVHGKNACTSCHVEITDLTKHMKGEVKVEKVRCERCHKKENAEHYASVHAQKDV
FT                   RCADCHTDIHTHSYWNKDKRKVVAKCIQCHDKEAGYRNSIHGKGVAAGNMDSAACNDCH
FT                   NLHDIKPLGDPKSKENREFHTKVCLKCHADEKMMERNNVFTVAVKTYMDSYHGKNYRLG
FT                   FPEKVAGCADCHTAHGVLPAKDPNSSVNPQNLVATCAKCHPKATPLFTKFYSHGELGDR
FT                   EKYPILYYTFIAMTGLLVSTFAVFWIHTLLWMFRGFVENREKQQALIHGHAEHHIPDGH
FT                   KVYRRFKRRHIFLHLLVIISFLILSLSGLPLKFSSQHWAKFMMDHIFGHSANAALVHRI
FT                   GAGITFVYFAGALLLSFHFLFVRKDIKGNWLQRMFGPDSLMPNFRDIKDVAGMVRWFLF
FT                   RGPKPTFERWTYWEKFDFIAVFWGMFAIGGSGLMLWFPEFFGSFLPGWMFNVATIVHSD
FT                   EALLATGFIFTVHFFNTHGRPEKFPMDFVIFNGQMPKHEFIEERGDQWKRYEELGITEE
FT                   FAAKKTSGVVYDFIVKGFGFTAVVIGLTLVVLMLYAFLSGGAH"
FT   misc_feature    251750..251781
FT                   /note="conserved nucleotide sequence; KN400_R0122"
FT   gene            complement(252012..252188)
FT                   /locus_tag="KN400_3417"
FT   CDS_pept        complement(252012..252188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_3417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_3417"
FT                   /db_xref="EnsemblGenomes-Tr:ADN78313"
FT                   /protein_id="ADN78313.1"
FT                   /translation="MRIRDGIRLNASMHEEIRRRTTSPDLWNRHHIMMAQHAAHTPDAA
FT                   GFVTSAAQPAALP"
FT   gene            complement(252237..253409)
FT                   /locus_tag="KN400_0247"
FT   CDS_pept        complement(252237..253409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0247"
FT                   /product="efflux pump, RND family, membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83110"
FT                   /protein_id="ADI83110.1"
FT                   /translation="MNDAMEQTSAKPVRSVLLWAFVVAFILFFIWAYVYRVDQTTRGIG
FT                   SVISSSRVQVIQAVDGGVLQSLKVKEGDRVRRGQVVALLDQTRSGASVRELDARLAAMK
FT                   AQSARLRAEVLGSPSVAFPPELRGFPELVKVQQALFDQRRQSLREELRTLDVAVKLARE
FT                   DAHLVAQLAKTGDVSRSEVIRSERALNDAEAQLINRKNKYYQDASAELAKIEDEINQNE
FT                   QVRTQRNQQLFDSVMKTPVDGIVKNVRVTTQGGVLRSGEELMQIVPLDDKLIIETKVKP
FT                   SDIAQIRPGLPAAIRFDAFDYTIHGAVDGTVAYVSADTIKEESKAGEQTYYRVHVEIAG
FT                   SNPVRTRTGKQLDIIPGMTAQVDIRTGSRTVLDYLLKPLRKTMTESMGER"
FT   gene            complement(253402..255570)
FT                   /locus_tag="KN400_0248"
FT   CDS_pept        complement(253402..255570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0248"
FT                   /product="ABC transporter, ATP-binding/membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83111"
FT                   /protein_id="ADI83111.1"
FT                   /translation="MRPQGHETVIFGENSLATPIEAPVLARLLLKIGLPVASGELEQAC
FT                   LTSQPEGVDVKPAERISRILLAVKQKNVKVAQLRWERLDRRHLPVLVLCNGRWQLAEQG
FT                   EGETITLTAADGTSAHLNANDLTDTIVLWLKAERVEASAVELLQSNASRLLLAELLKEK
FT                   RWLVEVFVATIIINLLAVATSLFSMQVYDRVVPTFAYSTLTAMVVGMGIMVLFDWVLKY
FT                   LRARILDDVAKRVDMALSQKLFEHVVDLRLDRRPRSLGSLAAQMNGLETVRNFFSSTIV
FT                   FALTDLPFGLMFIAIVASIGGQVSLVYITLVPVSLLLGWLAQRKLRLLARLEIQRGHER
FT                   HGLLVDTLQGAETIQSSGSAWRFADTWRGITATMAGYSLKSKLISSLTTTTAATLGTVG
FT                   YVGAIVVGVIQIEEGHLTTGGLIACTILGGKILGPLAQSVGILVQWQHVREAIEMVNRL
FT                   LAMETSRPADKSLLVPDNLPDRLELDGVRFSYPATPVVRLQLGSLQFAAGDRVVLMGPN
FT                   GCGKSTLLKVAAGLYKAGEGQVRLGGADIWELDPQVLMERVGYLPQDVHLFKGTLRSNI
FT                   ALAGGVGDSRLLEVVELLGIDKLAADNPRSMELEISEGGQGLSGGQRQLTALARIFMAQ
FT                   PRVWLLDEPTAALDMESEERVFKAIQNWTRPTDIILIATHRPRLLALANRLIVMRRGQI
FT                   VADGAPNDVIQAMQAGPKTPHHSGAVHE"
FT   gene            complement(255567..256832)
FT                   /locus_tag="KN400_0249"
FT   CDS_pept        complement(255567..256832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0249"
FT                   /product="efflux pump, RND family, outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83112"
FT                   /protein_id="ADI83112.2"
FT                   /translation="MGSVRTRVLGAVIGALCLAATAWGQEAPMTGDGLDVALNFAAIGH
FT                   PSIKSQVAELKALGSDLKSAEYKRYPALTIQAQTMTNNQNQVVAVVQQPLWVGGRIDGG
FT                   IEQADVGLRIGRAALLDVRRRVMEETSAAYATLRGALQRLKAAELNVGEHEKLKGLVSR
FT                   RVEGGVASNADILLAESRLSQAIAQRIQLKGAVSRARSDLLALTQQPVAGNEPVPAHLL
FT                   ELPEPERMAEMIVKTSATVEQRILKVEDARITSRLAVASMMPALYAKVEQNVYVAERYG
FT                   ETPHETRFGVVLQGSVEGLGLSGWKKVKASDSRIDAARKEVAAAENDVRRQAEALVTDI
FT                   LSLRQVVRSYELLVTSTEETLASFLRQYDAGRKSWVDVLNAQREFSEARISLEQARSSL
FT                   EEASLRLAARLGQLDSFTGGNE"
FT   gene            complement(256969..274668)
FT                   /locus_tag="KN400_0250"
FT   CDS_pept        complement(256969..274668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0250"
FT                   /product="cadherin domain/calx-beta domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83113"
FT                   /protein_id="ADI83113.1"
FT                   /translation="MKKTSDDQVRAAKGKSIPLSSSGKDFIEGSLDFRPVSPKKQTAVR
FT                   KPGEEQEEKAAVAAEQTESDHMTADEAADVSYDHVAAITGEQSFADTLSVADQTKTGKE
FT                   EKCGDNNDDDDCDDKGGWLWWAGGAVGVAGGSIGFAVAALNGDDDEGTHVDTAAVAFAG
FT                   RVTDGPVHGATIYNDINKNGVYDDGIDKAMTHNSEAITSDADGNFTITVGDLIENGITD
FT                   INKLKLVAYGGIDTVTGEAVTVDFTAPEGYRYLNPVTSLIAAYMEAYNEANPNAKITAA
FT                   EAEEAVIQALGLPQIDYATTDLALPETAVEAQKVAAILAVAAMLIEESGTDSDGFAFLA
FT                   AHLAPSETPLPGTMTYLTDEVTTALQSANDTTAANQFSSTVVAVNDATSLDDINTALNN
FT                   TIFADLIVAGNVKVGQTLDGGLGMGSTTGLEVTYQWLESIDGTTWTPIAGETGSDYTIR
FT                   PTDILHHLRLQATYIGTDGQPRTIFYDVGVVPDSSPVFASSTSGAVAENEAVGTVVYRA
FT                   EATSDLENNPLSYSLGGTDADLFTIDVATGEVTLKNPADYESKSSYSIDITATDTYGLT
FT                   STTSVTIGIDNLDEVAPSITSGPTAATIAENSGPGQVVYTAAADDSADISGGVTFSLKA
FT                   DGDAALFTIDAATGEVTLTGNPDYEAKPAYSFTVVATDAAGHSTEQTVTLAIDNLDEVA
FT                   PSITSGPTAATIAENSGPGQVVYTAAADDSADISGGVTFSLKADGDAALFTIDAATGEV
FT                   TLTGNPDYEAKPAYSFTVVATDAAGHSTEQTVTLAIDNLDEVAPSITSGPTAAAIEENS
FT                   GPGQVVYTAAADDSADISGGVTFSLKADGDAALFTIDAATGEVTLTGNPDYEAKPAYSF
FT                   TVVATDAAGHSTEQTVTLAIDNLDEVAPSITSGPTADIAENTGAGQVIYTAVADDAADI
FT                   SGGVTWSLKAGSDAALTIDAVTGAVTLADNPDHEAKSGYSFTVVATDAAGHSTEQAVEL
FT                   SVLDNNASAAIAVDLTTIAEGSEGTSTILTYTVTRTSALNASSVDWAISGVDAADLAAG
FT                   QAAVGTVTFAIGETSKTFTVEVVGDRTIESNEDLVVTLGNPGNDIDLGTADSSATTIAD
FT                   DDGEVSIAATAVSVPEGDTGDSRVVTFTVTRTNTLSASSVDWDVAGGTVNAADFGGTLP
FT                   SGTVTFAEGEATKTISITVTGDRIIEPDETLTVRLSNPGLNLVLGVDEASSTIVNDDVG
FT                   FSIFGDVMDVVEGGIGEQRAITFHVVRSDSLTLPMTIDYRLIPRGSTVPDGFDFTGSPD
FT                   SLGDNAGRPSGTISFGPDETSKTVTIYVAGDAVPELNETFSIVLANAPPSTIIINGEIE
FT                   GVIRSDETQYSIHAVTAATVEGNGTGGIQQFLITRTGDTSQPGSVGYTLSEYGENPTEA
FT                   NDFAAGTPLTGTISFAAGETSKILSVNLEGDSVLEGYESFQVALHTLDSNSIIGTNTAV
FT                   ASIIPDDAAINIAATDSIVKEGTGAVSRSHTFTLTRSSHVDSEVTVDWHLAGTGANPVD
FT                   AADFGGTLPSGSVTFAPGETVKTLTITPSTDAAYEPHESYEIVLSTSQLGVVLETDHAS
FT                   GMILNDDSGLTLVATNLDKAEGNPGTPSQLTFTVQRTGDTTGESTVHWELVSADGSGVS
FT                   AADFASGILPSGDLTFSRGVTSRVVTIPLTTDNIIEPDKGFTIRLSSPSEGTELLVSEV
FT                   GGYIRNDDAAFTLESVSPVAEGHNGTTTVTFTVVRTGDISGADTVEYVVAPADGGAVVD
FT                   GADFVGGQLPDGLITFNAGEASKTVTLAVAGDNALESDEAFTITLVNPGVGSTIASGST
FT                   DVVILNDDDALSIVATDADQAEAAAGGTRDFTFTVNRTGFLDRATTVNWSVAGVGANQV
FT                   DAADFGGALPSGTLEFAANESSKTITITVNGDYFQEADEGFRVTLSSPSDGTTLTTASA
FT                   DGVIRNDDTGLAITATTTTLAEGDSGTVTHVFTVTRTGVTTGTTTVDWALAGSGGHPVD
FT                   AADFGGTLPSGTLVFAPGETTKTIEVQASGDTDIEPGEGFTITLSGADGNADIMTASAN
FT                   GTVVADDISIAISAGTASVMEGATGSSRVLQFTVTRTGDLASPVSIDWSASGMDAADFA
FT                   NGTALSGTINFGAGETVKTINLTQIGDNVSESDETLTITLSNPAGNPAHDRTYITSATA
FT                   TTDVVNDDASLTITADAASQNEHNTGDGEATSFTFTVTRTGDTSTETTIDWVLQLPGGA
FT                   GSAAGNDFVAGQDLLGTNSGLPSGTISFAADETSKTITVLVATDNQVEQDETFSIQLQG
FT                   AGANTEVSGNSASAVISNDDTGFSIIALAADHTEANGGTVTYTFRVTRAGDISSAATVD
FT                   WDVAGSGASPANADDFGGSLPGGTLSFAENEASKEISFTVSGDTVVEQDEEFTVTISNA
FT                   QLTDATPQLIQDATVGGIIRNDDQSFSVSAANASVTEGSAGTTQIAYTITRTGDLSDSV
FT                   TIDYAVTGAGGAATSDVQGGVLPTGTLTFAAGETSKSVTFDVIADTLAEGNETFTLTLT
FT                   NPSAGIIGTASDSTVVVNDDTNFALSAPAPFAEGESGSATATFTVTRSGDSTGAGSVQW
FT                   SVAPATGLTTADFTGNQDLLGTNSGLPSGTITFAAGETSKNITIQVAGDLTLENDETLR
FT                   VILADPTGGTIEGTDGDKSTTILTDDDSFSISTLTASRAEGNSDSTITYTVTRTGSLVG
FT                   ARDLTWTITGADGFATGNDLAGGQAATGTVSFADGQESATIVVNVKGDSAVESDETMTV
FT                   TLSGAPANSVIGTASASTVLTNDDASVSIVTLIADKNEGNVTIVTPTGEVPGSTASTFT
FT                   VSAAGTVSGTVESAGDRDWYKVNLVAGHQYQIDLIGNGSYTAGDVFLSLRNSTGIQLAS
FT                   NDDFIGVNSRITYTAPSNGIYFIDAGHLGSGTGTYGVTIADLTVPGTDMSAPAYGVGAQ
FT                   PYTFTITRTGDTTHGSTVEWRVAQGVGVDAVDFGSVGSQDLLGDNSGLPSGTVTFAAGE
FT                   ISKTLTVNIATDSAKETDEILRVVLSNPSAGTEVITASADGIVRNDDAELNITAGTFNL
FT                   LEGDGLHGTGKAMTYTVTRTGNINQTSTVDWSVVHGTTSSADFTNGVGSNLTPSGTLTF
FT                   ASGVATQTIVVYVYGDTGVGSVEGDETFSIQLSNPNSGSALGNITSYTSTILEDDTRLV
FT                   LSAADYSQAEKTAGNNTTYTYNIAREGYTGGTTNYSWAVGYTDPYTGNPAYMYDNTQSR
FT                   YETVTANASDFTGSLSGSGSFSAGQTNASFTVTVTGDDTPEDDEWFAVNLTASSGYDEV
FT                   TVIYDDPTKGTGTQLARTYYSPYRTYYDGQQVSSATNGVASNTNYLFSSIERDEAVYYL
FT                   SDREVASTSVQTLNPGDGLRTRVEGDTPADGGAGATTVTIEGVEYGYVEHIFAVQRQVA
FT                   TAGTASVGWRIGTYYNAAVSADDFLTITRDGNGDITAITTAGALPSGTVTFADGQEWAY
FT                   IKFYTKVDDIGEYDEYFSIFLENPSAGSSIYTYDTVSYPQYNYGIITNDDTRFDASVND
FT                   VVEGGTLTYTVTRSGDSRGTDTVDWSLALPGSEATNESNNSTGTWYKLDPSDIDSVTPS
FT                   NGTATYNAGTLTWSGTLTFEDGETTKTITVVTTDDSWTETWREELPIVLSNATNVNAGE
FT                   GNHDQETASTGYTDTARVYDNESDPLIGVSVGSSTTWEGTGANDSATGNSVTFTITRTD
FT                   QGGRDGSLNYPTTVAWRLDGSGINWGSANNSAEILTYGGDAASVNEYTSNTTYGVVTFA
FT                   AGETSKNVVVTFTGDRYVESDKTLTFTVLDPDDAEHGPLYTDFYGPADINNAQASVTTT
FT                   LKNDDIRLWVGGWDTYSGDANGYYTNVQTSAYEGNPLTFAVNRYGRLDCDIVVNYTLIN
FT                   GTTTNGDFTTTSGSFTLAAQGSAYGEYTYSISLADLLTDDTTVEANETFTLRLSAPGDS
FT                   AGSSVRFQSYYADYTSSYNSPATTLDVRGTVYDDDTTYTLTPASTSLVETDQGASQTFS
FT                   FDVTRGGTGYTGAAQLRWRVEAVGGTPADSADFTSTDLLGTNNGLPSGTVSFANGELTK
FT                   TFSVLIRGDLVAENNETFRVVLYEDVLTSSSPTITNSQSVASSTLTIVTDDTGISIADS
FT                   TLTESDANQTMTFTITRSGDTSGTSSMNWTLYHGTTTAGDFSGATTGTVSFAAGETSKT
FT                   ISVTVAGDATPEADETFTILLSNLVGVDEAIDISATGTIKNDDSSFAIAGDAASSPESG
FT                   SQTFTITRTNDTAQSQTITWSVSAGSAGAADFGGSLPSGSVTFAPGEMSKTITISPSSD
FT                   ATPETDESYTVSIALGAGTTGDTITQATATGTIENDDAAIYIAADQTNQQEGHSGTTPF
FT                   TFTVTRTGNTTGAASVDWALSSAGASAADFTTADGLGSNGGLPSGTITFADGESAKTIT
FT                   IEIVGDEVVEADESFTITLSNAAGGAIITGSAGSTIANDDSTIAIAADSAVKNEGNSGT
FT                   TAYTFTITRTGYLGEAETVEYSVAGSGAHPADGTDFNGTTGTLTLAAGEATTTLTINVS
FT                   GDLSGEPDEDFTVTLSNPSSGVTITTDTATGSILADDIVFDVAAPASQTEGNPGDTTYF
FT                   DFVVTRSGNLSGSQTLTWSVAGIGADGTSGSDFDSTTGTVTFDPGETSKTISVPVKGDY
FT                   LGEADENFRLTLTGPDGVVFTHNSADATIIDDEASLRISATDAGRAEGANGVTSYTFTV
FT                   TRTGNTALEATVDWSLAAGATDPDDFAGGTLPSGSLSFAAGELSKTITVDVAGDTAIEG
FT                   DESFTVSLSNASTGADIVIGSATGTIVSDDVEWTVSPLSVPAVEGDGASSYVFRVTRTG
FT                   SLSATTLDWSTAGSGTNPADADDFLGSFFPSGTLVFAQGQTSQDIVVQIAGDNLLEADK
FT                   EFSVTLAAPVNGLTHSYAEQTASATIVNDDDVISIAPLSADHAEGTDSSSPFTFTVTRT
FT                   GSLTGTSTVGWRIVHGDTSADDFVATTGTVSFADGQDTATLTVLVSGDRNLEGDEGFSV
FT                   ELYNPGAGSTVDDTATTASGIIHDDDVDLSLAAADANVAEGDSSTAGHATFTVTRSGDL
FT                   SVETSVNWNVVAGTATAADFAGGELPGGTVVFGAGESSKTITIDLAGDGAWEGNETYTV
FT                   QLSGASDHADIVANNVSGQIIDDDDTLTLSAVSADHAEGNSGATIYTFRIDRAGTATGA
FT                   TSVEWIAAGSGAHPTDQDDLLATTGTVTFADGETSKTFTVEVAGDTTGEYDETFSVSLA
FT                   NPAYGSTTVGAPVTATVRNDDAVLFVRADHVSVAEGADGVETTFTFTVTRSGDTSGAAS
FT                   ALWEVTGSGLRPANAADFGGIFPSGAVAFQPGESTQQISLTVLGDAVGEYDETFSLVLS
FT                   DPEGATILEGTAETIIANDDTGISITALDADKAEGNNGLTDFTFRIERVGLANGAASVS
FT                   WAVAGTGSYPAGADDFAGGILPSGTVYFADGESVKDITIQVAGDETYGQDQTFRVLLSN
FT                   PAGANLINADATGVIRNDDSQVAITALDTAKLEGNAGTTTFSFQVTRTGALDTSATIDW
FT                   DVIGSGGHQTVAGDFAGNSFPGGALTFAVGESSKTITVEVAGDSLTEVDEEFSVRLRNP
FT                   GSGVSIAPNAGEASATILSDDDGVVLIGLDVDRHEGASGTQTVYTYQVLRSGNIDAPIT
FT                   LNYAVSGDVDSADFMSPLTGSFEMGAGENSRLLTLTVNGDDIVEPDEFFQVTLSGSGIN
FT                   IDSTPVTGAIRGDDVAGDGNDVIHAAATADTINSGAGDDVIHLTMDNLLHLQVTDGAHV
FT                   DGGLGFDTILFDAAGQEFDLVALVANDATSGIEKIDLGGEGNTLRLTTAELLHQDQNLF
FT                   SILANGSEPFHQLMVDGDADDEVIIADITNWSHGAADTYTDGSVTYDVYTNGTDHTQLL
FT                   INQAITNVHGVAG"
FT   gene            complement(274901..276253)
FT                   /locus_tag="KN400_0251"
FT   CDS_pept        complement(274901..276253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0251"
FT                   /product="transcriptional regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83114"
FT                   /protein_id="ADI83114.1"
FT                   /translation="MGELTDVTILYVEDEPVLREQVVFALRMHFSRVLSACDGKEAMRM
FT                   IRAECPDVVVSDIRMPAMDGLTLASLLKTELPDLPVVLCTALHETDHLLKAIELGVAAY
FT                   VSKPIDLEKLQHAIRLASLPCVNRREIARLRSEAAISNGLLGEGSIMRPIAEQLQRVAD
FT                   TDLSVMLLGEPGTGKNFLAAKVHALSKRKTQPFLAVDCLARTPEQLEKELFGEAKGRGR
FT                   PSSGATELLSEADGGTLLLDGPERLPLQLQQRLFNLLEDGMFVPNGSIRPVACNLRVIT
FT                   VTGANLDKLAQAGTFSQELLERLKDVEVTLPPLRERRSDIPLLARFFLAVAADEFGRHC
FT                   PSMTTEAEELLQQQQWPGNLRQLKQLMRRALFMAGNPISDAGLKPLIGQATSPIVPDLL
FT                   PSSLDLVELEKWAIIQALAATDGKKQQAARLLGVSYNTFKDKIRRYNLTGL"
FT   gene            complement(276255..278108)
FT                   /locus_tag="KN400_0252"
FT   CDS_pept        complement(276255..278108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0252"
FT                   /product="sensor histidine kinase"
FT                   /note="domains: HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83115"
FT                   /protein_id="ADI83115.1"
FT                   /translation="MPFYISPYLILPILSFLVNAVLAAYSWRNRRLPAAQPLFFLMIGM
FT                   AGWSCAYALNTAATSLSLKIRFFQMGVTFVCLIAPSVIALALESIGRSDWLTRRRLALI
FT                   CVVPALSLLLVWTNEFHLIFRHDMYLYSSGPLLLLGFENGPYFPIHQLYVIFANIVAIV
FT                   LFGQALRRSPRGQGLRFALLIAATALPILVELLAITPVKGFSMTTSSLFISGSLYVVAI
FT                   FRYRLLDIAPLARTALFAQLGDPVLVFDIHGALADCNNSARILAGDKPDHDLADICRVI
FT                   LTRIPELETHLAQPTTVPRNSYAADTADAGHHWSISSLPLQSGGVSRGLLVQLHDISDL
FT                   KEAERNLRASEQNLRELNHTLQERVESETTRRLERERLLANHARLAAMGDMLAAVAHQW
FT                   RQPLSTVGMIVQNIRNAWHSSQLNQAYLDSSVETAMKQIHQMSETIDTFRRFFRPDKQK
FT                   EALDAVAQIKKAVSIMEPQISGIRISSHVLEQDHGPAAISGFPNEFTQVIVNLLSNARD
FT                   AIRERQSVEPAVAGEIMIVVIKRHNSIEILVRDNGCGIAPESKGRIFEPYYTTKEEKGG
FT                   TGIGLYMSRMIIEDSMGGKLSFSSEPGETDFTIILPAAEEA"
FT   gene            complement(278484..278559)
FT                   /locus_tag="KN400_R0006"
FT   tRNA            complement(278484..278559)
FT                   /locus_tag="KN400_R0006"
FT                   /product="tRNA-Ala"
FT   gene            complement(278622..280424)
FT                   /locus_tag="KN400_0253"
FT   CDS_pept        complement(278622..280424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0253"
FT                   /product="sensor histidine kinase, GAF and GAF
FT                   domain-containing, nonconserved putative heme-binding site"
FT                   /note="domains: GAF, GAF, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83116"
FT                   /protein_id="ADI83116.1"
FT                   /translation="MAVHDPYTILSSAIRIANATERSHDERLKTLALLIAEAFGALSAT
FT                   FYLLDGDGRVIVRKISSAFSDICSRDCRIPGGRGIAGLCASSGKPIRQDCAGCHPDEVV
FT                   TGNERTIAAFPVSCQGQSLGVLALGFAHDAPLTDDDRDMLAVVLIEAAGVMRCKRQLES
FT                   VEKRIRELSFLNRINGVMLSTIELNRLIHLLLTALTSDQPPLFDRAMLFLLNERAGILQ
FT                   GMMGITSARQTDSNAPSEPRTKRRFPVRNADFDSVVKATRLPLDASLNQISRAVLERTL
FT                   LHVQHPDQEQPVDRTLTKQFGTSSYAVAPLVSQDRVVGAIVVDNRLTDRPLAGDDLGIL
FT                   HLVSGQAGMAIENSILFHRLEETNRNLQDAKERLLQEEKLAAIGRMAASIAHEIKNPLV
FT                   SVGGFAGRLKRKFTPESEEWLYADVIGREVQHLEKMLSDILFFSRKTTICYTRCGINQI
FT                   IEDGLATMAVPLEQREIVVDKRFASRLPTLLGDCQQLRHVFTNLISNALDVMEPQGVLT
FT                   IETGLARIDGKRAVSVKVGDTGSGIAPDVRHSIFTPFFTTKEKGTGLGLAIVHRIITNH
FT                   GGRIEVENRPEGGALFTVVLPTSP"
FT   gene            complement(280463..280819)
FT                   /locus_tag="KN400_0254"
FT   CDS_pept        complement(280463..280819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0254"
FT                   /product="zinc finger transcriptional regulator, TraR/DksA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83117"
FT                   /protein_id="ADI83117.1"
FT                   /translation="MESEKLEYFRTILNEEMRTLLDEAGKTVSEMTSDSTPFPDPNDRA
FT                   TQESDRNFELRIRDRERKLINKIREALERIDDGTFGTCEVCGEEIGEGRLKARPVTTLC
FT                   IDCKMEQERKEKHP"
FT   gene            complement(280904..282256)
FT                   /gene="radA"
FT                   /locus_tag="KN400_0255"
FT   CDS_pept        complement(280904..282256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="KN400_0255"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83118"
FT                   /protein_id="ADI83118.1"
FT                   /translation="MKTVTRYACQKCGYQSAKWLGKCPDCAAWNSFVEEVTGGGRKGAA
FT                   SLPAATRPVPICDVASEAETRLSCGISEFDRVLGGGLVSGSLVLIGGDPGIGKSTILLQ
FT                   VMDHLARTAGPVLYVSGEESARQTKMRGERLGIGARELLVLAETSLELILSQVTALAPR
FT                   ALVIDSIQTVFSANLESAPGSVSQVRECAGRLMELAKRNGIPTLLVGHVTKDGSLAGPR
FT                   VLEHMVDTVLYFEGDPGHAFRILRAVKNRFGSTNEIGVFEMKEGGLSEVRNPSELFLAE
FT                   RPLGVSGSAVVTTIEGSRPLLVELQALVTPSSLGVPRRTTLGVDHNRLALLVAVLDKKV
FT                   GLHLSGQDIFLNAAGGARLSEPAIDLGMVAALASSHLDKIIDPHTVIVGEVGLAGEVRA
FT                   ITQAETRVREAAKLGFTRAVIPAGSVRQVGDVPGMNVVGVKSLDEALEQLF"
FT   gene            282408..284045
FT                   /locus_tag="KN400_0256"
FT   CDS_pept        282408..284045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0256"
FT                   /product="HEAT-like repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83119"
FT                   /protein_id="ADI83119.1"
FT                   /translation="MGANGGNATGRPAAGGGQYGIVLAELYRALKALTFYPEGHPQRAE
FT                   VLARAHAALRGILWGTEPVFVIGKNGFTASEGGAFVEPTAMTQALARELFIRRVKRLTI
FT                   LPDVGEADLSLFLTLLSMDHRDVHEAGGIEALMAQLGLTTIWVNEVDLDEIRRKRAVVE
FT                   QTRSAAAHDGTSDNVLSAIEKVADQDGTPEEGRDAAGLQEEDRLEAEAILGRMERETSD
FT                   DRYRELARLLSARCAELGDRGEFERILWVLVNLHRHAKSEAASAARRGYALLAFEKAAG
FT                   GPMLPFLVGRLEERGEERETLVDLFREIGEPAVALLVERLTLAESRNARKLIIDALVAI
FT                   GAESVALLTEHLVDRRWYVVRNAAVILGEIGDPASAEPLRACLVHTDVRVRREALRSLV
FT                   KIGGEQAEDAIIGLLAAEDNLTKRHAVISLGLLKSRRAVEPLCALIERRDPFKKSLAFK
FT                   RDVIQSLGRIGDRRAVPSLLRLLEHRPWFGRRRWDDVRMAVVTTLAQIGDPAALGLLDS
FT                   LAAKGGMLAAASADAAEDIRRRGGVVND"
FT   gene            284038..285399
FT                   /locus_tag="KN400_0257"
FT   CDS_pept        284038..285399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0257"
FT                   /product="cyclic diguanylate phosphodiesterase"
FT                   /note="domains: HD-GYP"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83120"
FT                   /protein_id="ADI83120.1"
FT                   /translation="MIKLAQPQAQRLVLLLAGAVRSVLLYPGSHPAVVQQFAHLGSHVT
FT                   ELLRAYPEVRIGIIDGVLFCENHLFFTPTAAEEELAALLTNRHVEAVAFRAGLTPLELE
FT                   RFVELLTRRELLGEQLVAEVKRAGIAAISVELCGSGATEDHSQGDDEYDPGTTYREALD
FT                   VVTGLFSEVEKGRIPSSDKLRGVVDRMATMIMQDRATLLGLAMIKDYDNYTFCHSVNVG
FT                   ILSMSLGAAAGLQRDELGELGMAGFLHDVGKTRVEITILNKPGRLSSDEYERMKMHSEE
FT                   GARIVGEMPGVGERIARAVLGHHIRFDRAGYPESARALAFDRFCDIIAVADCYDAITTL
FT                   RVYKSPLNPKDALLKLRSLAGSHLDSGLVQAFTEMMGRYPVGTLVRLDTNEVAVVFRPD
FT                   PNGGERPVVKVVADPAGRLLDPAHMKNLARETGTRIVSVVDPLMTAIDVNRYLG"
FT   gene            complement(285409..285990)
FT                   /locus_tag="KN400_0258"
FT   CDS_pept        complement(285409..285990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0258"
FT                   /product="HEAT-like repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83121"
FT                   /protein_id="ADI83121.2"
FT                   /translation="MKAQVSMTRREELIALLKDPAEEVREAAARAIERIEGAGSFAEVI
FT                   EQLKKGNRGAKIRAIYALGRIGGERVLTPLMYCAMRPEEDIRIAAIDVLGTLATPQAFP
FT                   LLAECLREPSAAVQAKAIEALGRYRTTEAIRLILPFLDARDGFLDAEAARAVGNIGSAD
FT                   HEGKLLALLSSPHPATRAAAAEALGTLPFE"
FT   gene            286098..286430
FT                   /locus_tag="KN400_0259"
FT   CDS_pept        286098..286430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83122"
FT                   /protein_id="ADI83122.1"
FT                   /translation="MKLNIKAALLSAFVLPGLGQLKNGRRAKGGVLLLLSNVFLIGAVF
FT                   VVLRGLGPVLVKAKITGVVDANAVAETMASGGAVAMGLLAFFAAVWCYAVVDALFDRGD
FT                   ETDADG"
FT   gene            286528..287508
FT                   /gene="fabH-1"
FT                   /locus_tag="KN400_0260"
FT   CDS_pept        286528..287508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH-1"
FT                   /locus_tag="KN400_0260"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83123"
FT                   /protein_id="ADI83123.1"
FT                   /translation="MFHSIVLATGGQVPERVVPNSHFSYLVDDADTWIQSRTGIRERRF
FT                   AAPDEATSDLATAAALKALDRAGMGAGELDCLIVATSTPDMCLPATACMVQKNIGAVNA
FT                   FAFDMNAVCSGFVFGLETADNFIRSGKYERVMVIGADTYSKILDFQDQTTCPLFGDGAG
FT                   AVILGRTTERTGILQSVIRSDGSGWELIQVPSSGSRKPVTAETIALRENSFRMAGKQVF
FT                   IFATDVIPQIIEEVTTKAGVAVTDLDHIIPHQANYRIIDFISRKTGIPKERFLLNLDRY
FT                   GNTAAASVGLALDEYLRNGTIKPGELVLMMGFGGGLSWGGILIRA"
FT   gene            complement(287498..288557)
FT                   /locus_tag="KN400_0262"
FT   CDS_pept        complement(join(287498..288107,288109..288557))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0262"
FT                   /product="CheR-related putative SAM-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83125"
FT                   /protein_id="ADI83125.2"
FT                   /translation="MSPHHTPLHPCFDPAETSNELSRLLVSGPIVDADLDRRIARLRER
FT                   FRIYCGIYPFGMWDSGLVVTREMRALTDLLLPLAEILPAFSRLFRLTLRFPPLLEATPL
FT                   TTACSWLDLLERLDVSAARGNPARLLEQLAGDGARRTSFVFSLFIPRHYGGGFDRYPDQ
FT                   TAFLKRWIRQRGTPEGGIFSVLDAACGCGEGTYALARLLMGMGVAPDRFRVLGSSLEEI
FT                   ELFAARHAFFPHDQRRGEVLRSFAAPLLAAGAATSIGFVREDIREATGGAWDVILCNGI
FT                   LGGPFIHDRQTLERTIARLAARLAPGGLIVAADRFHEGWKRRVPAAMLEEMLRGAGLTV
FT                   LTVGEGVAGVRP"
FT                   /artificial_location="low-quality sequence region"
FT   gene            288616..288948
FT                   /locus_tag="KN400_0263"
FT   CDS_pept        288616..288948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83126"
FT                   /protein_id="ADI83126.2"
FT                   /translation="MIMLQRLWTFILVTAWCLVPPFTKNGSPCAGTAASVGSRGPGGVQ
FT                   RDLAPLARFLSCPESGVDHNGELSLFIPHCPALAGPLLLFRLKRTGFSLCRALIREGGI
FT                   LLSARR"
FT   gene            complement(288949..290037)
FT                   /gene="cheB64H-1"
FT                   /locus_tag="KN400_0264"
FT   CDS_pept        complement(288949..290037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheB64H-1"
FT                   /locus_tag="KN400_0264"
FT                   /product="protein glutamate methylesterase CheB associated
FT                   with MCPs of classes 40H and 40+24H, response receiver
FT                   domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83127"
FT                   /protein_id="ADI83127.1"
FT                   /translation="MLQNQTRKLRVLVVDDSSFMRMVIRSVLEKDPAIEVVGIAVDGME
FT                   GVEKALALKPDLITMDIEMPRLDGISALKQVMAKCPTRVLMVSTLTCEGAKATFDALDA
FT                   GAIDYIPKNVTDSADAQRVFREELLRKVKGAASSIFGRPMTTSAPRAIIAPPRQVQPAP
FT                   RPSQALAGKFHYVGIGASTGGPVALQEVLGRIPGNYPHGIVVAIHMPKAFTGPYAERLN
FT                   SKCSLQIKEANDGDIIQPGVVLVAPGGRHMALARQGNSIVVRTLSTAECPQYIYIPSVD
FT                   HMMTTLADATNGSALGVILTGMGSDGFKGMKHLKSKGGITIVQDEATSTIYGMPRACIE
FT                   GGVADTVLPLTQIGSEIARLGG"
FT   gene            complement(290044..290934)
FT                   /locus_tag="KN400_0265"
FT   CDS_pept        complement(290044..290934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0265"
FT                   /product="metal-dependent phosphohydrolase, HDOD
FT                   domain-containing"
FT                   /note="domains: HDOD"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83128"
FT                   /protein_id="ADI83128.1"
FT                   /translation="METSKMEKAAALLGGMIDLPTIPAVAIQVLSLLDEPEVDVDDVAE
FT                   LVLTDQVMAARVLKMVNSPLYRPATEITSLKGALVYLGLRHIREFILTCSIIQCSEGKD
FT                   GVLGVKPFWEHSFGVGIVARLIAEKVGYHDTEKAYIGGIIHDIGEVFLSYYMRDEFQKI
FT                   VDSISDKPHKLVEAEEEFLGTTHCEIGLCIARAWRFPDDYCEVIAHHHAPQEAKNAPRL
FT                   TAIVNLADLFCNVRQLDYGGKAWVSFSLADEPAWGMLQGPGSRLSELDIERFCYELDDR
FT                   VEEISELVGNIFKNG"
FT   gene            complement(290952..291785)
FT                   /gene="cheR64H"
FT                   /locus_tag="KN400_0266"
FT   CDS_pept        complement(290952..291785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR64H"
FT                   /locus_tag="KN400_0266"
FT                   /product="protein glutamate methyltransferase CheR
FT                   associated with MCPs of classes 40H and 40+24H"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83129"
FT                   /protein_id="ADI83129.1"
FT                   /translation="MKLSDKDFEILRDFIYNHCGMYFHASKKYFLESRIARRLEATKCS
FT                   DIHGYLGHLKGGVGKAEELTKLLNEITTNETCFFRNPPQLKALENVFLPEIVATKGKIG
FT                   FRKIRIWSAGSSSGEEAYTMAMMLLEKRSTILKDWIIEIVGTDISESVLAQAREGIYNS
FT                   YSVRNTPDFYLKKYFREETGGRFLLSPDVKKLVSFSHLNLYEDSKMVFMKSFDFIFCAN
FT                   VLIYFDLASKTKVVQHFYNNLQPYGYFFVGQSESLHGVNDKFKTVHFPGGFAYKK"
FT   gene            complement(291836..293668)
FT                   /gene="cheA64H"
FT                   /locus_tag="KN400_0267"
FT   CDS_pept        complement(291836..293668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA64H"
FT                   /locus_tag="KN400_0267"
FT                   /product="sensor histidine kinase CheA associated with MCPs
FT                   of classes 40H and 40+24H"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83130"
FT                   /protein_id="ADI83130.1"
FT                   /translation="MAIECEDQELLEGFLTETTELLEKLDDDLVALEKAPSDADLLNGI
FT                   FRSIHTVKGASSFLGFELLVKVTHKTEDVLNRLRRGELIVTPEIMDVILEAVDLVKVLV
FT                   ADIKGGDIVDREIDGTISKLIPLLSENAKEATVLKAPAAQPETSAPAEQSAEETASASE
FT                   QSADASAPTETAPPPPPEKAASAPAVRPQNAPAPAKDDKKADDLADNSTVRVDVKRLDD
FT                   LMNQVGELVLERNRMMQLNTDFQGDSGDSSFGEEFAKLSKRISFVTSELQMQVLKMRMI
FT                   PVEKVFKKFPRIVRNLARDLGKEVDLTVLGEETELDRSVVDEIGDPLIHLIRNAMDHGL
FT                   ETPDERVAAGKPRKGTLILSAAHEGNQIVISIKDDGRGVDTDKVARKAKEKGLVTDEQL
FT                   AAMGQRELLDLIFLPGFSTKEKATDLSGRGVGMDVVRTNIKKLNGIIDIRSELGRGSEF
FT                   ILKLPLTLAIIQSLLVEVEDETYSLPLAAVLETLRVDEKEFHTIGGQEVLKLRDSVLPL
FT                   MRLQRIFNIAPGERNRSSCYVVVVGVAEKRVGLVVSRLLGQQEVAIKSLGKYLANLPGI
FT                   AGSTILGDGRVTLIIDPAGLIENSDGSGGGRVAA"
FT   gene            complement(293717..294211)
FT                   /gene="cheW64H-1"
FT                   /locus_tag="KN400_0268"
FT   CDS_pept        complement(293717..294211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW64H-1"
FT                   /locus_tag="KN400_0268"
FT                   /product="scaffold protein CheW associated with MCPs of
FT                   classes 40H and 40+24H"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83131"
FT                   /protein_id="ADI83131.1"
FT                   /translation="MQNALQTRVDETRNELIQLVSFKLEEEEYGVNVLKVREIIRMPSI
FT                   TRVPNTPHYVEGVINLRGKVIPIISMRKRFGLPEGENSSQTRIMVMDMEGELMGFVVDA
FT                   VSEVIRISESEIQPPPAVVNSAVEQECLSGVINQTERLLFFLDLEKLITQDERRLFSGM
FT                   I"
FT   misc_feature    294500..294526
FT                   /note="conserved nucleotide sequence; KN400_R0123"
FT   gene            294605..295999
FT                   /gene="fgrM"
FT                   /locus_tag="KN400_0269"
FT   CDS_pept        294605..295999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fgrM"
FT                   /locus_tag="KN400_0269"
FT                   /product="flagellar biogenesis master sigma-54-dependent
FT                   transcriptional response regulator"
FT                   /note="domains: REC, sigma54 interaction, HTH8"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83132"
FT                   /protein_id="ADI83132.1"
FT                   /translation="METPRLLIADDDKKTRDFVAAFLKYKGYDVVQAFDGQDALEKLEV
FT                   EDVHLVITDLMMPRVNGLEFVKKLKAMRPGTVVIAYSAFGNYEMTSNLLKAGVFFYLEK
FT                   PFNLDELETHVKRGLEHQSLQSQTYRSKPALKSRSLIPNIIGESPRMLSLFELIEKVAE
FT                   SDSTVLIQGESGTGKELVARAVHDLSNRKNRNFVPVNCAAIPDELLESELFGHVKGSFT
FT                   GAIATRIGRFEMADKGTLFLDEIGDMKPNLQVKLLRVLQNRELEPVGATRSKKVDVRII
FT                   AATNQNLEKLVASKQFREDLFYRISVIPIFIPPLRDRREDIPLLVNTFLDRFNRNKKSK
FT                   VKGIDADAMEILCGYDWPGNVRELENLVERLVILKGFGTLGVKDLPEKYTGVSLSAPSE
FT                   TLALPDAGICLNTVVEEFENNLILQALKKTGGNKKEAALLLNLKRTTLIEKLKKRKLDV
FT                   ISTSLA"
FT   gene            296008..296775
FT                   /locus_tag="KN400_0270"
FT   CDS_pept        296008..296775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0270"
FT                   /product="lytic transglycosylase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83133"
FT                   /protein_id="ADI83133.1"
FT                   /translation="MFIDPTQRPNLQTDTAAGERPSVTGVADTSRFEALLAGRAASPGR
FT                   KTDIRETAAAAAELMRLDMMRSAFSLGDTAGETPRPVGAQAMEFILKSFAQNRGEVTGA
FT                   DAAQAEVGAPADVSAAEVSSTGPRDAGWLEDVIQRASRRYGVEVGLIKAVIKAESNFNP
FT                   NAVSHAGAQGLMQLMPATARGLGVTDSFDPEQNVMAGTRFLKDLLKRYGGDIDKTLAAY
FT                   NWGPGNVDRKPHLLPRETRDYLVKVKEYYSQFA"
FT   gene            296918..298882
FT                   /locus_tag="KN400_0271"
FT   CDS_pept        296918..298882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83134"
FT                   /protein_id="ADI83134.1"
FT                   /translation="MPHRLHLEQFGPVHALPVLHYRLEFAHLVREAVRRVKPDCIAIEL
FT                   PSTIEAPFLRAVERLPEISVIHYEGRQRRDGAESVYLLVEPADPLVEGARLALERRIPL
FT                   RLVDVDTDSYPRHVEALPDSYAIHRIGLTPYYEEYRRAAASVAPGREDRRRERGMAWRL
FT                   QELAKEHGSILFVCGMYHLERIKDDFGRPQAAPLERVRRQGVRLFNLHPDSCREILDEF
FT                   PFISAVHELRRGPLPPEPDDRGETLRKRFSAFELIVGGRKDLPAEELLRHAVERGARHA
FT                   GRGEEFPDRQRIIFRLFQEAARHYRQETGDPVHLWQKRAFFRFARNYALASGALLPDLF
FT                   QLLMAARGCVDDNFAYALWRLATFYHWQRAEADIPTISISPEEIWGGSRRIRFRPRERR
FT                   RKGLSHLGFLKRKKEKRPGEWLEGFTDPSICSYPPEDVLIEEYGRFLKKKGAMQLSEEL
FT                   SRTEPFTSSLLDGIDLRETLRNVADGRVYVRESQRAKGGVGSVVVIFDEDRENGNYPYR
FT                   TTWLGEHEQESDMAFYATPPEDNIVGPGICRCEYGGFLLSSPPRRMMDVWRDPDYVFAR
FT                   SKPEVLLLAALDYSPEKHVVHVAARPPRSIFRQIAARMGKKIVHIPLGSLSSVKLKSIR
FT                   VLHILHGHDKRQVAKDYIW"
FT   gene            298945..300162
FT                   /locus_tag="KN400_0272"
FT   CDS_pept        298945..300162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0272"
FT                   /product="sensor protein, DUF3365, HAMP and PAS
FT                   domain-containing, heme-binding"
FT                   /note="domains: DUF3365, HAMP, PAS"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83135"
FT                   /protein_id="ADI83135.1"
FT                   /translation="MSWFANLKITPKFIVILCVLFVALMGVNAVDDYLRQESLIVKDAT
FT                   DNARILARQIVETREYMSSVVRGEPEANYNLVPQVVATQVAKRITTGSKYYVRQVSLRY
FT                   RNPANRPDAYETAMLQRFGREKAAEQWEVVTIDGKRVFRYLLPMTADASCLGCHGRYEE
FT                   APAFVQARFPKGHPSYDYQIGQLIGAVSVSIPMADLYRQIGINLKLDLAIVSGVVLLIL
FT                   AAMSFMVHRSIIKPVRSVATSIGNVAATGNFSERLRRSSNDEVGELVGAFNELMEELDR
FT                   TTRQRQESEDRYRNVLEMAQSAIVTFLADGKLIITNRKAEDLFGLPKGELLGVSIYTFM
FT                   EEGDAVKGAIETYLREGAAAMIGETTPQRIRSIRGNVTTVEMALSVSRSDHNPLFTAIL
FT                   RENGRS"
FT   gene            complement(300159..302792)
FT                   /gene="pepN"
FT                   /locus_tag="KN400_0273"
FT   CDS_pept        complement(300159..302792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepN"
FT                   /locus_tag="KN400_0273"
FT                   /product="aminopeptidase N"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83136"
FT                   /protein_id="ADI83136.1"
FT                   /translation="MHLPHNHPVALSDYTPPDYRVESVHLTVDLHDDVTLVRADLSVVA
FT                   NHDRTKGIRPLVLDGRGLVLRCIALDGKPLTTDEYVRDDETLTIHHVPEQCTVSVSTEL
FT                   KPQENTLLEGLYRSGGTFCTQCEAEGFRRITYFPDRPDVLAAYTVTITADRATCPVLLA
FT                   NGNLAASGDLPDGRHYATWHDPFPKPSYLFALVAGDLVKVEDTFVTKSGRRVALQIYVQ
FT                   SHNRDKCDHAVRSLAEAMRWDEEAFGREYDLDLYMIVAVDDFNFGAMENKGLNVFNSRY
FT                   VLARPDTATDADYAAIEGVIGHEYFHNWSGNRVTCRDWFQLSVKEGLTIFRDQEFSAAM
FT                   GSSAVKRIQDVRYLRTHQFPEDAGPLAHPVRPETYDAINNLYTATVYNKGAELIRMLRT
FT                   LVGHDAFRRGMDLYFDRHDGTGATVENLVSALAEASGRDLTQFMRWYREAGTPEIHVTG
FT                   SHDADTKAYTLTIRQGVAGGEPLLIPLAMGLLDRNGNELSVHLDGEQAPLEPGRALELS
FT                   RQEETFCFRGIPEEPVPSLFRGFSAPVRLHYAYTEADLALLMGKDGDLFNRWEAGQRLM
FT                   TGTILQLVADRRAGQELRLPPALVEACGTLLTSGGNDRAFLAEALTLPSENLLGEQMKE
FT                   IEVEGIFEARRFVRTALARQLRGELSALWDQCRPTGPYRFEPAETGRRSLAACCLGYLM
FT                   TLDDPSIRQACLRQFREADNMTDSLSALTLLAHTEGSEGETALAEFHARWREEPLVIDK
FT                   WFAIQATSPLPDTFARVQRLLEHPDFTLANPNRARSLILSFAVNNPVRFHDRAGGGYRL
FT                   LADHVIKLNSLNPMIGARMAEPLTRWRRHELNRRERMKTELERIAREPTLARDIRDVVT
FT                   KGLARD"
FT   gene            complement(302867..303048)
FT                   /locus_tag="KN400_R0059"
FT   ncRNA           complement(302867..303048)
FT                   /locus_tag="KN400_R0059"
FT                   /product="6S RNA, stationary phase repressor of
FT                   sigma-70-containing RNA polymerase activity"
FT                   /ncRNA_class="scRNA"
FT   gene            303344..304108
FT                   /gene="hypB"
FT                   /locus_tag="KN400_0274"
FT   CDS_pept        303344..304108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypB"
FT                   /locus_tag="KN400_0274"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83137"
FT                   /protein_id="ADI83137.1"
FT                   /translation="MCTTCGCETGSHHHHHEHGHGHSHSHGHTHDDERESRKIAVETDI
FT                   LSRNNRFAADNRALFAKKGVFVLNLVSSPGSGKTTTLERTLGDLSDRYRCAVIEGDQQT
FT                   DNDAQRIAATGVPARQINTGAGCHLDAHMVGHAAEEFDLDALDLLLVENVGNLVCPASF
FT                   DLGEHHKVVVLSVTEGEDKPLKYPNMFHAADVMLLNKIDLLPYVDFDVEKCLEMARRVS
FT                   PGITIFQVSSRTGEGMDAWYAWLADRIAAVKG"
FT   gene            304124..306415
FT                   /gene="hypF"
FT                   /locus_tag="KN400_0275"
FT   CDS_pept        304124..306415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypF"
FT                   /locus_tag="KN400_0275"
FT                   /product="hydrogenase maturation protein HypF"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83138"
FT                   /protein_id="ADI83138.1"
FT                   /translation="MVLRLRIAVEGIVQGVGFRPFIFRLAAHHGIVGWVMNSGAGVVME
FT                   AEGDAGALAAFRSAIVSDAPPLAVIARIAIEEIAPQGDGSFVIGESGEGAGTVRVAPDG
FT                   DVCPDCLRELFDPSDRRYRYPFINCTNCGPRYSLVTAVPYDRSNTTMARFPLCDACRSE
FT                   YEDPMDRRFHAQPVACPDCGPTLRLVDASGAGLPGDPVDQTVELLTEGKIVAIKGLGGY
FT                   HLAVDAANDAAVAELRRRKHRDEKPFAVMARDMEAVARFALVDSVEARLLTGPEHPIVL
FT                   LRKRPSTILSGRVAPANGYIGTMLPYTPLHHLLLEERFAALVMTSGNLSDEPISYRDDE
FT                   AVERLSAIADAFLVHDREIRTRIDDSVIRVFRGSPLFLRRSRGYVPREVRLPVEIPPVL
FT                   AVGAELKGALCLTRGDRAFPSQHIGDLKNDTTLTSLAATAEHLQALLEIRPQLVAHDLH
FT                   PDYLSTGYAEGIAGLPRVAVQHHHAHLASCMADNGLDGSVIGVIFDGTGLGTDGTVWGG
FT                   EFLVGGYDGFRRAAHFRQVPLPGGDAAVREPYRMALAYLHDAFGADFFEQPVPWLTEVG
FT                   DEDRSLFLRMLERRINSPLTSSCGRLFDAVAAMVGLRRTVSYEGQAAIELEGQAEESAT
FT                   GRAYPFAVLSRQGAIEVDYRLMIRALMEDLAVQVSLPEMARAFHNTVAASVVDVCRKVR
FT                   SETGLDRIVLSGGVFQNRLLCEESCRLLEAEGFRVFTHRLVPPNDGGVALGQAVIAGVA
FT                   HRVPRSDKGE"
FT   gene            306422..306652
FT                   /gene="hypC"
FT                   /locus_tag="KN400_0276"
FT   CDS_pept        306422..306652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypC"
FT                   /locus_tag="KN400_0276"
FT                   /product="hydrogenase assembly chaperone HypC/HupF"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83139"
FT                   /protein_id="ADI83139.1"
FT                   /translation="MCLGVPMQVVAVGEGEVVAEIDGVRKEASLMLLDEEVRVGDFVIV
FT                   HAGFAISKLDEEDAQETLRLMREVFRPEDMA"
FT   gene            306652..307743
FT                   /gene="hypD"
FT                   /locus_tag="KN400_0277"
FT   CDS_pept        306652..307743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypD"
FT                   /locus_tag="KN400_0277"
FT                   /product="hydrogenase expression/formation protein HypD"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83140"
FT                   /protein_id="ADI83140.1"
FT                   /translation="MNYQDEFRDRALVQGYAQRIARLVEGRTDVMTFMEVCGTHTMSIY
FT                   QYGLRSLLPPQVRLISGPGCPVCVTPNEYLDRAVALCRLPGVIVATFGDMVRVPGSSSS
FT                   LQEERAMGADVRIVYSPLDAVALAAANPDRKVVFLGVGFETTAPAIGGSILAARKQGLA
FT                   NYFVLAAHKTMPIPMRVLANDPELGIDGYLCPAHVSTIIGADAYRFLPEEFGIPCVVTG
FT                   FEPVDVMQGVEMLVRQVVEGKPRVEIQYSRVATWEGNRKALDVLAQVFTPFDAPWRGIG
FT                   IIPGSGLRIADAYAAFDAEREIAVEVEETKEHQGCLCGEILKGKVTPFDCPLFANACTP
FT                   ESPVGACMVSSEGTCAAAYKYGQ"
FT   gene            307764..308777
FT                   /gene="hypE"
FT                   /locus_tag="KN400_0278"
FT   CDS_pept        307764..308777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypE"
FT                   /locus_tag="KN400_0278"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83141"
FT                   /protein_id="ADI83141.1"
FT                   /translation="MNKELILLGHGSGGKLSHQLLDDLIIPTLSGISLAGQNDAALVDA
FT                   DGRRLAFTTDSYVVDPVFFPGGNIGTLAVNGTVNDLAMMGARPLFLSAGLIIEEGFSRN
FT                   DLGTILASMRQAADAAGVRIVTGDTKVVPRGKADRIFINTSGIGLVEHDFTISGACARP
FT                   GDRIIINGTVGDHGIAVMAKREGLELLTDIVSDCAPLNGLVADIIAEGGGDVHVLRDPT
FT                   RGGVATTLKEIALQSDVTIMIREEAIPLAGPVKGVCAILGLDPLYVANEGKLLVAVAPS
FT                   AAERVLARMKTHPCGGAAAIIGEVTDAGGGKLRLETSVGGVRAVEMLAGEQLPRIC"
FT   gene            308864..309718
FT                   /locus_tag="KN400_0279"
FT   CDS_pept        308864..309718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0279"
FT                   /product="phospholipase, patatin family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83142"
FT                   /protein_id="ADI83142.2"
FT                   /translation="MDNRQPRPTGVDEPVTLMLVGGGIRCYAFIGALRAVEEIGVPIGR
FT                   IIGASTGSIIAALYAAGMPTADLKRLALETDTELFRDFSPRGVFSGMGICRGDALERWL
FT                   DERLGGVCLADLRRSPLAVITTDILNHAPFVLSADNAPRLKVSAAVRFSAAIPFIFAWK
FT                   KFVVRGKEHVLIDGTLMASVIESQCAEAGKTLVLRTFSKRSMNHHSSSVMTLRRYAGDL
FT                   LNIFFHSMDREFLKGARWKDTITIHCGMVPSLSFSVTADEREFLMEQGYQQTAKYLRYK
FT                   WGL"
FT   gene            309897..310256
FT                   /locus_tag="KN400_0280"
FT   CDS_pept        309897..310256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0280"
FT                   /product="PilZ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83143"
FT                   /protein_id="ADI83143.1"
FT                   /translation="MEKRKFERIDFRSEAIIRHNGTSFRAEVENVSLKGLFVRTDQKIP
FT                   INEQVDVSMFFFGSSAELSFSLEASVVRITDDGIGLNFRKIDMDSLVHSDTAVTTTGAD
FT                   RQGVIEEFYGFIEKD"
FT   gene            310332..311099
FT                   /locus_tag="KN400_0281"
FT   CDS_pept        310332..311099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0281"
FT                   /product="DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83144"
FT                   /protein_id="ADI83144.1"
FT                   /translation="MDDLRDCYGVLGLSPGASADEAKRAFRAAVSACHPDRFVNDPVRR
FT                   RNAEERLRLIIEAYHRIDAGRKPGPDTSASAHAGLQAWTWSAGRSPGFPCSSLVTFPNG
FT                   LFLLLCVVCAVRFTHLYGVTASAALAALELLLVPLFFGVAHNLIIPPNRLVRNLYGAFT
FT                   VCFLLVVIADTVTARHDSSLPLPASFEYSDGAPASSVLWPATSHDRPAEPTDGPAADTP
FT                   LYRQGVRPPHSPDAPVVPLAPAAPAAPLVPPAR"
FT   gene            311211..312314
FT                   /locus_tag="KN400_0282"
FT   CDS_pept        311211..312314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0282"
FT                   /product="GspIIEN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83145"
FT                   /protein_id="ADI83145.1"
FT                   /translation="MPIRLGEMLIKAGMITHTQLDEALKGQVIFGGRLGTNLIEMGVIG
FT                   EEELARVLSEKLRVPCVDPDELMAVPDHLLSLVPRDMVERYKIVPLGVDGRRLRLVMAD
FT                   PSDLPAIDEIAFRTGFVIVPMVAPEIRLFMALEKYYGIRREVRALPVSETLGGRRCTYG
FT                   TKRPAEQLMRRDVVDFSTLPDNGKYLPWEGGDIDDNRIEAAERYTIDALSRTLADCRER
FT                   DAVADALVDYAGRLFGCAGLLLVMRDMAAGWEAVAGHERLREFGQLRISLQEASHVRTV
FT                   VEERSVYLGPPGNMPTDRRLAEALGGAGAPGLMLVPMVMGRRVVTILCAAGEMVALGAR
FT                   LSEAQTIARKGVLAFEILILRGKILMT"
FT   gene            complement(312283..312711)
FT                   /locus_tag="KN400_0283"
FT   CDS_pept        complement(312283..312711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83146"
FT                   /protein_id="ADI83146.2"
FT                   /translation="MRQALAELSVLPGAIGSLVTDRGGKILERVFPPLFDDTTLSAVSE
FT                   DLAECVITLGISSVSTETLFLRYTEGIVAIKPLDDGLLLLLCTRESSGKSITCAIDAAA
FT                   ARLRRVMSPAPPSVQVGPNGPASDRLAIAMSSESYPAK"
FT   gene            complement(312713..313408)
FT                   /locus_tag="KN400_0284"
FT   CDS_pept        complement(312713..313408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0284"
FT                   /product="PATAN domain GTPase-activating protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83147"
FT                   /protein_id="ADI83147.2"
FT                   /translation="MAQEALCRKRHEGFNGSMVGVSLADLIQLKGTNRFSGCISVEFGG
FT                   RCGVIFFQDGEIVHAEKGSCEGEEALQRIMRWPGGRFTAYPHLATDRHSIRKNRQHLLL
FT                   DAHRAMDERHRHVDPKGERAEQTPLRERIRAIGMVSDAITLDFDGVPTDEKSPSADRLA
FT                   AGACFLARLADRIGSRLGTGSPTSMVLEGTREHLFIYTGKHHLLAVAAGADHQPPMVEE
FT                   AIRRAVQTA"
FT   gene            313793..314524
FT                   /locus_tag="KN400_0285"
FT   CDS_pept        313793..314524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83148"
FT                   /protein_id="ADI83148.1"
FT                   /translation="MKYVNAFVLMILLASQSIDAHAFGSMGGMGGGGAVSVQSTPLAGK
FT                   VVETFNSGGYTYVSLERDGKTVWAAIPETSLEVGREVTLKPGMEMQQFFSKALNRTFDS
FT                   IYFSEGLATQAASTKGKSSAGSKGGVVTPAEKIAVEKAAGANGFTVAELHGNREKLDGK
FT                   TISVRAKVTKVSAGIMGKNWLHLQDGSGDSSKGSHDLTVTTQDLPALGEVVTVTGTLRK
FT                   DKDFGGGYKYDAIVEDGTVSH"
FT   gene            314631..315875
FT                   /locus_tag="KN400_0286"
FT   CDS_pept        314631..315875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0286"
FT                   /product="peptidase, M48 family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83149"
FT                   /protein_id="ADI83149.2"
FT                   /translation="MTLTILACYLAVLTFEHLLRIMNLKHLRRQGTTVPDGFAGAVDEG
FT                   SLRTATAYTLDRSRLGIAESLVDSGLLVGFLFAGILPLFDRWVASLTSSFILGGVVFFL
FT                   LLSLVQSALAIPFGLYETFVIERRYGFTTITPKLWWSDLLKSTCISMTLATLMISGAFA
FT                   LVAWSPLHWWLWVWGFLAFLTLFLMYLSPYVIEPLFNRYEPVKTEGLEEEIRAMAERAG
FT                   LRVSRVMQVDASRRSRHSNAYFTGIGRVKRIVLYDTLLGQMTHAEILAVLAHEIGHWKL
FT                   GHIRRRLIAGQAGALAAAWLAWRVTSWEGLPGLLGMTEATFPARLVIVGFIGTLALFPL
FT                   TPLFAWLSRRQEREADRFAVELCENPASLATALVKLSRENLSNLHPHPLYAAFHYSHPP
FT                   VVERVQGLLALARKE"
FT   gene            complement(315911..316750)
FT                   /gene="gspN"
FT                   /locus_tag="KN400_0287"
FT   CDS_pept        complement(315911..316750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspN"
FT                   /locus_tag="KN400_0287"
FT                   /product="type II secretion system protein GspN, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83150"
FT                   /protein_id="ADI83150.1"
FT                   /translation="MTAQRWLAWGAGIIAGLLLILIFTLLLVPSRELEQLTVRWFARQG
FT                   YDFSASDFGKAFPLGVSARGVTIADNRGPLLRLDTVRTRLELLPLLAGKVSVDVDGSIG
FT                   AGQFDGTFRPRAGTGVFSARDVRLEDIPFFRTATDADIKGVMTADATLAGTGRSKGGEV
FT                   KLAVKGAHIRGATISGVPLPDAVYETVRGMVRVAGGRATIDSFSLQGEDVYVRLSGTMP
FT                   LMAPMGNSPLNLSLELMPRPAFLDRQKLVFTLLAKYLITPGHYRLPIRGTLSKPLLQ"
FT   gene            complement(316747..317295)
FT                   /gene="gspM"
FT                   /locus_tag="KN400_0288"
FT   CDS_pept        complement(316747..317295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspM"
FT                   /locus_tag="KN400_0288"
FT                   /product="type II secretion system protein GspM, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83151"
FT                   /protein_id="ADI83151.2"
FT                   /translation="MSALNRIRDTWNDMDRPTRLRWGYGVIAILALAVIFSFVYNRIGL
FT                   LENKRQRREADLVEMLRLKGRYQEARSTSMRLANRLAAVRADDSPAKLVEETGIRGKSL
FT                   RITPLKTELKNGFTEEAADIKIDSLTANEAVNLLHRIEKGQRPAIIRKALLRTRFDDPS
FT                   KLDLTLTVALLRGAPQGAR"
FT   gene            complement(317292..318608)
FT                   /gene="gspL"
FT                   /locus_tag="KN400_0289"
FT   CDS_pept        complement(317292..318608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspL"
FT                   /locus_tag="KN400_0289"
FT                   /product="type II secretion system protein GspL, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83152"
FT                   /protein_id="ADI83152.1"
FT                   /translation="MTYLILEWTGTDLVASRFFTRAGELVFQGRESRPAASEADLTAAL
FT                   RELASSDDDCRPVLAIPLGRLFSREIDLPIHERAKIRLLLPLELKGETALENEDLVFDG
FT                   LPLAAEGKVLALWARKREIAHLVQACTEAGIDPEVVTTAPIHWEELLSSDAAEATLAVT
FT                   DGTALAVYGNGKPLFFRALGRDEGELSRTLAALEMARQVRIERLFRHGSPVGNATAEAA
FT                   GAPMLALPVTDSLAAAFGGDEAAARESAGAWALARALQTGRIGTFRAGELAWTRGREQL
FT                   KRQLRIPAILTVLLLLLLAADAGIRYTMVKRDLASVDASIAALYREVFPGRKKSVDELG
FT                   ELKAEIRRLGAAGAGSHILNTLRGLAKAKGDDVTGLFEVEIDGTAVRLKGDARSSQAVS
FT                   QYRDRLAGVLAGAEVGQITAKPDGSVTFSLRGTISEVAK"
FT   gene            complement(318608..319528)
FT                   /gene="gspK"
FT                   /locus_tag="KN400_0290"
FT   CDS_pept        complement(318608..319528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspK"
FT                   /locus_tag="KN400_0290"
FT                   /product="type II secretion system minor pseudopilin GspK"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83153"
FT                   /protein_id="ADI83153.1"
FT                   /translation="MRRSESERGFALILTLVVTALLIAVTTEFIHGVYVDTSLHRNFVN
FT                   LQQASLMAEGGVTGGISLLRNLRTSGNDQGLQQLLADPVQFEDEKGRVSITIEEEDGKL
FT                   NLNAVTLPNGDEHVFYGPAERRLLTALKLPTALHDSLADWLDANDEPRPDGGESAYYQS
FT                   LSAPYAPRNAPFATFGELGLVRGVEPAVLERLRPFATVFVDGGAINVNTAPLQVLMALD
FT                   EGISEGIARDIMQRRRIKPFKSVGELSEIPGMETIAGKLSGFAGARGSTYRLVSRAAVG
FT                   DVTRLVEAVVNLDGTQPRYLYWREY"
FT   gene            complement(319525..320154)
FT                   /gene="gspJ"
FT                   /locus_tag="KN400_0291"
FT   CDS_pept        complement(319525..320154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspJ"
FT                   /locus_tag="KN400_0291"
FT                   /product="type II secretion system minor pseudopilin GspJ"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83154"
FT                   /protein_id="ADI83154.2"
FT                   /translation="MFATWRNSPGGQRGFTLLETLVVMLLLAVVAGALYSSYFTVVRAK
FT                   ERTDEGAEERRELRGTLDLLRREIDGAFFRGNDVRLRFVVEDRDIFGKPASSLEFAAVA
FT                   PPRAGDLPASDLEKIRYAVKETDSTLSLTRESTELFGSVKPMPYPQMEAIEGFLVECYD
FT                   AGKWVKTWNTELVPRLPERVRITIRVRQGDQTVEFTTLARPKGRQS"
FT   gene            complement(320132..320488)
FT                   /gene="gspI"
FT                   /locus_tag="KN400_0292"
FT   CDS_pept        complement(320132..320488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspI"
FT                   /locus_tag="KN400_0292"
FT                   /product="type II secretion system minor pseudopilin GspI"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83155"
FT                   /protein_id="ADI83155.1"
FT                   /translation="MRTIGARGFTLLEVMIAVAIIAGVVFTVIGVVNNHLAVAGRDRDE
FT                   GVAVLLGRQMLDDLDTRQDIPEKSNGTFAPVRPDYAWVMTSTATQVPGFRKVTVAISWD
FT                   NARRTVSLVRYVAK"
FT   gene            complement(320485..321012)
FT                   /gene="gspH"
FT                   /locus_tag="KN400_0293"
FT   CDS_pept        complement(320485..321012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspH"
FT                   /locus_tag="KN400_0293"
FT                   /product="type II secretion system minor pseudopilin GspH"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83156"
FT                   /protein_id="ADI83156.2"
FT                   /translation="MPTSRAGTCNNHGFTLMELVVVIAILALAAALVLPRLTPGDTANL
FT                   HRAAREFAATLRFIQDRAITAKTAYRMKLVPGESAIVITTILPDGTEGEPDDPILRRRL
FT                   LPEGISIASTFTPRVGKRAAGEVVVTVGAAGFEEFTVFHLKAEGSDAVMTVMAYPSSGK
FT                   VKVAEGYREEPL"
FT   gene            complement(320981..321424)
FT                   /gene="gspG"
FT                   /locus_tag="KN400_0294"
FT   CDS_pept        complement(320981..321424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspG"
FT                   /locus_tag="KN400_0294"
FT                   /product="type II secretion system major pseudopilin GspG"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83157"
FT                   /protein_id="ADI83157.1"
FT                   /translation="MHNTLRNRRGFTLIEIMVVIAILALLAALVGPRIIGRSDDAKVAD
FT                   AKVQIKNLETALKLYKLDSGTYPSTEQGLMALVAAPTVGTIPKNYRSEGYLESKQVPKD
FT                   PWGNDFVYLSPGEHGDYDLYSFGADGVKGGEGKNADIESWNLQ"
FT   gene            complement(321451..322662)
FT                   /gene="gspF"
FT                   /locus_tag="KN400_0295"
FT   CDS_pept        complement(321451..322662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspF"
FT                   /locus_tag="KN400_0295"
FT                   /product="type II secretion system inner membrane protein
FT                   GspF"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83158"
FT                   /protein_id="ADI83158.1"
FT                   /translation="MPTFRYSAYTAGGRETSGTIEAESLKEAKLRLKRDGLYPRDIGPV
FT                   SETAGTVSRRFGGRNAGPAQVALMTRRLATLVGSQVPIYEAVTTLWEQEEPGEIKKALG
FT                   RIRERLAEGANLAKALSLEPRLFSESYVAMVAAGEASGALDAVLERVALFLEEQRAIRS
FT                   KITASLAYPTLMVLVGSAVMLFLLAFVIPKIVTIFEDNRAALPLITIALIKTSTFLRSF
FT                   WWACIAAVAGVVLLYRRLMKDDAFRLRRDRFLLRIPVVGSLLRQLILSRFAKVLGLLLS
FT                   SGVPVMRALEITAQVVVNRHYRAALTSVTAGLAEGGTLSGALRTTGLFPPLLVHMVAVG
FT                   EKGGELEEMLGKAGSAFEREFESSVSGLMALLEPLLVLAMGLTVGLVVVAVLLPIFELN
FT                   QLIR"
FT   gene            complement(322643..324187)
FT                   /gene="gspE"
FT                   /locus_tag="KN400_0296"
FT   CDS_pept        complement(322643..324187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspE"
FT                   /locus_tag="KN400_0296"
FT                   /product="type II secretion system ATPase GspE"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83159"
FT                   /protein_id="ADI83159.1"
FT                   /translation="MEQIARRLGIPFLAEIGDNEADAALLARLPLAFARGRLVLPLRER
FT                   DGRLLVVSGNPADLSAIDEVRGVYGMEVELAAATPDTVLGAVNHLYARLGSSAQEVVEE
FT                   LEGEDLSVIATELAEPKDLLDLTDEAPVIRLLNSILSEAVKERASDIHIEPYERELEVR
FT                   FRIDGILYRKLAPPKVVQEALVSRVKIMAGLNIAEKRLPQDGRIRVIVAGRDVDIRVSI
FT                   IPTFFGERVVLRLLDKQKGLISLENIGLSEGGVRSMERLLGRTSGIILVTGPTGSGKST
FT                   TLYAALNRLNSPEKNIITIEDPIEYQVKGIGQIQVNPKIELTFAQGLRAILRQDPDIVM
FT                   VGEIRDAETAEIAMQASLTGHLVLSTLHTNDSATAIARLVDMGIEPFMVASSLSAVLAQ
FT                   RLVRRICPHCRESYTPERDYAGITLPSTLYRGRGCDACFGLGTLGRVGIYELLPVDGEI
FT                   CSMIIRREPAGAIKEYAVGKGMRTLRDDGLAKAAAGITTIEEVLRVTQEEYADLPV"
FT   gene            complement(324202..326100)
FT                   /gene="gspD"
FT                   /locus_tag="KN400_0297"
FT   CDS_pept        complement(324202..326100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspD"
FT                   /locus_tag="KN400_0297"
FT                   /product="type II secretion system protein GspD, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83160"
FT                   /protein_id="ADI83160.2"
FT                   /translation="MKKRFLNLLTAAVLACALLAPLPASAKGVVLNFNDVDIATMVKFI
FT                   SDLTGKNFVLDERVKGKISIYSPSKLTPDEAFSLFTSVLELKGFTLVQAGKVYKVVPTA
FT                   AAKQSGMRLLSDKDRLPVSDAYVARIIPLERISAQEAVAFLQPIVSKDGYIAAFGASNM
FT                   LMVVDSALNIQKLTGILTLVDSPQKREGAEIIFLKNASADSVSGVIREWLGGKTSRPAG
FT                   QAGQATATSSAGVLIVPDTRLNALVIFGSDQDKDDIKKLIAMVDVVPPTTSSKINVYYL
FT                   ENADATDVAKVIDGLIKGTPTTPGQPGVPAAAPVQSPFEGGKISVTPDKATNSLVIMAS
FT                   PVDYQNILQVIQKLDKRRRQVFVQALIAEVSLDKLKDVGVQIGALAVGTQGDASGGAVL
FT                   DPFNFLSATSGPQFLLVKALEELGKNVSVSAQVKALVSDGAINVLSTPNILTSDNKEAE
FT                   IFVGENVPFLSQTNLTTGGISQQSIERKDTGITLRITPQISEGEYVKLDIYQEISAVKE
FT                   NKGQANDLVTTKRSAKTAVVVKDKDTVVIGGLIQDRDTETINKIPLLGDIPLLGWLFKT
FT                   KSTRREKTNLMIVLTPRIIRGAEEMSDVSGQQRDKFGEALRLDAPMDLKRDLQLSK"
FT   gene            complement(326210..327085)
FT                   /gene="gspC"
FT                   /locus_tag="KN400_0298"
FT   CDS_pept        complement(326210..327085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspC"
FT                   /locus_tag="KN400_0298"
FT                   /product="type II secretion system protein GspC, putative
FT                   serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83161"
FT                   /protein_id="ADI83161.1"
FT                   /translation="MKKVYLLTALLIALNSLAAARIAAGLISYRLARTAPHTAMGATGA
FT                   PAAAVSDDILSFASILDQGLFGRATQGKLTPLSAPVQGAAGAQQPAPTHGDLTLLGTAR
FT                   GSFRETFALIRRATPPEERVFRLGDTVFGIGPLVGVQKESVEILANGRKIRLTTPLAMG
FT                   IEPTSAPPPPAVAPQTGAVQVGAGSYVIDQRALNAALENLGQVMTDARLLPSVKEGKVE
FT                   GFRISEVKPAGVFSMIGMRNGDILLRINDLPVDSPERAIQSLASLKGQNRIKLDLVRDG
FT                   QPTTFSYDIR"
FT   gene            327254..328648
FT                   /gene="degP"
FT                   /locus_tag="KN400_0299"
FT   CDS_pept        327254..328648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degP"
FT                   /locus_tag="KN400_0299"
FT                   /product="periplasmic trypsin-like serine protease DegP"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83162"
FT                   /protein_id="ADI83162.2"
FT                   /translation="MKMVSLRFLKTMLTVICLMALSAGEVPAKVMAPDFVTLAEKLKPT
FT                   VVNISTSKNPAQTARPRRQPSPFNDPFHDFFDRFFDEAPRRQQRERSLGSGFIISDQGF
FT                   IITNNHVVAGADEIKVRLSDGREFKAELKGADEKLDLALIKIESKDQLPVAILGNSDEI
FT                   KVGEWVMAIGNPFGLAQTVTAGIVSATGRVIGSGPYDDFIQTDASINPGNSGGPLFSAE
FT                   GKVIGINTAIIAGGQGIGFAIPINMAKDVIPQLEEKGKVIRGWLGVTVQPITPDLARSF
FT                   GLEGERGALIADVVKDGPAAKAGLKSGDIVLEFDGKKIREMNELPRIVAATPVGKAALV
FT                   KVLRDGKMQDVEVSVGRLADTGDESDQKNGEDKLGMAVRELTRDLAARMGLKETQGVVV
FT                   TGVKSGSLAEEAGILPGDIVREIGGRSITTMADYETAIRAVKKGDVVRFLLRRGGGNHF
FT                   LAIRVE"
FT   gene            328724..330214
FT                   /gene="pepA"
FT                   /locus_tag="KN400_0300"
FT   CDS_pept        328724..330214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="KN400_0300"
FT                   /product="cytosolic aminopeptidase, M17 family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83163"
FT                   /protein_id="ADI83163.1"
FT                   /translation="MVISVEAADYTAFPCAALLVGCREDNPLEDSLLARIDQLLQGAIA
FT                   SLVQSREITGELNRVTILHTLGRLPAERIVLVGLGNSGALTSDRLRQVGGSAVKALKGA
FT                   GVTRAASVVHRAAGVPPTSVADIAQGLSLGDYSFDIYKTKPGTTVPVTELVNLFEPGTD
FT                   TADAERLLAADATICEAVSFARDLVSQPGNVATPLFLAEKALEFSARLGIACTVLDRDE
FT                   MERQGMEGILSVAKGSHQLPRFIVLEYRGGSADKRPTVLVGKGITFDSGGISLKPREGM
FT                   ERMKDDMAGAAAVMGAVMAVAGLRLPVNVIGLIPAAENLPGGGAYKPGDIVRTMSGQTV
FT                   EIVNTDAEGRMILSDALFYAQRFKPAAVIDLATLTGACLVALGSAASGVMGNDAALVKL
FT                   LRRAGEATGERLWELPLWDEYGEIMKSDVADLKNAGGPHAGTITAAWFLQRFVGKSRWA
FT                   HVDIAGTAWEEKGRPYQPKGATGVGVRLLVEYLKATVR"
FT   gene            complement(330292..330567)
FT                   /gene="atpE"
FT                   /locus_tag="KN400_0301"
FT   CDS_pept        complement(330292..330567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="KN400_0301"
FT                   /product="ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83164"
FT                   /protein_id="ADI83164.1"
FT                   /translation="MEFFTMCMLAAGFGMAIGAFGTGIGQGLAVKNAVEGVSRNPGASG
FT                   KILTTMMIGLAMIESLAIYVLVVCLIILFANPYKDVAIELAKAVVK"
FT   gene            complement(330627..331316)
FT                   /gene="atpB"
FT                   /locus_tag="KN400_0302"
FT   CDS_pept        complement(330627..331316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="KN400_0302"
FT                   /product="ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83165"
FT                   /protein_id="ADI83165.1"
FT                   /translation="MVHPLLFLQFFRKLLEPLHISEAGADAIAYTWLIIVCLLIVSLIA
FT                   TKALKAVPTGMQNFMEVVIGGIENMVEETMGEKGKPYFPLIATLALFVLVSNLIGLIPG
FT                   FFPPTANLNTTAACAVIVFLSTHIVGIKKHGFHYLQHFMGPIWWLAPLMFFIEIIGHLS
FT                   RPLSLSLRLFGNMNGHELVLMIFFALAPFLVPLPMMLMGVLVSFIQAFVFMLLAMIYIQ
FT                   GSLEEAH"
FT   gene            complement(331321..331707)
FT                   /gene="atpI"
FT                   /locus_tag="KN400_0303"
FT   CDS_pept        complement(331321..331707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpI"
FT                   /locus_tag="KN400_0303"
FT                   /product="ATP synthase-associated magnesium import membrane
FT                   protein AtpI"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83166"
FT                   /protein_id="ADI83166.2"
FT                   /translation="MTATRIHENNLLTAVVVGSWLLLAIMTAAGYLFGSVQFAGGILAG
FT                   GILALANYYWLFRIIRRALGLDAHQAARFAQLRYLLRFAILAFVIYLLVVHAGIEVLGL
FT                   TLGLSLLVIVITALAIYMFVTKGD"
FT   gene            complement(331679..331924)
FT                   /gene="atpZ"
FT                   /locus_tag="KN400_0304"
FT   CDS_pept        complement(331679..331924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpZ"
FT                   /locus_tag="KN400_0304"
FT                   /product="ATP synthase-associated magnesium import membrane
FT                   protein AtpZ"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83167"
FT                   /protein_id="ADI83167.1"
FT                   /translation="MNDDKRRLIQTLGLVSSMGISVALAIIIGVLIGRQLDKWLGTHPW
FT                   FFFIFLFFGIAAGFRNIYIIAGRAIKKDDGDKDSRE"
FT   gene            complement(332021..333304)
FT                   /gene="hemL"
FT                   /locus_tag="KN400_0305"
FT   CDS_pept        complement(332021..333304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="KN400_0305"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83168"
FT                   /protein_id="ADI83168.1"
FT                   /translation="MLTARSKDLFTQAQEFIPGGVNSPVRAFKSVGADPLFIKKAFGCT
FT                   ITDADNNSYIDYVGSWGPMILGHCHPQVVEAVKRAVESGSSFGAPTELEITLARMVIDA
FT                   VPSIEMVRMVSSGTEATMSAIRLARGYTGRDKIIKFSGCYHGHADALLVKAGSGAATFG
FT                   VPDSPGVPVDVAKNTLTAQFNDLDSVSKLIDENKNEIACIIVEPIAGNMGTVPPGEGFL
FT                   EGLRSICDSEGIVLIFDEVMTGFRVAYGGAQELYGVTPDMTTLGKIIGGGLPVGAFGGK
FT                   KDIMKLLSPSGGVYQAGTLSGNPLAMTAGIETLKLLQADGFYEQLEQTSRRLAEGITEA
FT                   AKSAGYPIYPTRVGSMFCTFFTSNEVKDWPTATTCDTKAFAAFFRMMLEKGIYLAPSQF
FT                   ETAFVSIAHTEVEIEKTIVAARSCFAAL"
FT   misc_feature    333454..333529
FT                   /note="conserved nucleotide sequence; KN400_R0124"
FT   gene            333611..333967
FT                   /gene="nuoA-1"
FT                   /locus_tag="KN400_0306"
FT   CDS_pept        333611..333967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoA-1"
FT                   /locus_tag="KN400_0306"
FT                   /product="NADH dehydrogenase I, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83169"
FT                   /protein_id="ADI83169.1"
FT                   /translation="MLGVYLPIIVLVAVAVIFGLASLTFSSLIGQKKPSAVKLAPYECG
FT                   CEPVGSARERFSVKFYIIAMLFILFDIEAVFMYPWSVLFKRLGIFGVVEMGLFIVILFV
FT                   GYIYVWKKGALEWE"
FT   gene            333958..334470
FT                   /gene="nuoB"
FT                   /locus_tag="KN400_0307"
FT   CDS_pept        333958..334470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoB"
FT                   /locus_tag="KN400_0307"
FT                   /product="NADH dehydrogenase I, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83170"
FT                   /protein_id="ADI83170.1"
FT                   /translation="MGVDQPLGDNFITTSLDSLVNWARKSSIWPMTFGLACCAIEMMAT
FT                   GASHNDLDRFGIIFRASPRQSDCIIIAGTVTKKMLPVIKTVYEQMPEPKWVVAMGACAC
FT                   SGGVFDTYSVVQGIDTALPVDVYIPGCPPRPEALLYGLLKLQDKIMKDKNSFGSTIGLG
FT                   ERLESAA"
FT   gene            334503..334991
FT                   /gene="nuoC"
FT                   /locus_tag="KN400_0308"
FT   CDS_pept        334503..334991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoC"
FT                   /locus_tag="KN400_0308"
FT                   /product="NADH dehydrogenase I, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83171"
FT                   /protein_id="ADI83171.1"
FT                   /translation="MAENNRAVIKLKEKFAASILDVREFRGEVTVTVAREKVVDICRFL
FT                   KESLQYNLCTDVTAVDYLGKQEPRFMVVYNLYSIPNKDRLRLKAGVPDADCSIDTVSCV
FT                   WNSANWLEREVYDLMGVQFNNHPDLRRILMTDDWVGHPLRKDYPLQGPDREPYKGRLS"
FT   gene            335044..336216
FT                   /gene="nuoD"
FT                   /locus_tag="KN400_0309"
FT   CDS_pept        335044..336216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoD"
FT                   /locus_tag="KN400_0309"
FT                   /product="NADH dehydrogenase I, D subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83172"
FT                   /protein_id="ADI83172.2"
FT                   /translation="MASTEIMTVNMGPQHPSTHGVLRMVIELDGEVIQKITPHIGYLHR
FT                   GVEKLSEHRTYHQTIPLTDRLDYLAPMSNNLGYVLAVEKLLGIEIPERAQTIRVIMAEL
FT                   TRLKSHLVWIACHALDIGAMTVFIYAFREREMIMSLYEKISGARMTSNYFRVGGLSSDV
FT                   YDGFEKDVREVIDTFPGHFDTYEGLLTKNTIWVNRTVGNGVISAEDAVDYGITGPALRG
FT                   SGVDWDLRRDNPYSGYEKYSFKVPVGEKCDTFDRYKVRLIEMREAVNIIRQALDSLKPG
FT                   PVLADNPQVTYPPKENVYNSIEGLIHHFKIASEGFPVPEGEVYQSVEAPKGELGYYIVS
FT                   DGGPKPYRMRIRPPSFVNLGAIEKMAKGSMIADLVAVIGTLDIVLGEIDR"
FT   gene            336244..336765
FT                   /gene="nuoE-1"
FT                   /locus_tag="KN400_0310"
FT   CDS_pept        336244..336765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoE-1"
FT                   /locus_tag="KN400_0310"
FT                   /product="NADH dehydrogenase I, E subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83173"
FT                   /protein_id="ADI83173.1"
FT                   /translation="MSNAPAEATTTEEVPVEEIDLGPANHVIDKYLTLPGNLMPVLQGI
FT                   QDEYGYVPRPTIDLVAERLNVYPSQIFGVLTFYAQFHLKPRGRFIIRVCVGTACHVQGA
FT                   PRIVDTFFEKLGIGHAETTPDLRYTFEKVACLGACGMAPLAMVNDDTFGKMTVQKVEEI
FT                   IAEYNQRPMK"
FT   gene            336801..338576
FT                   /gene="nuoF-1"
FT                   /locus_tag="KN400_0311"
FT   CDS_pept        336801..338576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoF-1"
FT                   /locus_tag="KN400_0311"
FT                   /product="NADH dehydrogenase I, F subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83174"
FT                   /protein_id="ADI83174.1"
FT                   /translation="MGEAIKILICQGTGGVSAGAKKVEAEFLRVIGEKGVDATVGKRCD
FT                   VIKTGCRGLCANDVLVDIVDPELGRVTYDFVLPEEVEKIVAEHIVNRTPLEKRKAKPYY
FT                   NTFVDQQMRVVMTGCGQIDPESLDAYLEEDGFKAIEKCVKEMTPAAVIDEVKKSGLRGR
FT                   GGGGFPTGMKWSFCAATPGKLKYVICNADEGDPGAFMDRSILEGDPYCIIEGMMIAAYA
FT                   IGCTAGYVYVRAEYPLAIERLQKALDVCYEKGYLGKNVMGWGFDFDLRIKKGAGAFVCG
FT                   EETALMASIEGERGMPRPRPPFPAVKGLWGKPTNINNVETFANVRHIILKGADWYASLG
FT                   TDTTKGTKIFAVTGKVKHTGLVEVPAGMSVREVIYNVCGGIANNRKFKAVQAGGPSGGC
FT                   IPSEVLDTPVDYDSLIKAGAMMGSGGLVVMDETTCMVDVARFFLTFTRMESCGKCVPCR
FT                   IGLKAMLDILERITEGRGQAGDIETLLEMGSTIKKASLCGLGQTAPNPILSTIKYFREE
FT                   YEAHINDRRCPSNCCKELLLWQVVEEKCVKCGACFKACPVDAIIWEKGQIAILDKEKCT
FT                   KCKSCYDACRFMAIE"
FT   gene            338617..341097
FT                   /gene="nuoG-1"
FT                   /locus_tag="KN400_0312"
FT   CDS_pept        338617..341097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoG-1"
FT                   /locus_tag="KN400_0312"
FT                   /product="NADH dehydrogenase I, G subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83175"
FT                   /protein_id="ADI83175.1"
FT                   /translation="MVTLTIDDKQVTVPKDATIFDAAKQAGIRIPILCHDKKLHPFGGC
FT                   RMCLVEVEQMKGRQIPACTTPVTEGMIVRTMTDEIVKARKMVLELLLLKHPIDCPVCDA
FT                   AGDCDLQNLTYEYGVDTNRFTDEKFNWKIDYVNPLIERDMNRCVHCGKCARICDEIVSF
FT                   GAYSFINRGIEAKIGTEFDGPLNCEFCGSCVSVCPVGALISRPFKFKARWWALNKVKTV
FT                   CSYCGTGCQLTLGVKDNKVLTTIYDENQGFHNGQLCTRGRWGYQFVNSSKRLTTPLIRK
FT                   GDTLQPASWDEALGMVADRLKTSKDAAATLVTPRLTNEELYLLKRVVKDAVGSDNLDHS
FT                   GGYAHEALTAGARESLGFPGSPSVIADIQKSELLLVIKTDAYETHPVIGFEVNLAVKRQ
FT                   GVALRILSDKKGKLSRLPGAQTYVHTPGAELVLVNALAKTIVDEGLHDASSVGAIKGFD
FT                   AWLKSIESCTPDQAAGQCGIAADTIKAVAREYAAAGKALIMLPLGMGYPGHGKALAQAL
FT                   INLALLTGRVGKEGCGVLIMGEKNNSQGAADLGIHPTANGLNAQAILAGCSAGSIKTLY
FT                   VVGENPVVSYPNRKQVEAALDAVEFLVVQDLFLTETASKADVVLPACSFAEKDGTFTSL
FT                   GGAVQRVNRAITPLGDCRSDFDILNMLHAKLTGQAAYTSQKEAFADLAAATPGYAGLTL
FT                   EGLGDAGAVRVNNCTASFVPVATSTVTTEAGKFALLTGSALNHSGTLSLYGEGPMLVCP
FT                   EGYLELNKDDAAKLSITEGDAVTMKSATGELRLKAKVGTRLPQGVAFAPYHFAEASINS
FT                   LTGATAITWITISK"
FT   gene            341150..342196
FT                   /gene="nuoH-1"
FT                   /locus_tag="KN400_0313"
FT   CDS_pept        341150..342196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoH-1"
FT                   /locus_tag="KN400_0313"
FT                   /product="NADH dehydrogenase I, H subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83176"
FT                   /protein_id="ADI83176.1"
FT                   /translation="MGYELFGLPMIYYISMVAKVLVVFVFVLLTVAYATYAERKIIGHM
FT                   QVRLGPMRTGWHGLLQPIADGLKLFFKEEIVPSQADKFAFLIAPIIALVPAFIGFAVIP
FT                   FGETIEVAGYKIPLQIAGYYDTVSGQVVDMNVGVLYILALASIGVYGIVLAGWSSNSKY
FT                   SLLGGLRSSAQMISYELAAGLAIISVFMLSESLSLQKIVADQANGAWYCFKQPLAFILF
FT                   FICSLAEINRTPFDLPEAETELVSGFCTEYSSMKYAMFFMAEYANMVTVCAVTTTLFLG
FT                   GWHGPAFLPGWAWFIAKVYFLIFVCMWIRATYPRYRYDQLMRLGWKVFLPLTLVNIIVT
FT                   GIVVSLQS"
FT   gene            342218..342616
FT                   /gene="nuoI-1"
FT                   /locus_tag="KN400_0314"
FT   CDS_pept        342218..342616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoI-1"
FT                   /locus_tag="KN400_0314"
FT                   /product="NADH dehydrogenase I, I subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83177"
FT                   /protein_id="ADI83177.1"
FT                   /translation="MIMPLINGLKITLKHMFMKPVTLQYPDERPTPSPNFRGLHALKVS
FT                   HDKAKCVACYLCPTVCPAKCITVEAGEDATHDKYAERYEIDMLRCIFCGYCVEACPVDA
FT                   LKMTGQFELANYKREDFIFVKERLLEKK"
FT   gene            342627..343130
FT                   /gene="nuoJ-1"
FT                   /locus_tag="KN400_0315"
FT   CDS_pept        342627..343130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoJ-1"
FT                   /locus_tag="KN400_0315"
FT                   /product="NADH dehydrogenase I, J subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83178"
FT                   /protein_id="ADI83178.1"
FT                   /translation="METFFFTIVAAVAVLASILVITCKNPINSALSLILTFFCLATFYV
FT                   MLDAPFMAAIQVIVYAGAIMVLIVFVIMLLNVRTEAGRRSSHTVLLGSLVGIFTLVQLF
FT                   YVLNRSSLTGNKGEISPELIHRIGHTEIIGKALYTDFLLPFEVTSILLLVAIIGAVILT
FT                   KKKI"
FT   gene            343149..343451
FT                   /gene="nuoK-1"
FT                   /locus_tag="KN400_0316"
FT   CDS_pept        343149..343451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoK-1"
FT                   /locus_tag="KN400_0316"
FT                   /product="NADH dehydrogenase I, K subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83179"
FT                   /protein_id="ADI83179.1"
FT                   /translation="MVSLHSYLIVSAILFSIGTIGVLVRRNAIVIFMCVEMMLNAVNLT
FT                   FIALSRHLGNIDGQIFVFFVMTVAAAEAAVGLALMIAFYKNRESIDVEDVKLMKL"
FT   gene            343505..345505
FT                   /gene="nuoL-1"
FT                   /locus_tag="KN400_0317"
FT   CDS_pept        343505..345505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoL-1"
FT                   /locus_tag="KN400_0317"
FT                   /product="NADH dehydrogenase I, L subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83180"
FT                   /protein_id="ADI83180.1"
FT                   /translation="MFEYVWLIPLFPLIGVIINGLFGKSIKNEKVIGGIGALMVFCSFL
FT                   VSCGILIQLLSLPVEERFFEKSLFTWIAAGTFKTDIGFLIDPLSTLMIMVVTGVGFLIH
FT                   VYSIGYMHGEEGFYRYFTYLNLFTFSMLLLVLGSNLLLMFVGWEGVGLCSYLLIGYYFH
FT                   KKSAGDAGKKAFVMNRVGDFGFLLGTFTLFWYLGQNHNVWTINFRELSANAHLLPVGGI
FT                   VTVITLCFFLGATGKSAQIPLYTWLPDAMEGPTPVSALIHAATMVTAGVYMIGRLNFVY
FT                   IRSHETMMIVAIIGAATAIFAATIGTAQNDIKRVLAYSTVSQLGFMFLAMGVGAFTAGI
FT                   FHLMTHAFFKACLFLGSGSVIHAMHHALHHAHSHDDPQDMRNMGGLRKAMPITFLTFLA
FT                   STIAIAGIPGFSGFFSKDEILWQAFANPLHGSLNMILWGTGAVAAGFTAFYMFRLVFMT
FT                   FTGECRINPKAKDHLHESPFVITFPLIVLGILAVVGGYVGMPKVLGMLPNYLEHYLEPV
FT                   FVGSHEFMQQQLQGHGEAHHSHALEFGLMGLSVLIALVGISIAYVLYVMSPSLPAKFTA
FT                   AFPALHRAVYNKWYVDELYDFLFVNPCKALGNFLWKGFDVVVVDGMVNGVAAVVKGFGS
FT                   VLRNTQTGYVHNYAFSMAVGVVVIVAFYLFR"
FT   gene            345539..347107
FT                   /gene="nuoM-1"
FT                   /locus_tag="KN400_0318"
FT   CDS_pept        345539..347107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoM-1"
FT                   /locus_tag="KN400_0318"
FT                   /product="NADH dehydrogenase I, M subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83181"
FT                   /protein_id="ADI83181.1"
FT                   /translation="MSQFPLISVMTFLPLLGVVLLFFVPKQSHSVHRMLALLVSLVTFV
FT                   VSIPLVTGFQSNADFQFVEKMPWIAAGPFQMNYHVAIDGISLWLVLLTTFIMPIAILST
FT                   WTAVEEKVKEYMICLLLLEVGMLGAFVSLDLFLFYIFWEVMLIPMYFIIGIWGGKNKIY
FT                   AAVKFFIYTMVGSMLMLVALVTLYFKAGAGDFNVLRFYEVTLDPATQVWMFLAFALAFA
FT                   IKVPMFPLHTWLPDAHTEAPTAGSVILAAVLLKMGTYGFVRFAMPLFPDATDKFTPLIA
FT                   TLSVIGIIYAALVAMVQEDVKKLVAYSSVAHLGYVMLGVFALNLQGLSGGMLQMLNHGV
FT                   STGALFLIVGFIYERRHTRLITDFGGLAKQMPVFATIFMIVTLSSIGLPGTNGFVGEFL
FT                   VLLGAFESELRWYAVIGTSGVILAAVYMLWMFQRVMFGELTNPKNQTLCDLNAREVGIM
FT                   LPLLVLIFVMGVYPTPFIEKMSPSLEKLIVHVKTKQQGAVAQVETVPAAPQVMPAAAVV
FT                   PAEHK"
FT   gene            347142..348596
FT                   /gene="nuoN-1"
FT                   /locus_tag="KN400_0319"
FT   CDS_pept        347142..348596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoN-1"
FT                   /locus_tag="KN400_0319"
FT                   /product="NADH dehydrogenase I, N subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83182"
FT                   /protein_id="ADI83182.1"
FT                   /translation="METIVLPVINLAPIMPEIILSVFGMALLLVNVFVPSEQKAYLGYL
FT                   SLVGIIAAGVSIVGGWGVPLDSFSGSVVQDNFALFFKGIFLLSAGLTILISDHYMKREG
FT                   CNQGELYPLILFATMGMMLMASGTDLMTVFLGLEVLSVSLYVLAGFNRANLKSNEAGLK
FT                   YFLLGAFSTGFLLYGMALTYGATGTTKIPKIAEFVAANGMVAQSPMFYIGMLLMASGFA
FT                   FKIAAAPFHMWTPDVYEGAPTPMTAFMSAGPKAAGFAAFMRVLIVAFPTLKADWSDLLW
FT                   VLAVLTMTIGNLIALNQDNIKRMLAYSSIAHAGYALVGFTAGNAEGAAGILFYMLSYAF
FT                   MNIGAFAIIILVGKKGEENNNVADYAGFATKHPVLALAMAIFLFSLAGMPPTAGFIGKF
FT                   YLFSGAIKAGYIWLAIIGVLNSAASVYYYLRVMVYMYMKNPTEEFDWMTLSPAVMLCIL
FT                   IAVVGVIIPGVVPSYLLELAQKAVLL"
FT   gene            348699..349214
FT                   /gene="prx-3"
FT                   /locus_tag="KN400_0320"
FT   CDS_pept        348699..349214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prx-3"
FT                   /locus_tag="KN400_0320"
FT                   /product="peroxiredoxin, atypical 2-Cys subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83183"
FT                   /protein_id="ADI83183.1"
FT                   /translation="MEERTGIITFKGNPMTLLGPQLKVGDQAPAFTAVDTSLTVRSLSD
FT                   FGAAIKIISAVPSLDTPVCDAETRRFNQEAASLPANVVLLTISLDLPFAQKRWCGAAGI
FT                   DRVVTLSDYRDRSFGLAYGVLIKELMLLSRSVFVVDGNGVIRYLQHVPEVTSEPDYAAV
FT                   LDSVRAML"
FT   gene            349353..349799
FT                   /gene="yqaA"
FT                   /locus_tag="KN400_0321"
FT   CDS_pept        349353..349799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqaA"
FT                   /locus_tag="KN400_0321"
FT                   /product="membrane protein YqaA"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83184"
FT                   /protein_id="ADI83184.1"
FT                   /translation="MEQQLAADGLIVLFVVSFLAATLIPVGSEWLLVALLTQDYNPLAV
FT                   TTTATVGNILGACTTWAVGMWGGVYLVRRILRISEDAERRAEQFYRRYGYWSLLLSWLP
FT                   ILGDPLCLVGGILRVGFGRFVLLVGIGKLARYSFIAWVTVHAVN"
FT   gene            349786..350976
FT                   /locus_tag="KN400_0322"
FT   CDS_pept        349786..350976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0322"
FT                   /product="protein of unknown function DUF2201, VWFA
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83185"
FT                   /protein_id="ADI83185.1"
FT                   /translation="MQSTEASAHRELENTIVRLLKRRPFYGQFLLAMRREQRPGTFPLG
FT                   VTFRDGVPVLMVNPHRLEAESPAIREGLLEHCVRHVIHLHMVRRKGRNGHDWDVACDLA
FT                   INPSIEHLPADAPLPVHFSADDGLAAEEYYSLLSNPFDAGSLEGQGTGRASRDEGGATG
FT                   DGCDRDLNVTTVDDHSAWEEADSTPFRLAEEVVRGMVREAWRQADGHVPADIRRVIEGM
FT                   LAPSPIPWQQVLRQFVAAAGRTGRETSWLKEHRRFVHMTPGIRKRRRLNLLVGIDVSES
FT                   TDTVELREAFARELVRISRGRDAQVTVLYANSRIQQMESFRGALGLTEAYYGGGFTDLR
FT                   PVFEHARTMIPRPAAVIYLTDGVGPAPEQMEFPTLWVLTRAGEKPVPWGVELRLEV"
FT   gene            350979..351383
FT                   /locus_tag="KN400_0323"
FT   CDS_pept        350979..351383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83186"
FT                   /protein_id="ADI83186.1"
FT                   /translation="MGELKPMTTESVKELLEEAGAKAMARSGRTESYSAPRDFSFEVKA
FT                   IFPNGMGLHIVARQFNYRDPWEATGRVNDLVDVSLLRDGIYTPLPKGYKWFQGRDLEEG
FT                   VDEARLRELIACVRDVNPKLYLLQELTGDL"
FT   gene            complement(351536..353014)
FT                   /locus_tag="KN400_0324"
FT   CDS_pept        complement(351536..353014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0324"
FT                   /product="sensor histidine kinase, DUF3365-containing,
FT                   heme-binding"
FT                   /note="domains: DUF3365, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83187"
FT                   /protein_id="ADI83187.1"
FT                   /translation="MHRNSIVSYSYLILVLLMVVTGLSLWFNLRLAAEHYEELAAQMGR
FT                   SILRSIIATRQWNAEHGGFYLPVSDTIRPNPYLEDPRRDVETTDGLKLTKINPAYMTRL
FT                   LGEELRKIQDVAIHITSSVPVNPANRPDEWEEQALRGFEEGKPEIWSVEHGHNGKMFRL
FT                   MTPLKSDAACFSCHEMTKHRRPGSILGGISVSFPYAPFGRTLAVVRVQIVLIHSLFFVL
FT                   TTAVLIFFSRVNGELKREIAERSRAEEHARLANTELERRVAERTAELEAVNRELETFNY
FT                   SVSHDLRTPLTSIYGFGKILLDDYGSRLDDKGRGYVERILTAGKRMNRLIESLLSLARL
FT                   GREEIRREPVDLSHMASMIIEEFRFRFPERNVKTTIADGVVVNGDRRLMRVVIENLVGN
FT                   AWKYTGDKETAVIEFGRCELTGEAVYYIRDNGAGFDMSRAHRLFTPFERLHSSEFEGSG
FT                   IGLATVRRTIERHGGRIWADAMAGEGATFYFTVP"
FT   gene            complement(353099..354700)
FT                   /locus_tag="KN400_0325"
FT   CDS_pept        complement(353099..354700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0325"
FT                   /product="cytochrome c nitrite reductase, 8 heme-binding
FT                   sites"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83188"
FT                   /protein_id="ADI83188.1"
FT                   /translation="MWKKRLAVLAVAAGAAVALSIPALSTAAKGKPAATGAKGDGRETC
FT                   YGCHEEVKALKEGSKHARLACDSCHDKLKEHLANYETKPGTNLDPAKCGSCHKNEYSSF
FT                   FTVNYDAQPRKEKGIPTGRSPMQDKLLAGHGFTFEHNEPRGHAFMVVDQFIVDRFQGGR
FT                   FQYKKGAWGMDATGKAWDILTDTGKKLPETAMAGNPTCIQCKTSDHILKWKFMGDKDPK
FT                   ATWDRSSDIVAVAKDTQNPVGCIHCHDPHGTQPRVVRDGLIQAIEKDPTANIFAKNGKT
FT                   DLKVISFRDGFRKIGVMEKTDSRLMCAQCHVEYNCNAGSQWSDGQKVGYDDQRTNHFPL
FT                   KNAKDLLAHYKKLDFYDFKHAITGARLVKLQHPEAETYAGSVHDRAGVGCADCHMPRMK
FT                   GKDGKMFKSHGVIRPAHHVKEACLGCHPKSTVEQKSYQIEGTRNYIRGKMRKAEYWLGQ
FT                   LIDTYAAAKRMGIGEDVLAKAREKHEEAHVLWEYWTAENSDGFHNPELARDSLTSSIAA
FT                   SKAGVKLLNDAMEPKK"
FT   gene            complement(354733..355236)
FT                   /locus_tag="KN400_0326"
FT   CDS_pept        complement(354733..355236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0326"
FT                   /product="periplasmic nitrate reductase, iron-sulfur
FT                   cluster-binding subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83189"
FT                   /protein_id="ADI83189.2"
FT                   /translation="MAGRWFLFRFLSGYWSAARNIGAATPVCRPPRFKETASGSCGDCT
FT                   ACRDACPSAIIVRDFARKGPHLDFFQGRCTFCYLCAGACPKGILTLPNEGERMVIGRAR
FT                   LIRDRCLVREGCSVCIERCPEGALTLIFGRTIRVSKRKCTGCGGCRHVCPAKPNAMSIE
FT                   PLNG"
FT   gene            complement(355556..356932)
FT                   /locus_tag="KN400_0327"
FT   CDS_pept        complement(355556..356932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0327"
FT                   /product="sigma-54-dependent sensor transcriptional
FT                   regulator, PAS domain-containing"
FT                   /note="domains: PAS, sigma54 interaction, HTH8"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83190"
FT                   /protein_id="ADI83190.2"
FT                   /translation="MRIEPQPLHLPVFRAILASMGEGIIFADADDRIRYINAAAEEIRG
FT                   IIAGNYLGRSIVSIHSPASEGRIRRLIAGLKGGDIPFSTRVIHVREKIFENSYYPIRNE
FT                   NGTYEGTLLISRDITEKERLKEENNSLREQVRADFACGGMIGKSHAMEPVFHMIRATAA
FT                   LDSTILISGESGTGKELVACAIHQMSPRHKNPFVKVNCAALPETLLESELFGHERGAFT
FT                   GAVRERKGKFEQAHLGTIFLDEIGEMPLAAQAKLLRVIQGKTLERIGGNREIVVDVRII
FT                   AATNKDLRREVERGAFREDLFYRLNVIPIHLPPLRERREDILSLAEHFLSVYAERMRKP
FT                   VRCIAPDARKALLDYDYPGNVRELENAIERGVALSMGETITLADLAPYFVTGASAAPAG
FT                   AALPKDPPAATLSRAVSVAEQEAIREALQTTGNRKGVAAKLLGISRKTLWEKLKQMERT
FT                   "
FT   gene            357204..358493
FT                   /locus_tag="KN400_0328"
FT   CDS_pept        357204..358493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0328"
FT                   /product="peptidoglycan-binding outer membrane protein,
FT                   OMP_b-brl and OmpA domain-containing"
FT                   /note="domains: OMP_b-brl, OmpA"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83191"
FT                   /protein_id="ADI83191.1"
FT                   /translation="MKQRIVPGLLALAAIAVTAAPALAENRSGAGYISPFVGGYTFDGA
FT                   QHLKTRPTFGLRGGYNLDKNWAAELLLGYVPTKQSRGQGNDADAYRYGLDVLYNFMPDS
FT                   ALVPFLAVGGGASTIDHSEGVSDEHEQYVNYGGGLKYFLTDNFALRGDVRHIYMLGPEN
FT                   HNFEYTVGLNYLFGGERPAPAKVAAPPEPPKAVEPPPPAPAPKKEIAPPPPPPAPAPKD
FT                   TDGDGVIDDLDKCPDTPAGVKVDSVGCPLDTDKDGVYDYLDKCPGTPAGVKVDSVGCPL
FT                   DTDGDGVYDYLDKCPDTPKDLAVDAKGCPERICITLGVQFDTDKAVVKPQYNDEIKKAA
FT                   DFLKEYPDATAVIEGHTDSVGSDAYNQKLSERRAKAVMKYLVDKFGISAKRLSAKGFGE
FT                   SKPIADNATEEGRYKNRRVVAVIDCGMKKR"
FT   gene            complement(358602..359495)
FT                   /locus_tag="KN400_0329"
FT   CDS_pept        complement(358602..359495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0329"
FT                   /product="peptidylprolyl cis-trans isomerase, PpiC-type"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83192"
FT                   /protein_id="ADI83192.2"
FT                   /translation="MTSRTLLVGALLVALAAGVSRAEEINPVVGKAGEFTLREADLDRF
FT                   IDALPAEAQQQLRKNPEQRSLLAREILQTRAIAMKARKDGFDRKPEVRERLGYFVDDFL
FT                   AREYLTKVVIAGVKVSDAELRAYYQEHAKDFVMPEQAIVRHIFIGFTDAADSQAKAAAK
FT                   TKTEGVLERLKKGEDFAAVAAEASEDIESAKEGGLLGAITPGQTNSEEFEKAVFALKAG
FT                   EMSGLVESPFGYHIVKVDERKEKRALPFDEVKDALRSKLQGEAEQKKLREFVDEVAKQT
FT                   GLELPASEEKPSGEGK"
FT   gene            359745..360200
FT                   /locus_tag="KN400_0330"
FT   CDS_pept        359745..360200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83193"
FT                   /protein_id="ADI83193.1"
FT                   /translation="MAQVFDFTRLRRLTIIHVFVQAFLLILLVGTTSVLLGKVPSQVFM
FT                   NSVIRVVVLQLILFYPVYKLAASDAEREVASAVTGLPAEEMQALRRKRVFSDILKGALI
FT                   IFFFTFILRAPGAPQIQFSILAVFLLSYLAYFQCFNSVAKRLMRAKS"
FT   gene            complement(360215..362737)
FT                   /gene="dinG"
FT                   /locus_tag="KN400_0331"
FT   CDS_pept        complement(360215..362737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinG"
FT                   /locus_tag="KN400_0331"
FT                   /product="ATP-dependent DNA helicase DinG"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83194"
FT                   /protein_id="ADI83194.2"
FT                   /translation="MKRYFSEQAILDLRAAIADAGGNEVFFLGRTDENLLVVEVEPLAR
FT                   GNRDAVAAIMIATSFGDVVIHNHPSGVLTPSQADVEIASLLGNQGVGFSIIDNRAENCY
FT                   QVVPPFARRETQRLSFPEIERIFAPAGVLTDNLPGYEYRDEQLRMAFRVTEAFNDDRVA
FT                   VIEAGTGTGKSLAYLVPAVLWAIRNQERVVVSTNTINLQEQLTRKDIPFLQQHAGISFK
FT                   AVLVKGRSNYLCRRKLAAVKAEPSLFADDPAAGELEAIIAWSETTGEGCRSDLSFIPKE
FT                   EAWEEVACEADQCGRVRCPFYARCFFYSARRQAASADLLVVNHSLLMADLALRQEAGYR
FT                   STAILPPFERLIVDEGHHLEDVATGHLSAQVSRTGLLKLMGRLQNPRKPQRGLLPQFSA
FT                   GLVREMPEALDELYRELAERIDGTLIPRRQQLTDGVTRAMDAIGIALVGHLSERGGTTG
FT                   ERKLRVTPSLFGSRLWRVVDDEVRELAADMNDYVRELKGVLTACVRLPEEVREKLAGLL
FT                   IDLRGITGRLEAVAGDLIFFIGREGEVCRWFEVKRGKNGMVVRLCSSPLEVAASLKRTL
FT                   FDAFRTVVVTSATLAVGERFDYLARRTGIALLKQDRVTELLLASPFDYEHQAFVGIPAD
FT                   IPEPASRGFQEALELALHQGLAISEGHAFVLFTSYDLLAKLFGRMAETLKRRGLTPLRQ
FT                   GEVNRHHLLARFRQEPNAVLFGTDSFWEGVDVQGKALELVALTRLPFRVPTEPVLEARA
FT                   EHIAAGGGDPFMEYTVPQAVIKFKQGFGRLIRSREDRGAVLILDSRVLTKNYGGHFLRS
FT                   LPPVRLVTGSSAEVFGAMADFFAAPPSP"
FT   misc_feature    360561..360582
FT                   /note="conserved nucleotide sequence; KN400_R0125"
FT   gene            complement(362834..363109)
FT                   /gene="ppcB"
FT                   /locus_tag="KN400_0332"
FT   CDS_pept        complement(362834..363109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppcB"
FT                   /locus_tag="KN400_0332"
FT                   /product="cytochrome c, 3 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83195"
FT                   /protein_id="ADI83195.1"
FT                   /translation="MKKLIASLALTLFAAGAALAADTMTFTAKNGNVTFDHKKHQTIVP
FT                   DCAVCHGKTPGKIEGFGKEMAHGKSCKGCHEEMKKGPTKCGECHKK"
FT   gene            complement(363244..363531)
FT                   /gene="ppcC"
FT                   /locus_tag="KN400_0333"
FT   CDS_pept        complement(363244..363531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppcC"
FT                   /locus_tag="KN400_0333"
FT                   /product="cytochrome c, 3 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83196"
FT                   /protein_id="ADI83196.1"
FT                   /translation="MRFIPATAALLIILAGTAGAIDKITYPTRIGAVVFPHKKHQDALG
FT                   ECRGCHEKGPGRIDGFDKVMAHGKGCKGCHEEMKIGPVRCGDCHKGGSTH"
FT   gene            363662..364582
FT                   /locus_tag="KN400_0334"
FT   CDS_pept        363662..364582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0334"
FT                   /product="helix-turn-helix XRE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83197"
FT                   /protein_id="ADI83197.1"
FT                   /translation="MDNLAEHSDRTPTPIVAIDGTTIRRIREAKRLTQLYVASVVGVTT
FT                   DTISRWENNRYPSVKRDNAEKLAQALEVSLEDILRREEAAEDAPAEVAPPEPPPRRRLR
FT                   LAVILLLAGAAILGIMFFRGAAPGLKAERTLPPYSAPGQILPVRVKVERPAEGGSGFIL
FT                   KERIPAGWRFVSANPPVTGEAGVREIKWLIPPGAGTMTISYTLMSPRETPLRTAADFGG
FT                   EVVRSDERGTRREPVAGAARVTVAGIHWADVNGDGRIDDNEIMPAYYLTEEMKGLGLDW
FT                   KTIETIWASTGYTWNDKLKTFEVVR"
FT   gene            364579..365496
FT                   /gene="yhcC-1"
FT                   /locus_tag="KN400_0335"
FT   CDS_pept        364579..365496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhcC-1"
FT                   /locus_tag="KN400_0335"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase, TIGR01212 family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83198"
FT                   /protein_id="ADI83198.1"
FT                   /translation="MTERRYNAFSDELRRVFGCRVQRVSVDAGFTCPNRDGTTGLGGCI
FT                   FCGGRGSGSFGIRPELGVADQLAHGMTYLSRRYGAEKFLAYFQSYSNTYAPVERLRLLY
FT                   DEALSVPGVAGLIVGTRPDCLPPEVIDLLAEYARSTYFWLELGMQTSHDRTLALLNRGH
FT                   DAASFQDAADRCRRRGIRLCAHVILGLPGETDADMLETAMMLNGVGIDGVKLHHLHVMK
FT                   DTPLEVMYRQGAVGCLGRDDYVGLVCDFLERLDPRIVVHRLVGDAPADHLVAPAWTLEK
FT                   SAVLAAIDEEFIRRDSRQGARLSR"
FT   gene            complement(365532..366782)
FT                   /locus_tag="KN400_0336"
FT   CDS_pept        complement(365532..366782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0336"
FT                   /product="outer membrane surface lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83199"
FT                   /protein_id="ADI83199.1"
FT                   /translation="MGLRTVLLFAAFLVLTGCTTMVPRERLPYPLTDDSFGDPVKVVTI
FT                   PLPVIATSPNEGAILGGLTAFLLHNARDEVNTLIAPQVNYNQNFGTTFSLYGAFFPLPE
FT                   RNWEFNLSKSTNVNEDYEVRLRDKTFLSLNGKPLETNAFLYYFTDGSSRFYGFESGSLQ
FT                   QDETNYANREYGITMGVGYDLTDHLQLVLGERFRKVDIRPGAVSKVPYIRDRFTTAEVP
FT                   GINGFTAHAQKIALIYNTLDDRTMPTGGLYARASIEGSAELLGSDAGYRHYEVELKGYF
FT                   PLDTARYITVVRVAYNQTLGSEVPFLERSILGGETTLRGYGRNRFVDSSYLLCNLEERI
FT                   RLFRWSVFDVNTDWEVAPFIDLGAVMESLDRAEAKSFEFNPGIGFRAVVRPNIVGRVDI
FT                   GFGNEGPAVFVGLGYPF"
FT   gene            complement(366948..367220)
FT                   /locus_tag="KN400_0337"
FT   CDS_pept        complement(366948..367220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0337"
FT                   /product="FlhB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83200"
FT                   /protein_id="ADI83200.1"
FT                   /translation="MTTNDRDRKAVALSYREGHYAPQVVAKGYGVTAEAIIACAREAGV
FT                   YVHQSPELVRQLIQVDIDSCIPADLYRAVAELLAWLYWLEHAEGD"
FT   gene            complement(367207..368964)
FT                   /locus_tag="KN400_0338"
FT   CDS_pept        complement(367207..368964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0338"
FT                   /product="FliK domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83201"
FT                   /protein_id="ADI83201.1"
FT                   /translation="MIVTQEIARIAQALLKDSTYSLVEARWQTLTPLNLTPGQMVQAEV
FT                   LANLPDSRYLIRLANQLLRMEIPLNLQPGQTVELTFVSEEPRLVFALSKEANSGVPVRI
FT                   SDTGRWLNQLATSRNDAVQSTPLPRPSIILQEPPRDTGRLAEGLRNALTRSGVFYESHL
FT                   SQWVKGERPLADLLREPQGSLSRLAVATTSGGNNTSPAPANGGAPPQQNAAPPASQSPG
FT                   GPPAATTDAGQKPAAAPLPAANQPTGSQPAAGGGNAPSTVPASAGTGTTGSLGSPSVAT
FT                   PATGDAPQAPHQSGTPAPSVTTTPAGGAPPTDQAPPPLRPDGGTAALPDTDQATPRPQG
FT                   PAPDGTRPPTPQEPLRPDSTPVAGKPLPAPSQPDQSSPQGPTLRQVPLPDPAAQNSPTA
FT                   PGTTVVSQARGERIAVDQHAASQPRAPMALAADGDGVAVAARAGDPAATERAGGLRHIP
FT                   PPPQGGVEPQTIPIIKEQLTTLATGQFTWHGQVWPGQDMEWKVEEREADGRGSSAERSW
FT                   QTEVALDLPRLGSVRATLSLGSSGVTVNLAARNEETIAAMKEGRPRLEEALDAAGIRMT
FT                   GFRVSHDDE"
FT   gene            complement(369010..371574)
FT                   /locus_tag="KN400_0339"
FT   CDS_pept        complement(369010..371574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0339"
FT                   /product="alpha-glucan phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83202"
FT                   /protein_id="ADI83202.1"
FT                   /translation="MDFTKRIHRFTVVPSLSGELAILQTLAYNLWWTWEPDAVELFKRL
FT                   DIDLWQQTRHNPVEMLGILQQTTLERLVADEGFMAQLKRVEEKYHGYMTGKTWFDRTWN
FT                   GERPLRVAYFSMEFGLHESVPTYSGGLGVLAGDHLKSASDLGIPLVGIGLLYRQGYFRQ
FT                   YLNIEGWQQELYPENDFYNLPLKLQRDEEGQPVTIELDLAGRKVHVQIWKVQVGRIPLY
FT                   LLDTNMEENDPLDREITAQLYGGDQDMRIRQEILLGIGGIRALNRLGIDPNVCHMNEGH
FT                   AAFLALERTKLLMEKHGLRFPEAMEAVRAGTIFTTHTPVDAGIDHFPADLLERYLGRYY
FT                   RFLGLSRDEFLSLGRQLPKNPHESFCMAVLALRLANHANGVSQLHGEVSRKMWKNLWPE
FT                   LPDEHIPITSVTNGVHTKTWLSVEMAGLLTRYLGNRWREDPTDSLLWKRVANIPDSELW
FT                   RTHERCRERLVVFARRRLKDHLHQVGATAKEIAQADEVLDPEALTIGFARRFATYKRGT
FT                   LLFRDLDRLARILNDADRPVQIIFSGKAHPHDVEGKELIRRIFQHSLEARFHNRIVFIE
FT                   DYDMAVARHLVQGVDVWLNTPLRPLEASGTSGMKVAFNGGLNMSVLDGWWPEGYRGNNG
FT                   WAIGKGEVYDDIDFQNEVESRAIYDLLEKEVIPLFYDRGPDGIPRGWLACMKASLQTLC
FT                   PVFSTERMVKEYAERMYLPSFEEWRTLAGDGLARAVDLARWKGEMHRSWHQVKVISVEA
FT                   PAPEEVPLGAPIPVTARIALGDIVPDRVIVETYCGVLDSRGNIVGGELIPLDHAEEEGG
FT                   GSHRFTGDIETRFCGRHGFMIRVMPRHPELGPVYEQGLLVWG"
FT   misc_feature    371570..371606
FT                   /note="conserved nucleotide sequence; KN400_R0126"
FT   gene            complement(371761..373128)
FT                   /locus_tag="KN400_0340"
FT   CDS_pept        complement(371761..373128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0340"
FT                   /product="sigma-54-dependent transcriptional response
FT                   regulator"
FT                   /note="domains: REC, sigma54 interaction, HTH8"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83203"
FT                   /protein_id="ADI83203.1"
FT                   /translation="MPATILIVDDERGQREILQTILEGERYETTTAAGGQEALALLDER
FT                   EFDVILTDLKMQGMSGMELLERLLAADPQQCIIMMTAHGTVDSAVEAMKKGAFDYLEKP
FT                   LERDTLLLTLRRAVERVRLLKENRALHKKLEETGAIPDIIGEHPKMKEVFRIVTKIAPT
FT                   ASTVLIQGESGTGKELVASAIHERSPRADKPFFAINCAAIPETLMESELFGHEKGAFTG
FT                   ASSREIGIFEAANGGTVFLDEIGEMSVAMQAKLLRAIQAKEIRRVGGKVNIPVDVRIIS
FT                   ATNRDLEAEIRRGNFREDLFYRLNVIRISLPPLRERGSDIAALTDFFVAKYRGDTGVKG
FT                   LSRAALKLLMNYSWPGNVRQLESVIERGILMAEGELVEPGDLPAEIGEGVSPGGGLPFE
FT                   LPADGIQFEELEKNLIIKAMERAGGVIAKAAPLLGMSYKTLQYRLEKFGITRDQGP"
FT   gene            complement(373172..374587)
FT                   /locus_tag="KN400_0341"
FT   CDS_pept        complement(373172..374587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0341"
FT                   /product="sensor histidine kinase, HAMP domain-containing"
FT                   /note="domains: HAMP, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83204"
FT                   /protein_id="ADI83204.1"
FT                   /translation="MRLNTKLVMIMLTLLVIAVVTLFVLNQYSQNEMVQEIQESSSFVS
FT                   QAIQMSVEDLTSEFEPDPERLARYMKEARVRGVKEISIISNEGEIIDSSDPSKVGKKRD
FT                   IKKMEKGLRAAPESRRERATANRSYELLVPVIVGDQQLGYVQINLLLDNIRTIQHENFV
FT                   NRVVATSLVFLLGIIFTIFLATRYTAPINRLAAQVRRVADGDLTVSFPVAGSDEIGELG
FT                   RNFNEMVTKLQERENLEKRLYEAEHLSKVGQLASGIAHEIRNPLNYISLAVDHLKGEFV
FT                   AACPDKGERFVPLAEKIKEEVRRANYLVVNFMNYGRPLKLRIGEVCYRELIDRALPLLR
FT                   ERLDEQRIAVATEIPPDLPPMRADGEMLRNCVFNFVTNAIQAMPGGGTITLGASFDRET
FT                   ETFHLTFTDQGVGIPPEDLPKIFQPWFTSKEAGIGLGLAITERIIREHGGEILVESTPA
FT                   QGTTFTVILRGGR"
FT   gene            374773..375105
FT                   /gene="hypA"
FT                   /locus_tag="KN400_0342"
FT   CDS_pept        374773..375105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypA"
FT                   /locus_tag="KN400_0342"
FT                   /product="hydrogenase nickel insertion protein HypA"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83205"
FT                   /protein_id="ADI83205.2"
FT                   /translation="MHEMSITQNVVEICEKSAEGRRILAVVLEIGELSGVVPEAVEFCF
FT                   EACTAGTLAEGARLAIDRVPGRGECGNCATVFPVRTYFDPCPACGAYGVRVVAGEELRV
FT                   KELEVE"
FT   gene            375228..376316
FT                   /gene="gcvT"
FT                   /locus_tag="KN400_0343"
FT   CDS_pept        375228..376316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="KN400_0343"
FT                   /product="glycine cleavage system T protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83206"
FT                   /protein_id="ADI83206.1"
FT                   /translation="MDTLASTPLRIEHERLNALMAPFGGWNMPIQYEGIIAEHRWCREK
FT                   ASLFDICHMGEFLFTGDIIADGLEDVFTFSVASIPVGRSRYGFLLNGDGGIMDDLIVFR
FT                   LAQNEAMVVVNAATIGKDFAAISARLGGGGFQDISAATAKLDLQGPLSREVLVEVIGPE
FT                   IAAIPYFKFIRTKVLGADAIVSRTGYTGELGYEIFLPSDRVVELWQRLLADPRVRPAGL
FT                   GARDVLRLEVGYSLYGSDIDESTTPLEAGLESFVSFDKSFVGKDALLAQRAEGVMRRRV
FT                   AFQVASRRSPRHDYEILFQGEQVGAVTSGVFSPMLGCGLGLGYVTPGTAVPGAPLTIRH
FT                   ERVSMDATVVDAPFYRGGSLRA"
FT   gene            376372..376746
FT                   /gene="gcvH"
FT                   /locus_tag="KN400_0344"
FT   CDS_pept        376372..376746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="KN400_0344"
FT                   /product="glycine cleavage system lipoyl carrier protein
FT                   GcvH"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83207"
FT                   /protein_id="ADI83207.1"
FT                   /translation="METYFTKEHEWVKVKEGVAAVGITEYAAHQLGDVTFVELPQVGKQ
FT                   VKQFEVLAAIESVKAASDIYAPVSGKVTQVNEALDDRPEIVNEAAEEAGWIAWIEMGDT
FT                   SELNGLLTREQYDEYLKGLE"
FT   gene            376746..378092
FT                   /gene="gcvP1"
FT                   /locus_tag="KN400_0345"
FT   CDS_pept        376746..378092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvP1"
FT                   /locus_tag="KN400_0345"
FT                   /product="glycine cleavage system P protein, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83208"
FT                   /protein_id="ADI83208.1"
FT                   /translation="MSGADYCPNSPEEVRRMLDAVGVADIDDLFRPISPALRAKSFDLP
FT                   PGMSEFEMLHRLQTLAGRNAQGLVHFVGGGFHDHLIPAVVDHLASRPEFYTAYTPYQPE
FT                   CSQGTLQALFEYQTAICRLTGMEVANASLYDGGTALAEAALMALRITGRSRLVVDGAVN
FT                   PFHREILATYLANLDVELVEIAPKAGMEDDARLRAAIDDATAAVIVQNPDFFGTLSDLS
FT                   GLAAEAHGVGALLVASVYPISLGLVRSPGSMGADIVVGDGQSLGNPLSFGGPSFGFIAG
FT                   RREHIRNLPGRIIGETVDRNGARGFVLTLQAREQHIKRHKATSNICSNQSLCALRGLIF
FT                   LSALGSEGMAELARLNRDKAEYAKAVLGAVPGVEVLNSGFTFNEFTVCLPKVAEEAVVA
FT                   LLRKGVAAGVPLGPYYPDMEKCMVVTVTERRTRAEIDAFARQLEGALWN"
FT   gene            378083..379528
FT                   /gene="gcvP2"
FT                   /locus_tag="KN400_0346"
FT   CDS_pept        378083..379528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvP2"
FT                   /locus_tag="KN400_0346"
FT                   /product="glycine cleavage system P protein, subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83209"
FT                   /protein_id="ADI83209.1"
FT                   /translation="MELIFEKSVTGRRGVRLPASDVPPAPPLSAVLARDGAPDLPQVSE
FT                   LDVVRHFTTLSRRNFSVDTHFYPLGSCTMKYNAKALEEAAKLFAPYHPMVPLLPHGASF
FT                   SQGSLGLVHGLGEALAEITGMDEVTCQPLAGAHGEMTGIMLIAAYHEAKGNRKKYVVVP
FT                   DSSHGTNPASAAMVGYEIITVPTAPYGDMDLEKYRAVMTDEVAAVMMTCPNTLGLFNPH
FT                   IREICDIAHDHDALMYYDGANLNAILGKVRPGDVGFDVIHVNLHKTFGTPHGGGGPGSG
FT                   PVGVKKLLASYLPGPRVVKNSDGDYSVIPHSHESIGRTAGFFGNFGVMAKAFAYITMLG
FT                   REGLIQVSEQAVLNANYIMARLKDVYDLPYDQTCMHECVFSAARQARNGVHAIDIAKFL
FT                   IDRGFHPPTVYFPLIVKEAIMIEPTETESKETMDAFIEAMRDAADLAERNPAAFAELPR
FT                   TMPITRPDETKAAREQNVCYFGC"
FT   gene            379528..380337
FT                   /gene="lplA"
FT                   /locus_tag="KN400_0347"
FT   CDS_pept        379528..380337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lplA"
FT                   /locus_tag="KN400_0347"
FT                   /product="lipoate--protein ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83210"
FT                   /protein_id="ADI83210.1"
FT                   /translation="MEPPAWRLIDTGPLDGPRNMAVDEALLRHFGQGAAPVLRLYGWEP
FT                   PAFSVGRFQKADEAIDRERCRRADIPVVRRITGGGLIYHGPELTYSLVCAPRHIAGARG
FT                   VKESFRALTGFLFRFYGELGLAACWAADDAAGDARLGARTPLCFAGREESDIVIRGRKI
FT                   GGNAQRRLRDAIFQHGSIPLADGVGEALPFFRSVPAGLREGTTDLAALGVAGGADRLRA
FT                   LLARSFSAAHGVALVPSELSPAERETADRLLRERYGNDDWNFGGENG"
FT   gene            380334..381245
FT                   /gene="lipA"
FT                   /locus_tag="KN400_0348"
FT   CDS_pept        380334..381245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="KN400_0348"
FT                   /product="lipoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83211"
FT                   /protein_id="ADI83211.1"
FT                   /translation="MNIHRKPEWLRKKINPAAHGAMDELLGELRLHTVCREARCPNITE
FT                   CFRERQATFLILGAECTRLCSFCNVTKGEPLPPDPDEPARVAQAVVRLSLAHVVITSPT
FT                   RDDLPDGGAGHYVATVATIGRVAPATVVELLIPDFLGSRAALADVVAAAPRIIGHNVET
FT                   VPRLYAIRAGADYGRSLAVLRTLRELAPGCATKSGLMLGLGETEEEVLAVMADLRRVDC
FT                   TYLSLGQYLAPSRFHHPVREFVLPETFDRLKELAEKMGFRHVESGPYVRSSYHAAGYGG
FT                   GTRTDQPVASGCLSDQEGVSAQ"
FT   gene            381242..381466
FT                   /locus_tag="KN400_0349"
FT   CDS_pept        381242..381466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0349"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83212"
FT                   /protein_id="ADI83212.1"
FT                   /translation="MRKITVLALVASMLTLAACSGKGVQELYDTAQFEEKQHNLEHATK
FT                   LYEEIVAKHPQSELAARAKERLEAIKAGK"
FT   gene            381475..381879
FT                   /locus_tag="KN400_0350"
FT   CDS_pept        381475..381879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83213"
FT                   /protein_id="ADI83213.1"
FT                   /translation="MELIVTFPGGKKVNAELGGMVIPTDQPVESGGEGTAPSPYDYFLA
FT                   SIGTCAGFYVLAFCQQRGIATENISLRQAMEFTPTADGRKKLSRVQMEIVVPSDFPEKY
FT                   RNALVKSAELCSVKRALADPPDFAIRTVVA"
FT   gene            381995..382423
FT                   /locus_tag="KN400_0351"
FT   CDS_pept        381995..382423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0351"
FT                   /product="peptidylprolyl cis-trans isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83214"
FT                   /protein_id="ADI83214.1"
FT                   /translation="MAQAKQGDTVTVHYTGSLTTGELFDSSEESGPLKFTVGQDEVIPG
FT                   FEEAVIGMSPGETKTVTIPEDKAYGARMPELVADVERQYLPAGAEPVIGQQYEVTQDDG
FT                   QVFNVTVTAMTDDMVTLDANHPLAGRELVFEIKLLEIA"
FT   gene            complement(382504..382980)
FT                   /locus_tag="KN400_0352"
FT   CDS_pept        complement(382504..382980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0352"
FT                   /product="ferritin-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83215"
FT                   /protein_id="ADI83215.1"
FT                   /translation="MSEQGAVCYTFEAAVEMAITMEEEGFRHYLDAIRRVKNKGAKQIL
FT                   KEAALDELEHKLSLEKALLEGQMEGAGSMERQIPTMNLGYVLAKKELSPESDAREALAY
FT                   AIHLEKGAIDFYQRMAQGCAGAPMAKLFDRLLADETKHLQQLEDMYEQHFMTEN"
FT   gene            383161..384045
FT                   /locus_tag="KN400_0353"
FT   CDS_pept        383161..384045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0353"
FT                   /product="NAD-dependent nucleoside diphosphate-sugar
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83216"
FT                   /protein_id="ADI83216.1"
FT                   /translation="MKIFVTGGTGFVGGHVRRALLERGHSLRLLVHQRSEGVEAGIEQV
FT                   EGDVTRPDTFAGAVAGCDATVNLVGIIREFPGRGITFEKLHVEATRNVVEAARAAGIRR
FT                   HLQMSALATRPDATAAYHRTKWRAEEVVRQSELDWTIFRPSLIFGPKGAFVDMLAGFVR
FT                   RFPAVPVVGDGTYRLQPVSVDDVARCFALALDMPETFGQTYELCGPDRLTYNEVLDIIG
FT                   RVLGKGHVVKIPQPLGLLKLVVPIMQGFSFFPLTMDQITLLTEENICSNAWPSVFGFEP
FT                   CRFEAGIASFLHR"
FT   gene            complement(384083..384772)
FT                   /locus_tag="KN400_0354"
FT   CDS_pept        complement(384083..384772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0354"
FT                   /product="protein of unknown function DUF2466"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83217"
FT                   /protein_id="ADI83217.1"
FT                   /translation="MAGGIKAWPEDERPREKLLRRGAPVLSDAELLALIIRTGDSVTGR
FT                   SAIDLGRALLQECGDLRTLAGATVSELCAVKGMGTAKATSIKAALEMASRINSERLMIC
FT                   SERFTSPEQVYNHYHYAFRDRRKEYFMALLLDGKNRIMREIQVSEGSLNQSIVHPREVF
FT                   NPAVRESAAAVILVHNHPTGDPAPSREDLEITRRLREAGDIMGIRVLDHIIIGDGRFTS
FT                   FVSAGLL"
FT   gene            complement(384864..385673)
FT                   /gene="uppP"
FT                   /locus_tag="KN400_0355"
FT   CDS_pept        complement(384864..385673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppP"
FT                   /locus_tag="KN400_0355"
FT                   /product="undecaprenyl diphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83218"
FT                   /protein_id="ADI83218.1"
FT                   /translation="MDIMHAAVLGILQGLTEILPISSSAHLILVPWLLGWPESGLTFDV
FT                   GLHVGTLIALCVYFRRDIAYLISDAITGLREGFGSQTSRLPFFIIAGTVPAAIAGKTLE
FT                   KPIEEFFRGSHTLIALLLIAFGLLLALADTTGPKRWRMDRVDLRGALLIGLAQCLALIP
FT                   GVSRSGITITAALFLGFTRDTAARFSFLLSLPIVAGAGILKMGELARHGIPAGELAPLL
FT                   AGMATSAVSGYLGVALLLRLVQRYSLYPFVWYRLLAGGAVLAYLFAR"
FT   gene            385873..386490
FT                   /locus_tag="KN400_0356"
FT   CDS_pept        385873..386490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83219"
FT                   /protein_id="ADI83219.1"
FT                   /translation="MFGLIPKEEKFFAMFKDMAANIVTGGKLLKQMLDSYDDPQASQKK
FT                   IKDVEHACDAITHDIIQKLNKSFVTPFDREDIYALAAALDDIVDLIDASAQRFIMYNVE
FT                   KPTPEAKELAFLILQGCLAIEKAVSHLGEKFEHIAEHCVEVNALENEADRVCREAISRL
FT                   FDEEKDPIQLIKWKEIYETLERATDKCEDAANILESVVVKNA"
FT   gene            386483..387484
FT                   /locus_tag="KN400_0357"
FT   CDS_pept        386483..387484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0357"
FT                   /product="phosphate/sulfate transporter family membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83220"
FT                   /protein_id="ADI83220.1"
FT                   /translation="MLDTTLIMLVLVIGAALAFDYINGFHDTANAIATCVSTRALSVRS
FT                   AIVMAAVLNFAGAMISTKVAATIGKGIVDAGNVTQMVVLAGVLGAIIWDLVTWYYGLPS
FT                   SSSHAIIGGIMGAVIAHAGTTALHWGGLKKIILSLILSPVIGTLLGFIVMVVMLWSFKS
FT                   TSPHSINKHFRRLQVLSAAFMAFSHGTADAQKSMGVITMALVSYGTLTTFDVPTWVKIA
FT                   CAVAMGLGTAAGGWRIIKTVGKDFVKLQPVHGFCVETASAGVILGASSIGMPVSTTHVI
FT                   TSTILGVGLSKRITAVNWNVAYRILWAWVLTIPASAIMSYVSYMVLNPFLGK"
FT   gene            complement(387536..388018)
FT                   /locus_tag="KN400_0358"
FT   CDS_pept        complement(387536..388018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0358"
FT                   /product="protein of unknown function DUF2062"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83221"
FT                   /protein_id="ADI83221.1"
FT                   /translation="MLNKEKWKKNIKAILSLDSHPGHIAAGFAVGVFISFTPFFAFHTL
FT                   MAIAAAFIFRLNKLTCITGAWVNTPLTVVPVLAISYKLGRVMRGLPPAELSFHGLDWHA
FT                   LKPHATSLLLGTSVIGFVAAVVAYVICYWLVVRFRRKDETLATLAEEMEEVGEELE"
FT   gene            388235..389578
FT                   /locus_tag="KN400_0359"
FT   CDS_pept        388235..389578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0359"
FT                   /product="efflux pump, RND family, outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83222"
FT                   /protein_id="ADI83222.2"
FT                   /translation="MVRSLIVAFSMLVLSPPVLLAADRSVTLQEALQSALERNHLVNGA
FT                   RFEREAAERGAAASRSRYFPHIFLEEGFAASDAPDRVFMMKLDQGRFTLDDFQLENLNT
FT                   PSSYRDFRTAVTLEQPLFDLGIGYGREMAEKEAERAGFSLAQRREDVGLAVYAAYLDVQ
FT                   KGRVTLAATEKEVAEARESLRVAQARSREGTALRSDELRARTFLSESEQRTITALNDLR
FT                   LARMRLALATGEDAGGSLDIAEELISSPVRLSEDELVREALVNRSDLKGGEKDVERAEA
FT                   AAGAARSAWFPTVYAGASYQMNNRDVPFGRDNDAWMAGVNLRWELFDGLRRSHDQAKAG
FT                   AVRQAALQYLEQQRKEVVLRVREAALRREEAGKRLEVARHALLAADEGMRIVAKRYENG
FT                   LATMVELLDAQSALNRSRTGLVERESEYLLATARVYHAAGLFLKETVK"
FT   gene            389575..390687
FT                   /locus_tag="KN400_0360"
FT   CDS_pept        389575..390687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0360"
FT                   /product="efflux pump, RND family, membrane fusion
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83223"
FT                   /protein_id="ADI83223.1"
FT                   /translation="MRMGRGVRAACGVVLLAAALTGCGHKADKAESKQPPVVTGVTLIP
FT                   AAGEAIPDGAEVVGTVRAADAAVIAARLPATVTGVLVREGDRVGRGKLLVTLEAAESSA
FT                   QASAAAAQVAEAERALDEARARKRLADATYERYANLFKDEAVTRQEMDNRRADRDVAEQ
FT                   GVERATARLMASRESARAAGVVAGYTRIVSPLAGVVTAKQVENGMTVFPGTPLMTIEGD
FT                   GGRRLEASVPESLAGRVRLGQRVPVTIDGAGLSLEGRVVEIVPAADPASRTFTVKVDLA
FT                   GEGIRSGMFGRAFIATGQRQGILVPKSAVMERGALSSVWTLDQGNVARLRLVKTGKPLG
FT                   DRIEILSGLTAGERVISAGLEKVVEGAKIQ"
FT   gene            390724..390903
FT                   /locus_tag="KN400_0361"
FT   CDS_pept        390724..390903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83224"
FT                   /protein_id="ADI83224.2"
FT                   /translation="MLRAPARGGAAAMHDDGRDPEKDETNAVCPSWLLWVLAVWLFIIC
FT                   IVLVLRHGWTFPEF"
FT   gene            390909..394142
FT                   /locus_tag="KN400_0362"
FT   CDS_pept        390909..394142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0362"
FT                   /product="efflux pump, RND family, inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83225"
FT                   /protein_id="ADI83225.1"
FT                   /translation="MDTHHLGFAGKIARAFIDSKLTPLIVIASLLLGVYAVLVTPREEE
FT                   PQIVVPMVDIYLPMPGSTPQEVEERVVSPIERKMWELNGVEYVYAMSRPGMGLVTVRFL
FT                   VGENMEDSLVKLYNKLMSNRGLLPPGAGEPLVVPKSIDDVPILSLTLWSERYDGFMLRR
FT                   IAREICDELKKGENVAEAEIKGGLNRTLSVRLDSARLAAYNLSPLQVAAAIHAGNASLQ
FT                   SGAFAADNRETIVETGSFIADADDARRLVVGVFNGRPVYLADVATVTDGAPEPANYVFF
FT                   GLGPAAGTKGISGNQAENYPAVTIAVAKRKGANATWVAEDLLHRVEALKGKVIPSDVKV
FT                   TVTRNYGETAREKNNELLYHMFLAAISVTILIAVFMGWRAGAVAAIAIPVTLALTMLVF
FT                   NQIGYTLNRITLFALIFSIGILVDDAIVVVENIHRYFTTTRFKPLEAAIRAVDEIGNPT
FT                   VLATFAVIASILPMGFVGGLMGPYMRPIPVGASMAMLLSMFIAFIVTPYFAYRLMKGES
FT                   HYGSDAAAEESKLTVFYRKAMGALLHNRPLRAGFMIGVAVLLVASCSLLYFKLVTVKML
FT                   PFDNKNELQVIIDAPEGTPLEETARMTAEMGQALRGIPEVTDFQMYVGTSAPFNFNGLV
FT                   RHYYLRTGSHVADIQVNFVHKSERAAQSHDLAKRIRPLLKAVADRHGARIKVAEVPPGP
FT                   PVLSTLVTEVYGPDHATRLDIARKIKAIYEKVDGVVDTDWYVEDDQPKVSFAVDREKAA
FT                   LSGISVEDVSRTLRMALGGVDAGIMHLPREKEPVAINVRLPAAQRSSVEALSSIYVPGP
FT                   RGNVPLSQLVRVSTGVEDQTLYRKNLKSVVYVTGDVAGAIEAPVYAILQMQKEIDKIPL
FT                   PGGYRIEQRAATQPWSEERPGIKWDGEWHITYEVFRDLGLAFGAVMILIYLLVVAWFKD
FT                   FTTPLVIMGPIPLTLIGILPGHALFGAFFTATSMIGFIALAGIIVRNSIILIDFAEMKR
FT                   REGLPLDEAIIEAGAVRFRPMLLTGAAVVVGSFVIVFDPIFQGLALALMFGEIASTTLS
FT                   RVTIPIVYFLVERWKEKRRNSDVLVEEKG"
FT   gene            394117..394545
FT                   /locus_tag="KN400_0363"
FT   CDS_pept        394117..394545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0363"
FT                   /product="redox-active protein, C_GCAxxG_C_C family,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83226"
FT                   /protein_id="ADI83226.1"
FT                   /translation="MFWLKKKDNAPADSLAEQVGLDAEGFYRTGRMHCAEAVLMAMRNA
FT                   YSPEMPQDVVRVAAGFGGGSNAGCLCGAVSGGTMAFGLAVKEDKRRVNRLTRQLHDWFK
FT                   HEYGATCCRIATKNAKGKGGCAVLTGEVAKKAAELLEE"
FT   gene            394559..394771
FT                   /locus_tag="KN400_0364"
FT   CDS_pept        394559..394771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0364"
FT                   /product="protein of unknown function DUF2892"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83227"
FT                   /protein_id="ADI83227.1"
FT                   /translation="MYIDRMLRIIAGAFIMLSLALAHFHNPNWLWFTAFVGLNLFQSGF
FT                   TNWCPMVYFLEKLGVPKFPKGCCDK"
FT   gene            394768..395598
FT                   /locus_tag="KN400_0365"
FT   CDS_pept        394768..395598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0365"
FT                   /product="metal-dependent hydrolase, beta-lactamase
FT                   superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83228"
FT                   /protein_id="ADI83228.1"
FT                   /translation="MTHRITILCDNTVGPVSGTLGEHGFAALVEWEGGSLLFDTGMGET
FT                   LLRNAQRLGRNLAAVPRVVISHGHYDHGGGLWPLLRTCGSKTVLAHPGIFAPRYRVKDT
FT                   GDPLSIGIPFDEAFLRGQGAQFDFNDRFREVGPGLYLTGEVPRTTAFETGDTGLFCDEA
FT                   GCRPDPISDDQSLVIRTERGLVLLLGCCHAGVVNTARWALECTGETVVHTVIGGTHLGF
FT                   CGREQLDETVKSLRELGVHKLVGSHCTGFAAAARLMHEFPGRFHPSAVGYTLEV"
FT   gene            395619..395999
FT                   /locus_tag="KN400_0366"
FT   CDS_pept        395619..395999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0366"
FT                   /product="rhodanese homology domain superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83229"
FT                   /protein_id="ADI83229.1"
FT                   /translation="MIRKFIIAVFMVTSLAATALAAPYRNIGSAEAKALLDKKRNVFLL
FT                   DVRTPDEYRQARLAGSVLIPINEVERRIAQIPKGRPVLVYCAVGSRSGLVAGYLTQRGY
FT                   GEVYNMHDGIVGWYRNGFPITR"
FT   gene            396022..396297
FT                   /locus_tag="KN400_0367"
FT   CDS_pept        396022..396297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0367"
FT                   /product="helix-turn-helix transcriptional regulator, ArsR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83230"
FT                   /protein_id="ADI83230.1"
FT                   /translation="MSEELTRDYEISAQLLRILGHPVRLRIAAGLARECACVKDIWECL
FT                   GMPQAVVSQHLKVMRDHGVLEARREGARVCYSLREGAPAQVVRALF"
FT   gene            396571..398220
FT                   /gene="mcp40H-11"
FT                   /locus_tag="KN400_0368"
FT   CDS_pept        396571..398220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp40H-11"
FT                   /locus_tag="KN400_0368"
FT                   /product="methyl-accepting chemotaxis sensory transducer,
FT                   class 40H, Cache_2 domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83231"
FT                   /protein_id="ADI83231.1"
FT                   /translation="MQIKRYRNWGILPKIMTISGITVVLIAALVLFVLLPLIGEKMMDG
FT                   KKEKTKSVVEVAYNLVADLGERAKRGEISEEEARKRAIDHVKQLRYQGKEYFWINDLTP
FT                   RMIMHPIKPELDGTDLSENKDPRGTYLFREFANICREKGEGFVPYLWPKPGASEPVEKI
FT                   SYVKLYEPWGWVIGSGIYVDDVRADMARLRWVVLGGTALFGLFALSLAFSVGLGVVRPL
FT                   RHAVTSLQDIAEGEGDLTRRIAVEREDESGELALAFNRFVEKLQGIVGTVANNALQVAA
FT                   AAGQVQEASRQMAEAAENVAGQAATVATASEEMAATSMEIAGNCVSLADGARHASETAE
FT                   SGAAVVQETVSVMGRIAERVKEAARTVDSLGSRSDQIGEIIGTIEDIADQTNLLALNAA
FT                   IEAARAGESGRGFAVVADEVRALAERTTRATREIALMIKAIQNETRGAVASMDEGVREV
FT                   EKGTGEAARSGAALREILEQIGSVSLQISQIATAAEQQTSTTTEISGSIQTITDTAHET
FT                   ARGAQESAGAAGQLADLAEQLQNVVMTFRLSA"
FT   gene            398357..399976
FT                   /gene="mcp40H-12"
FT                   /locus_tag="KN400_0369"
FT   CDS_pept        398357..399976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp40H-12"
FT                   /locus_tag="KN400_0369"
FT                   /product="methyl-accepting chemotaxis sensory transducer,
FT                   class 40H"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83232"
FT                   /protein_id="ADI83232.1"
FT                   /translation="MQLTIKQRMGMTVGVTLLGMVVIIVFMVVGFTKVHRQQELMDRLT
FT                   LINNTALRGNIAMLKAREYEAEFFDRKQDKWVPRVKQAVDQVNKELDVILKNTDDPKIK
FT                   GWAESARKLATQYVQQFQELASVALGSNFQGAELAETREELRDILNEFEPLLDNYIPKQ
FT                   VGVAYQAATEEMDRSIAAIRLQIFGAVLLVAVAMLVSISSTAIYLLRSLRLINDRLRDI
FT                   ADGDGDLTKRIELQSRDELGTLAVSFNNFVGKLHDIIAQVSQGTLQVASASYELQANAE
FT                   QMAHGAEAAATQVNTVASSSEVLAASTFEISSNCGTVAESSRRANDSAQTGAVVVEKTV
FT                   DIMARIAERVKDSARTVESLGARGNQIGEIISTIEDIADQTNLLALNAAIEAARAGEQG
FT                   RGFAVVADEVRALAERTSRATREISQMIKGIQGETRGAVLAMEQGVKEVELGSEEAARS
FT                   GEAIRTILEQFRTLDCQVGEISAAAEDQTRVTTEISTNVMQITEIIETTAKGAADSAEA
FT                   AQGLAELSDQLKQIVGRFKLSV"
FT   gene            400154..400561
FT                   /locus_tag="KN400_0370"
FT   CDS_pept        400154..400561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0370"
FT                   /product="hemerythrin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83233"
FT                   /protein_id="ADI83233.1"
FT                   /translation="MALISWSDSLSVKVKQFDDQHKKLVDMVNQLFDAMKAGKGNQVMG
FT                   DILKSLIQYTQTHFAAEERIMKQYGYPDFEAHKKEHNALVMQVLDLQKQFQEGKAVLTQ
FT                   NVMTFLRDWLSKHIQGDDKKYGVYLNGKGVS"
FT   gene            400722..401084
FT                   /gene="cheY64H-1"
FT                   /locus_tag="KN400_0371"
FT   CDS_pept        400722..401084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY64H-1"
FT                   /locus_tag="KN400_0371"
FT                   /product="response receiver CheY associated with MCPs of
FT                   classes 40H and 40+24H"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83234"
FT                   /protein_id="ADI83234.1"
FT                   /translation="MANVLIVDDSSTMRKIISRSLRQAGLPVDEIFEAGDGIEGLNVLS
FT                   GKSVDLILSDINMPNMDGLEFIKQARANGHKAPIVMITTEGGEDILKEAISSGASDSIK
FT                   KPFTPDQLNEKLGSLL"
FT   gene            401081..401587
FT                   /gene="cheX64H"
FT                   /locus_tag="KN400_0372"
FT   CDS_pept        401081..401587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheX64H"
FT                   /locus_tag="KN400_0372"
FT                   /product="protein phosphoaspartate phosphatase CheX
FT                   associated with MCPs of classes 40H and 40+24H"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83235"
FT                   /protein_id="ADI83235.2"
FT                   /translation="MSLNSDVASSSKLSEEQLAGYIIGATKEVFGTMVMMEPQDQYPLR
FT                   EPVTTFHCSVTGMVGLAGTYSGILSIHCPLELALKVTSNMLGMEVEEVGDDVNDALGEI
FT                   ANMLGGYVKMALSKGGTDLHLSVPTVISGEEYTLNAMADNDCVIIPFIIDDTRFLVGLK
FT                   LQKEA"
FT   gene            401612..402721
FT                   /locus_tag="KN400_0373"
FT   CDS_pept        401612..402721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0373"
FT                   /product="response regulator"
FT                   /note="domains: REC"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83236"
FT                   /protein_id="ADI83236.1"
FT                   /translation="MEGFGTLTDVVNNSFRQAAEDSGMLLGQELVIGEADRIATNRQTY
FT                   FCDMDDVCFVAEVTASGDYAGKFHVVFGLRDAICMSGFLLGIPTARINEKRRLAIMEND
FT                   DVDAFSEIVNQVVGSFNSVFQPSFGNKVHLKVVPPKKFIPESTELTETEPVPDGEYLLF
FT                   RGRMELSGMEMGNLDVLIPMDLALLFDPPAEEPEPPVEEIVAEAVDAPDDAEEVEAGAE
FT                   TEADGEAAQEPAAAAAGAPRPVDENCRRVLILEDDESDRQRIRELLEEKGYEPVEAGLD
FT                   ADIREIFSQGGVRLVVLGIHNGDDRDMAVCIKIKAIAQGDTLPIIMCAREWTRSAVLKA
FT                   VKYGARDIIVKPYQSDEVVAKVAKFLKAA"
FT   gene            402925..405015
FT                   /locus_tag="KN400_0374"
FT   CDS_pept        402925..405015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83237"
FT                   /protein_id="ADI83237.2"
FT                   /translation="MIRFIVKLLLCALVLLPLPAFATSGADTGPDNRLLRMGVRAHGGF
FT                   TRLSMAFERDIAPVLHQLSGNRVRLVFSNTVGGRWKKLRSYRDAHVEGVVVAPRGNDLM
FT                   VTVTIKGDPRGVRVSTSPGAGVVSLDVGASLAPRRSPPLAQGREGIKVGVEQLITTFDP
FT                   PFKSEIPFTPTDRRVLEAMVPPAEAALIMDGEAALYEGNGSEAAEIFAGIGTNSPGRPL
FT                   ALYRLGEANYLLQKYGDALRFFREAERQWPVFLTRSPSTAFCYADSVARSGDLAGGRRL
FT                   LGSLIAGLADKKYAPALLVRMADILARQGKDQEALAIYRNVADNFTGSKGSWQARMKLA
FT                   DRRLLALEPAAYSSLVKDYLEIYERGTDFGLREQGLFKAALLLSLYGDADQAFARVAEY
FT                   EKKFPRGMYVSIAKGMREELLVPVYRRITRAGDNEALVKLALENRDYLGRVLAEDDFIK
FT                   NLSAAFADLGRIKEEVGLYANLAIREQNRVYAPELYRRILHDAEQLGDPTLMEKAAGEF
FT                   VERFPAHPWVQRFREELAAVEYNRGDFQRVVGRLSGMLASGTRPEYAESLYYLGKSLDA
FT                   SGNRRDAERAMLLFLAELRRREMSSPLAADASYVAATARLSRGDRKGAKEILRAAGEAS
FT                   PEERDPFLYKLGEIARSEGRYEEAAHYLRTVVKEGKDPDWRDMASRLLADMELTGMVRK
FT                   SK"
FT   gene            405249..405668
FT                   /gene="flgB"
FT                   /locus_tag="KN400_0375"
FT   CDS_pept        405249..405668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="KN400_0375"
FT                   /product="flagellar basal body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83238"
FT                   /protein_id="ADI83238.1"
FT                   /translation="MPVDSMFGTTINVLAKAVDLRARNHTMISANLANAETPNYTPKAL
FT                   SFEKELGAALKGNKTGSPATTHPRHIPLKGQAASVQSVEGTVIETPAPTPGRDNNGVEL
FT                   EAEMSRMAENQIMYNASIQILTKKFEGMKYAIKGQ"
FT   gene            405671..406111
FT                   /gene="flgC"
FT                   /locus_tag="KN400_0376"
FT   CDS_pept        405671..406111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="KN400_0376"
FT                   /product="flagellar basal body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83239"
FT                   /protein_id="ADI83239.1"
FT                   /translation="MDFFSAMQVSSSALSAERTRMNLISANLANANSTRTAEGGPYKRK
FT                   DAVFAATQVGEGFRSALDRMRKNAPQGVQVTGIVEDPNPPRLQYDPSHPDADAKGYVAL
FT                   PNVNVVEEMADMIAATRAYEANVTAMQAAKNMALKTLEIGSR"
FT   gene            406217..406519
FT                   /gene="fliE"
FT                   /locus_tag="KN400_0377"
FT   CDS_pept        406217..406519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="KN400_0377"
FT                   /product="flagellar hook-basal body complex protein FliE"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83240"
FT                   /protein_id="ADI83240.1"
FT                   /translation="MIDGIESGLGIAQAFPSVTGEAKPGNLAADGGKFFGELVSKVSEL
FT                   QAQSDTAIKGLVSGESKGLHEVMIAMEKSSISFQFLSQVRNKAVEAYQEVMRMQV"
FT   gene            406544..408127
FT                   /gene="fliF"
FT                   /locus_tag="KN400_0378"
FT   CDS_pept        406544..408127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="KN400_0378"
FT                   /product="flagellar M-ring mounting plate protein FliF"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83241"
FT                   /protein_id="ADI83241.1"
FT                   /translation="MPEALNKLIQPFMALPPAKRWVVGGVVGLSVIAFTILILVANRTD
FT                   YRPLFTNLTSEDAGEIVTKLKEQKVPYRIAADGKAILVPSDKVYDLRLSLASDGLPQGG
FT                   GVGFEIFDRKNFGMTDFVQKLNYQRALQGELSRTISQISGVEQARVHLVIPEKSLFKED
FT                   EKPATASVVLKVKGQRQLRENDVQGIVHLVASAIEGMNPEHVTVLDQKGKLLSKNTPGD
FT                   AAGKMTASMQEVQRAYERSTEERLQSLLDKAVGAGKSVARVSAVFDFRQVERYEEKYDP
FT                   ETVVRSEQRSEEKQDGSTVTGGVPGVQTNLGRTAGQPAGTSGGGSKNDETLNYEVSRAT
FT                   ARTIEPVGTLSKVSVAILVDGKYDAAAAGKDGKEAKPKYTPRSPDELQKIDALVKSSVG
FT                   FNVERGDQVTVVNIPFQDTGDVGAGEADKWWNAPIFLSLLKNGLIGFGFLALLLFVVRP
FT                   LLKTLKPEKSTSFEPIPSAEDALNQIAEIHRLQIGNQTVSQMELINKIKQEPYQAAQII
FT                   QNWLRDKGEE"
FT   gene            408139..409131
FT                   /gene="fliG"
FT                   /locus_tag="KN400_0379"
FT   CDS_pept        408139..409131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="KN400_0379"
FT                   /product="flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83242"
FT                   /protein_id="ADI83242.1"
FT                   /translation="MTGTDKAAILLLYLGPEATSKVFEHLDDDEIKKISKSMATLGHVP
FT                   RNVIQDVVTEYSSLTNPDTGIFSQGEEFVRKILEQTLGPQKAEILLKELQSSSFGDMVD
FT                   VLANLDAKSIANFLSQEHPQTIAVILAKLRAKQTSEIISMLPQGLQAEVVMRIADVDQV
FT                   SPEILADIDEVIKRELTAMGGVQRYKVGGVEKVVDMFNHLDRSKEKQILEKLDTLNPPL
FT                   AEVIRKHLFTFEDIFKLDDRSIQAIMREVSNDTLTLAMKTAPDEIKDKIFRNISSRAAE
FT                   MIKEDLEVMGPVRLSDVEKGQSEIIKIVRRMEEEGKVVLAGRGGDDVLV"
FT   gene            409118..409999
FT                   /gene="fliH"
FT                   /locus_tag="KN400_0380"
FT   CDS_pept        409118..409999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliH"
FT                   /locus_tag="KN400_0380"
FT                   /product="flagellar assembly protein FliH"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83243"
FT                   /protein_id="ADI83243.1"
FT                   /translation="MSSSKASRIIKVDQSPNQAIRSYSFGFIAADAPQELPPEADGFVP
FT                   FALGTPVPLPGLQSAEEPDPDPVVPFNLEGKVVLAEDELQARVDEVFRNGMDEGRRQAE
FT                   RGLANVFKSLRDGVAALTGLRSRVMKESEEDLLRLAVMIARKIVQREVAQDPQVLAAIV
FT                   AAAVGGCTERDRVVVRLNPDDYTQVSANRQAFLAGLGEESAITLAPDESIGPGGCLVET
FT                   ATGTVDARIEAQLDEIYRSLLEERSAPVEPSASPDTDSRADLAFGGEETIAPFKGQGAW
FT                   VKGSEEKPRDDV"
FT   gene            409992..411317
FT                   /gene="fliI"
FT                   /locus_tag="KN400_0381"
FT   CDS_pept        409992..411317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="KN400_0381"
FT                   /product="flagellum-specific ATPase FliI"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83244"
FT                   /protein_id="ADI83244.1"
FT                   /translation="MSRIDLSRYLSAVDAMKPIRFHGKVTQVVGLVIEGFCPDAAVGTL
FT                   CLVHPNDGDPIPAEVVGFRDNKTLLMPLGELRGVGLGSLISVKRKKASLGVGPGLLGRV
FT                   IDGLGVPIDDKGPLAIREEYPIYANPVNPMKRRPIRQPLDLGIRAINALLTCGEGQRVG
FT                   IMAGSGVGKSTLLGMIARYTEADVNVIALIGERGRELREFIEKDLQEEGLKKSVVVVAT
FT                   SDQPPLVRMRGAYIATTIAEYFQAQGKKVLLMMDSATRFAMAMREVGLAIGEPPTTKGY
FT                   TPSVFAALPKLLERTGSFLDGSITGLYTVLVEGDDFNEPISDAMRSILDGHIVLNRELA
FT                   ARAIYPPLDILASASRVMNDVTERSQQQFASRFKELLAAYRQAEDLINIGAYKPGSNPT
FT                   IDYAIAKMDGMVNFIRQGIHDGVSMEQSIAELADIFDEGMAL"
FT   gene            411377..411817
FT                   /gene="fliJ"
FT                   /locus_tag="KN400_0382"
FT   CDS_pept        411377..411817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliJ"
FT                   /locus_tag="KN400_0382"
FT                   /product="flagellar export protein FliJ"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83245"
FT                   /protein_id="ADI83245.1"
FT                   /translation="MTHKHGFQLQQVLNYRKEVEKVKKLEFATARHEFEHATDVLSRHE
FT                   AEADRARVEYNNKQAAGTTANELQLYADFFARKHMDIQFQRIEVDNLNRKMSEKREDLM
FT                   DAAKDKKALELLKEKQMLAFRREMAERERAFLDEMALQKVAR"
FT   gene            411832..412341
FT                   /locus_tag="KN400_0383"
FT   CDS_pept        411832..412341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83246"
FT                   /protein_id="ADI83246.2"
FT                   /translation="MATVMVMSGGPLLAPPVSAPPAGAQPAAGEPQAPAAAAAGKSVVG
FT                   EMALVEAKRQQLAAREAALAVKEQELKNLSAKLEARVKELESAKAALDRSLDARKKVQS
FT                   ANYQKMLKVYKALKPAEAAQLLDKMDEGEVLEILNEMDQKRVAKLLPLMKQERALRWTR
FT                   HSLAAK"
FT   gene            412555..413994
FT                   /gene="fliK"
FT                   /locus_tag="KN400_0384"
FT   CDS_pept        412555..413994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliK"
FT                   /locus_tag="KN400_0384"
FT                   /product="flagellar hook-length control protein FliK"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83247"
FT                   /protein_id="ADI83247.1"
FT                   /translation="MEIMQLLQIAPQVVPTGGIPSEAPAQPAGDDSLFASLFAGLLMPP
FT                   ITTNAATQEVLDASSESLENAARNQDQENPPATDATLASLVPPIPLPLPAEAAPAPEST
FT                   ASSSGTAAAAPVAPVSSPVTTTVAEPPASTMPHAMAQTAPTEAPVAAASSVPAGQTAAV
FT                   ADAGAAEKPVEVLNVAVERTPVRQAGADILPEAEQSPQSVGMTEEATAETRSPVRTMGP
FT                   TAAYPDRIPVRHAEGIPAGKADTVNPVEPRSAEVRADATTGSQVKALDVEVTVRDGSGE
FT                   QHFAEGHEQAFTGKESAAMKDVVSGHATHEAGKSTTAQPTETRSTSESSHSLRDSIMAQ
FT                   VRDAVTTREPNGNGRISIRLNPVELGELTINVRVADQQVKVDVVAANGQVRDILLNNLD
FT                   NLKENFSRQNLTMTGFDVSTGTGQGFEHQLFREGGQAGQGGTHFSFSRGDDLDGDIQAA
FT                   VEDTRRYVTDRRENGLVDVRL"
FT   gene            414019..414675
FT                   /gene="flgD"
FT                   /locus_tag="KN400_0385"
FT   CDS_pept        414019..414675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="KN400_0385"
FT                   /product="flagellar hook capping protein FlgD"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83248"
FT                   /protein_id="ADI83248.1"
FT                   /translation="MVYGVTNDTAAAAAAMKKSTGMNKDDFLKLFVTQLQNQDPLNPQD
FT                   STEFIGQLAQLTQVEQAYNTNSNLSNLLNLVNGATSLSAVSFIGKEITASGDLIKLTSG
FT                   TQPTLGYRLPATAQKVTIKIMDDTDTVVRTLTLGGTQAGDGSITWDGKDEKGNALPDGR
FT                   YTFSVTGTNAEGKDFDGAPLLLGRAEGVMLEGEEPYITIGGINVPLGNILSVKGA"
FT   gene            414683..415069
FT                   /locus_tag="KN400_0386"
FT   CDS_pept        414683..415069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0386"
FT                   /product="flagellar operon protein of unknown function
FT                   DUF3766"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83249"
FT                   /protein_id="ADI83249.1"
FT                   /translation="MIDSIYFPEPLPINPGRSQSQPQPAQPAGKQGEFARILDGKLPTQ
FT                   EVKFSSHAQQRLQSRGITFSDTDLKRLEGAVESVAQKGGRESLIMLGDAALVVSVRNRT
FT                   VITAMDRASMQGNVFTNIDSAVII"
FT   misc_feature    415070..415201
FT                   /note="conserved nucleotide sequence; KN400_R0127"
FT   gene            415232..416491
FT                   /gene="flgE"
FT                   /locus_tag="KN400_0387"
FT   CDS_pept        415232..416491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="KN400_0387"
FT                   /product="flagellar hook protein FlgE"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83250"
FT                   /protein_id="ADI83250.1"
FT                   /translation="MSVTSALYTGISGLNANGEAMSVIGNNISNVNTIGFKQGRMLFSD
FT                   VLSSTISGGSQIGRGVQIQTVENQFTQGSFESTESGTDLAIQGDSFFVVQNTSGRYYTR
FT                   AGAFSFNKDKTLVNPEGYQVMGYGIIPSSGLSDGVLKPIDLTNFATTPPKQTSTVKFVV
FT                   NLDSTQTTPTLAWDPANPVATSNYSTSLSVYDSQGNAHTATVYFRKTADNAWDWHVILP
FT                   DAAAGTPGSTTTPIDGTLTFDATGALTAQTPLAGAAQNITFAGGVTAPQPIFFDLGVGA
FT                   TTQYASSSVVSSQTQDGYYQGTLTKVTIDDKGYVNGVYSNGQLQKLYQVALAKFSSTAG
FT                   LSKAGGTLFEETLESGQPLFSDASTPGVGKILANSLEQSNVDMAAQFVKMITTQRGYSA
FT                   NSKTITTADEMLQEVLSLKR"
FT   gene            416862..417383
FT                   /gene="fliL"
FT                   /locus_tag="KN400_0388"
FT   CDS_pept        416862..417383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /locus_tag="KN400_0388"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83251"
FT                   /protein_id="ADI83251.1"
FT                   /translation="MAADEKAPVEGAPKDKKKLFIIIGAAAVVIIALAVVFLGGGKKEK
FT                   GKEGEAEAKVEQKAEGGHGGGKEGAAGAVATAFALEPFIVNIYDGQELRYLRVKVEFET
FT                   ATPDAKAEIESRQAPLRDAILVLLTTKTLQDIQDLQGKNQLRDEILVAANKILPPGKVT
FT                   KVYFTDFVVQ"
FT   gene            417418..418404
FT                   /gene="fliM"
FT                   /locus_tag="KN400_0389"
FT   CDS_pept        417418..418404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="KN400_0389"
FT                   /product="flagellar motor switch protein FliM"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83252"
FT                   /protein_id="ADI83252.1"
FT                   /translation="MEKILTKQEIEALLAAVFEGKIEPDRELAKEEGTVHSYDLFNSEA
FT                   HKGLVPNLDIIYDGFIRYQRGTLSNRLGRIVEIKKLGAGSYKFDDFIQTLPSPVCMAIY
FT                   KADPLKGAALIAFDSTLVFTIVDCILGGTGMTSVQTSANRMFTSIELRLVQKIVQDMLV
FT                   DLEKAWAPLYAAKMSLLRMEMNPRLVNIVPPEYQVVTMEMQIQIDQLEGKMVFAVPYMT
FT                   IEPIRDKLKSGAQFDLMAIDPQWSFRLSKELLEAPLDVSVEVGGAVISLNDLLSLVPGD
FT                   TIMLDTPCTSDLTVKVGGVPKFTGMPGIRHGNKALQITNVVGKGEQR"
FT   gene            418401..418706
FT                   /gene="fliN"
FT                   /locus_tag="KN400_0390"
FT   CDS_pept        418401..418706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="KN400_0390"
FT                   /product="flagellar motor switch protein FliN"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83253"
FT                   /protein_id="ADI83253.1"
FT                   /translation="MSDFTKEETKDGELDRKNLEFILDIPLQLTVELGRTKILVKDVLQ
FT                   LNQGAVVELTKLAGEPLDVFVNSKLVARGEAVVVNEKFGVRLVDIVSPNERVEKVL"
FT   gene            418703..419200
FT                   /gene="fliO"
FT                   /locus_tag="KN400_0391"
FT   CDS_pept        418703..419200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliO"
FT                   /locus_tag="KN400_0391"
FT                   /product="flagellar biogenesis protein FliO"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83254"
FT                   /protein_id="ADI83254.1"
FT                   /translation="MKQPASVTALALAVPGVARAAEAAGGANFSFATVFIQMLASLSLV
FT                   LGLIYLAYYAANRWFRPGVHGKGTERHIRLVETRYLAPKKSLVLVEVGGEFLLLGSSGD
FT                   TLSFIKQIDILEEIEVLDETTGRTPLATLFQGKLDAVTTRLAAMKQGRADVPERRAGEG
FT                   KA"
FT   gene            419206..419973
FT                   /gene="fliP"
FT                   /locus_tag="KN400_0392"
FT   CDS_pept        419206..419973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="KN400_0392"
FT                   /product="flagellar biogenesis protein FliP"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83255"
FT                   /protein_id="ADI83255.1"
FT                   /translation="MDGVPIFKRIPFIALCVILLTASLAAAAEPLALPSVSIGVGKATK
FT                   PGDVSVVLQIFFLMTVLSLAPGLLMMTTSFTRIAVVLSFLRHAIGTQQAPPNQIIIALS
FT                   LFLTFFVMAPVWQQVNTQAIQPYRAAQITQDEALKRAVAPMRKFMLSQTREKDLALFLN
FT                   LSKLPRPRTADDIPTLTLIPAFMISELRTAFQIGFLIFIPFLVVDMVVASVLMSMGMMM
FT                   LPPVMISLPFKILLFVLVDGWGLVIGSLIKSFG"
FT   gene            419986..420255
FT                   /gene="fliQ"
FT                   /locus_tag="KN400_0393"
FT   CDS_pept        419986..420255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="KN400_0393"
FT                   /product="flagellar biogenesis protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83256"
FT                   /protein_id="ADI83256.1"
FT                   /translation="MSPDLVVQLARRSFEVTLMLAAPLLISGLVVGLAVSIFQAVTSIQ
FT                   EATLAFAPKIIAVMVALVIFFPWMMNYMSDFTREVYALIATMRR"
FT   gene            420306..421100
FT                   /gene="fliR"
FT                   /locus_tag="KN400_0394"
FT   CDS_pept        420306..421100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="KN400_0394"
FT                   /product="flagellar biogenesis protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83257"
FT                   /protein_id="ADI83257.1"
FT                   /translation="MFPLTTPFPTANDVAFFTLVMGRMAGIFAAIPIFGGRRVPTPIKA
FT                   LLVFAMTMVCFPIIKEKMPQLPTDVLSLGFLMVQEVLVGVSLGLLSLIIFAAVEFAGQI
FT                   VSVQIGLTIVTEFDPSQGGQLSIMSIILEMLATLLFLSLGMHHIFIGALVQSYDVLPLG
FT                   AWHMSGALLQFIVTTIGEVFVLAVRLAAPVMVTLLATSVMLGIMARSFPQMNVFFVSMP
FT                   LNIGIGFIVLGLSLPLFLHTVQGHFGLLDEQLKTMMKLMGKG"
FT   gene            421105..422163
FT                   /gene="flhB"
FT                   /locus_tag="KN400_0395"
FT   CDS_pept        421105..422163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="KN400_0395"
FT                   /product="flagellar biogenesis protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83258"
FT                   /protein_id="ADI83258.1"
FT                   /translation="MSDDKHSKTEKPTAKKLDEAKKKGVPHSRDLTSTVTLIAAMVALY
FT                   TTGGFMFTTLKRTSGELLGSMGTFHLTEASVEHLLIKLFLVFLSVVMPFMLVVVISGLA
FT                   TTMVQVGFSMNSERITFKLDKLNPVTNAQKLFNKDSLVEMLKAVLKIVIVGYMSYKIMR
FT                   DEMDGLLFLADTDLAGILEVFKHLAFKLVIHTCGVLLILGVLDLAFVKWRFIDNLKMTK
FT                   QEVKDEHKESEGDPKVKGKIRQMQFQQAQKRLRKVIPTADVVVTNPTHYAVALKYERET
FT                   MAAPLVLAKGVDHMAQTIKAIARENNVMLVENRFLARELYAQVKEGQPIPESLYTAVAE
FT                   VLAYVYSLKGKI"
FT   gene            complement(422222..422692)
FT                   /locus_tag="KN400_0396"
FT   CDS_pept        complement(422222..422692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0396"
FT                   /product="bacterial SH3 domain lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83259"
FT                   /protein_id="ADI83259.2"
FT                   /translation="MTLIRLQSRMLIPSLALVVPLLAACTTVTEERGGPQAPGIGFEEA
FT                   PAVVDRTDRQHAPPTPMVQPPPPQAPLPQPPEPPATPAVAVPASLRIGPEHKYVNVRRG
FT                   SSPRTKVVAVLKGGTQLELLGKEGSWLRVRWQHGGKTAEGWVYRKFVEGNGL"
FT   gene            422979..423533
FT                   /gene="tssJ"
FT                   /locus_tag="KN400_0397"
FT   CDS_pept        422979..423533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tssJ"
FT                   /locus_tag="KN400_0397"
FT                   /product="type VI secretion system outer membrane
FT                   lipoprotein TssJ"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83260"
FT                   /protein_id="ADI83260.1"
FT                   /translation="MKRHSALLPCWSVVACLCSCASSPEVRPPVEWGFEREAIHLSLTG
FT                   DPRLNLYQNSPHALVACIYQLRDPNAFNQLRNEPDGPARLLECSRFDQAVATARRVVIQ
FT                   PGQVLNDVLDRAEGARYVGFAAGYYLLDKERSVRLYPIPISEETKGFVSRTKLVKPGRV
FT                   DIRLHLGPQEIQDVKEEPRKP"
FT   gene            423530..424921
FT                   /gene="tssK"
FT                   /locus_tag="KN400_0398"
FT   CDS_pept        423530..424921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tssK"
FT                   /locus_tag="KN400_0398"
FT                   /product="type VI secretion system protein TssK"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83261"
FT                   /protein_id="ADI83261.1"
FT                   /translation="MNAHPPLYWHQGLFLQPHHFQLQDLSVQGRLAPLFRHLHPHFWGA
FT                   GELEIEASALGTRVFSILSGEFLFPDGTWAVIGENALCEPRSFDDSWIEGDRPLPVYVG
FT                   VRKWSGDRENVTVTERLENLGGITTRFAAAADPEEMRDLHAGGPAGQVKRLRHVLKILW
FT                   DSERDQLGDWHLIPVARLERFGADVRLSGRFIPPCLSLEASEPLFRIVREIRDQVAARA
FT                   RQLEEHKKQRGIQNAGFGSRDMVYLLALRSLNRHVPLLFHLTEARQVHPWDVYGALRQL
FT                   IGELSSFSERVSALGKLDDGVRLLPPYDHRALGERFFVARDLIARLLDEITAGPDYVIR
FT                   LTHDGTFFSADLKPGIFETGSRYYLALRTTTEPAAFLPSLEAAAKLSARNHLPVLAARA
FT                   LPGIGLSHLPVPPQELPRRADTHYFAVDTAGDQWPLVEREHALALHWTGAPADLEVELM
FT                   VVAKG"
FT   gene            424925..425332
FT                   /gene="tssE"
FT                   /locus_tag="KN400_0399"
FT   CDS_pept        424925..425332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tssE"
FT                   /locus_tag="KN400_0399"
FT                   /product="type VI secretion system needle hub protein TssE"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83262"
FT                   /protein_id="ADI83262.1"
FT                   /translation="MREERLLERIRSLERDPSRRGGTDRGRLVDSILAHVRRIINTRRG
FT                   SVPIAPDFGIPDMLDVLQSYPDSVREIERSIRAAIQGFEPRLADVRVAFVPQEDDVLAL
FT                   RFAISARLGSDGGAVCFETLVDTDGKVTVRR"
FT   gene            425361..427094
FT                   /gene="tssF"
FT                   /locus_tag="KN400_0400"
FT   CDS_pept        425361..427094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tssF"
FT                   /locus_tag="KN400_0400"
FT                   /product="type VI secretion system protein TssF"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83263"
FT                   /protein_id="ADI83263.1"
FT                   /translation="MITRHFQDELARLKELGAEFSVTHPALAPMLGGPSTDPDVERLLE
FT                   GVAFQTALLRQKLDDDFPEVVHDLVRLVAPHYLRPVPATTIVAFEPKPSLTRSRLIPAG
FT                   TELASIPVEGTRCLFRTTSPVELHPLELLEATFAQPAGSAPVVTLSLSLTGLSLDHWEP
FT                   RSLRFFLAGDHAPAAELFLILSRHLKRIVITPEERGASASLPAACLQPVGLNDDEHLIP
FT                   WPSHAFPGYRLLQEYFAAPQRFLFLELTGWERWTTRGSGSRFTITFELGELTIPPPPVR
FT                   RDSFVLFASPAVNLFSHDAEPILLDHRVGRYPVRPAGLEPGHGQVYSVDRVTGIVRGAA
FT                   TERIYHPFEQFRDGADAQPTFHTAVSASPVRAGFDVHLAVAYPQGEGLPETETLSIALT
FT                   CSNGRLPENLWLGDLCEPTSSSPESATFHNITPLTPTLLPPLGKNLLWRLVSHLSLNRL
FT                   SLASADNLRTLLALYLFEEGGDRGDLAANRKRLDGIEAVIAKPAGRLVGGHLLRGSEIV
FT                   LTLRGDHFASPGDLFLFGAVLDRFLGGYASLNSFTRLTVRESVRGEVYSWAPRLGHRQL
FT                   L"
FT   gene            427058..428050
FT                   /gene="tssG"
FT                   /locus_tag="KN400_0401"
FT   CDS_pept        427058..428050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tssG"
FT                   /locus_tag="KN400_0401"
FT                   /product="type VI secretion system protein TssG"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83264"
FT                   /protein_id="ADI83264.1"
FT                   /translation="MGSPPWSPPASLETQLFERGHEFSFAQAVRLLRLLAAAQGREGAC
FT                   PCGVRVRPELSLSFPVADVARIERQSDGYRITARFLGLYGPSSPLPTFYTEELIDEERE
FT                   DGSASRDFLDVLSHRIFDLWVAGDAKYRLFNRVVEDGSGDDLERLFCLAGLDLAQGQTV
FT                   LPESGRWLRYVGLLGQVPRSALGLRTMVADALGVPVEVIPCQHRQVSIPPGQRLAVGIA
FT                   ASSLGIDTVVGTNLDDRLGMFRLCLGPLSREQFADLLPGAPGRSTLDLIVELYLDAPLA
FT                   WDVELTLAPGETPEARLGACRGARVGWDTWLGVAAGESLPCVVFPGHFP"
FT   gene            428063..430690
FT                   /gene="tssH"
FT                   /locus_tag="KN400_0402"
FT   CDS_pept        428063..430690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tssH"
FT                   /locus_tag="KN400_0402"
FT                   /product="type VI secretion system ATPase TssH, putative
FT                   chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83265"
FT                   /protein_id="ADI83265.1"
FT                   /translation="MLTVDLTALLKRLNPLCTRVLEGAAGLCVARGHYEVTVEHFLARL
FT                   LDEAGGDLVAVLRNSNIDASPLKIGVVRVLDELPTGNGGRPVFSPILLEWLQAGWLTAS
FT                   LDLNEERVRSGALFAALLARPLRFAAGRYVDQLMPVGREGLLSGFSRAVSGSEENSCMG
FT                   GDTASVAGPGRDGTALSRFCTDFTARAAEGGMDPVFGRDREIGRMIDILARRRKNNPIV
FT                   VGEAGVGKTAVVEGLALRIVEGEVPEALREVRLLGLDLGLLQAGAGVKGEFESRLKSVI
FT                   EEVKGASRPVILFIDEAHTLIGAGNQAGGGDAANLLKPALARGELRTIAATTWSEYKKY
FT                   FEKDAALARRFQPVKLDEPSVETAVLILRGLKDTYEAAHGVTIRDDAVRAAAELSSRYL
FT                   SGRQLPDKAVDLLDTAAARVKLLLTGKPGRVEEAERRIQALEREEAALRRDRLQGRPED
FT                   EGRLAVLKEELALLREELAAVTARWHRERELAGAVVALRNEAAEGRDAGGDAVGLKMAE
FT                   PAAKLAEVQGDEPLVRIEVDPEVVAQVVADWTGIPLGRLRKDRTAGVLALEEGLRRRIR
FT                   GQEPALAAVAEVLRSSAAGLKDPRQPLGVFLLVGPSGVGKTETAVAVADLLFGGERFLT
FT                   VINMSEFQERHTTSRLIGSPPGYVGYGEGGVLTEAVRRSPYSAVLLDEVEKAHPDVLNL
FT                   FYQVFDKGMLADGEGRVIDFANTVIFLTSNLAADVVVSRCAEEPQPTTEELAAAIRPHL
FT                   ARHFKPALLARMTVVPYLTLAPDSLEEIVGLKLGRVAERLRENSRTELAWTPAVAARLA
FT                   ARCSEVESGARAIDHILRGTLLPLLSREILARIGGGEELEAIRLDVAADGSFTVGCGDG
FT                   AAVR"
FT   gene            complement(430700..431704)
FT                   /locus_tag="KN400_0403"
FT   CDS_pept        complement(430700..431704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0403"
FT                   /product="thiamin biosynthesis protein ThiI-related adenine
FT                   nucleotide alpha hydrolase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83266"
FT                   /protein_id="ADI83266.1"
FT                   /translation="MKRKALALLSGGLDSTLAVKVMLEQGIEVEALNFTSPFCTCTGKN
FT                   AGCKSEAIRVAEEFGIPIKVMHKGVDYLEVVRAPRHGYGKGMNPCVDCRIFLLRKAKEY
FT                   MAESGADFVITGEVLGQRPMSQRRDTLRVIERESGLEGLLLRPLSAKHFEPTRPEREGW
FT                   VDREKLLAIQGRSRKEQMQLAEDLDVKNYPCPAGGCLLTEVSFVSKVRDVFDHSDQLNL
FT                   RDFRLLKVARHFRVGPRTKVLIGRNEAENELLSHHVQPGEAAIRWLDGSSPLGVLMGTV
FT                   DDVLLETAAKVLLRYTKAEPGSDCRIKVTVDGSEQMLTVSHTFSETCIEQYRV"
FT   misc_feature    complement(431710..431788)
FT                   /note="conserved nucleotide sequence; KN400_R0128"
FT   gene            431878..433527
FT                   /locus_tag="KN400_0404"
FT   CDS_pept        431878..433527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0404"
FT                   /product="PilB/PulE/GspE family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83267"
FT                   /protein_id="ADI83267.1"
FT                   /translation="MESIVKEGSLGSILFKCQIISEDDIRRALDEQERTGGRFGEALVS
FT                   LGIVTQEDIDWALSNQLNIPYVRLKPAMVDRDAVALVPAVMARQHNLIPLIRAGEELSI
FT                   AIADPLNVAAVAAVEKETGCAVSVSVALIREIREMQERFYGPPDTEERLGFTSSAFPPQ
FT                   ALAAMNHDLTGGKFIDYLLLFVAQQKLSSLSLHPLGDRVSVIGRRGGTTREVGQLAPSR
FT                   YPDVVMHVKKLAHIDGARFSARGGLSFALKGRSIPFQVATLRGEGGDHLTFRMTVAALF
FT                   PTSLADLGLTDDQVRQFADLAAAGRGMVVTGARDREIRRRLTDLYLQEHEAEGKTVLVV
FT                   GSGAGTGEQRFPRIPVPSDADLSAVVSACLEHDPDILVLEDVTDGQAFAAACRATLRGK
FT                   LVVAGIGCGDAVGALDQLIAFRDMHVLVPAYLRGVITCTPIRPLCPACRRSEPFPAAER
FT                   AALGIGADVTSCWRSAGCESCDQTGHDGRRYLLDVLVLDHDLRERFEAARNGAEVIEHL
FT                   RGQGWRGITDERQTLLAEGTISLEEYASSLHG"
FT   gene            433541..434611
FT                   /gene="pilT-3"
FT                   /locus_tag="KN400_0405"
FT   CDS_pept        433541..434611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT-3"
FT                   /locus_tag="KN400_0405"
FT                   /product="twitching motility pilus retraction protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83268"
FT                   /protein_id="ADI83268.1"
FT                   /translation="MARIDALFKLLKEQGASDLHLSSGAPPIFRLHGEMARQNFKVLSH
FT                   EELTAILYEILTDKQKADFEERRDLDFAYAIPGLARFRGNYMMTHRGIAAVFRIIPSKI
FT                   LSADDLSLPDGVRRMTQFKKGLVLVTGPTGSGKSTTLAAMIDLINATRKEHILTLEDPL
FT                   EFIHENKMSLLNQRQIGEHSLSFSAALRAALREDPDVILVGEMRDLETIGLAMSAAETG
FT                   HLVFGTLHTNSAAKTIDRIIDVFPTDQQEQTRAMLSESLKGVVCQQLLKTADGKGRVAA
FT                   LEIMLGTPAIANLIREGKTFQIPSIIQTAKRDGMQLMDQHLLDLFKTKRITAEEAYRCA
FT                   QDKKQFEQYLAEKPGQ"
FT   gene            complement(434641..435075)
FT                   /locus_tag="KN400_0406"
FT   CDS_pept        complement(434641..435075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83269"
FT                   /protein_id="ADI83269.1"
FT                   /translation="MREQLSRRYLKTFACGTAHKFASSAVHYAWLAHHYGIARVTIDLL
FT                   ALTIEPPEFNIRRNRILAGQCRDSLLCNAKRLKPPGAVTAATLAAEFGVHEHGVDDRFE
FT                   WIGPSTFTVILTDDRGKEWRGKITLDRVLAQGDGVGDPNR"
FT   gene            complement(435308..435859)
FT                   /locus_tag="KN400_0407"
FT   CDS_pept        complement(435308..435859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83270"
FT                   /protein_id="ADI83270.1"
FT                   /translation="MVVSRKTESYQPGMTVRHERLGLGKVVAVEGSGIVSVRFDSWGTK
FT                   HFDPLSEPMAPLTENELREQLEVAVSRWEEAIPWLEQGWDCIEEYTNDLTAREILDDAI
FT                   DGYCGMPLPHDLAERIERADARFRAATEESELCVWHPEKPYPYGESAPYAPDRQWYYFR
FT                   WPPDAPYRFRKHDSTAARNE"
FT   gene            complement(435934..436857)
FT                   /locus_tag="KN400_0408"
FT   CDS_pept        complement(435934..436857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0408"
FT                   /product="HNH endonuclease domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83271"
FT                   /protein_id="ADI83271.2"
FT                   /translation="MRRPKENEPELLRRKLVTLLSNFESELKQEDLRRKVLALVPAHHL
FT                   LRDLGSSLIPRDVASAARDRLEQYFLKYPRTVLTGDELMVIAGIGEWARRVRELRVEAG
FT                   YAIVTGIMIKEMKSVDDLPKSEFGKLKPDDYVLLSSEYDRDAAFRWKLANRIRKKNNLS
FT                   MRDKILEFLRANVGKQVTGEELRYVAGNKTEWARRVRELRTEQGWPVVTKTTGMPELPI
FT                   GVYMLVEDKQAEPHDRVIPDNIRRAVLMKSGYKCADCGWHQELWNPSDPRHLELHHMEM
FT                   HMEGGTNTEENLVAVCNVCHDVRHRT"
FT   gene            complement(437191..438477)
FT                   /locus_tag="KN400_0411"
FT   CDS_pept        complement(437191..438477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0411"
FT                   /product="DNA cytosine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83274"
FT                   /protein_id="ADI83274.1"
FT                   /translation="MAKNNQIKDLPIVAEEEEIYSARVHGRLSPEKFSPRVIDLFCGAG
FT                   GMTLGFTKFTNHVFTPVWANDFNAYAARTYNRNFGNHCVVGDIVEILERPETVIPKADV
FT                   VIGGPPCQGFSLLNKFRNGDPRKQLWRPFMEVVKRSGASVFVMENVPQLLESHEYVEIK
FT                   HVAHEMGFQIRKAKLCAADYGVPQIRWRAFIIGCSFTNPAAVFPPKKTNFKPNNGYRKA
FT                   FSEEFDSYTENPHIWKTVRDAISDLPEPVGTEVRDAIPPLDLHFGRTPTPTSIARYKAI
FT                   PEEGMNRFDLQRFAPHLTPACWIRKTSGGTDLFGRLWWDRPSVTIRTEFFKPEKGRYLH
FT                   PVQNRPITHREAARLQSFPDDFTFLGTKVEIAKQIGNAVPPLLAARIADAVYALLLTKG
FT                   IHECRTSSARKNEAGLCPEFQEAIQSLRL"
FT   gene            439030..439106
FT                   /locus_tag="KN400_R0007"
FT   tRNA            439030..439106
FT                   /locus_tag="KN400_R0007"
FT                   /product="tRNA-Pro"
FT   gene            439356..440771
FT                   /locus_tag="KN400_0412"
FT   CDS_pept        439356..440771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0412"
FT                   /product="UbiD family decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83275"
FT                   /protein_id="ADI83275.1"
FT                   /translation="MANGDLHDFLAELERLGDLHRVAAEVDPVLEVAAITDRVSKLPGG
FT                   GKGLLFERVKGSRFPLVTNVFGSAGRVAAALGAATLDDLTARMESLLAAVPPAKTASPL
FT                   EAMASLAEMRRFAPMIVEKAPCQEVVEAPDLLRYPFPHSWPGDGGRFITLPLVVTRDPE
FT                   TNTPNCGMYRVRVVDGASAGIRWYAGKGGELHCRRHRERGERMPVAVAIGGDPAAILAA
FT                   ILPLPEGFDEMLFAGFLRGRPLELARCRTSDLLVPAGAELVLEGYVEPGETVMDGAFGN
FT                   HTGFYAPAASVPLMRLTCITRRADCLCPATVVGRPPMEDCYLAKAAERLLLPVLRMRWP
FT                   EIVDINYPLEWIFNGGAVLSLRECSSSRVRRIVTELWSSGLAGPGRLLVAVDEGTRVDD
FT                   PADVAWRAMNAVDWRTDLIIAERDAAAAWPGLGSRLAIDATRSAARRYGAEELVPDRET
FT                   ARRVDSRWREYGF"
FT   gene            440771..441301
FT                   /locus_tag="KN400_0413"
FT   CDS_pept        440771..441301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0413"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83276"
FT                   /protein_id="ADI83276.1"
FT                   /translation="MMFRLGWGILVCLFLALAAGCYHLRLEPAALPVQRAVTARSAADV
FT                   FDRVRDVLVQDGYAVERDERRDNGEGGVITCGYRHFSTRAGGISQPVGGRLYYHRLMIT
FT                   VNGGEEGAEILMESTGLEIRSSYVYEEGGAVRSFAKRYPYEQYPGMFDLKAVDRELARV
FT                   RGMLEAALRQGER"
FT   gene            441301..442197
FT                   /locus_tag="KN400_0414"
FT   CDS_pept        441301..442197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0414"
FT                   /product="menaquinone biosynthesis polyprenyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83277"
FT                   /protein_id="ADI83277.2"
FT                   /translation="MVSEEGLEKGMFAKIRVFLEMIKFSHTVFALPFAFTGAVLAADGM
FT                   PSAHQVFWILMAMVGARTAAMGMNRLIDAEIDARNPRTASRAIPAGLIGTGTVALFIVL
FT                   SILLMLYAAWQLNPLCLYLSPVALFFLGLYSYCKRFTSLAHVVLGICLAAAPLGAWIAI
FT                   RGTVEVPAILLGLAVLFWVAGFDILYALQDLDFDRASGLHSIPVRLGVNGSLWAARVFH
FT                   LVMLGLLAGLYLSAGLGPWFLAGLAATIAMLGYEHWLLRHGDLTKLDAAFFTMNGYISI
FT                   TLFVATLADVLAGRGGV"
FT   gene            442194..442817
FT                   /locus_tag="KN400_0415"
FT   CDS_pept        442194..442817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0415"
FT                   /product="menaquinone biosynthesis decarboxylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83278"
FT                   /protein_id="ADI83278.2"
FT                   /translation="MSGRHVVLAITGASGAVYGLRLGRELLAAGCRLTLLISRPGFTVI
FT                   REECGLDWGDWPHETLGALEEYFRPAPGMLAYYTEDDLMAPVASGSRAPDAMVVCPCSM
FT                   GSLARIAAGLSSTLTERCADVTLKEGRPLVLVPRETPLSAIHLENMLKLARLGVRIVPA
FT                   MPGFYHEPRTVDDLVGFVVGKVLDALQIPHELFTRWGDVSRVEE"
FT   gene            442822..443907
FT                   /gene="mqnC-2"
FT                   /locus_tag="KN400_0416"
FT   CDS_pept        442822..443907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mqnC-2"
FT                   /locus_tag="KN400_0416"
FT                   /product="dehypoxanthinylfutalosine cyclase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83279"
FT                   /protein_id="ADI83279.1"
FT                   /translation="MSISLATISGRVHAGERISDEEALFLFESRDPLAVGELAAAVNRR
FT                   RNGDRVFFNVNRHINHTNICVNRCSFCAFYRAADELGAYLYDLEEIRNRAAEAHAQGAT
FT                   EIHIVGGLHPDLPFDFYLAMLRTVKEVSPDLHVKAFTAVEIEYLSRLAGLSTAETLTVL
FT                   KEAGLGSLPGGGAEIFAPAVRNRLCPEKISGDKWLAIMEEVHRAGLKSNATMLYGHIES
FT                   YADRVDHMRRLRELQDRTGGFQVFIPLAFQKDNNPLGHLKRPGPGGVDALLTLAVARIY
FT                   LDNFANIKAYWVMLGVKIAQTSLAFGVNDLDGTVVEEKIGHDAGAASPQTMGRDEIVSL
FT                   IRTAGRVPVERDTLYNELRVY"
FT   gene            443907..444971
FT                   /gene="mqnC-1"
FT                   /locus_tag="KN400_0417"
FT   CDS_pept        443907..444971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mqnC-1"
FT                   /locus_tag="KN400_0417"
FT                   /product="dehypoxanthinylfutalosine cyclase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83280"
FT                   /protein_id="ADI83280.1"
FT                   /translation="MPIRAMEKATAGKLLTRAEALSLLTEGDLLALGRLADAVRRRMHP
FT                   ENLVTFVVDRNVNYTNVCESKCKFCAFYRDEAAPDAYLLAEEAIFAKIAELVEHGGTQL
FT                   LMQGGLHPQLGIDWFEDLFRGIKARFPQVQNHSLSPAEITQIATVSKLTIPETVRRLRE
FT                   AGLDSIPGGGAEILVDSVRQEISPRKIGWEGWAAVMSEAARQGMATTATMMFGSRETPE
FT                   DIVEHLFRVRELQAAGGSFTAFIPWTYQPGNTELGGTGATGVEYLKVLALSRIVLDNIP
FT                   SIQASWVTQGAAMAQVSLFFGANDLGGTMLEENVVAAAGCTFRMSREEMVELIREAGFR
FT                   AAQRTTLYSIVREY"
FT   gene            445138..446283
FT                   /locus_tag="KN400_0418"
FT   CDS_pept        445138..446283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0418"
FT                   /product="ribonuclease D, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83281"
FT                   /protein_id="ADI83281.1"
FT                   /translation="MPLLPVSPEIITTVDGVRRLADRLGREPIVACDLEADSMHHYQEK
FT                   VCLIQFAVPGYAAIVDPLAAPDISPLAPLFANAAIRKVFHGADYDIRSLHRDFGMEVNN
FT                   LFDTMIACQLLGEREFGLAAQLRKRFGVELDKQYQRADWSRRPLTPGMIEYAVKDTTLL
FT                   IELCWQLATDLEAKGRRGWVEEECELLSRVRVAERGDEPFFLRFKGASRMDGRTLAVLE
FT                   ELLAFRDGRARQVDVPPFKVLGTDTVRELAERRPRLPEELQGITGLTDKVAARHGEGIL
FT                   RAVERGCAVPAQQLPAYPREERRKMERGEEERLKRLKEWRAEQAGRLGIEPGYIANNAL
FT                   LELVAVNAPRTMGDLEALPPMRCWQRSEFGEQILSAVSPRR"
FT   gene            complement(446433..447158)
FT                   /locus_tag="KN400_0419"
FT   CDS_pept        complement(446433..447158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83282"
FT                   /protein_id="ADI83282.1"
FT                   /translation="MKCPKCGYNSFEFLDNCKKCSHDLSAFKQTHGIRAVVLPLAGLTV
FT                   AAPAVAVAAPSAANAANAEESFTWEVPAAPESFKPGDDIFSDLDLGLSPSPAPAEPASA
FT                   GLDLGDFSFDDTPAAPAVPAPSTTDADAGTDDFATLLETGDNSEITAAAPGAAQVPEME
FT                   SPWEVPTDSFGGFGDTPAPAAEPAASGDFDLESFSWDDKETKTETPPAAPKGPEAGVES
FT                   FPGTDFDSLFGDAGEDEKK"
FT   gene            complement(447198..447980)
FT                   /gene="rsmE"
FT                   /locus_tag="KN400_0420"
FT   CDS_pept        complement(447198..447980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmE"
FT                   /locus_tag="KN400_0420"
FT                   /product="16S rRNA (3-methyl-U1498)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83283"
FT                   /protein_id="ADI83283.1"
FT                   /translation="MRRFIVTGLDLSGKNVVVRGDLFRHMARSLRLKIDTEVILADGKE
FT                   AECTGVITAMGRDSLTVTISERRQIRGDGDGLWLTLCQGLPKGDKMELILQKSTELGVS
FT                   EVVPFLAERSVPRISPEREQERLRRWQRVAEEAARQAGCPAVPRVQLARGLTEAVRGTD
FT                   HDLKLLLWEDERTTTLAGVLAAAQTPKRIAVVVGPEGGFTAAEAAEAREAGFVPVTLGR
FT                   RILRTETAGIALVAILQYLYGDLGSGPHPRPAPAQPIP"
FT   gene            complement(447983..448882)
FT                   /gene="prmA"
FT                   /locus_tag="KN400_0421"
FT   CDS_pept        complement(447983..448882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="KN400_0421"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83284"
FT                   /protein_id="ADI83284.1"
FT                   /translation="MDKQWAEVCCQVPAGLVDLLADFLVELSGNGVSIDNRALDTFTLD
FT                   GIEELDTATVRAYFDPATDMAGQIAQIERFLGDNAAAFGGAPIPAPTVTLIRDEDWATG
FT                   WRQHFVPTRIGRHLVIKPTWEPFAPEPGDQVIELDPGMAFGTGTHPTTRLCLEALETLG
FT                   RPDRVLDVGTGSGILAIAAVRLGARQVIGTDIDPDAVIVAGENCALNGVEVELVTTPLA
FT                   LIPGRFDVVLANILAEDLVRMAGDLAAKVAAGGHLILSGILTEREAFVVEGFGRSGLAL
FT                   VAVSREGEWSCLVYRNEG"
FT   misc_feature    complement(448933..448977)
FT                   /note="conserved nucleotide sequence; KN400_R0129"
FT   gene            449027..450190
FT                   /locus_tag="KN400_0422"
FT   CDS_pept        449027..450190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0422"
FT                   /product="zinc-dependent amidohydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83285"
FT                   /protein_id="ADI83285.1"
FT                   /translation="MDLEQIKQELVAFVDARRDDFIHVSEELFHNPETGLNEVRSAALL
FT                   ADRLEAEGFRVARGVAGLPTAFRADSGEKGPTVGIIAEMDALPGLGHACGHNVIAAAAL
FT                   GAAIALRRVLPADAARLVVLGTPAEEIGVGKVEMIRHGIFDDVEFAMMVHPSSRRYVIK
FT                   HYLGLAKIRFVFLGKPAHAAAYPEEGINALDGVIQAFNAVNALRQQLRQDVRVHGIIPE
FT                   GGVAPNIIPERASAFFYVRADDMAELERVRERVIACARGAATATGCRLEIEEDPRVMAP
FT                   LKVNYRFSDLYAEQLAYLGLELSESRPDRNKGSSDIGNVSQIMPTIHPHVPIGEGINIH
FT                   SDAFARATVSAQGKAAVVEGATALALTAAELIARPELREEILCEFRR"
FT   gene            450327..451136
FT                   /locus_tag="KN400_0423"
FT   CDS_pept        450327..451136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0423"
FT                   /product="ADP--[pyruvate phosphate dikinase]-threonine
FT                   phosphotransferase and [pyruvate phosphate
FT                   dikinase]-phosphothreonine--phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83286"
FT                   /protein_id="ADI83286.1"
FT                   /translation="MKRSIKHIYLLSDATGETVERVVRAALSQFRDVEARFHRVTRIRS
FT                   REDVIWALEEVLREPGMVVYTLVDTELAQLLRDEAEAHGLDAIDLISPLLFKLSDFFGE
FT                   APQKEPGLLHQINSEYHKRVDAVDFTVKHDDGQDPRGLAKADFILVGVSRSSKTPLSMY
FT                   LAHKGYKVANVPIVKGIDPPPELYKVDQKRVVGLIIDAERLVQIRTARLRNLGQMPKGS
FT                   YADYERIEEELEFCRRLYRRNPQWLVIDVTKKSVEESAAEIIQKLAG"
FT   gene            451184..451858
FT                   /locus_tag="KN400_0424"
FT   CDS_pept        451184..451858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0424"
FT                   /product="winged-helix transcriptional response regulator"
FT                   /note="domains: REC, trans_reg_C"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83287"
FT                   /protein_id="ADI83287.1"
FT                   /translation="MKVLVVEDEKKVSSFIKRGLEEEKYEVDAAFNGEEGLKMALDKGY
FT                   DLIVLDVMLPKKDGLSVVRELRERKNSTPVLMLTAKDSVEDIVAGLDSGSDDYLTKPFA
FT                   FAELLARVRALVRRSEQDRGAEIRFADLRLDPVTHKVWRKDKEIDLTAKEYSLLEYFMR
FT                   NPNQVLTRTMIAEHVWDYTFDSFTNIIDVYVNYLRKKIDRESDKKLIHTVRGVGYILKE
FT                   ED"
FT   gene            451862..453271
FT                   /locus_tag="KN400_0425"
FT   CDS_pept        451862..453271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0425"
FT                   /product="sensor histidine kinase, HAMP domain-containing"
FT                   /note="domains: HAMP, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83288"
FT                   /protein_id="ADI83288.1"
FT                   /translation="MFFRSIRFSLTLWYAVTLAVILVLFSSFIYLVLSNQLNKGIDREL
FT                   LTVAEAVASPTLEPFRHAAPSVFDQVLEDFIGTRLTGKHVQVLDGSGAVAASSKSMEEL
FT                   RIPLGKTALRRVQAGKVSYETRVNLDVYPVRTIVYPIMTDGRLDQIVLVGTSMRGPAET
FT                   LEKVQLVFAVSIPLALILWSLGGWFLAGRALKPVDLITRSARKITAENLGLRLEVINPQ
FT                   DEIGRLATTFNDTLERLENAFNRIRQFTGDVSHELRTPLTILRGEAEVGLKWAKEPEEF
FT                   RELLRSNLEEINRMSKIIETLLELSRVEGGVKLELADLDLSDLLAELVQQSRLIAPDKN
FT                   LRIAFVGQEPVTILGDWLRLRQVFMNLLDNAVKYTPADGEISVVVDTTGDSARVAIIDS
FT                   GPGIPPEDLPHIFERFYRVDKARNRADGGCGLGLSLVKTFVEAHGGRIEVVSEAGKGSI
FT                   FTVLLPRVVAG"
FT   gene            453277..454008
FT                   /gene="mqnB"
FT                   /locus_tag="KN400_0426"
FT   CDS_pept        453277..454008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mqnB"
FT                   /locus_tag="KN400_0426"
FT                   /product="futalosine hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83289"
FT                   /protein_id="ADI83289.1"
FT                   /translation="MEPILVVAATRQELTLLIRSLGARERGGAGRRPSWLGKVGLLPVV
FT                   LAETGIGKVNTAAALAALFENFIPRLVINTGCAGAYTASGLRVGDLAVASAEISGDEGV
FT                   LTPQGWEGLDLIGIPALERKGVRYFNEFPLPLHPAEQAVQLATALGVPLRRGKFVTVST
FT                   CSGVTARGDELASRFDAICENMEGAAVAQVALDYGVDCLEVRGISNMVEDRDLSRWNLP
FT                   LAVEKAQRFIIKYLETCGEEQ"
FT   gene            454008..454844
FT                   /gene="mqnD"
FT                   /locus_tag="KN400_0427"
FT   CDS_pept        454008..454844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mqnD"
FT                   /locus_tag="KN400_0427"
FT                   /product="1,4-dihydroxy-6-naphthoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83290"
FT                   /protein_id="ADI83290.1"
FT                   /translation="MDALSLGFSPCPNDTFIFYGLIHGRVPTSGLAFRERLEDVETLNG
FT                   LALAGALDICKVSYHALGYLRDRYCLLRSGGALGRGCGPLVVARGASTLADLRGKPVAV
FT                   PGRFTTAALLLRLADPAIDTLVYMPFHEIMGAVARGEVAAGVIIHESRFTFRDYGLTQL
FT                   LDLGEWWEGETGCPIPLGGIVARRDLGVDTIIAVEQALRSSVAFAQANPGEAKAYIRAH
FT                   SQEMSDEVCAAHIDLYVNDFSLQLGPEGEAAVIELFSRAEAAGVIPPSDVLLFPSL"
FT   gene            454947..455399
FT                   /locus_tag="KN400_0428"
FT   CDS_pept        454947..455399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0428"
FT                   /product="rare lipoprotein A-like double-psi beta-barrel
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83291"
FT                   /protein_id="ADI83291.1"
FT                   /translation="MVSALRKGRLAILIILCQAFFQIQTLSLQAEEIAAKETSDKEAAI
FT                   AAAADEGVTGTASYYAKRYHGRRTTSGKRYDPKKLTAAHPTLPLGTKVKVVNLTNDREV
FT                   TVTITDRCRKRVNHFIDLSREAARRLGFLGKGVTQVRIITLDETAS"
FT   gene            complement(455451..458000)
FT                   /locus_tag="KN400_0429"
FT   CDS_pept        complement(455451..458000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0429"
FT                   /product="exporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83292"
FT                   /protein_id="ADI83292.1"
FT                   /translation="MRRIVAFVHSAIGRHLAWLFRVTWHHPRATLAGSLLALCLAITSI
FT                   SGIRFEADIFKLFPTDRGALRLFLDTLEWTGSAGEAYLLLEGNRERLPAEAEVLAARLR
FT                   ALRVDGEPALRSVSYRVVESADLPDFAAFVGRAVTLPHLFLSPDQADEFTNRLDASRMD
FT                   AALRRATAELAAGGGVGSRDLVAADPLALRELILPRLQSASQALDLDPESPYFLSRDGQ
FT                   LLVMIAEPARPVQDMEFARKLVAGINEARAAVGPGVSVSCAGAHLSAVIDEAVMKRNIL
FT                   ACIASSLAVVLGLFFMTYRRVLPTILIPVIIAFGTVMALGTAGLLLPSVHIISFAFTAL
FT                   IIGLGTDYSIHLYDRYRTERSAGRNTEESLRLAVVDTGHGVFTAATTTAFPFLALVISD
FT                   VRALSELGLLVGLGVLYSLYATFFFLPPLLIFAERRAPDVRHNPLPSLGLARLWRLTQR
FT                   GPRTIAFISLATAAGLTLTAFSISFEGDLKNLQPRHSEAFLTQERIERHLSISPRQMVV
FT                   AVEGSDLSDVMRKGGEVAALAEGYRQRREVVAITWLGSVMNGAGEQQQVLERLQKRSAV
FT                   REAGRELGLALERADFDAAMFPEAVSGLGRLSSAGPVPTAEAVALLRGSPLGSMVDRFL
FT                   VERNGRWHLLLTLHYRGDAFPQERFLAQLEAVAPGARATGPDLISRQLAESVRGSFLEG
FT                   FAIGGVLILFLLVVHFESLAGIAASLLPVVAGVISMLGLMAVTGMKINFMNAMVLVTIL
FT                   GMGSDYGLHVYHRLREGDGSEAGDRYVQAGRAVLLSALTTVAGFGSLAFTDYGAMSSIG
FT                   WATNFGIGATAFFALVSLPAFLGLRRSRKPAGLSTKE"
FT   gene            complement(458001..458690)
FT                   /locus_tag="KN400_0430"
FT   CDS_pept        complement(458001..458690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0430"
FT                   /product="outer membrane lipoprotein LolB, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83293"
FT                   /protein_id="ADI83293.1"
FT                   /translation="MRRLALFLILAVALAAGCATVPQPQVPLEPGARVETLAATVSLSV
FT                   KTPDGSTGGNGYLLYRRPDRFHMVMLTPFGTTALEFFAAGERITILLPSKGQAYVGTFA
FT                   DLPAKGGLQGWRMMQWVVEGSPLYRPEAAGRTEEQSDDGGVTLATYGPDGLLERKRSAR
FT                   GEVIYRNYRSLEGVPFPALVEFSDSHGVRVKITFDEPEVNAPLDDAALTPTLEGVTVMP
FT                   LANLKGL"
FT   gene            complement(458704..459327)
FT                   /locus_tag="KN400_0431"
FT   CDS_pept        complement(458704..459327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0431"
FT                   /product="outer membrane lipoprotein carrier/sorting
FT                   protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83294"
FT                   /protein_id="ADI83294.1"
FT                   /translation="MTTSRLARILLALAVLALAVPAPGQAARISPREGLELLRSAFAGV
FT                   NDFTAEITQEKQIALMKKKLVTNGMVRFRKPDSFMMELNPPHASRVLLRDNVISTLLPA
FT                   DGVRQKIVLPPDEGLARWFALMENPVTSLPDGVAVQAERNGDAVTISIAPSQGRGVKNL
FT                   QVILAADGKLRRVIIEEQNRDRTVISFRNVRRNVGLTDRDFRIE"
FT   gene            complement(459327..459716)
FT                   /gene="fabZ-1"
FT                   /locus_tag="KN400_0432"
FT   CDS_pept        complement(459327..459716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ-1"
FT                   /locus_tag="KN400_0432"
FT                   /product="(3R)-hydroxyacyl-(acyl carrier protein)
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83295"
FT                   /protein_id="ADI83295.1"
FT                   /translation="MHSPAPWDFLPHRYPFLVLDRIIAKEPGRSATALMRTTAAGTRGW
FT                   SSLLLLEAMAQLGGIAAADDTNGGGILAAVDHADFHGTVEAGDTLTVSVTVVKSFGPLH
FT                   LIAGEVTADGRPAASATITLKVGNL"
FT   gene            complement(459709..460734)
FT                   /locus_tag="KN400_0433"
FT   CDS_pept        complement(459709..460734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0433"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83296"
FT                   /protein_id="ADI83296.1"
FT                   /translation="MDIAVTGLAAISAAGVGIEPLRETVAQRQCRLTPVPVEVLGEDGY
FT                   LWGKADGFRAADFMPPLKARKFDRCSLLATVAAGMALADAGIDPKGGDPTRIGIALGCG
FT                   FGGIANSVEFLGGYFSRGVEGLVPMLFPNTVANAAASNASIEHGLKGPNVTQVQRFCSA
FT                   EAAIQMACRFLEEGRADVMLAGGVDELTPLMMAGFQAVGQLRTYARSFSEGCGILVLER
FT                   RDHAERRAARLRGRITGLRTVGMLPAGREQETVDRLMPPAAPALVSLSGIAADITALIA
FT                   PLPAVPTLESGNLIGRSLAMGGLALASLLLVLPEGARGLHLAASPEGPYHAIDVTGGMR
FT                   A"
FT   gene            complement(460746..461951)
FT                   /gene="fabF-1"
FT                   /locus_tag="KN400_0434"
FT   CDS_pept        complement(460746..461951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF-1"
FT                   /locus_tag="KN400_0434"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83297"
FT                   /protein_id="ADI83297.1"
FT                   /translation="MDKTRIAITGLGIFCAAGKDLASFTDALLHGRCGIGPVDLFDVSP
FT                   FPSHIGAQVRDYSPLDYFDRADARRLSRTDQFAAVAAAEALGMSGAREHYDPFTVGICV
FT                   GAGASGMIHGEAWLRDRLAGGKGRPGDLRCILPDRTTTALAERFGLWGYQGSITTACSS
FT                   SATAIGWGADLIATGQLDACLCGGSDTLSILTYAGFNSLRVVDPEPCSPFSLGRQGISL
FT                   GEGAAFVVLEREETARSRGARIYGRVLGYALAGEAHHMTAPEPSGSEAARVMRAALDNA
FT                   GVSAGEIGWVNAHGTGTPLNDVVESKAMKLVFGADVQHVPLVSTKGMTGHCLGAAGSIE
FT                   IVATVTALGAGIIPRTLNFRGSDPECDLDYCHDGPRESSATVALSNSFAFGGNVTSVVI
FT                   GR"
FT   gene            complement(462086..462826)
FT                   /gene="fabG-1"
FT                   /locus_tag="KN400_0435"
FT   CDS_pept        complement(462086..462826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG-1"
FT                   /locus_tag="KN400_0435"
FT                   /product="3-oxoacyl-(acyl carrier protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83298"
FT                   /protein_id="ADI83298.1"
FT                   /translation="MEFKDSIVVVTGGTRGIGRAISLHFARQGALVTAAYRADDEAARA
FT                   LEAEAAGLPGSIAVIRADVGTAEGAMAVIDAASGESGTLHVLVNNAGIIRDGYLAMMAE
FT                   DDWDAVMRANLSPLFHCCKWGVRKMLARRRGAIINLSSVSAFAGTAGQTNYAATKGAAV
FT                   SFTKSLAREVGPLGIRVNAVAPGLIETEMIAGMKREMVDRIVGSSILGRTGRPEEVAEA
FT                   VAFLASDRASYITGQCLVVDGGIL"
FT   gene            complement(462875..463948)
FT                   /locus_tag="KN400_0436"
FT   CDS_pept        complement(462875..463948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0436"
FT                   /product="peptidase, M48 family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83299"
FT                   /protein_id="ADI83299.2"
FT                   /translation="MSEARGLFYDGISSAQTAVTLVVEGSKLRVRGEGMERTYLITEVT
FT                   VSPRLATVRRSIRFPDGALCELSDERFADGLLHRQGRGRSSAALHRWERSLPRALVALV
FT                   LTVAVIAAFVTYGIPALARKAAFAIPPSTEESLGREGLALLDRMIFTPSQIPAARRREL
FT                   TRLFARMTRELPYAGGYRIEFRRSDRLGANALALPSGIIVVTDGLVKLAKNDDEIAAVL
FT                   AHEMGHVRNRHALRHVLQNSATGLLLATITGDITSVTSLSAGLPTALVDARFSREFEVE
FT                   ADDAAVEYLHGKRIPLSRYADILARLEQDHQRRAGEGEDRKKERSLSDYFSTHPATDER
FT                   IRRFMTSGDGAGAPSGR"
FT   gene            complement(463945..465186)
FT                   /locus_tag="KN400_0437"
FT   CDS_pept        complement(463945..465186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0437"
FT                   /product="membrane protein of unknown function DUF898"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83300"
FT                   /protein_id="ADI83300.1"
FT                   /translation="MDRETVSCPACGFSRDMPAGTIPDGAQVTCPRCRDTFMFARGAAA
FT                   EADPVPTIASPQGPEAAVAAPAAPPTACPRTLRFSFTGAAREYFGIWIVNTLLKILTLG
FT                   VYSAWAKVRKRRYLYGNTMLHGAPFDYLANPRVLFRGWLIGVLAFLLYTLGTNYSPTLS
FT                   FVIGALFFAAVPWLVVRSRLFNLRNTSYRNLRFTFRADYCQAYLVYGLLSLLVPLTLGL
FT                   LYPYAAYRRKRFLVENSAYGTTSFSFTATTRDFYLLYLKAVAGFVAIVIVAVPFLFLAG
FT                   GAFLPAGTGGPWRLAAVLPAFLIPLAYLYFVIYISTNETNLVWSGTQVAGARFTCSLRA
FT                   RHMAWLYLSNAVAIFLTLGLMIPWATVRVLRYRMENLTVLATGDLEEFAAAPTEEVTAT
FT                   GEEIGDIFGIDVAL"
FT   gene            complement(465200..465397)
FT                   /locus_tag="KN400_0438"
FT   CDS_pept        complement(465200..465397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0438"
FT                   /product="S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83301"
FT                   /protein_id="ADI83301.1"
FT                   /translation="MKIDTDHIKLDSFLKAANLVASGGEAKIIIAEGAVRVNGETELRR
FT                   GRKLRPGDQVEVAGECFVIE"
FT   gene            465495..466058
FT                   /gene="efp-1"
FT                   /locus_tag="KN400_0439"
FT   CDS_pept        465495..466058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp-1"
FT                   /locus_tag="KN400_0439"
FT                   /product="translation elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83302"
FT                   /protein_id="ADI83302.1"
FT                   /translation="MLTTSDFKRGLVIKLDNSPCLILDVHFQSPSARGASTMVKTRYRN
FT                   LLTGQVLDKTFRSGDKVEEADFERHKGQYLYADGDRGVFMDMETYEQFEMDAESFQVIQ
FT                   PYLLDGTEVVLGLFQERLVSVDPPQVVELTITDTPPVIKNATATAQTKEATLETGLTLQ
FT                   VPPYLEVGEKIKVDTRDCRFISRA"
FT   gene            466159..466234
FT                   /locus_tag="KN400_R0008"
FT   tRNA            466159..466234
FT                   /locus_tag="KN400_R0008"
FT                   /product="tRNA-Phe"
FT   gene            466412..467656
FT                   /locus_tag="KN400_0440"
FT   CDS_pept        466412..467656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0440"
FT                   /product="integrase, bacteriophage P4-type"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83303"
FT                   /protein_id="ADI83303.1"
FT                   /translation="MPKKIIPLSALKIDKAKPQEKEVKLYDGGGLFLLITPSGGKLWHL
FT                   KYRYGGKEKKLALGAYPLVSLEGARQRREDAKKLLANGVDPGEMKKVLKSAAKDKAANT
FT                   FEVVAREWHHKFSSAGKWSPTHAADILHRLEKDIFPPLGARPISEIKPLDLLRVLERIA
FT                   SRGALDTAHRLRHHCGMIFRYAVVTERAERDVAADLRGALPPVKNGHHAAPTTPQSLLP
FT                   LLRAIDVYEGSYIVKCALQLLPLFFCRPGELRAAEWTEFDFDKAIWEIPATRMKMKQPH
FT                   IVPLSKQAIAILESLQSLTGSGKYLFPCQRSTQRCMSDNAYNAALRRMGFTKDEATAHG
FT                   FRASARTILDEVLRIPVVLIEHQLSHSVRDPLGRAYNRTSHLDERKKMMQQWADYLDGL
FT                   KCGAKVIPLRDQRSA"
FT   gene            468488..468742
FT                   /locus_tag="KN400_0441"
FT   CDS_pept        468488..468742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83304"
FT                   /protein_id="ADI83304.1"
FT                   /translation="MASITQKNNRRYRLQFTMRRELYETYQTLLERASELRVVIDFAHD
FT                   FEEWFFNQLEQVSHELGKLEAHSQRSSRPRPNDGQADLD"
FT   gene            468808..469119
FT                   /locus_tag="KN400_0442"
FT   CDS_pept        468808..469119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0442"
FT                   /product="phage regulatory protein, AlpA family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83305"
FT                   /protein_id="ADI83305.1"
FT                   /translation="MGNIIVPKITLPETGFVRLPNIIGDPKADPPIAPIIPVSKSTWWA
FT                   GVKSGRYPQPIKLGPRITAWRVEDIRELVREARTFQGGMDNGQNWMAGGADGLGKDHV"
FT   gene            469112..470083
FT                   /locus_tag="KN400_0443"
FT   CDS_pept        469112..470083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0443"
FT                   /product="phage replisome organizer"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83306"
FT                   /protein_id="ADI83306.2"
FT                   /translation="MCNLLDHRKIKMIRKGPEGNTLVLLWLLMLTEAGKCSRGGYLMVS
FT                   ATLPYTEQTLSMVTDIPLPTVQLGLVTFTGLDMIDQEDGAIFIKNWGKYQSEDKLEARR
FT                   ESDRKRQQLYRHNERERLRALALTSQEQVSRDCHVTMSRDVTVENRTEENRGEKTTTDE
FT                   VRLLLSGTPLSKITDRELQGLAKRHGPYRLAKAADVAAETWRRDREERHNPGGYLQSLC
FT                   TSLVVPEWYVPFRERKALAEALQRRKGEVEAEQATQKAQEEAQIAARHALWESLSEEQR
FT                   EEYRSAALAGLPAGIAPAMAVTAMAKLLAWDAVQTGNPAGTG"
FT   gene            470350..470652
FT                   /locus_tag="KN400_0444"
FT   CDS_pept        470350..470652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83307"
FT                   /protein_id="ADI83307.1"
FT                   /translation="MSKRDETFDPLAEVERIRARRAEARRKLYRKSRLDKYRAELVAMK
FT                   QAGASCADLAEWLRVSHRCKVNRSSIDRYLKKLPELTGAQAVTVEPEATMSKEDR"
FT   gene            470662..471559
FT                   /locus_tag="KN400_0445"
FT   CDS_pept        join(470662..471144,471146..471559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83308"
FT                   /protein_id="ADI83308.2"
FT                   /translation="MPSFRSAKTQAEHAVSRKIALGQGRHDHRDDGKIHSVGTARGYEQ
FT                   ALKGATEYVQEHRLGDLRSLTVEIAQQYLADRAAIVSQKTLDIDRQAMQMHLGVRLEVV
FT                   KSELETHLTTRSYTATQVERIASAQSERNSLATQIAHNAGLRAHELLTIRLANERPPPP
FT                   PTHREWSAERFAGREGERYTVEGKGGLVREVLLSRELAAQLEATRLGEPRQVTDRGVNY
FT                   TQHYNIGGGRAWSQSFSAASQRELGFSNGAHGLRHSYAQERMEEMQRGGMNYDDAKGTV
FT                   AQEVGHFDKETTEAYLR"
FT                   /artificial_location="low-quality sequence region"
FT   gene            471766..472263
FT                   /locus_tag="KN400_0447"
FT   CDS_pept        471766..472263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83310"
FT                   /protein_id="ADI83310.1"
FT                   /translation="MKATWPLSLTLLIVSLAAGIAGGYALRDDDNSDRHRRELSDLENR
FT                   YRQRIDAADRKYDQAGIWETNSRRRFKEADQKEAAAKRREKAVEEKEQNIDKIVEEKVQ
FT                   AIRKQFQGLQEDHRNRCHKMEGLEKEKIELKRKNISLEKEVIKLQEENLALTKENLALK
FT                   RK"
FT   gene            complement(472744..474231)
FT                   /locus_tag="KN400_0448"
FT   CDS_pept        complement(472744..474231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0448"
FT                   /product="ATPase, AAA_4 family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83311"
FT                   /protein_id="ADI83311.2"
FT                   /translation="MTTNRSPEYLISLVNELRKLPRETEWVEFKVNRAEPEEIGEYLSA
FT                   LSNSAVLAGKAFGYMVWGIDNDTHEIVGTEFSPLATKVGNEELENWLLRLLSPKIHFRF
FT                   FEFEVGGCRLVLLEIGRAFRHPVQFQHQEFIRVGSYKKKLKDFPEKERELWRTFDQIPF
FT                   ENLVAAEEVASEEVLKLLDYPSYFDLLKLPLPESRDGILQSLEADDLICRTESGRWNIM
FT                   NLGAMLFAKRLGEFRSLRRKAVRVIAYKDNSRVETIREQEGAKGYAAGFEGLIGYINAL
FT                   LPSNEVIEKALRRTVPMYPELAVRELVANALIHQDFFVTGSGPMIEIFSDRMEISNPGI
FT                   PLVQTERFLDTPPRSRNEALASFLRRIGVCEERGSGIDKVVFQTEYFQLPAPAFEVIGE
FT                   NTRAVLFAHRPLTRMDKDDRIRACYLHACLKYVNREYLTNSSVRERFGIEPQNMAAASR
FT                   LIKEAVDAGEIVPHDVGAAPKLMKYIPWWAAAPKTGT"
FT   gene            complement(474319..477453)
FT                   /locus_tag="KN400_0449"
FT   CDS_pept        complement(474319..477453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0449"
FT                   /product="type I restriction endonuclease, HsdR family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83312"
FT                   /protein_id="ADI83312.1"
FT                   /translation="METFNESIIEDATLAWLEGLGYTIRSGLDIAPGELLAERQDYSQV
FT                   LLGDRLRQALARLNPSLPVEALDDAFRKLTRPEGATLEDRNRSVHRWLVDGVTVEYRHK
FT                   DGHIAGAQARVIDFDLPGNNDWLAVNQFTVIENKHNRRPDVVLFVNGLPLVLVELKNAA
FT                   DENATIWSAFQQFQTYKAELPSLFTYNSLLVISDGVEARIGTLTAGKEWFKPWRTVSGE
FT                   SLAGPHIPELQVMLEGVFDKRRLLDLLNFFIVFEDGGDGRLIKKMAGYHQFHAVNVAVS
FT                   ETLRAGKSADRAAEEIGRWEAGLQRGGEPGDRRIGVVWHTQGSGKSLTMAFYAGRVIRE
FT                   PAMSNPTLVILTDRNDLDDQLFGTFSRCQDLLRQPPAQATDRADLRNKLAVNAGGVVFT
FT                   TIQKFFPEEKGDRHPLLSDRRNIVVIADEAHRSQYDFIDGYARHMRDALPNASFIGFTG
FT                   TPIELTDKNTRSVFGDYISVYDIQRAVMDGATVPIYYESRLARLELEETEKPKIDPEFE
FT                   EVTEGEEIERKEKLKSRWAQLEALVGSEKRIKLVAEDLVRHFEERQAAMEGKAMVVCMS
FT                   RRICIDLYNAIVALRPDWHHDDDDKGAIKVIMTGSATDPLEWQKHIRNKPRREALAKRF
FT                   RSAGDPFRIVIVRDMWLTGFDAPSLATMYADKPMRGHGLMQAIARVNRVFKDKPGGLVV
FT                   DYLGLADELRKALATYTESGGTGKTAIDQADAVALMLEKYEVCKGLFHGFDWTAWLTGT
FT                   PQQRLTLLPAAQEHILSQEDGKNRLLKAVTELSKAFALAVPHEDALAIRDDVAFFQAVR
FT                   AVLAKSGTGERKSDEELDHAIRQIISKAVASDEVIDIFEAAGLKKPDISILSDEFLAEV
FT                   RGMPQRNLAVELLQKLLKGEIRNRRRKNVVQARSFTEMLEEALRRYQNRAIETAQVIEE
FT                   LIALARQMREASGRGEELGLTEDELAFYDALEINDSAVKVLGDDTLRAIARELADTVRR
FT                   NVTIDWTMRENVRAQLRVLVKRILRKYGYPPDKQEKATQIVLEQTEVLSQEWATV"
FT   gene            complement(478024..478608)
FT                   /locus_tag="KN400_0450"
FT   CDS_pept        complement(478024..478608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0450"
FT                   /product="7-cyano-7-deazaguanine synthase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83313"
FT                   /protein_id="ADI83313.2"
FT                   /translation="MGLVNLVSGGLDSTLVGVLAREDGLSVYPLFINYGQKAVQQEWEA
FT                   CQRVHQALNLPTPIKMDLSGFGKVICSGLTNDKMDVKEEAFTPGRNLLFLLMGSAYAYQ
FT                   VGASAVAIGLLTEQFSLFPDQRTLFLEKAEQAIEAALGKNIKLLAPLSDFSKMDVVKLS
FT                   IEKGIAGTYSCHAGGDQPCGHCISCLEFELR"
FT   gene            complement(480833..482983)
FT                   /locus_tag="KN400_0451"
FT   CDS_pept        complement(480833..482983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0451"
FT                   /product="type I restriction-modification system DNA
FT                   adenine N6-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83314"
FT                   /protein_id="ADI83314.1"
FT                   /translation="MARPKKQANGTAANIGYEAELWQMADALRGSMDAAEYKHVALGLL
FT                   FLKYISDAFEEKHAQLESERSQGADPEDPDEYRALNIFWVPPEARWSHLKAQAKQPTIG
FT                   QLVDDAMAGIERDNPALKGVLPKEYARPALDKQRLGQLIDLISNIRVGDAESRAKDVLG
FT                   RVYEYFLSQFASAEGKKGGEFYTPRCVVRLLVEMIEPYKGRVYDPCCGSSGMFVQSVEF
FT                   IRAHANGNGNSGNAKADISIYGQESNYTTWRLAKMNLAIRGIDGQIAHGDTFHNDRFPD
FT                   LKADFILANPPFNISDWGGDRLRDDKRWQYGVPPTGNANFAWVQHMIYHLAPKGVAGFI
FT                   LGNISLTSETGGEDTIRKGIVDANLVDCIVTLPDRLFYSTPIPAGIWILRRGRDFDREV
FT                   NKPNREILFIDASRLGKSVTRTHRELTDDDLERIACTYRNWQKCSDAYLDVEGFCRRVE
FT                   LEEVIANGYNLLPAAYVNQGHLRATGGPQLHDVIHSNFRNETSQSLDRVTDLNKAFEES
FT                   LKMAEAELRILEQEIEFKSMFLGDILIRSDERLGNAEEPEVLTCTESGGLIFQRERFAK
FT                   RVATEDASDYKIVRMGDIVYNPYLLWKGSIDQCWIAEIGITSPAYEVLRVRPEFDATIV
FT                   GQLVTSPEMIRRYDGISFGTVQRRRRAPVEKFLELEVNVPVGASLSAISALLDCAQDSQ
FT                   FACRSAERAIKSFVKRICEKLR"
FT   gene            complement(483560..484600)
FT                   /gene="macA"
FT                   /locus_tag="KN400_0452"
FT   CDS_pept        complement(483560..484600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="macA"
FT                   /locus_tag="KN400_0452"
FT                   /product="cytochrome c peroxidase, 2 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83315"
FT                   /protein_id="ADI83315.1"
FT                   /translation="MKTRNLAWGMALTLVAGVAWGKEDVMKRAQGLFKPIPAKPPVMKD
FT                   NPASPSRVELGRMLFFDPRLSASHLISCNTCHNVGLGGTDILETSIGHGWQKGPRNSPT
FT                   VLNAVYNIAQFWDGRAEDLAAQAKGPVQASVEMNNKPENLVATLKSIPGYPPLFRKAFP
FT                   GQGDPVTFDNVAKAIEVFEATLVTPDAPFDKYLKGNRKAISSTAEQGLALFLDKGCAAC
FT                   HSGVNMGGTGYFPFGVREDPGPVVRPVDDTGRYKVTSTAADKYVFRSPSLRNVAITMPY
FT                   FHSGKVWKLKDAVKIMGSAQLGISITDADADKIVTFLNTLTGAQPKVMHPVLPPNSDDT
FT                   PRPVSN"
FT   gene            complement(484695..485555)
FT                   /locus_tag="KN400_0453"
FT   CDS_pept        complement(484695..485555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83316"
FT                   /protein_id="ADI83316.2"
FT                   /translation="MLPLFFACALLCLSWTAALASERRDVSVEGRWGAVGLGVDFATGD
FT                   YGSGTRTDFISVPLIVDLYPTERLDLELVIPWVYQTNGDNAYGTVMPYRQGYARGAATA
FT                   ADTRFQAGAGGNSGSTAGGSTGSANGLGDITLTAGYIIIPEGTVAPRVRPLLYLKFPTA
FT                   DEDKGLGTGKFDAGGGLSLDKWLGDWRPFGEAVWIVQGSSDLYATKDYLSYEAGLGRQF
FT                   TPSLYAAILGRGATAPAEDSDAPFEGRLKGVYAFDSMALEGYVAAGLSDASPDFAAGLA
FT                   VFYDF"
FT   gene            complement(485603..486115)
FT                   /locus_tag="KN400_0454"
FT   CDS_pept        complement(485603..486115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83317"
FT                   /protein_id="ADI83317.1"
FT                   /translation="MIRGRSTLILTILVFLALFHAGNATAGWGFGFGWGWEKSGLDLDE
FT                   GYDLNTVVTVTGTIASVEPGGDGKHMLVAIKEGEDAVVLALGPRWYWNEKGFPLKPGDR
FT                   LTAKGAKAIGKDGTIYLLTQKVGNSLTGEETAIRSDAGRPFWSGSGRGNTTRPTAPIRR
FT                   GGGRHGR"
FT   gene            complement(486144..486497)
FT                   /locus_tag="KN400_0455"
FT   CDS_pept        complement(486144..486497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83318"
FT                   /protein_id="ADI83318.1"
FT                   /translation="MTRKVLAVAVMVAAGALALGGEAMARGGKGPMAGQGTGDRLQLRD
FT                   GSCLSSTATATAASAATSSRQQLRDGSGAGTARQGVGTGAMRRLGPGDGTGNVTPPQDG
FT                   TGYGSAYTGGTAR"
FT   gene            complement(486679..488040)
FT                   /locus_tag="KN400_0456"
FT   CDS_pept        complement(486679..488040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0456"
FT                   /product="sigma-54-dependent transcriptional response
FT                   regulator"
FT                   /note="domains: REC, sigma54 interaction, HTH8"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83319"
FT                   /protein_id="ADI83319.1"
FT                   /translation="MTTRILIAEDDSTFRGFLRTVLKGEGYDIREAADGEEALALLRRE
FT                   SFDLVLSDLRMPGIGGLELLRASRDDDYPPAFVILTAFGTIEEAVAAVKEGAADFLTKP
FT                   LKDPDTLRVLVGRVLSGKSREREYLALKETEAAGLPPEDLIFAGEAMAPVRRLVGEVAP
FT                   TGTTVLVSGESGTGKELIARAVHLLSPRHGAGFVAVNCAAIPETLLESELFGHERGAFT
FT                   GAVQARRGKFELAQGGTLFLDEIGELSLPLQAKLLRVLQERAFERVGGNREIRADVRVV
FT                   AATNRDLVVEIRERRFREDLFYRLNVFPVALPPLRERRDALPHLVNWFIRRFSGVTGKK
FT                   IRGIEPDAMAALKRYPWPGNIRELQNVIERGVILARHALTLDDLPETFRAPLPAGQDGE
FT                   GVLKGLEREAILAALKSCGNNRRLTAEKLGISRRTLQYRLREYGLVGDDRDGAN"
FT   gene            complement(488057..489292)
FT                   /locus_tag="KN400_0457"
FT   CDS_pept        complement(488057..489292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0457"
FT                   /product="sensor histidine kinase"
FT                   /note="domains: HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83320"
FT                   /protein_id="ADI83320.1"
FT                   /translation="MRGNIVSLIALAAGVILSLLLGWFAVGNYRSARPIAEGNLRGLAL
FT                   SLTSALESIAARDSSLASLAAFRARDIAYISVIDRNGTIVFHSNADLIGSRVTDQRYVT
FT                   VLGGRGLAENRIRLGTGEEVYEYHAPLHLPGRTLALRLALHPWRADAVIHRARVGMVVL
FT                   FSLLAAAWTMGVLLYRYARRAQEHRLEMVRRERLAQLGEMGAVLAHEVRNPLSGIKGYA
FT                   QLLMERSNDDENREFSALIVTEAIRLESLVSDLLAYARPEPGPEGPLQVNAVIDHVLAL
FT                   VDPEARAAGVTIAASLAEGLATRGNEARLEQLILNLAKNGIQAMPDGGTLTVVTRREGK
FT                   TVEISVADHGHGIAPHDRERIFTPFFTTKARGSGLGLAVCRKIAEAHGGSISVADNPGG
FT                   GTVFRVTLPLHR"
FT   gene            489455..489925
FT                   /locus_tag="KN400_0458"
FT   CDS_pept        489455..489925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0458"
FT                   /product="SRPBCC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83321"
FT                   /protein_id="ADI83321.1"
FT                   /translation="MKMYQLSRTQILPVPLTVAWDFFSDPRNLAAITPPDMGFVITSPV
FT                   PERTHAGMVVTYAVSPFGGLRLPWVTEITHCAEPSLFVDEQRFGPYRFWHHQHHFLEVS
FT                   GGVEMRDIVHYILPFGIIGRLSAPVVAKRLKAIFDYRRDTLAVRFAALSRGA"
FT   gene            490059..491063
FT                   /locus_tag="KN400_0459"
FT   CDS_pept        490059..491063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0459"
FT                   /product="helix-turn-helix transcriptional regulator,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83322"
FT                   /protein_id="ADI83322.1"
FT                   /translation="MKKGKPAKKYSQAARVHDLIRLIEARHGVTIAEMAEETGVDRRTI
FT                   HRDLAAIHEAGYPLISDWEDGRKVYRFITRFRDVPPITFTLQELVALSFFRTQLHFLDG
FT                   TPFREDLDAVFRKVSSVLPPRYAAHMERIAEVSVPLLQGRRDYSRVGDGLRSLRDALIY
FT                   QYRVRLSYQAKGQGRPALYEVDPYTLVFYKGGLYLVGYAHNRRALRTFAAERITAVEVT
FT                   RDRFEIPDDYRPSERLRDAFGIVEEEPLSVAIRFSPELAHTVRDRIWHPTQQVRMESDG
FT                   ACILSFTAGGRMEIIAWVLSYGAHAEVLSPPDLRAEVARVAAAVAARYVSVGG"
FT   gene            491196..493574
FT                   /locus_tag="KN400_0460"
FT   CDS_pept        491196..493574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0460"
FT                   /product="sensor diguanylate cyclase/phosphodiesterase, PAS
FT                   and PAS domain-containing"
FT                   /note="domains: PAS, PAS, GGDEF, EAL"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83323"
FT                   /protein_id="ADI83323.1"
FT                   /translation="MDFTKISALHYRLPSPVRQFIVLLSIIFLIEMLLMAVLPQVTGRE
FT                   VEFKDALVDSMGLVTVAAPFLWAFIVRPLRRTAVAAVFREEVLLRQMVDGVITFGEDGT
FT                   IRSLNPAAERMFGYRDDEAAGMAIDCLLSADGGYFRFAVQASGGHGTRQLAYELEGIRR
FT                   DGSRFVADLSVSRIVFEDHRAVIGIVRDITARKRDEQNLLVFKRAIESSVNGITITDAT
FT                   NGENLIIYVNPAFERMTGYAGHEVLGKNPRFLRGDDRDQVELRKLAMALEERREGYFVL
FT                   RNYRKDGSQFMNELYVAPVRDRDGAVTNYIGIMNDISDQRRYEEQLVYQATHDPLTGLP
FT                   NRNLLQDRLGQALALESFRRRNPIGVMFLDLDNFKKINDTLGHTVGDMLLKAVANRLRN
FT                   CVRGGDTVSRLGGDEYILILPNVKEMHDVTTVAKKLLGVFSTPFLLMGHELYITASIGI
FT                   TLFPSDGDTVDALLKNADAAMYHAKEQGKNNYQFYSEEMNTRVFERMALETSLHRAIRQ
FT                   HEFLLCYQPRVDLRTGRISGVEALVRWNHPEMGLVPPARFIPLAEETGLIVPIGEWVLR
FT                   TACAQNKAWQDAGLPPLRMAVNLSARQFRQENLIQMVADALAETGLDPRWLELELTESL
FT                   LMEQAEQSVSILRSLADMGIDIAVDDFGTGYSSLGYLKRFPITNLKIDQSFIRDIASDP
FT                   DDAILVRTIITMAHGLGMKTVGEGVESLEQIDFLYRHGCEEVQGYYFSRPLTAEGCEEL
FT                   LREERFLDLRALRDGLPGQRSEERIRALASSADDCRVTA"
FT   gene            complement(493564..495432)
FT                   /locus_tag="KN400_0461"
FT   CDS_pept        complement(493564..495432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0461"
FT                   /product="sensor histidine kinase, PAS domain-containing"
FT                   /note="domains: PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83324"
FT                   /protein_id="ADI83324.1"
FT                   /translation="MTSSDLVSRSARFALVMLFLAALVLTSRVNYLLFHTLTEIVTVVA
FT                   GCGIFMVAWHARRQIDNHCILLIGISHLFVAIITLFHALSYRGMGVFPGAGTNLSTQLW
FT                   IGSRLLQGASLALAPLFVRKRLNPSVTVTAYMAATSLFLLSILCGDIFPLCFSDEVGLT
FT                   PFKKGAEFLAGIFILAALTGLLTKRRHFDARVFRMLSLSLVFLATSGFVFALNTGISSL
FT                   TGMTGHLLTLGGFILIYRAMVETGLERPYDLLFRDLKESEERYRSLYNRTPVMLHSIDR
FT                   EGKIVNVSDFWLETLGYRRDEVLGRLSADFMTDESRSYVIGTVVPEFLRTGRTRDIPLH
FT                   LLTSSGKVIDVLLSSEAERDEEGEIVRSLSVMTDVTEQRRAARQIERLNESLASRAMDL
FT                   EVANGDLEAFNYSVSHDLRSHLTVIRGFSDVLLEICTDKLDDECRSYVRHIGEETGRMN
FT                   GLIGTLLDFSRVARVELERVPVNLSTLAEEIALELRMKDQERMAEFIIIDDADVTADPG
FT                   LMRVVMENLLGNAWKYTGRREQAVIEFGKEEMEGQTVFFVRDNGAGFSSQQADKLFLPF
FT                   QRLHGRSEFPGHGIGLATVHRIISRHGGTIWAQGEEGAGAVFYFTL"
FT   gene            495764..496924
FT                   /locus_tag="KN400_0463"
FT   CDS_pept        495764..496924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0463"
FT                   /product="protein of unknown function DUF185"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83326"
FT                   /protein_id="ADI83326.1"
FT                   /translation="MEQIDDSRLRGIIHDRIKERGGRIPFADFMAACLYEPGLGYYTSP
FT                   GRKVGAEGDFYTSINVHRVFGRLIGREICRMWEVMGCPAPFTLVEAGAGHGRLAADVLD
FT                   AVRELNPELYASLTLRLVEAEPSLAEAQRQVLAEHLDRVAWNDPAELMGGTLTFTGCLY
FT                   SNELIDSFPTHVVEMTPAGLREVFVTADGDGFAEQLDLPSTPDLADYFRRIDVNLQPGQ
FT                   RTEINLNACRWLEGVARCLERGFVLTVDYGFLSPELYGPMRQNGTLLCYFRHTIQEDPY
FT                   QRVGHQDITSHVDFTTLILRGEELGLHKAWFGEQYRFLMAAGLMEELMALEAAAATEEE
FT                   RIKIRLVLKKLVLPEGGMGDTFKILVQAKGVENPRLLCMRDWSKLF"
FT   gene            496995..497633
FT                   /locus_tag="KN400_0464"
FT   CDS_pept        496995..497633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0464"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83327"
FT                   /protein_id="ADI83327.1"
FT                   /translation="MLTGIGAIVFDLDGTLYQSESLGGQIAACADRYLADLLSVSPEEA
FT                   GEIVRRVRRELTARFGREASLSDACRELGGDLRELHRRFAAEVAPEPHLRRDSRVVQLL
FT                   RTLGANRELYLYTNNNRALSGRIMDAIGVTGLFRRVVTIEDSWRPKPDLQALEALFAAL
FT                   GRKPSECLFVGDRYDIDLRLPAELGCSVYLSRTVDELLGLTLPLSEEQQ"
FT   gene            497630..498088
FT                   /locus_tag="KN400_0465"
FT   CDS_pept        497630..498088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0465"
FT                   /product="ferritin-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83328"
FT                   /protein_id="ADI83328.1"
FT                   /translation="MNEHGKEMLDAIMRAMEIEKETFDFYTRAEHKTFNPEGKRIFRWL
FT                   ARTEEQHYLKLNELYQSLHEGGRWVFYGGSTVSLDPAGPGEKQVAFDTDDRQALEIAME
FT                   IEKKGIAHFEELMEKATDPQGKSMLRALRDEEAEHLRIVTEKYNALQR"
FT   gene            498120..499571
FT                   /gene="aspA"
FT                   /locus_tag="KN400_0466"
FT   CDS_pept        498120..499571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="KN400_0466"
FT                   /product="aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83329"
FT                   /protein_id="ADI83329.1"
FT                   /translation="MTFRVEKDTLGEVRVPADAYYGAQTVRAVENFPISGLRPHPALVR
FT                   ATVLVKMCAARANMATGRLDSRLGDAIVRAADECLAGAFDAHFVVDPFQAGAGTSHNMN
FT                   VNEVLANRANELLGEERGRYAPVHPNDHVNMAQSTNDVFPTAMRLAALRVAGDLRPALE
FT                   GLVAALRKKSAEFDGILKSGRTHLQDAVPIRLGQEFEAWAVALEKNLAAIEGAVPGLAE
FT                   LGIGGTAAGTGMNAEPAYIDLVVAELARETGFPLVRGANLVERMQNMDPFVALSSALKG
FT                   LAVNLARIANDLRLLSSGPRTGLAEIALPALQPGSSIMPGKVNPVMAEVTDMVAFQVMG
FT                   ADTTIMLAAQAGQLELNVMMPVIAFNLLFSLEILKNTVPKLADACIAGITADRERCLRY
FT                   LEQSVGLATVLAPYIGYAAAAEVAKESTATGRSIRQIVEDRQLLSAGRLAEILDPFPLT
FT                   SPGVPGATHQAENTTQGGDNNAGRR"
FT   gene            499555..499779
FT                   /locus_tag="KN400_0467"
FT   CDS_pept        499555..499779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0467"
FT                   /product="thioredoxin/NifU-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83330"
FT                   /protein_id="ADI83330.1"
FT                   /translation="MLEDVKKVLDLVRPALQADGGDVELVEVTEDGVVKVKLVGACGHC
FT                   PMSTMTLKMGIERTLKEKVPGVKEVVSVQ"
FT   gene            499816..500016
FT                   /locus_tag="KN400_0468"
FT   CDS_pept        499816..500016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83331"
FT                   /protein_id="ADI83331.1"
FT                   /translation="MGYKVKTFGMELRPLKAMQELFALDAMVNAFVAENGVKRIVSVSD
FT                   SPTTDDKGETIGLVRVVAYED"
FT   gene            500151..501341
FT                   /gene="cls-1"
FT                   /locus_tag="KN400_0469"
FT   CDS_pept        500151..501341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls-1"
FT                   /locus_tag="KN400_0469"
FT                   /product="cardiolipin synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83332"
FT                   /protein_id="ADI83332.1"
FT                   /translation="MSIVRRKMIMGTPRAPRFLRVFRRNAEAAHSRGNRVKLFTSGADF
FT                   FPAMLGAFAEARHHIHAEFYIVRDDATGAAFAEALLAAAARGVEVSLIYDYIGCFDTPS
FT                   AYFRRLEQGGVRCLAFNPPPFKGGIAWFDKRDHRKMAVVDGETAFTGGVNVGDEYSGFG
FT                   FPHERWRDVGIRIDGPAVIDLSRLFRGFWLAEKGSSSPAWHQERLPVAAVGDADVMVIS
FT                   DGPYHARSFIRNAFRIAMAGAGESIRIMNPYFVPGPRVVRSLLRAVRRGVRVQIILPAK
FT                   NDVPIVRLVSRSYYTPLLREGIELFERQGPVLHAKVMLIDDAWGVVGSANLDQRSFHRN
FT                   YEVNTIVASHEFGSQVAEMFAEDLAGSRRVVLEEHEQRGWHVRLLERLCGSVSWFL"
FT   gene            501432..502145
FT                   /gene="queC"
FT                   /locus_tag="KN400_0470"
FT   CDS_pept        501432..502145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queC"
FT                   /locus_tag="KN400_0470"
FT                   /product="7-cyano-7-deazaguanine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83333"
FT                   /protein_id="ADI83333.1"
FT                   /translation="MTRKAVVLYSGGLDSTTCLAIARAEGFEPHAMSFSYGQRHSVELE
FT                   LAKRNARPAGAVEHMVVEFDLRKVGGSALTADIAVPKEGVGDDIPVTYVPARNTIFLSF
FT                   ALGWAEVLGAFDIFIGVNALDYSGYPDCRPEYISAFETMANLATRLGVEGTGRFRIHAP
FT                   LMRLTKAEIIRKGLALGVDYGLTHSCYDPSPAGVACGLCDSCRLRLKGFAEVGVADPVP
FT                   YVTGGQGLGSGKETP"
FT   gene            502211..502987
FT                   /gene="folE"
FT                   /locus_tag="KN400_0471"
FT   CDS_pept        502211..502987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="KN400_0471"
FT                   /product="GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83334"
FT                   /protein_id="ADI83334.2"
FT                   /translation="MPDMQTSRDTRKIPISKVGVKDISYPIVVMDKNRKFQQTVARVNM
FT                   YVDLPHHFKGTHMSRFIEILNAYREDIALDKMEPILQEMKKKLGASSAHLEIEFPYFIE
FT                   KRAPVSGARSLMEYTCTFTGTLAETFDFVLGVQVPVTSLCPCSKELSRYGAHNQRSHIT
FT                   VRVRYAGFVWIEELVELIEGCGSSPVWSLLKRADEKFVTERAYENPKFVEDIVREATLA
FT                   LAAHEAITWFSVEAENFESIHKHSAYAAIEQDKRKA"
FT   gene            503101..503838
FT                   /locus_tag="KN400_0472"
FT   CDS_pept        503101..503838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0472"
FT                   /product="protein of unknown function DUF2064"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83335"
FT                   /protein_id="ADI83335.2"
FT                   /translation="MSAVNPLPMSLQPCRKALMIFAKRPMAGRVKTRLTPPLSPGDAAE
FT                   LYRRMLLDILAKCARMVGVDLLLFYEPGEGSGRFFEEAAPGWACRPQEGGDLGARLDSA
FT                   FRLAFGEGYGEVAVIGTDSPDLPEEYVRLAFDLLDHRAVDAVYGPSEDGGYYLLALKQH
FT                   RPELFRDIPWSTGEVLEHSLARAKAVGVRVELLPVWYDVDSIADLWRPGLAGAGTVAPL
FT                   TAEFVSGLISAHPPDTPPPAGER"
FT   gene            complement(503789..504997)
FT                   /gene="tdcB"
FT                   /locus_tag="KN400_0473"
FT   CDS_pept        complement(503789..504997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdcB"
FT                   /locus_tag="KN400_0473"
FT                   /product="threonine and serine dehydratase and deaminase,
FT                   catabolic"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83336"
FT                   /protein_id="ADI83336.1"
FT                   /translation="MLPYTLIQEADDRLRKRVRRTELIHSHHFSEKLGIPIYFKCENLQ
FT                   RTGAFKIRGALNFMTSQPREALAKGVITASAGNHAQGVAFSADLLGVPSTVFMPESTPP
FT                   QKVFATRDYGAEVVLTGRNFDEAYAAAVQAQEERGALFVHPFDDPLVMAGQGTIGLEVL
FT                   QELPDVANILVPIGGGGLIAGIATAIRETHPHVRIIGVETAAAPSAHYSLQKGKIVQVP
FT                   VTVTLADGIAVKKPGVNTFPIIRDLVDEVVLVEEEEIALAIVALLERTKLLVEGAGAVP
FT                   LAALLNRRVTDLSGKTVCVLSGGNIDVKTISVVVERGLVAAGRYLKLKVELDDLPGALA
FT                   RLATEIAEAKANISIITHDRRSKSLPIGKTEVLIELETRGFEHIQEVISHLQGVGYLVD
FT                   VLK"
FT   gene            complement(505019..506014)
FT                   /gene="dmeF"
FT                   /locus_tag="KN400_0474"
FT   CDS_pept        complement(505019..506014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dmeF"
FT                   /locus_tag="KN400_0474"
FT                   /product="cobalt/zinc/iron/cadmium/nickel efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83337"
FT                   /protein_id="ADI83337.1"
FT                   /translation="MHADSHLDRSITGRLKYAIALTALTLVAEIVGGIWTNSLALLSDA
FT                   AHVFLDLFALVLSLAAIKLASYPASDTKTFGWHRAEVFASFINGATVFLMALGIFYEAV
FT                   GRLMNPEAVKSLPMLLIATLGLVMNLISATALHGHSHDDLNVRSAFLHVVGDAAASVGV
FT                   IVGGLIMYFTGWYVLDALISIGIGCVIFAGSWRVLREAAHILLEGVPRGMSTQQVANEM
FT                   AGVEGVNAVHQMNIWTICSHILALSAHVDVKPEYKGQQAEVLRQIEQLLFERYHITHTT
FT                   LQAECTRCVDGPVIKDLRHRPRHGQSHDDHHHAHAHCTHGPHGHHHGHSH"
FT   gene            506172..507122
FT                   /gene="trxB"
FT                   /locus_tag="KN400_0475"
FT   CDS_pept        506172..507122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="KN400_0475"
FT                   /product="thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83338"
FT                   /protein_id="ADI83338.1"
FT                   /translation="MQATHHRLLILGSGPAGYTAAVYAARANLSPALITGLQQGGQLMT
FT                   TTEVDNWPGDPDGVLGPDLMDRMRRHAERFNTAMIYDHIHTANLRERPFRLEGDSGIYT
FT                   CDALIIATGASARYLGLPSEEAFKGKGVSACATCDGFFYRGKPVAVIGGGNTAVEEALY
FT                   LSNIASHVTLVHRRDKLRAEKILADKLIEKTRGGNVTIEWNHVLDEVLGDQAGVTGVRI
FT                   RHTSGSTKELDVHGCFIAIGHTPNTHLFEGQLEMDEGYIRTQCGAEGNFTATSIPGVFA
FT                   AGDVQDQHYRQAITSAGTGCMAALDAERYLDMLKP"
FT   gene            507128..508657
FT                   /gene="comM"
FT                   /locus_tag="KN400_0476"
FT   CDS_pept        507128..508657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comM"
FT                   /locus_tag="KN400_0476"
FT                   /product="competence ATPase ComM"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83339"
FT                   /protein_id="ADI83339.1"
FT                   /translation="MLAKALSSALLGIDAVIVDVEVDISPGLPQFATVGLPDGAVKESK
FT                   DRVKSALKNAGYDFPPRKITVNLAPADLKKEGAAFDLPISVGILAATGVVEGGRLKEYL
FT                   LLGELSLDGIIKPVRGCLSVAVAARNAGLAGIVVPRENAPEAAVVEGVDVIGVSELAEV
FT                   VEFLNGERRIDPHRVDVAELFERNAETGDDFAEVKGQEHAKRALEVAAAGSHNLLMIGP
FT                   PGSGKTMLARRIPTILPRMSFEEAIETTKVYSITGLLDREHALIAQRPFRSPHHTVSDI
FT                   GLIGGGNTPRPGEVSLSHYGVLFLDELPEFKKNVLEVLRQPLEDGKVTISRALMSLTYP
FT                   SRFMLVAAMNPCPCGYLGDAHHACSCTPLMVHRYRSRISGPLLDRIDIHIEVPAVKYRD
FT                   LADGREGEGSLDISRRVESAREVQRDRFRGSKVHSNAQMTPRFIKKYCEPDSAGNRLLE
FT                   LVTDRLGLSARSYSRILKVARTIADLAGSEQVREEHLSEAIQYRTLDRKTF"
FT   misc_feature    508728..508764
FT                   /note="conserved nucleotide sequence; KN400_R0130"
FT   gene            508909..510504
FT                   /gene="ato-1"
FT                   /locus_tag="KN400_0477"
FT   CDS_pept        508909..510504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ato-1"
FT                   /locus_tag="KN400_0477"
FT                   /product="succinyl:acetate coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83340"
FT                   /protein_id="ADI83340.1"
FT                   /translation="MSEYGTLQDRVRCKSLLNKVMSAEETIQFFKPGMNLGWSGFTPAG
FT                   YPKAVPIALADHVEKNSLQGKMKFNLFIGASVGAETEDRWATLDMIDRRWPYQTGKNIA
FT                   AGINEGRIRMGDKHLSLFAQDLGYGFYTKDSETGKLDLAIIEVSAITEDGGLVPTTSCG
FT                   VIPEILMICDKIIVEVNTGQPSFEGMHDIVVCNHPPKRQILGITHAGERIGTTYVPCDP
FT                   SKIIAVVESKYRDKGRAFSEQDDTSEAIANNIIDFFSHEVKMGRLPKNLLPLQSGVGSI
FT                   ANAVIGGLAKGPFSNLTVYTEVLQDTMLDLFDSGKLDAASSCSLSLSETPGFPRFFENW
FT                   EKYFDKITLRPLSISNAPEPIRRLGCIAMNTPVEIDIYAHANSTLVGGTRMINGLGGSG
FT                   DFLRNGFLKIMHTPSSRPSKTDPTGISCVVPHCSHIDHTEHDLDCVVTEQGLADLRGLA
FT                   PKDRAKRIIEKCAHPDYKPILSEYLAIASADCLKRKVGHEPQLWDRAFKMHLNLERNGT
FT                   MKIKNWDVKVDLCE"
FT   gene            complement(510608..511960)
FT                   /gene="rhlE-1"
FT                   /locus_tag="KN400_0478"
FT   CDS_pept        complement(510608..511960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlE-1"
FT                   /locus_tag="KN400_0478"
FT                   /product="ATP-dependent RNA helicase RhlE"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83341"
FT                   /protein_id="ADI83341.1"
FT                   /translation="MTFAELKLAPHILKAVAACGYTEPTPVQAAAVPRALENVDLLATA
FT                   QTGTGKTAAFVLPALQRLSSPPQGPGRGPRVLVLTPTRELAQQVTDAVRTYGAFMRVRS
FT                   GAILGGMPYHAQLRLLSAPVDFIVATPGRLVDLLDRRSLDLSRLELLVLDEADRMLDMG
FT                   FSDDVDRIAAASPATRQTLLFTATMDSAMARLAGRLLREPERIDIAGTKTTHEHIEQRL
FT                   HVADDLHHKNRLLRHLITDESLRRAIIFSATKRDAENLALELKAQGHSAAALHGDMPQN
FT                   ARNRTIAAMKQGRIRLLVATDVAARGLDVTGISHVINFDLPKFAEDYVHRIGRTGRAGA
FT                   SGIAISFASLNEVNYLARIERYIGQTLPEHHIPGLEPSRPLRRVSAGSGRKPGMGAGPA
FT                   RKGSSNRPSGAAPGRSGKSSDRTSWGSRRSKDPVVEYRTGRHGAGQPRRSS"
FT   misc_feature    complement(512086..512328)
FT                   /note="conserved nucleotide sequence; KN400_R0131"
FT   gene            complement(512388..513272)
FT                   /gene="xerC"
FT                   /locus_tag="KN400_0480"
FT   CDS_pept        complement(512388..513272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="KN400_0480"
FT                   /product="site-specific recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83343"
FT                   /protein_id="ADI83343.1"
FT                   /translation="MEFEVTTFIRYLENERAVSPHTRAAYESDLAQFRDFVRGELGAGA
FT                   GAAAISHLLVRRWLAQLHQSHARSSIGRKLAAVRAFFTYLVRTGALPRNPAELVSTPKR
FT                   EKKVPFHLNIDEVTALVESPREPGVLSLRDRAILETLYSCGVRVSELTGLNVGGIDLAD
FT                   GTVRVLGKGGKERVVPIGSHARLALSSYLAARNHPPLEVPLFTNARGGRLTARSVRRVV
FT                   DKHILKVAAMRKISPHTLRHTFATHLLEGGADLRAIQELLGHASLSTTQKYTHVGIDRL
FT                   MEVYDKAHPKART"
FT   gene            513463..514722
FT                   /locus_tag="KN400_0481"
FT   CDS_pept        513463..514722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0481"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83344"
FT                   /protein_id="ADI83344.1"
FT                   /translation="MKRVVIIGMGFGGIRAARTLAQKGLDVVLVDRNNYHLFQPLLYQV
FT                   ATAGLEQESIAYPVRAMARGWTGTRFQLAEVTGVDFEARQVVTDNGTIPYDYLVIGAGS
FT                   VTNYFGLKSVEQHAFDLKELVDAERLRNHILTAFERAVVEPDPAKRRALMTFVIVGGGP
FT                   TGVEFAGALIELVRYVLTKDYPELSVQAARVVLVEAFDRLLAAMPAELQGYTLEKLRGM
FT                   GVEVLLNARVVDAGPERVTLHDGAVIPAHTLFWSAGVKAAPLAATLGVEQNPGGRIAVE
FT                   PDLTLPGHPDVYVVGDMAWLEQDGAPLPMVAPVAMQMGIHAGKSILAREQGAPAPPFRY
FT                   HDKGSMATIGRSAAVASAFGMNLRGYAAWIAWLLLHLYYLIGFRNRIVVMLNWIWYYWF
FT                   HERQVRLITERETPGNGCTR"
FT   gene            514710..515840
FT                   /locus_tag="KN400_0482"
FT   CDS_pept        514710..515840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0482"
FT                   /product="DUF362 iron-sulfur cluster-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83345"
FT                   /protein_id="ADI83345.1"
FT                   /translation="MHTVAVERAARYDPSEVAEAMDRALASLGGMDTFVRPGERVLIKP
FT                   NMLAAKAPERAVTTHPEVLRAVIRLVRKAGGIPLVGDSPGIGGFRAVAEKSGMAAVVRE
FT                   AGAELVPFDEAVAVPGSGLFRRMDVARPYLEADRLINLPKLKTHEMMTMTCAVKNLFGA
FT                   VVGTAKAGWHLKAGADRELFARLLLEIYLLRPPDLTIVDGIVAMEGDGPGSGDPRPMGL
FT                   ILAGANAVAVDVVAAELAGIPKQLLWVERAAERLGIDGWDRSRIATVGLPPDDARVPDF
FT                   RLPHLSDVQFGIPGFLKNRLRHHLTARPVPNPEGCHLCGACLDACPPRAISVRDGRLHF
FT                   DYHACIRCFCCRELCPDSSLGVRDGVLLKLLKKFKE"
FT   misc_feature    515922..516066
FT                   /note="conserved nucleotide sequence; KN400_R0132"
FT   gene            516140..517348
FT                   /locus_tag="KN400_0483"
FT   CDS_pept        516140..517348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0483"
FT                   /product="efflux pump, RND family, membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83346"
FT                   /protein_id="ADI83346.1"
FT                   /translation="MKKAAIIAAVVIVAVAGIYFAFGKREPERTYKTAKVERGDVVATV
FT                   SATGNLSAVTTVQVGTQVSGTIYRLLVDYNTPVKKGQVIAEIDPALFRADVEQARGNLL
FT                   SAQANLLKARATAADAKRTMERNRQLVKEGVVSQSDFDTAETGAQEAAAAVKAAEASVV
FT                   QTRGALSRAETNLKNATIRSPVDGVVISRAVDVGQTVAASFQTPTLFTIAQDLTRMQIE
FT                   TSVDEADISRVRMGQQVTFTVDAYPDEKFNARVAQIRNAPVITQNVVTYVVVITVDNPD
FT                   LKLKPGMTANVAIEVGKKEKVLKVPMAALRFKPRADGDEGERRAPSGPAKAKREAGQQV
FT                   FILSPEKKPVPVKVQTGLGNDSHVEIVSGALKEGDEVIVQETTPRDKQKSGGSGRSPMG
FT                   MRF"
FT   gene            517349..518056
FT                   /locus_tag="KN400_0484"
FT   CDS_pept        517349..518056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0484"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83347"
FT                   /protein_id="ADI83347.1"
FT                   /translation="MGAVVRLDNVAKVYTMGDQRVEALRGISFSVEQGEFIAIMGSSGS
FT                   GKSTCMNMLGCLDVPTSGTYLLEGVNVGDLSQNELAAIRNRKLGFVFQGFNLLPRTTAR
FT                   ENVELPLVYAGVNAAQRRERALAALAMVGLAERAGHYSNQLSGGQQQRVAIARALVNAP
FT                   ALLLADEPTGNLDSTTSEEIMRIFAELHGKGITILMVTHEPDIAAWASRSITFRDGRII
FT                   ADTTVPAPGEGQA"
FT   gene            518053..519279
FT                   /locus_tag="KN400_0485"
FT   CDS_pept        518053..519279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0485"
FT                   /product="ABC transporter, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83348"
FT                   /protein_id="ADI83348.1"
FT                   /translation="MNLLMSLRISLRALLANKMRSFLTMLGIIIGIAAVIIIVAIGSGA
FT                   QKVVSDVIASIGSNIILVIPGSTTSGGLRIGAGSVPSLTQDDARAINTELPSVLRAAPT
FT                   VRGTAQVVAGNMNWSTMIMGVTPEFLQVREWQVVSGRELSPSDIEGASKNCILGQTVAE
FT                   NLFGSEDPIGKTVRIKRVPFIVVGLLDRKGQSPQGSDQDDIILLPLSTAQRKILGSQFP
FT                   NTVGAIMVQAKSRELMDQAEEELTTLLDQRHRIGPAKERDYTVRNLTEILAASEQSQKM
FT                   LTILFGAVASISLIVGGIGIMNIMLVSVTERTREIGIRMAIGARQRDILLQFLAEAVLL
FT                   TLLGGVIGMAIGIGGATLISQFFGWPTMISSKAILLAFAFSGGVGIFFGFYPARKAAGL
FT                   NPIEALRYE"
FT   gene            519310..519480
FT                   /locus_tag="KN400_0486"
FT   CDS_pept        519310..519480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83349"
FT                   /protein_id="ADI83349.1"
FT                   /translation="MKTLLVFLAVTLLNGAFLYPLFYLGLGREVSWWLVAAMVVVGAFC
FT                   IYLLVRYRKSL"
FT   gene            complement(519488..520093)
FT                   /locus_tag="KN400_0487"
FT   CDS_pept        complement(519488..520093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0487"
FT                   /product="zinc metalloendopeptidase, M23 family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83350"
FT                   /protein_id="ADI83350.1"
FT                   /translation="MTRRILAILLSLSLAVGLGSSPAAAARRLPVDGGTVTSGIGWRID
FT                   PFGSGRQVYHHGVDIAVPEGTPVYPTERGMVLHAGLYKGYGNLVAVDHGNGYVSLYGHN
FT                   ATLLVTEGQKVDTSTVIALSGNTGRSTGPHVHYEVRQIPGYTQKARDRMEEQLKVLVAE
FT                   RIEGWVEDHVATAQGDGTDTGPRDPLAELALPSDDGFQ"
FT   gene            520449..522245
FT                   /gene="typA"
FT                   /locus_tag="KN400_0489"
FT   CDS_pept        520449..522245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="KN400_0489"
FT                   /product="translation-regulating membrane GTPase TypA"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83352"
FT                   /protein_id="ADI83352.1"
FT                   /translation="MQERIRNIAIIAHVDHGKTTLVDAMLKHAGVFRENEAITERVMDS
FT                   NDLEKERGITILAKNLSVHHGRYKINIVDTPGHADFGGEVERVLKMVDSVLLLVDALDG
FT                   PMPQTRFVLKKSLDLGLKPIVVINKIDRPGSRPDEVVDMVFDLFCELNATDEQLDFPIV
FT                   YTSAKLGFAKLDLNSDSNSMEPLFAVIESNVHPPAGDSKAPFQLLVTNIDYNDYIGRIA
FT                   TGRIFNGRVKAGETVALVRRDGSIERGRITKLLGYEGLKQVEIPEACTGDIVTVAGFDD
FT                   VGIGETLAAADNPVALPYVSIDEPTISMNFIVNSSPFAGREGKFVTSRNIRERLDRELR
FT                   TNVSLRVEDTANADTFKVSGRGELHLSILIENMRREGFEMAVSKPEVILRVIDGTKMEP
FT                   MEYLVVDVPSEFQGAIIEKMGPRKGEMTSLQPMGETVRLEFVVPARGLIGLRGELLTET
FT                   RGTAVMTHTFHDYAPYKGDIPGRKNGVLIAMELGETTAYALDALQPRGILFIGPGVEVY
FT                   GGMIIGQHAKDNDLDVNPCKGKKLTNVRASGSDDAIKLTPPRILTLEQALEFIDDDELV
FT                   EVTPQSIRLRKKELDPNKRKRK"
FT   gene            522361..523125
FT                   /gene="yfiO"
FT                   /locus_tag="KN400_0490"
FT   CDS_pept        522361..523125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiO"
FT                   /locus_tag="KN400_0490"
FT                   /product="outer membrane protein assembly lipoprotein YfiO,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83353"
FT                   /protein_id="ADI83353.1"
FT                   /translation="MNVSRLCSLYPTLLIPLLFVAGCGLFASSTAPVSRSPESMAREAE
FT                   EFQSSRRFEDAIAQWRKVKESYISPELITLAEIKIADAQFDSGNYIEAAASYEEFRKLH
FT                   PNHEKSAYALYRQGLSYFNQIHGFDTDQTPVSNTVTIFESFLRLYPQSEYAEEVRNKLD
FT                   AARQNQVQYEIYVGQFYYRTEKYTSAIKRLEDALKRYPRSPLHDETLYYLGKAYIKAGD
FT                   KAGGREAFQRLFNEFRTSKYVDEARSFLDKNF"
FT   gene            523127..523498
FT                   /locus_tag="KN400_0491"
FT   CDS_pept        523127..523498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0491"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83354"
FT                   /protein_id="ADI83354.1"
FT                   /translation="MRRLAALLFLLSLAGCGSDRRAVEEVLRLREEALSRGDAALYASL
FT                   LAPAYRQARPDLEQNLLISGPIGYRSLERRIRLDGTTAEVAGRYVMKANVKGRILELAG
FT                   QETIVLHREKDGWKIAGGL"
FT   gene            523530..523904
FT                   /gene="crcB"
FT                   /locus_tag="KN400_0492"
FT   CDS_pept        523530..523904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="KN400_0492"
FT                   /product="chromosome condensation membrane protein CrcB,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83355"
FT                   /protein_id="ADI83355.1"
FT                   /translation="MTTILAIAVFGAVGCVARYLLAGGVYALAGRAFPWGTLAVNVIGA
FT                   FLIGLIMEAALRTTLMSQELRLGLTIGFLGGFTTFSTFSYETFKLLEDGEFFSASLNVL
FT                   ASVALCLVGTWAGIMAARQL"
FT   gene            523914..524273
FT                   /locus_tag="KN400_0493"
FT   CDS_pept        523914..524273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0493"
FT                   /product="protein of unknown function DUF190"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83356"
FT                   /protein_id="ADI83356.1"
FT                   /translation="MTRFIGEKILMRIFIGEGDRWGSRPLHEALLELLRREGCAGATVL
FT                   RGVAGFGASSVCHTARLLDLSADLPMVVEVVDDQERLDALMPKIDDMMTGGMITLEKAT
FT                   VIRYTPAGKGGAATP"
FT   gene            524270..524779
FT                   /locus_tag="KN400_0494"
FT   CDS_pept        524270..524779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0494"
FT                   /product="rhodanese homology domain superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83357"
FT                   /protein_id="ADI83357.1"
FT                   /translation="MKSDPKRLAAEMAIIVVVAAIIGITWNYRLLADVFQGRAVGAGTS
FT                   DPPPAATVASAPIPLPLGLMQVKELFDRNEALIIDARDRDSYGAGHIRGAVLLPLGEAD
FT                   QLIPPLAANTPKDRFLIVYCNGYDCHDSRALGEKLIRAGFGQVFVFEGGFPEWRDAGYP
FT                   VARGGA"
FT   gene            524779..525195
FT                   /locus_tag="KN400_0495"
FT   CDS_pept        524779..525195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83358"
FT                   /protein_id="ADI83358.1"
FT                   /translation="MDAVKRHLTALLRVALGAVFLYAAVIKIANPPAFAGNVAAYQLLP
FT                   YAGNYLVAAILPWIEAICGLLLVTGWRARSAAALVAVMNILFIVLLISTVARGLDIDCG
FT                   CFRQGGEKTSAWTAIFRDIMLLVAAVFVFRKTKQ"
FT   gene            525269..525853
FT                   /gene="plsY"
FT                   /locus_tag="KN400_0496"
FT   CDS_pept        525269..525853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsY"
FT                   /locus_tag="KN400_0496"
FT                   /product="acyl-phosphate--glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83359"
FT                   /protein_id="ADI83359.1"
FT                   /translation="MLNELILTAVAYIVGSIPTGLLLARASGVDIRATGSGNIGATNVY
FT                   RTLGRTVGIATLLGDCLKGLVPVLVARKLGFADPWVAAVGLAAFLGHVYTIFLGFKGGK
FT                   GVATALGVFLGVSPLSVLGALALFIGIVATTRYISLGSIIAAAAMPLFVAAVERRPLLV
FT                   GMTLVIAVIVIVKHRENIRRLREGTENRFKA"
FT   gene            525850..526872
FT                   /gene="yceG"
FT                   /locus_tag="KN400_0497"
FT   CDS_pept        525850..526872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceG"
FT                   /locus_tag="KN400_0497"
FT                   /product="protein of unknown function YceG"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83360"
FT                   /protein_id="ADI83360.1"
FT                   /translation="MKVSVNLRDRRLLVVAALIIASILAPLVRYGLFLAVPAGNGKNVR
FT                   ILSFEKGATPRRIAGELEAAGLITSARLFVFHARLHGEAERLKAGEYQFSDAMKPAEIL
FT                   HKLVAGEVYAQPFAVPEGYSMYQVAELLEGKGMFSRERFLAAATDPSFLAELGIQSSSV
FT                   EGYLYPSTYAVSRSMDEKDLIRVMVSQFDKIYAAGFAEEARRRGISRHRVVTLASMIEK
FT                   EAVSPAERPLISSVFHNRLAKGMRLQSDPTAVYGVRAFGGNVTRQDILRNTSHNTYRIA
FT                   GLPPGPIGNPGRDALAAALNPAATRYLYFVARKDGTHHFSATLVEHNAAVQRYLKDPTK
FT                   "
FT   gene            complement(526930..529464)
FT                   /gene="sfrA"
FT                   /locus_tag="KN400_0498"
FT   CDS_pept        complement(526930..529464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfrA"
FT                   /locus_tag="KN400_0498"
FT                   /product="NADPH oxidoreductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83361"
FT                   /db_xref="GOA:D7AF63"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/Swiss-Prot:D7AF63"
FT                   /protein_id="ADI83361.1"
FT                   /translation="MVSLTIDGKDITVAKETTILDAAALLGITIPTLCWLKKVSPTGAC
FT                   RVCAVEIEGVDRPMTACNTPVKDGIKVTTQSEKLSRIRQKIMELMLVNHPLDCPVCDAG
FT                   GECDLQNACYGLGAAKQEYGAVLERRKIRYDWPLIESDPNRCILCEKCVKVDHEIVGCN
FT                   AIRVVNRGEATIIDTVDGNPLNCEFCGNCVAACPTGTLISKPFKFRGRPWAFTTTPSVC
FT                   PFCATGCQIEYHSRNGRVERVTSDDSTYNSGNLCINGRFGYSYINSPDRLAEPMVKGQK
FT                   ADWNTAMGTAATALKQIVASHGADAVAGFGSPRVTNEDNYLFQKLMRSAIGTGNIDSEA
FT                   RLGFAATQKVLREMLGIAGASTTIDAIDRATAVLVVGCDLNAEATGMEYRVIKAATKNN
FT                   AKLVLAAMRDIKLKKFANSHLKYRPGNETLLINALTKAVLEEGLENKEFCSANISNLSD
FT                   LTAALAGVSIADAAAATGVTEADLRAAARLVGGKKGVAVIFGAELMRGGNTDAVKALIN
FT                   LALILGATAGDTGGLFPVYEKTNIRGLLDMGVAPDHFPGHQTDGTTFEKAWGKKLPAAA
FT                   GKDLWQIIEGIEQGSVKALYLLGCDPVASFPEGERIRKALEKLELLIVQDPFPGEAAKM
FT                   AHVVFPSSVAAEKNGTFTTIDGRVQPLAKAVAPSGDAREDWDILTELYNRLTGESRIHS
FT                   PAAVLDEVAALVPAYASVGRTGGTITAQPRSGGLALAPVSARAVAGSPTTLLVGTILYH
FT                   SGTTTTWSKNNLEIIPKGYIEIHPNDAAKLGIAEGGKVRLSAGSVKVEGTAKITPRVQP
FT                   GLLFAPSHFRGMNVNALLSRDGGVVPVTVEKA"
FT   misc_feature    complement(529465..529587)
FT                   /note="conserved nucleotide sequence; KN400_R0133"
FT   gene            complement(529588..531606)
FT                   /gene="sfrB"
FT                   /locus_tag="KN400_0499"
FT   CDS_pept        complement(529588..531606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfrB"
FT                   /locus_tag="KN400_0499"
FT                   /product="NADPH oxidoreductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83362"
FT                   /db_xref="GOA:D7AF64"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="UniProtKB/Swiss-Prot:D7AF64"
FT                   /protein_id="ADI83362.1"
FT                   /translation="MAQVVFSSWGRTIVDNRKGGEAQDVSFRLPTTLDGERQIAAFMGW
FT                   DGIILYDLKVDVPAMAAEYMKRVQTQYCCGKCTPGKKGTKVLADVLAAIIEGRATEADL
FT                   DTIDDLADLLTNCKCTLCQSSTIPVLDAVKHFREDFLAYITGIRKPANVHRFIDKYTAP
FT                   CMDRCPAHIDIPAYIEAIKEYRFDESLDIIRDNMPLPSVCGRVCPHPCETHCRRKNVDD
FT                   SVNIMVLKRSASDYEWMHNAAPPMQPKPQKNKKVAIVGAGPAGLACAYYLALEGYPCTI
FT                   YEALPEGYGGGMIAVGIPPYRQPRHLLQRDIDIISSMGVDIIYDTRIGKDISLEELKQK
FT                   FDAVFLAPGAHRSKPMGVEGEDKGYKGFLKGGIDFLREAYMGRPTGMGKKVVVVGGGNT
FT                   AIDCVRVALREGAEESTLLYRRSRKEMPADVWEVDGADEEGVRFEFQVLPTRVLVDENE
FT                   QVTGVECVRMALGEPDASGRRRPEPVPGSEFVVECDTVIPAIGQDPDLSFIPDNLGIDI
FT                   TKWNTVVTKYVPLKDAAGKDLKDGMGNPLARVLITDLEGVFAGGDAEIGPLTVVACIGN
FT                   AHRAARVIQRWLEEGKAYLTEDELMEDILTNMPVYDKNEKVPWLDSRERAHQAEVHGQE
FT                   RASKGNYQEVELGFVDTQAVEEAERCLRCYRVAMAAI"
FT   misc_feature    complement(531609..531747)
FT                   /note="conserved nucleotide sequence; KN400_R0134"
FT   gene            531876..533000
FT                   /locus_tag="KN400_0500"
FT   CDS_pept        531876..533000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0500"
FT                   /product="leucyl aminopeptidase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83363"
FT                   /protein_id="ADI83363.1"
FT                   /translation="MYREAFASLFGINMGVTAGERILVFGDRARSDEVLSAEDAVRRQR
FT                   LLAVAEEAGRYADTSYGNASFVSFPATAASGAEPPEVLWRAAFGDAAVNALAAEGVLTR
FT                   LLAKEATPEDLERARRVVLSNRHAAAQVVVALSNNSTSHTRFRHLVNAVGGRFASLPHF
FT                   DPDMFFSSMRVDWHQLAERTRRVADAVNGATALRVETPNGTRMSFSKEGRVAKGDDGLL
FT                   SAAGSFGNLPAGEVYLAPLEGTSEGVMVLEWGPTRRLDTPVELVVRAGAVVEVRGDDLL
FT                   RAALERKFAESDLNRNIAELGIGTNDRATRPDNVLEAEKILGTIHIALGDNSGFGGTVQ
FT                   TPFHEDYVFYRPTLILVSEAGTETVLLRNGSLLL"
FT   gene            533090..534730
FT                   /locus_tag="KN400_0501"
FT   CDS_pept        533090..534730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0501"
FT                   /product="protein of unknown function DUF342"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83364"
FT                   /protein_id="ADI83364.1"
FT                   /translation="MAGEIEDAKVGLTFRLDGGGYKLSASFVPTDEKPPINLTWIKQAL
FT                   AAAGFADLYLYEHALVELLKRYNAASQPFTFDLGERRNGSFTITCTPDNLEARLTIIPA
FT                   YGGKAVAAEQVRQALKEKGIVFGVDEEAINRAIADGVASDLLVARGIPPQSGTDGELVS
FT                   FVPEIRDRQPQLLDDDRVDYRNLGQILSVRAGEPLMRRIPPVEGVAGTSITGKAISSPP
FT                   ARDVAFAPNLPGTAFDADDPNLLVAAVDGQPVLVANGIVVEQVLRLKLVDLSVGNLDFN
FT                   GTIDIAGDVVAGMTVKASGDIIIGGVVEASRIEAGGNIEVRGGVIGQGDTRSSAAEAGR
FT                   DTVRIRAGGCVSAQFVENAFVEAGDSIQVQEFCMQSELVAGNQIVVGHDGGSKGHVIGG
FT                   SCQAINLVRAVTLGSHAGVHTTVSVGVDPHVRERFSTVRLKLQEKEREMDELAKKLEYY
FT                   VSLPSAQPEQVARTREARDKLQSVISELTGEKKRLQKRLEQVASAQVVVEREALVGVVI
FT                   SIGAKVFQVDEDLGATVFRIEEGAIVASS"
FT   gene            534833..535426
FT                   /locus_tag="KN400_0502"
FT   CDS_pept        534833..535426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0502"
FT                   /product="dephospho-coenzyme A kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83365"
FT                   /protein_id="ADI83365.1"
FT                   /translation="MNIIGLTGGIASGKSTVSRILERLGAVVIDADQLAREAVMPGTSA
FT                   HRSIVAAFGEGILLPDGAIDRKALGSIIFADSSARKRLEAITHPAIRDLAELRLAELRR
FT                   SGVPVAVYMAALLIEAGATDRVDEVWVVYVDRETQVRRVMARDGLSRSEAEQRLAAQMP
FT                   MEEKAARGQVVIDNNGTPEELERRIEEIWAKRFP"
FT   gene            complement(535458..536240)
FT                   /locus_tag="KN400_0503"
FT   CDS_pept        complement(535458..536240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0503"
FT                   /product="helix-turn-helix transcriptional regulator, IclR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83366"
FT                   /protein_id="ADI83366.1"
FT                   /translation="MAKKDKSEYIIQAVDHALDLLEQFHDDVDELGVTELSKRLKLHKN
FT                   NVFRLLATLESRGYIEQNKVTENYRLGLKTLELGQTFIRQMGLLRQSRPVLEWLVNQCN
FT                   ETAYVAILKDQSIVYLDVVETDLTVRVVPRVGSRLPAYCTAAGKVQIAWMNDEELDSFF
FT                   PQRELKPFTPNTITDREVLRKHLREVVEQGYAVDNEELDIGVRCVGAPIRDYTRRIIGA
FT                   VSLSGPSMRFTDERLDKELIPLVKKAADEISMKLGFHR"
FT   misc_feature    complement(536380..536405)
FT                   /note="conserved nucleotide sequence; KN400_R0135"
FT   gene            536554..537009
FT                   /gene="usp-1"
FT                   /locus_tag="KN400_0504"
FT   CDS_pept        536554..537009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="usp-1"
FT                   /locus_tag="KN400_0504"
FT                   /product="universal stress protein Usp"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83367"
FT                   /protein_id="ADI83367.1"
FT                   /translation="MLHLRKKILVAIDGSPLSDKAAEEAVRMAAGNPSQFKSKIYAMLV
FT                   LPNAPRSTFTDFVPPPPITETPEWEELRQRVFYVIEKNAREADIPLEIRVVYGEPAEEL
FT                   VKFADKEQIDVIVLGSSGKGFLKRQLLGSVSHKVVKTASCSVYIVKG"
FT   gene            complement(537142..537933)
FT                   /locus_tag="KN400_0505"
FT   CDS_pept        complement(537142..537933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0505"
FT                   /product="TIM alpha/beta-barrel protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83368"
FT                   /protein_id="ADI83368.1"
FT                   /translation="MRISLSTGTLFTFPLGKVMRIAREAGFDGVELIINQDFQKVNCRK
FT                   LIEELAEILPINSIHAPFMPLDGWGGPIDSLERCVELAAGAGIPLVNFHPPSWMGFEIG
FT                   FWRWLYRVMDFQKEVGRETVIVTLENMPWVGTRFRVNPHILSNTEKLIEFIQERNLYMT
FT                   FDTTHMGSGKANFINDFYHCYNSGRIRNIHFSDYGHGREHLIPGHGILPLTRFLNHLRS
FT                   TDYADTLTLELSPEEFPRDERIIVESLREILQYLRRETSPA"
FT   gene            complement(537939..539153)
FT                   /locus_tag="KN400_0506"
FT   CDS_pept        complement(537939..539153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0506"
FT                   /product="nucleotidyltransferase DUF294, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83369"
FT                   /protein_id="ADI83369.1"
FT                   /translation="MPLFLAVKNDDVLSRRGTADFLEGMRRDLFARLKSLPPGGECRLL
FT                   KGVTEALDKELAFEDAFGQDFPRLLAETETATDVNGLIDLQRQLAEKAAEYFRQRGSVP
FT                   AFDILCTTMTDYLTRRALQLAFRWMEEHGPAAPAVGWAWLALGALGRGEAGLSGAADFA
FT                   VIHDGEAPEETSFFVGLAGRAAGILERLGLASPGGVTPVGAAWRGSMTDWRKRITSRVT
FT                   EGDGDLGWLIGLTDLRCVAGDSALAEGMNNLVRSMLAFHRDQFRETARHISMMPSGFDF
FT                   FGRFRTERIGESRGMFNLGYYGISPLVANVRVLAVHAEIPETGTIERIRALLRKGHMDV
FT                   DLAERLLRACHCFGRRRAAMGGEASGIYVDTARLTEQEEDELKAGIEAVGTLQRLVYTT
FT                   ITGQG"
FT   gene            complement(539175..540698)
FT                   /gene="aplD"
FT                   /locus_tag="KN400_0507"
FT   CDS_pept        complement(539175..540698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aplD"
FT                   /locus_tag="KN400_0507"
FT                   /product="sodium/solute symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83370"
FT                   /protein_id="ADI83370.1"
FT                   /translation="MTDANLVPLLIVTAALATFIITGLRARAREAGDYGFGGRYIGRIG
FT                   GGAAIASNWMSAASFLGMGGLLYLQGYYALAYVIGWTGGYVLLLVLMAGQIRRFGKYTA
FT                   PDFVGDRYASPGARLISAAISITISVIYCTAQFKGIGMLFGWLFATDYRTGVILGATVA
FT                   VGYVILSGMLGVARNQQLQYTLLIVSFILPLMALAHKLGYFWVLPQFGYGVAIQDLKRE
FT                   FGINFAAPFASAGLFQWVALCFTLMVGTAGLPHVLSRFYVVPNIRDARWSLVWGLFFIA
FT                   LIYWSAPAYAVFARLLEARSGMAPPPVAAGKMADIIVIKTAVMGGLPSWMIGILAAGAM
FT                   SAAFFTVAGLLITGAASLSHDIYYRLINPRASEGSKMALAKGAVVVLAAIVLAIALNPP
FT                   GLIAEITAVAFALAGNTIFPAFLLGIWWSRANRHGVIAGMLTGVLITFSTPLFGGLVPA
FT                   VAKVFPLTSSALIGAPLVIGVMIVVSLLTPPPPEAVRRFLAEQVHGHMD"
FT   gene            complement(540691..541017)
FT                   /locus_tag="KN400_0508"
FT   CDS_pept        complement(540691..541017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83371"
FT                   /protein_id="ADI83371.1"
FT                   /translation="MNDPQKLCDVNFFRPRKGYMTGEVAIIAAVLVGWAVANFGFQGVL
FT                   ALLAQSPDGEGILTRLTFLSFPWHFWFTGQFLPLWFIILCVLFNIYIDRHTEQHSRRRD
FT                   RSHD"
FT   gene            complement(541094..542320)
FT                   /gene="truD"
FT                   /locus_tag="KN400_0509"
FT   CDS_pept        complement(541094..542320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truD"
FT                   /locus_tag="KN400_0509"
FT                   /product="tRNA pseudouridine 13 synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83372"
FT                   /protein_id="ADI83372.1"
FT                   /translation="MARDEHDSRYLTAELPGTGGLFKETPEDFLVEEISLYLPCGEGEH
FT                   TYAVIEKRGITTLEAIRRLCRATGAPERDTGYAGMKDARGITRQTVSLPRVTPAEVMGL
FT                   NIPGIRILSADRHRNKLRLGHLAGNRFRLRLRETVPDAADRARAILDVLARRGVPNRFG
FT                   EQRYGIQGNSHLVGRAMLAGDWRGAVDLLMGDPAKVEGERWRAAIEAYRQGDLAGSLSL
FT                   FPGHCRTERDVLQRLAKRPDDFERAVHGVHPRLKKLYLSACQSALFDRVLETRLQTIDH
FT                   VMEGDLAWKHDNGACFLVTDAKAEAPRAERFEISPTGPLFGCRMTSPEGEPAALEKSIL
FT                   DAAGLTPAAFNLAGGLRMEGERRPLRVPLEGPELSCEEEDLVLRFSLPRGSYATAVLRE
FT                   VMKRPGNGA"
FT   gene            complement(542324..542953)
FT                   /gene="trmB"
FT                   /locus_tag="KN400_0510"
FT   CDS_pept        complement(542324..542953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="KN400_0510"
FT                   /product="tRNA (N7-methyl-G46)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83373"
FT                   /protein_id="ADI83373.1"
FT                   /translation="MQRIIPIDSPFFLNPDELGTPADWTAVFGNDNPLALEIGCGIGDF
FT                   IARTALDHPTTNFIAIDYYNKGCLKTCSRLERHGITNVRVVRAEARQFIVERIQKGSLA
FT                   AVYINCPDPWPKKRHRKRRLVNTQFVRFIRDYLAPGGDFYFATDFDDYGEDVAAFMPQM
FT                   PGYANMLAPDIFRHELEGYHLSKYMQKFMAEGKRIYFIHYRTTMEG"
FT   gene            543093..544424
FT                   /gene="rhlB"
FT                   /locus_tag="KN400_0511"
FT   CDS_pept        543093..544424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlB"
FT                   /locus_tag="KN400_0511"
FT                   /product="ATP-dependent RNA helicase RhlB"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83374"
FT                   /protein_id="ADI83374.2"
FT                   /translation="MKFADLNLPEQVMQGVADAGFSDCTPIQEKTLPLSLGGKDVAGQA
FT                   QTGTGKTAAFLISLFTKLLRSGRGGERRHPRAIILAPTRELVVQIEKDAQVLGAHCGFT
FT                   IQAIYGGVDYMKQKNALKEGADVVVGTPGRLIDYLKQKVYSLKEIEMLVIDEADRMFDM
FT                   GFIADLRFILRRLPPYDKRQNLMFSATLNQRVMELAYEFMNVPEKVAVTPEQMTAERVE
FT                   QVLYHVGRKEKFPLLLGLLRKEGMERTMIFVNTKREAEFLDERLNANDFPCRVISGDVE
FT                   QRKRLKILEDFKSGKLPIMIATDVASRGLHIDGVSHVINYDLPQDAEDYVHRIGRTARA
FT                   GAEGKAISMADEDGAFHLEAIHEYIKDKIPVEWAEDDLFVHDFKRVKPRPKGQETRAKG
FT                   PTRHGRKHPEAEKKEPEGEKKKRSRPRRKKNPAAGEGGTPPAAE"
FT   gene            complement(544493..546283)
FT                   /locus_tag="KN400_0512"
FT   CDS_pept        complement(544493..546283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0512"
FT                   /product="pyridoxal-5'-phosphate-dependent
FT                   chorismate-binding enzyme, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83375"
FT                   /protein_id="ADI83375.1"
FT                   /translation="MSGAPTVILASFDAERHSASYRFEEFVEAVTALTPAEVVPALRRV
FT                   EAAVAGGLHAAGFVSYEAAPGLDETLTTREPVPDTPLVWFGLFRRRIGFAPRLPECEQD
FT                   VPPGYETSQWSATLQREPYLESVGRIRQYITAGDCYQVNFTFRQQFRFTGDPQAWFHDL
FT                   CRAQRAPFCAFIDTGSLRVLSTSPELFFDLRQGTLTCRPMKGTARRGRWRAEDEELRAG
FT                   LAASEKERAENLMIVDLLRNDMGMVAETGSVRVESLFDVESLETLHQMTSTITARPQAG
FT                   VGLADLFRALFPCGSVTGAPKRRSMEIIRELEDSPRGIYTGAIGYVSPAAQGAPAPFEA
FT                   TFSVAIRTVVLDAASGQGQLGIGSGVTIGSTPSSEYDECLAKSRFARERVPDFQLVETL
FT                   LHEEGAGFFLLERHLARLYRSAAHFGIPLRLGSLQEILNRRAALMEGRQKVRVLVNRRG
FT                   AFTIQEAPLTEAPCPEPIPVRFAATSVDPADQFLYHKTTYRPLYRHELAAAPDCADVIF
FT                   VNRHGEVTEGTTANVAARIDGEMVTPPLAAGILPGTFREELLAEGALRERPITREELER
FT                   CPEIYLINSVRRWRPVTLIT"
FT   gene            complement(546280..547137)
FT                   /locus_tag="KN400_0513"
FT   CDS_pept        complement(546280..547137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0513"
FT                   /product="protein of unknown function DUF2400"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83376"
FT                   /protein_id="ADI83376.1"
FT                   /translation="MELKAVLDNLYASRSPRHLANDPLSFCHRYASPADREIAGLLASC
FT                   LAYGNVKIILRNLATVFGAVGPSPRRFVEEFEPEAGMRLFAGFKHRFNDGRDLCALFLA
FT                   ARTMIEEADTIGDFFLGCHDPEAEDITPSLTEFSSAILAFDYSPVFGTAAIPADSAFPF
FT                   FFPSPASGSACKRLCMFLRWMVRADDGIDLGLWKEISPAQLVIPVDTHIHRIARNLGLT
FT                   ARRQADWRTAREITAALRRLDPDDPVKYDFSLCHLGISEGCDGTVTPLCEACPVVKCCA
FT                   GELS"
FT   gene            complement(547280..547738)
FT                   /gene="dtd"
FT                   /locus_tag="KN400_0514"
FT   CDS_pept        complement(547280..547738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="KN400_0514"
FT                   /product="D-aminoacyl-tRNA deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83377"
FT                   /protein_id="ADI83377.1"
FT                   /translation="MKAVIQRVSEARVEVDGSTVGAIGRGILVLLGVEKGDTERDAAWL
FT                   AEKMAGLRIFEDDAGKMNLSVREVEGSILAVSQFTLAGNCAKGRRPSFDTAAPPDEGKR
FT                   LYDRFVDLIRETGIPTATGIFQADMKVHLVNDGPVTFILDTKSRSSST"
FT   gene            complement(547735..548256)
FT                   /gene="ymdB"
FT                   /locus_tag="KN400_0515"
FT   CDS_pept        complement(547735..548256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ymdB"
FT                   /locus_tag="KN400_0515"
FT                   /product="O-acetyl-ADP-ribose deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83378"
FT                   /protein_id="ADI83378.1"
FT                   /translation="MKGKIEIIPGDITTLAVDAIVNAANNSLLGGGGVDGAIHRAAGPE
FT                   LLAECRTLNGCATGDAKITAGYRLPAKHVIHTVGPVWHGGARGEPDLLRSCYRRSFEVA
FT                   HGAGLRSIAFPAISCGVYGYPLDEACSIALEETKAALERYPELERVIFTPFGAEAEAAY
FT                   RAALARVFGP"
FT   gene            complement(548401..550095)
FT                   /locus_tag="KN400_0516"
FT   CDS_pept        complement(548401..550095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0516"
FT                   /product="TrkA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83379"
FT                   /protein_id="ADI83379.1"
FT                   /translation="MKVLASELAYFLRGRARQNLKVLLLYCAFLLVMLLAYASIFRYLM
FT                   WHLEGREYSFMAGIYWTITVMTTLGFGDITFQSDAGYLFASIVTVSGVIFLLIILPFGF
FT                   VSMFLAPWIERRLRYHPTIELPDDTRGHILIFGIDPITRTLIRKLESRNHLFVVVTDNY
FT                   DQALHLEEQEGFKVVYGSPTDAHVLAGLRVAAARSIIANLSDPDNANLCLTVRSLCQTP
FT                   IIAVVKEPVHGELLRLAGANQVVPLTRILGRYLGIRATTCGALAHILDSFGNLQIAELP
FT                   VHGTPFAGKTIGESGIRQRTGLSIIGVWERGSLTTPQRETVLTEQSLLVLAGTKSQLAA
FT                   LEYLIGEAPEDELIFIIGHGRIGCAAAAFLDRKPVPFILIDRQESPVCNDHVVVYGDAT
FT                   VGQTLRQAGIDRASGIIVTTNDDSTNIFLTLACRHLHSHIRIVARANGEENVDQLYAAG
FT                   ADFVVSNASVGANILGNLLEHKESAFLSEGMAVFRRPLPPAMAGKTIAETRLRPLTGCS
FT                   IVAIEAPDRADILISPPPETILAEGARLILIGTSEQEKTFDQTIAAR"
FT   gene            complement(550117..550941)
FT                   /locus_tag="KN400_0517"
FT   CDS_pept        complement(550117..550941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0517"
FT                   /product="ferredoxin and NADH nitroreductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83380"
FT                   /protein_id="ADI83380.1"
FT                   /translation="MPELIVTDAACTRCGACVSVCPLRIVELPEGNLPPRFTEEGAGRC
FT                   IICGHCEAVCPTAALAVDDPRLDPAVYSPPTAPFAPAELDAYLRMRRSIRHFRPEPVPP
FT                   ETIAGMLDVVRYAPTGSNSQRVKWLIIHDTAEVRRLTGLVVDWLRSQQEGDTHLSRHFN
FT                   IAAMIRSWRKGNDPICRNAPHLAIAYTDRRHPTVAVDAVIAATHLDILAPAHGVGTCWA
FT                   GFFQMAAEAWEPLQQAIGLPEGHHAGYTLLLGYPAVTYRRPPRRNRLDVVWR"
FT   gene            complement(550929..551819)
FT                   /gene="nfo"
FT                   /locus_tag="KN400_0518"
FT   CDS_pept        complement(550929..551819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfo"
FT                   /locus_tag="KN400_0518"
FT                   /product="endodeoxyribonuclease IV"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83381"
FT                   /protein_id="ADI83381.1"
FT                   /translation="MKDYLGAHMSIAGGIHKAPARGNRVGCGVIQVFTQNSNQWRGKMP
FT                   TEGEAALFREQWEAAGLHEIIAHDIYLINLAAPPGETRDKSLAAFREEMERCTRLGIGT
FT                   IVMHPGAHLGDGEETGIRRICEAFNRLIPAVPEFTGVILLETTAGQGTSLGHTFEQLAA
FT                   IIAGTAFPDRFAVCFDTCHTFAAGYDFTTGEGYRRVFAEFDRLIGLDRLRCFHLNDSRK
FT                   GLNSRVDRHEHIGRGTLGLEPFRFLMNDDRFTTVPKILETPKGDDDEFDIMNLNTLRRL
FT                   VRRRTTKERTEPCPS"
FT   gene            complement(551824..552243)
FT                   /locus_tag="KN400_0519"
FT   CDS_pept        complement(551824..552243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0519"
FT                   /product="histidine triad (HIT) family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83382"
FT                   /protein_id="ADI83382.1"
FT                   /translation="MPPSCPMCTKWLDEPELRIAELGHTRVMLNRDQFFPGYTFVFTRE
FT                   HVTELFHLSPPVRQGVMEEVTAVAAALYDLFQPAKMNYELLGNMVPHMHWHLVPRFATD
FT                   PLWPRPIWSEPHAETLLAPEEYAGRIALIRDRLGL"
FT   gene            complement(552350..553198)
FT                   /gene="dapF"
FT                   /locus_tag="KN400_0520"
FT   CDS_pept        complement(552350..553198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="KN400_0520"
FT                   /product="diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83383"
FT                   /protein_id="ADI83383.2"
FT                   /translation="MKFTKMHGAGNDYVYVNCFEETVGNPEQTAIKVSNRNFGIGSDGL
FT                   ILIMPSDKADVRMRMFNSDGSESEMCGNGIRCVAKYAYDHGIVTKKEITAETGAGVLTL
FT                   QLFTGADGRVDRVRVNMGKPRLTRAEIPMLGDPGDGQVVGQPLNILHTTFNITCVSMGN
FT                   PHCVIFVDDVENFQVEKYGPLIENHEMFPRRTNVEFVQIISRTEVRQRTWERGAGETLA
FT                   CGTGASAVCVAGALNGLTEKNILNHLSGGDLELEWAEDGFLYMTGPATEVFSGEINLGT
FT                   L"
FT   gene            553355..553564
FT                   /locus_tag="KN400_0521"
FT   CDS_pept        553355..553564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83384"
FT                   /protein_id="ADI83384.1"
FT                   /translation="MELKNKIWMTGNLDWFAYIGDEEVWLGRREVPIPLDEGDRWTNSL
FT                   GFVFEVRNAEIVVVEKVEPPNITW"
FT   gene            553655..554059
FT                   /locus_tag="KN400_0522"
FT   CDS_pept        553655..554059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0522"
FT                   /product="cytochrome c, 3 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83385"
FT                   /protein_id="ADI83385.1"
FT                   /translation="MVVRALVVCLAALWAMFSRAPSLYAETVSHFGQVVDAAGATEDCL
FT                   SCHDGQIATDVGYCLGGCALSSAHPVNRPYPPRGKEQSFRSADELEGAGIRFINGMMVC
FT                   ISCHDLHNPGRHQLAIEMKESRLCFACHLK"
FT   gene            554209..554673
FT                   /gene="iscR-1"
FT                   /locus_tag="KN400_0523"
FT   CDS_pept        554209..554673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscR-1"
FT                   /locus_tag="KN400_0523"
FT                   /product="helix-turn-helix iron-sulfur cluster-binding
FT                   transcriptional regulator IscR"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83386"
FT                   /protein_id="ADI83386.1"
FT                   /translation="MKLSTKSRYGLRAIFDIAYNSGSLPAQVQDISRRQGISPRYLEQI
FT                   FQGLKRAGILKSKRGPQGGYCLAKKPEEITVADVLLATERDINLVECTSKRKKKGECTF
FT                   DGTCVTQELWCEAGAKLLDFFSGFTVKDLCDRGQQMGVKREQDHRFMYFI"
FT   gene            554694..555617
FT                   /gene="cysK"
FT                   /locus_tag="KN400_0524"
FT   CDS_pept        554694..555617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="KN400_0524"
FT                   /product="cysteine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83387"
FT                   /protein_id="ADI83387.1"
FT                   /translation="MPLLTNDKVIEQIGNTPLLRLAKLERKGSAAVFGKAEFFNPGGSI
FT                   KDRICLAMIEAAERDGTLKPGATVVEPTSGNTGIGLSMICAVKGYKLILTMPDTMTVER
FT                   RRLLAAYGAELILTPGAQGMRGAVMKAEELAAQPGHVMMHQFKNPANPDIHRRTTGPEI
FT                   VETLSGTTIDAFVAGVGTGGTITGVGEVLRTHNSSVRVVAVEPADSPVLSGGQPGPHKI
FT                   QGIGAGFVPDVLNTKVYDEIITVSNDDAYATVRDLAREEGILVGISSGANVFAALQVAA
FT                   KLGPGKNVVTILCDTGERYLSTGVFD"
FT   gene            555681..556490
FT                   /locus_tag="KN400_0525"
FT   CDS_pept        555681..556490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0525"
FT                   /product="adenosine nucleotide alpha-hydrolase superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83388"
FT                   /protein_id="ADI83388.1"
FT                   /translation="MEQTHLKYEQLKAILREMGSVLVAFSGGVDSTFLLRVAHDLLGDK
FT                   AVAFTATSPTYPESEFREAVGLARSMGARQVVVESNELEIPGFAFNPRNRCYHCKKELF
FT                   GLCGRTAAELGLAWVADGSNCDDLDDYRPGRAAAGELGVRSPLVEAGLTKADIRELSRE
FT                   LGLPTWDKQAFACLSSRFPYGTEITPERLRMVGACEEFLRENGFRVYRVRFHGDTARIE
FT                   TAPEEIPRLFDPSLRLRIAAFFREAGFAHVAVDLEGYRTGSMNTDAG"
FT   gene            556567..558786
FT                   /locus_tag="KN400_0526"
FT   CDS_pept        556567..558786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0526"
FT                   /product="sensor diguanylate cyclase/phosphodiesterase, PAS
FT                   domain-containing"
FT                   /note="domains: PAS, GGDEF, EAL"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83389"
FT                   /protein_id="ADI83389.1"
FT                   /translation="MPLRKNHNLKETLHEMVLGVSVAVGDQFFHSLLEHLTRALDVEYA
FT                   FIAEYTDREAMRVKTVAFRADGQEAEPLEFDLVGTPCERVVLDAYYCTPEGVCTLFPLD
FT                   HLAMAMGVEGYAGIALTDAAGNVLGPLAVLSRRPLGDSELAETMLRIFAARASAELERT
FT                   KAEQARREQLHFLQVLIDSIPHPIFYKDADRRYIGCNAALESFIGRTREEIIGKTVFDI
FT                   GAEGRARICDAVDRKLLANGGVESYDSTMIHTDGSIRDIIFSKTVFGNTDGSIGGIVGT
FT                   ILDITERKRAEEAIQQLAYFDALTGLPNRTLLRDRVSQLLSQARREGGGFGVLHLDVDR
FT                   FKGVNDSLGHACGDVLLSTVAGRIASSIRESDTVARLGSDEFVVILPGVGHEEDVVAVV
FT                   RKIVEELNRPIVIQGNDIFCTASIGIAIYPTDGSSADILLKNADMAMHKAKEFGGDGYQ
FT                   FYSSELNHRAMERLTLETSLRRALERREFLLHYQPLLGIGSGRIVGVEALLRWDSPELG
FT                   MVSPARFIPLAEETGLIVPIGEWVLRSACEQLRALHELGYTELCVSVNVSARQFRHDGF
FT                   CAMVAAVLAAVGLDPRYLELELTESVIMERSETAKGILRKLKQMGVSLAIDDFGTGYSS
FT                   LSYLKHFPIDRLKIDRTFVKEVTVDQDNAAIAEAIVALAHVLNLDVVAEGVETAEQLAF
FT                   LAALRCDVVQGYHIARPLPPRNLLEFLEARQEDRAARPMLRSLQP"
FT   gene            complement(558767..559210)
FT                   /gene="hspA-1"
FT                   /locus_tag="KN400_0527"
FT   CDS_pept        complement(558767..559210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hspA-1"
FT                   /locus_tag="KN400_0527"
FT                   /product="ATP-independent chaperone, alpha-crystallin/Hsp20
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83390"
FT                   /protein_id="ADI83390.1"
FT                   /translation="MAIVKYSPFRDMMNMQEQMNRLLDLAWSKQGGEELREGAWQPPVD
FT                   IFEDENAVIIKAELPGIDQKDIEVRIEDNTLTIRGERKHEEEVRKENYHRVERYYGSFQ
FT                   RSFSIPATIDQEKVRASSDKGVLTITLPKREEVKPKQITVEVT"
FT   gene            complement(559357..559533)
FT                   /locus_tag="KN400_0528"
FT   CDS_pept        complement(559357..559533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83391"
FT                   /protein_id="ADI83391.1"
FT                   /translation="MMMEKQTEMIEQLAEDAEVTLSTDYERKDLKERRSVAKSSLYDGS
FT                   KKLKHSVPKGKRV"
FT   gene            559789..559968
FT                   /locus_tag="KN400_0529"
FT   CDS_pept        559789..559968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83392"
FT                   /protein_id="ADI83392.1"
FT                   /translation="MLTYKVVEIGTVTEDVIEEALNEWTAKGWRFDGMQFAMREASRRP
FT                   SMAFLIFTREAEEA"
FT   gene            559969..562644
FT                   /gene="polA"
FT                   /locus_tag="KN400_0530"
FT   CDS_pept        559969..562644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="KN400_0530"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83393"
FT                   /protein_id="ADI83393.1"
FT                   /translation="MATDTLFLIDGSSYIYRAYFAIRHLSSPAGFPTNALYGFTQMLLK
FT                   VIKDHHPGRLAVVFDKGRTTFRTEIYPDYKANRAAMPDDLVPQIGPIKEMVRAFSIPVL
FT                   ELEGYEADDIIGTIARRCEEQGLEAVVVTGDKDLMQIVSDRIRLLDTMKDRVSGIPEVV
FT                   ERFGVGPGQVIDILGLAGDTSDNIPGVPGIGEKTATKLIQEFGSLDALLERAGEVKGKT
FT                   GERLREFAEQARLSRRLATIVRDVPLDFDLDAFAVAPADNRRLAELFKEYGFTTLMKEL
FT                   TSEATLTTEHYRTIFAEADFRALLADLAGAGVFSVDLETTSLNPLEADIVGISLSFRDH
FT                   EACYIPVGHAYDGAPAQLDRTLVLEGLRPLLTDPAVRKVGQNLKYDYQVLRRHGIVMAG
FT                   VWCDTMVASYLINPVRSGHGLDSLAVEHLDHRMISYEEVAGKGKDQLNFARVPVEKAST
FT                   YSCEDADAAWLLHRLFLPRVAEAGMERLFFDLEMPLVPILAEMETAGVKLDLALLGELS
FT                   AGLGSQLTALEEQVMALAPEPFNLNSPKQLGEVLFEKMKLPAGKKTKTKTGWSTNVEEL
FT                   ERLAEAGHEIAAAILRYRGLAKLKSTYTDALPRLVHPASGRVHTSYNQTVTNTGRLSSS
FT                   EPNLQNIPVRTDEGRKIRRAFIAEEGHLILSADYSQIELRVLAHLSEDRVFCDAFARDE
FT                   DIHTRTAAEVFGLFPEMVTPEMRRQAKAINFGVIYGQGAFSLAKQLGITTKVAKEFIDN
FT                   YFARHPGARAFLDGCVAEAEARGYVTTLMGRRLPIPDIASSNGNIRAFAQRNAVNYPIQ
FT                   GSAADIIKAAMVRVTERMRREGLTSRLIMQVHDELVFEVPEGERTAMERLVQHEMEHAA
FT                   PLRVPLRADVNVGRNWSEAH"
FT   gene            562834..563859
FT                   /locus_tag="KN400_0531"
FT   CDS_pept        562834..563859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0531"
FT                   /product="diguanylate cyclase"
FT                   /note="domains: GGDEF"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83394"
FT                   /protein_id="ADI83394.1"
FT                   /translation="MSGDILNDIVAACLELERKASSVFKMFAAHAGSDEARRFWETVAD
FT                   ETRHHSAVYERLQERGGRENLPIIIYKPAETLEELEMIGKSIDEQVERYTEAPSSEAAC
FT                   LLGFRLQLYLLHPAFASLCRLTRDASGEDLPDIGYGRYLRRFIDGIGSCGLATAETELL
FT                   GEALFRLWNEARQLAAQSHFDALTGVMTRAGFFKTVGSLAYAAQRSGSNVGIMLIDLDY
FT                   FKLVGDNYGHQTGDRILQLVAETITSHLRRSDVVGRYDGDEFVVYLSPVEPASLRTVAE
FT                   NLRRSIEEESARMVPVTASIGVAQGILGTDVDGGIEELVRLADECLMQAKYTGKNKVVV
FT                   K"
FT   gene            complement(563884..564381)
FT                   /locus_tag="KN400_0532"
FT   CDS_pept        complement(563884..564381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0532"
FT                   /product="outer membrane lipoprotein, Slp family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83395"
FT                   /protein_id="ADI83395.1"
FT                   /translation="MPIRLLFVLVIACTLAGCARQVISRESLLLAERSLSFAVVRENPN
FT                   AYMGRHLLLGGAVAETANRPDGAELEVVQFSLDSDDRPQEKHGSEGRFLARSREFLDPL
FT                   IFSRGRLVTLVGTVTGVTERRLDGTSYRYPVIAIREMYVWRPEDPYAQPAVHFGIGVGV
FT                   GF"
FT   gene            complement(564398..565027)
FT                   /locus_tag="KN400_0533"
FT   CDS_pept        complement(564398..565027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0533"
FT                   /product="SAM-dependent methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83396"
FT                   /protein_id="ADI83396.1"
FT                   /translation="MIPIVDSRIGAYLDGLLPEADPVVAAMEQIARERNIPIVDRQTGR
FT                   LLYLLARIKQPQLVVVPGDGLGCASWWFARAISISSRVVMIDPDRDNVEHARRMLHDNG
FT                   LIDRVELQVGDPLGIAAGQRDIDILFMDCDVFNGADVLERMNRCLAKNALLIAVNALRR
FT                   GSVAESHEDPETAALREFNHHLSRRRDFFTTIVPVGNGVLLGYRLS"
FT   gene            565176..566102
FT                   /locus_tag="KN400_0535"
FT   CDS_pept        565176..566102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0535"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83398"
FT                   /protein_id="ADI83398.1"
FT                   /translation="MIQAQTAAPPHAKVTAILLFTTLMWGGSFLFNKIGMREVPPVHFF
FT                   FFRFALAALLMGGVCLPRLARLNRHIAVRGAVVGLALAAVNLTFVLGVSGTTISRAGYL
FT                   NNLFVLFIPLLTFALWRERVDRVTFGGIALAVVGLWALASGGAEGFNQGDLLSTVCALF
FT                   IAIHIIAVSRVLRDEDVYLVTFVQFVTVAAVGLVLCLVLPWPEFTIGRAGAWSLAYCAL
FT                   FPTVICFTLQNAYQRFTTPTRAGLIYTLDPVWSMLFGVFILGERLTPRELAGCVLILMA
FT                   VAGPLLARLYLEQRHRRLYRLDGAEGT"
FT   gene            566105..566485
FT                   /locus_tag="KN400_0536"
FT   CDS_pept        566105..566485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0536"
FT                   /product="peptidyl-tRNA hydrolase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83399"
FT                   /protein_id="ADI83399.1"
FT                   /translation="MAPPTFAVSEEKNRWLRDKMAELGVSEADLEETFVRSSGAGGQHV
FT                   NKTATCVQIRHRPTGIEVKCMKDRSQSVNRFLARREILERIERLNKGESPRDVRVEKLR
FT                   KQKARRKRRATTKYDPEKDNQQ"
FT   gene            566482..568860
FT                   /gene="mutS-2"
FT                   /locus_tag="KN400_0537"
FT   CDS_pept        566482..568860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS-2"
FT                   /locus_tag="KN400_0537"
FT                   /product="DNA mismatch repair ATPase MutS-2"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83400"
FT                   /protein_id="ADI83400.1"
FT                   /translation="MIRTETLRTLEFDKILSAVSGYAHSGATRDETALIRPLDDREAIV
FT                   RRFGQVDEIRRLRQLGIDLSLRSFEDIAPLLAAVRPDGAVLDPTELVVLFPILRTMTAI
FT                   AKQFAYRTDIPLLRELAGTLTGFPDLLDELEVSIDSEGEILDSASPLLSDLRQKKRHLT
FT                   ERIRRRLAEIVRETGVTTFLQDDFITQRGGRWVIPVRMDSKGMVPGVVHDVSNSGETAF
FT                   MEPLEIIGLANELENLVAEEKAEMIRIVRTICRMIRQEADGLEEQFRILVRLDVLNGIA
FT                   LFADSLGAETPEITDARFIRVREGRHPLLALMARERGAGRVVPLDLGLGGAERPDSHVA
FT                   NQVMVITGPNAGGKTISLKTTGLLHLMALAGIPVPAASTSSFPLISDLLVDIGDEQSIE
FT                   QSLSTFSAHVSNIAGILERADRRTVVLLDELGTGTEPVQGAAISCAVLADLQDKGALVI
FT                   ATTHLTDIVGFVHKRDGMVNASMEFDRQTLTPLYRLTVGEPGQSHALEIARRYGLPDRV
FT                   VAVATGMLSRMETEFHELLAELKDQRRRHEEALAEAERLRRDAEEKARIARERLAEAET
FT                   RRREATEKALQEAKEIVRAARRDVNAIIEEARREKSREARKKIDEAEAAVEAKLQEFHP
FT                   EETLSLDAVREGDTVFVKAIGHDGTVTAVDRRTGRLRVRAGAMELEVAATDVSPRRGKA
FT                   TEAKIRTGSGRRPAPDAETPREINLIGLRVDDALARLEPFLNHASLEGYGELRIVHGKG
FT                   TGALMRAVREYLDGHPLVREFRPGEPFEGGEGATVVTLR"
FT   gene            complement(568882..570396)
FT                   /locus_tag="KN400_0538"
FT   CDS_pept        complement(568882..570396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0538"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase with cobalamin-binding-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83401"
FT                   /protein_id="ADI83401.1"
FT                   /translation="MNVLLVYPRYPDSFWSFRHALKFVGKKAAFPPLGLLTVAALFPDT
FT                   WQARLIDQNVREVTDADLARADLVFVSAMTIQREAVREILGRCRQLGVTTVAGGPLFTT
FT                   APEEFPEADHLVLNEAELTLPRFLDDLAMDRAQRIYTAEARADVTRTPLPRWDLLDIRD
FT                   YAAMNIQYSRGCPFDCEFCDITRLFGRRPRTKGREQLTAELDGLHARGWQGGVFFVDDN
FT                   FIGDRAKLKREVLPAMIDWQEQRGRPFSFFTESSIDLADDPELMGLMVRAGFTEVFVGI
FT                   ETPHDEGLHESGKVQNRNRDLLESVKRIQRAGLQVQGGFIVGFDSDPETIFERQIRFIQ
FT                   ESGIVTAMVGMLTALRGTRLHRRLAQEGRLLRNASGNNTAIALNFVPRMPADALVGGYR
FT                   KILDTIYAPRHYYRRVITFLTEYRTPPGGFQPNPARLRAFLASVVLLGVIGRERLYYWK
FT                   LFFWSLARRPRLFPLAITLAIYGFHFRKVAESIGATGMFEEQECVE"
FT   gene            570518..571198
FT                   /locus_tag="KN400_0539"
FT   CDS_pept        570518..571198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0539"
FT                   /product="SAM-dependent methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83402"
FT                   /protein_id="ADI83402.1"
FT                   /translation="MIQDPTGEYIRTITSHCDLRGAEVLEVGCGTGRITRDLARHAARV
FT                   VAVDPDERALAQARAAVTAANVSFLPMPDGVLSFPPASFDIVIYTLSFHHVPLHQMDES
FT                   LATAVGLVRPGGAVVVVEPGEGGSFTEAKERFGAGSGDERPAQEAAIRAMHALPGWTVG
FT                   DTVHFRVGFLFTDEDDFISSKLPGFAGQPAAYQQEVRAFLARHRTPEGIVLDAGRRLTV
FT                   LRRR"
FT   misc_feature    571225..571279
FT                   /note="conserved nucleotide sequence; KN400_R0136"
FT   gene            571356..571718
FT                   /locus_tag="KN400_0540"
FT   CDS_pept        571356..571718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0540"
FT                   /product="protein of unknown function of ISGsu7"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83403"
FT                   /protein_id="ADI83403.1"
FT                   /translation="MEKDVSVSGAAEGERSSTGAAPEVKRWSANRKKEVVLRLMRGEPI
FT                   DALSRELGIEIYRLEEWHQKALQGIESALKAREGDPLAAELDAAFKRIGEITMENELLR
FT                   EKARRAHPLAQRRSKK"
FT   gene            571715..572605
FT                   /locus_tag="KN400_0541"
FT   CDS_pept        571715..572605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0541"
FT                   /product="transposase of ISGsu7"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83404"
FT                   /protein_id="ADI83404.1"
FT                   /translation="MSATISPATGKAYGVQRVCLAWGVPRSSFYSRAGRKTLPAVLLKR
FT                   GPKTPLSDDEVLSLIRTDLETSPFVGEGHRKVWGRLRFVKGIKVGRKRVLRLMRENNLL
FT                   SPHRVVQGQPKDHAGKIITAAPNVMWGTDGTKIFTLEEGWCWLFTAVEHWNAECVGWHV
FT                   TKNGDRFAALQPLAMGIKARFGSVGAAAARGLALRMDHGSQYLSEHFQNQIKFWGIAPS
FT                   FSFVAEPQTNGVTERFNRTIKEQVIYGRHYRTIEEVRMAVADFMDRYNRLWLVEKLGFR
FT                   SPRQAFEEYQLKKAA"
FT   gene            complement(572828..572965)
FT                   /locus_tag="KN400_0542"
FT   CDS_pept        complement(572828..572965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83405"
FT                   /protein_id="ADI83405.1"
FT                   /translation="MFINARPLNCSNISSIFICQFMDIIVSSYFKKFITVNIVENVIES
FT                   "
FT   gene            573194..573979
FT                   /locus_tag="KN400_3418"
FT   CDS_pept        573194..573979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_3418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_3418"
FT                   /db_xref="EnsemblGenomes-Tr:ADN78314"
FT                   /protein_id="ADN78314.1"
FT                   /translation="MIESMEPTSWRDLQNVVARILRETGVITAVEKTIQTARGDVSIDV
FT                   WVHDPTATPTQTYLIECKRWRSRVPQTIVHAFRAVVGDSGANWGAIISIAGFQKGAIKA
FT                   AEYSNLRLLSWTEFQALFAERWFSHYFVSEIAKETDPLLEYTEPINSRIFKKADLLSED
FT                   LRQEFRRLRVEHQAIGMLCLLYRAHAASALRLVLGENAPTLMPSLPLRKTIGTYLDAEG
FT                   MPIADEILDASSYRTLLESIIREAKKAIAQFDEVFGERA"
FT   gene            574100..575506
FT                   /locus_tag="KN400_0543"
FT   CDS_pept        574100..575506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0543"
FT                   /product="SAM-dependent methyltransferase, FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83406"
FT                   /protein_id="ADI83406.1"
FT                   /translation="MIPTTIITLVDGVRIVVPDSLEMITPYVLREQQDWFEDEIKFLRR
FT                   LLQPGFNVIDIGANYGVYTLSMAQTVGPSGRVWAFEPASTTASLLAEGIAANGFEQVLL
FT                   ERAALSSARGTAQLSLNQNSELNAIVRDNLSTDGCETVPVITLDDCLESFGWRNIEFIK
FT                   IDAEGEEANILKGGKRFFAELSPLVQYEVKAGTVLHLDLVQAFSSLGYESYRLVPGLDL
FT                   LIPFDPEAQPDGYLLNLFCCKPDRVSQLVTQGFLLNAAALKTGMERFKARASHDAYNWR
FT                   NTLTRLPYGTELADVWERTLAVDKSGRVEEALSLYVASQDASLPAAERYHALARSFMRF
FT                   SFLCEQEPSYLRLASLARVAQDYGARSVAVSALEQQCKIILEHNQLDPSEPFLSPCARF
FT                   DFVPPGEALGDWVLSALLEGFERLGSFSSFYTGESARQRLNIIRELGFGSAEMERRLLL
FT                   LQQRFDLPRE"
FT   misc_feature    574368..574416
FT                   /locus_tag="KN400_0543"
FT                   /note="conserved nucleotide sequence; KN400_R0137"
FT   gene            575657..576148
FT                   /locus_tag="KN400_0544"
FT   CDS_pept        575657..576148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0544"
FT                   /product="NrdH-like redox domain protein, YruB family,
FT                   DUF4124-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83407"
FT                   /protein_id="ADI83407.1"
FT                   /translation="MPIRILLPIVTLLLTCSLAGAEMYKWVDEHGVVTFKDTPPPATKK
FT                   GKKVKVYTDGDFAPAPSPQPAAPRRATSAPQPAPPVKQRFTGTVELYVTDWCGYCKWAE
FT                   RYLQSKGVSYVAYDIEKDSAAMQRHKDLGGRGVPLIVVGSHKISGFSPETIDYYLENGR
FT                   "
FT   gene            576191..576766
FT                   /gene="tag"
FT                   /locus_tag="KN400_0545"
FT   CDS_pept        576191..576766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="KN400_0545"
FT                   /product="3-methyladenine-DNA glycosylase I"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83408"
FT                   /protein_id="ADI83408.1"
FT                   /translation="MIQRCEWCGTDPLYVAYHDGEWGVPAHDDRHLFEMLILEGAQAGL
FT                   SWLTILRKREAYRRAFANFDAETVAAWSEADVARLLADPGIVRNRLKVESTIRNARGVL
FT                   KIREEFGSLDAYLWRFVDHAPRHNAWRSLAEVPARTEQSDAMGKDLKRRGFNFVGSTIC
FT                   YAFMQAVGMVNDHVVHCFRHDEIRRLGG"
FT   gene            576763..577164
FT                   /locus_tag="KN400_0546"
FT   CDS_pept        576763..577164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83409"
FT                   /protein_id="ADI83409.1"
FT                   /translation="MTSSILKACAIWLLFIPLGIVNGVVREKVLNPLVGAQVALPLSGV
FT                   SLGALIVAVTTLLIPLAGGLTPSRCRLIGWIWLVLTVFFEFFFGRVVMGHPWAKLLEAY
FT                   DPRGGNLWVAVLLVIAAAPYLAARLRGLV"
FT   gene            577204..577752
FT                   /locus_tag="KN400_0547"
FT   CDS_pept        577204..577752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0547"
FT                   /product="nicotinamidase-related cysteine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83410"
FT                   /protein_id="ADI83410.1"
FT                   /translation="MKRALLVIDVQNEYFTGALPVSYPEGSLPNILAAMDAAVANGIPV
FT                   VAVRHASRRPDSATFRQGSPGWELHPEVARRPHDLLLEKNLPGSFTDTNLEAWLRERGI
FT                   DTLVISGYMTQMCCDTTSREAFHRGFAVEFLADATGTLAFANSAGAVTAEELHRAVLVT
FT                   QQLMFATVMTTGEWIGSLL"
FT   gene            577793..578398
FT                   /locus_tag="KN400_0548"
FT   CDS_pept        577793..578398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0548"
FT                   /product="SAM-dependent methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83411"
FT                   /protein_id="ADI83411.1"
FT                   /translation="MSDVTNTWNERYDTEEFVYGREPNAFLAGVSAMMPPGDVLCLAEG
FT                   EGRNAVFLARQGHRVLAVDASAVGLSKAARLAEEHGVRIETLTTDLADLVIEPGRWDAI
FT                   VSIFCHVPPPVRRVLHRQAVAGLRPGGLFVLEAYTPAQLELRTGGPPTVELLMTLADLR
FT                   EELAGLEFLQAREIERDVVEGRLHTGRGAVVQIVARKP"
FT   gene            578413..578895
FT                   /gene="folA"
FT                   /locus_tag="KN400_0549"
FT   CDS_pept        578413..578895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="KN400_0549"
FT                   /product="dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83412"
FT                   /protein_id="ADI83412.1"
FT                   /translation="MRITLIAAMAENRVIGNRGAIPWHLPDDLARFRAITLGHPVLMGR
FT                   RTFESIGRPLPGRLNIVLSHREGYAPPGCLVARDLAAALELARDAAELFVCGGGELYRE
FT                   ALPLADQILLTLVQGEFPGDVTFPEVPADFVETAREEGVGGPAHLFLTYERRKEAP"
FT   gene            578892..580040
FT                   /locus_tag="KN400_0550"
FT   CDS_pept        578892..580040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0550"
FT                   /product="hydrolase, putative, cyclic
FT                   phosphodiesterase-like domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83413"
FT                   /protein_id="ADI83413.2"
FT                   /translation="MSTEPRRFSVFLVPAAGDRRWADGVIHELADRYDTLPFEPHVTVY
FT                   GGAFSNDAELEPVRRALADAAAGTGQITLQVAGLGVTEEYFRSLFVAFGEDPALRRLHE
FT                   AVKGAVAQDPGYVLVPHLSLLYADLPLAAKEAAARTVTLDRREIRFDEVKIVVPDPVTG
FT                   WSDARRWQTRFRLRLGAPAEKVTTVIFDYGGVLAEEGFREGLFELARRQGLDPVAVHGA
FT                   GMEAVYASGYVLGKGSQSAFWQSLRERTGLRGSDRELSNLILDRFVLRPRVMEAVRALR
FT                   AQGYRTVILSDQTDWLEWLDRRDGFFREFERVFNSYRLGKGKRDPSVFDDVARELGIAP
FT                   GEALFVDDMLANVVRAESRGMRGILFEDEPRFERDLKRYTEV"
FT   gene            580042..581034
FT                   /locus_tag="KN400_0551"
FT   CDS_pept        580042..581034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0551"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83414"
FT                   /protein_id="ADI83414.1"
FT                   /translation="MRAMLFEEVGKPLRPVRVPVPEPGPGEVLLKVHACGICRTDLHIV
FT                   DGELTEPALPLIPGHQIVGSVAKLGEGVERFREGTRVGVPWLGATCGACRYCRSGRENL
FT                   CDHARFTGYQRDGGFAEFTVADTRFCFPIPGGYPDLQAAPLLCAGLIGYRSLVMAGEGE
FT                   RLGIYGFGAAAHIVTQVARFRGWRVYAFTRPDDRAGQAFAREMGAVWAGASHERPPEEL
FT                   DAAIIFAPAGELVPAALRAVGKGGVVVCGGIHMSDIPPIPYDILWGERSIRSVANLTRR
FT                   DGEEFLALAPKVPVRTEVTAYPLSAANEALDDLRRGRLRGAGVLVIDEG"
FT   gene            581377..582303
FT                   /locus_tag="KN400_0552"
FT   CDS_pept        581377..582303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0552"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83415"
FT                   /protein_id="ADI83415.1"
FT                   /translation="MQTASRAHADSRHGLFLILFSAMLWGTVGITTKALYGLADTTPLS
FT                   IGFFRLALAVPVLVAACRLATGPAMFRVARRDLGTMIVVGAMTALYQVCYFAAIRQIGV
FT                   AAATLVTLCTAPVIVALLSAILTGERPSGRVLLSLACALAGTALLVGLRPLAGEGGNIP
FT                   LGIAQALGSAFSYAAVTVASRTLAGRYHPLQPVAIGFAAGALFLLPTALADGLVLTYPA
FT                   AGWVLLLYLGVVPTALAYALFLAGMRTTTATAASICTLLEPLVSTVLAWLIFGERLGPL
FT                   GAVGAVLLFGAIGLLARPVRRRQSSAA"
FT   gene            582428..584356
FT                   /gene="cstA"
FT                   /locus_tag="KN400_0553"
FT   CDS_pept        582428..584356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cstA"
FT                   /locus_tag="KN400_0553"
FT                   /product="carbon starvation protein CstA"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83416"
FT                   /protein_id="ADI83416.1"
FT                   /translation="MLAKGFWLVVSLVAACSLAVVAGVVNPAEKVNALWLVTAAACFYM
FT                   VAYRFYGAFLAARVLSLDPALRTPARRLADGMDFHPTNRWVLFGHHFAAIAGAGPLIGP
FT                   MLAAQFGYLPGFLWILIGSVLVGAVHDMVILGASVRRNGRSLAQIAKDEIGPVGGLAAS
FT                   LAILFILIVALAGLGLAVVNSLAKSPWGTFTIFLTIPIALFMGLYLYKIRPGRVGEVSA
FT                   IGFVLLLAAVFAGHYIPGSPIEPYFNLSKHGLVVAMAAYGFVASILPVWMLLCPRDYLS
FT                   TYMKIGTVLLLACGVIFMAPTLQMPPVTRFVSGGGPIIPGTLFPFMFITIACGAISGFH
FT                   SLISSGTTPKMITSEREIPMIGYGAMLAEGFVAVMALVAATILIPGDYFAINTKLSFDA
FT                   IAALGFPVERVRELSALVGTDVAGRPGGAVSLAVGMASILSSLPGMAGLMPYWYNFALM
FT                   FEALFILTTVDTGTRVARFLLQELGSRVYAPLGQPRWLPGIIATSLMVVVAWSYLIWSG
FT                   NVSTIWPMFGVSNQLLAAIALGIGTTVLIKGGKVRYAWTTALPMAFMYVTTFAASWQLT
FT                   GSFLRKAATAPTAAEALTFRINGGLVAVMAILAVVTLGDMLHKWYGYLTSTRPVVTSEV
FT                   LEYEEAA"
FT   gene            584626..585069
FT                   /locus_tag="KN400_0554"
FT   CDS_pept        584626..585069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0554"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83417"
FT                   /protein_id="ADI83417.1"
FT                   /translation="MTVTNMTEWFAKGVEALHHDHVYLARACFEQAVTEQRSPLSSSYL
FT                   ALCQAKTRGTFSDAIASAREAVAADPANPALYHNLGCIYLLAGKRTEAIETFRQGLRVG
FT                   GGEDITSELERLGTRRAPPIKRLPRNHPVNKYLGIVLSRLGLR"
FT   gene            585136..585867
FT                   /gene="recO"
FT                   /locus_tag="KN400_0555"
FT   CDS_pept        585136..585867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="KN400_0555"
FT                   /product="DNA repair protein RecO"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83418"
FT                   /protein_id="ADI83418.1"
FT                   /translation="MHPIRCEAVVLATMDYRESDRIVTLFTLCHGKVRGLARGARKSMR
FT                   RFGGALEPFARLSVELVVREGLSSLRGVDIVTVYPRIRQDLAAIGHGGYAVELVDRLLP
FT                   DGASVPRLFRLLVSYLEHLDQGGASPSDRRFFEANLLNILGYRLSLDACAACGVEFPAD
FT                   AARRAGAAGTVLCTGCGRYGAPLSAETVRLLHRCLGTGRFGAIVFPPEPLGEAGPLLDG
FT                   AIGAHLARPLNSLAFLRQLTP"
FT   gene            586145..587023
FT                   /gene="glyQ"
FT                   /locus_tag="KN400_0556"
FT   CDS_pept        586145..587023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="KN400_0556"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83419"
FT                   /protein_id="ADI83419.1"
FT                   /translation="MTFQDLILALQGYWAQQGCVIQQPYDTEKGAGTFNPATFLRVLGP
FT                   EPWNVAYVEPSRRPTDGRYGENPNRLQHYYQFQVIMKPSPMNILDLYLDSLRAFGIDPA
FT                   KHDIRFVEDDWESPTLGAWGLGWEVWLDGMEITQFTYFQQAGGIDLKPVSSEITYGCER
FT                   IAMYLQGVDNVYDLEWVKGVSYGDIHHRTEVEFSTYNFEEADVDMLLTLFTMYEKECVR
FT                   LVERGLVLPAYDFVMKCSHTFNLLDARGAISVTERASYIGRVRNVARLCAEGYLKLRES
FT                   LGFPLLKGGRK"
FT   gene            587025..589088
FT                   /gene="glyS"
FT                   /locus_tag="KN400_0557"
FT   CDS_pept        587025..589088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="KN400_0557"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83420"
FT                   /protein_id="ADI83420.1"
FT                   /translation="MSKELFLEIGTEEIPAGFLPKAMADMEAIVTKELENARLAFGEVK
FT                   TFATPRRLALVVKGLPTVQPDAEITALGPARNIAFGPDGTPSKAAEGFARGQGVDVASL
FT                   TLVSTEKGEYVAAVRKESGRPVPDLLAEILPRLVGGIPFRKSMRWADLDVRFARPIHWI
FT                   VALFDGVVVPFAFGNVQSGNVSRGHRFMANQPFPVRDFAHYLDECERHFVIPDPERRKE
FT                   TIRREIHRVAKTAGGHLLPDEGLLDEVAYLVEYPSVVHGTFSPDFLKVPREVLITSMRS
FT                   HQRYFSIVDDAGKLMPGFITINNTLTEDPSVVVKGNERVLRARLSDARFFFEEDQKVKL
FT                   ETRVESLKNVVYQQKLGTSYEKMERFRALAEGLADLLNPAVKAKTSRAAFLCKADLVSG
FT                   MVGEFPEVQGIMGREYALLQGEDAEVAAAIAEHYLPTQAGGDLPASDIGAFVSIADKLD
FT                   TICGCFGVGLIPTGSADPYALRRSALGIINIILDRGCRLSLEGEIGKALELLSAKLTRP
FT                   AAEVMADVLEFFRGRFVNLMADRYPADAVDAAIAAGFDDLVDAEARIGALAAFKGRPDF
FT                   DSLAVAFKRVCNIVKDGVDQPVDAALFQEPAEGALFAAFQQVRADVEARTASGDYLAAL
FT                   TGIAALKGAVDDFFDKVMVMAEDERVRTNRLALLTGIARLFGGVADFAKIAA"
FT   gene            589209..591875
FT                   /gene="ppdK"
FT                   /locus_tag="KN400_0558"
FT   CDS_pept        589209..591875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdK"
FT                   /locus_tag="KN400_0558"
FT                   /product="pyruvate phosphate dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83421"
FT                   /protein_id="ADI83421.1"
FT                   /translation="MAGKYVYFFGNGQAEGKAEMKNLLGGKGANLAEMTAIGLPVPPGF
FT                   TITTEVCTYYYANNRSYPPTLAAEVADNLKKVEALMGRTFGDRNNPLLVSVRSGARASM
FT                   PGMMDTILNLGLNDETVQGIIAQSGDERFAYDAYRRFVQMYSDVVMGMDKDLLEHLLEQ
FT                   KKEEKGVHLDTDLTAADWKELVGKFKAKIRETLGKEFPEDPQEQLWGAVGAVFGSWMNQ
FT                   RAITYRRLNNIPADWGTAVNVQSMVYGNMGNDCATGVAFTRDPSTGENYFYGEYLVNAQ
FT                   GEDVVAGIRTPQPINRANSKDTTLPAMEDVLPECYQQLVQIRGILEKHYRDMQDIEFTI
FT                   EKGKLFMLQTRNGKRTAKAAIKIAVDMVREGLIDEKTAVLRVSPSQLDQLLHPSLDPKA
FT                   QKRVIAKGLPASPGAASGEVVFTADEAEAAARLGLKVILVRVETSPEDIHGMHAAQGIL
FT                   TARGGMTSHAAVVARGMGKCCVAGCGDIKVDYAGSQFATAKGQVVKKGDVITLDGSTGE
FT                   VMLGEVPTVPPQLTGDFGTLMEWVDRFRKLKVRTNADTPNDSRVAREFGAEGIGLCRTE
FT                   HMFFEADRIAAVREMILAEDVEGRKKALAKILPMQKGDFVGIFREMKGLPVTIRLLDPP
FT                   LHEFLPHEDKDIDALAKTMGVTPQSLRAKVDYLHEFNPMLGHRGCRLGLTFPEIYDMQV
FT                   QAIMEAACELTKNEGFSIVPEIMIPLVGVVTELARLRENTVRVCEEVIAAYGVKVEYLI
FT                   GTMIELPRAALTADEIAREAEFFSFGTNDLTQTTFGLSRDDAGKFLPFYVETGLLEDDP
FT                   FVSLDQNGVGLLVKMAVEKGRATRPGIKLGICGEHGGDPSSVIFCHQIGLDYVSCSPFR
FT                   VPIARLAAAHAALEEGK"
FT   gene            592033..592233
FT                   /locus_tag="KN400_0559"
FT   CDS_pept        592033..592233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0559"
FT                   /product="cold shock DNA/RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83422"
FT                   /protein_id="ADI83422.1"
FT                   /translation="MAKGVVKWFNDSKGYGFIEQENGEDVFVHFSSIQGDGFKTLVEGQ
FT                   AVTFDVVQGAKGLQAANVMKA"
FT   misc_feature    592265..592291
FT                   /note="conserved palindrome; KN400_R0138"
FT   gene            592434..594524
FT                   /gene="mcp40H-2"
FT                   /locus_tag="KN400_0560"
FT   CDS_pept        592434..594524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp40H-2"
FT                   /locus_tag="KN400_0560"
FT                   /product="methyl-accepting chemotaxis sensory transducer,
FT                   class 40H, putative dimer with helix-swapped heme-binding
FT                   site-containing PAS domain"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83423"
FT                   /protein_id="ADI83423.1"
FT                   /translation="MFRTRLAFKVLAIIGITLFLGFAALGITSIWLEYNAIMDLQTRNT
FT                   RGLSTLVVRDIGELMMAGDMAVIERYVADVRGKGAVLDLRIYDAAGRPAGKKQDAPDGE
FT                   VQAALTSGATAEKRHKVDGRHVLSFIVPLANEVRCQSCHEQGARFNGAMLLTTSLEEGY
FT                   AGARNLTLALALVGVCSFFLLLGVMYLFFNRVIIRNIGEISRRVQEIAQGEGDLTASVP
FT                   VRSSDELGVLAEGINLLVTKLREIISGLYHQAGHIAISACRTIKETERLVASTHEQKDL
FT                   STSVAVASEEMAATLNDVAVNTQRAAQLSLSVDRAAHEGMATVTETAESIDRIKDSVMA
FT                   TLDTMDKLQQSSGQIGEIVGIIGDIADQTNLLALNAAIEAARAGDSGKGFAVVANEVKV
FT                   LSDRTASSTREIGTIIRSIQAEIRAVVASIAEGKDKVEVGVERSTTARRQLEDILRLAA
FT                   ESTDMINQIATATEEQSATTGEISEKISQVSGTAERVNGQMEQTAGIFRELSETAEQIY
FT                   GTVGRFKVGTYHDTVKGLASEMRDRVVATLERAASDRRVTLDALFSSEYTPIPDTFPQK
FT                   YRTPSDRLFDEIISPIQEEILGRDSGMYYAICVDRRGYCPSHNLRYSRPLTGNREADKE
FT                   HNRTKRIFEDRTGLRCAGNTGSFLLQTYLRDTGEVMNDLSVPIVIGGRHWGAVRIGYRA
FT                   DD"
FT   gene            complement(594537..596237)
FT                   /gene="mcp64H-1"
FT                   /locus_tag="KN400_0561"
FT   CDS_pept        complement(594537..596237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp64H-1"
FT                   /locus_tag="KN400_0561"
FT                   /product="methyl-accepting chemotaxis sensory transducer,
FT                   class 40+24H"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83424"
FT                   /protein_id="ADI83424.1"
FT                   /translation="MAKNLSLGSRLIRFSLTAGFIVGTAGAVMALNYAPAAGYDRGHAH
FT                   LLAGMLGCNALLSLFALWMLSARKLVVRVNNLASAMDRGAEGDLTVTVTDESSDELGQL
FT                   TDNFNAMFGRLAGMVTRVKEAVEELRAISATVKDAVERGLDTAEVQTGAVQRTTDGIRA
FT                   IDRSVNEVAQSVESLSRTASENAAAIVQMSTSIEVVAEHMEGLAREVDEVSSSIIQMAA
FT                   AEKEIGRSVRVLMEDASRTASLVAEMDLSIRQVEKSALETAAISEEVLRDAELGRDSVD
FT                   RTISGISEIRRSSRSASDTITTLSHRVGDIGTIISVINEIAEQTKLLALNASIIAAQAG
FT                   EHGKGFAVVANEIKELAKRTTSSTGEIAEIISGLREETVRAVQAIKQAEDRIGEGETLS
FT                   YRSGEALEKIVDGVKMAVDQVGEIARTTVEQAQGSENMRRAMERVAEMVEQIMRATQEQ
FT                   AHGTELITEAADRMKSLTGRVFSSTREQRDTSTHIVRSSEGVTHMISTIRQASQVQAEN
FT                   SQKIVEAVENMETTAVNGLDTTRLMEEAVSRLARQTEGLTEAMAGFKVR"
FT   gene            complement(596348..597622)
FT                   /locus_tag="KN400_0562"
FT   CDS_pept        complement(596348..597622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83425"
FT                   /protein_id="ADI83425.1"
FT                   /translation="MPIDVFDAIKPSLQGLLGGARVALTGPGEEEAEEGHVLRKPMVVD
FT                   EVTYLFSACRHSIPFTRTEEVFCGELVAAFAVLYSGFRQEGYAAHFRTALLASLMDITV
FT                   ARFLRGDHRKAFWSIQQLIQLLKNLSYQRYEGKPATTGFLVYRTTLVEFRKRVRYQKSA
FT                   WLDLNPQQALTPTLFDNPITYRFIDGTNSLFAANVQMQLTGIVKPSGLAERDEVDRHAH
FT                   RSVFALLRNAGAGAFAVKVNESSEIEAIICPDKLLVRRRGQWGIFDPDIFRSFLAGCLD
FT                   PEEIEELAWTLYTLSKARHGTVVLILERGDRQLARLKRGSVGGDDPLGMMLAKRVKGKT
FT                   ISQLKQSGELMRLLSSDGMTVFSRRGRLLDTGVIIDTSHARELVTGGGRTTAATAASFS
FT                   GRVIKVSEDGPIELYQGGARVYSFG"
FT   misc_feature    complement(597739..597924)
FT                   /note="conserved nucleotide sequence; KN400_R0060"
FT   gene            complement(598000..598656)
FT                   /gene="ycgM"
FT                   /locus_tag="KN400_0563"
FT   CDS_pept        complement(598000..598656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgM"
FT                   /locus_tag="KN400_0563"
FT                   /product="fumarylacetoacetate hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83426"
FT                   /protein_id="ADI83426.1"
FT                   /translation="MKTARLSPSGNEFPIGKILCIGRNYAEHIKELGNETPDAPVVFMK
FT                   PATAVIGDGETIIIPSYSRECHHEAELALLIGKGGKDIPPERALEHVAGYGVAIDLTLR
FT                   DVQAELKKKGLPWEIAKGFDTSCPLSSFVPADRVADPHDLHITLRVNGEMRQDGSSSLM
FT                   IHRIPQILSYMSGVFTLEPGDVILTGTPAGVGPLAAGDAVEAEVVGVAAIRVTVK"
FT   gene            complement(598684..599643)
FT                   /gene="yhcC-2"
FT                   /locus_tag="KN400_0564"
FT   CDS_pept        complement(598684..599643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhcC-2"
FT                   /locus_tag="KN400_0564"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase, TIGR01212 family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83427"
FT                   /protein_id="ADI83427.1"
FT                   /translation="MSDLFIHPELRFHSYGTWLRRRFGCNVSKVNVDGGFTCPNRDGSR
FT                   GTGGCIYCDNASFSPGGTVPDKSIELQMAEGMAYHRQRLGSEKFIIYFQKFTNTYAPAA
FT                   RLRDLYTRALSHPDVVGISVGTRPDALADEALELLADLAQEHYVCIELGLQSMDDAILE
FT                   RINRGHTLDEYLRTVDRIAGRGIALCTHLIYGFPGETREGFLKTAHLLAGLPVDSVKLH
FT                   QLHAVKGTRLAELYHRREFVPITLAEYVTTACDFLELLPPRIAVQRLYGSAPLAIRVAP
FT                   TWNLKNNQMWYAIVNELRRRGTWQGCRLDREHCRVGNL"
FT   gene            complement(599647..600288)
FT                   /gene="tenI"
FT                   /locus_tag="KN400_0565"
FT   CDS_pept        complement(599647..600288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tenI"
FT                   /locus_tag="KN400_0565"
FT                   /product="carboxythiazole phosphate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83428"
FT                   /protein_id="ADI83428.1"
FT                   /translation="MAKVDFSLYLITDRHQAGGRDLLAVVEGALAGGVRCVQLREKDLP
FT                   ARTLLELARAMRRLTDRFGARLLINDRVDIALAAGADGVHLGEEGMPAAVARELLGSGR
FT                   LIGVSCHGRGGAAAAVAQGADFITFGPVYPTPSKAAYGEPVGIDQLAATTKEIHIPVFA
FT                   LGGIKEANIPEALAAGAAGVALISAIIADPDPRERARALLALLPPRTRDE"
FT   gene            complement(600281..601063)
FT                   /gene="thiG"
FT                   /locus_tag="KN400_0566"
FT   CDS_pept        complement(600281..601063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="KN400_0566"
FT                   /product="carboxythiazole phosphate tautomer synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83429"
FT                   /protein_id="ADI83429.1"
FT                   /translation="MSNAADKLVIAGREFSSRLMVGTGKYASNEQMIKALEVSGAEIIT
FT                   VAVRRVNLADRGKGCLLDFIDPKKYTLLPNTAGCYTADDAVRTCRLAREAGMSDLVKLE
FT                   VLGDEKTLFPDNEELLKAAKILVKEGFTVLPYTSDDPIVCKKLEDIGCAAVMPLGAPIG
FT                   SGLGIRNPYNILIIKETVKVPVIVDAGVGTASDAAIAMELGIDGVLMNTGIAGARDPIA
FT                   MAEAMNMAVRAGRLAYLAGRIPKKLYATASSPIEGMIG"
FT   gene            complement(601135..601332)
FT                   /gene="thiS"
FT                   /locus_tag="KN400_0567"
FT   CDS_pept        complement(601135..601332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="KN400_0567"
FT                   /product="thiamin biosynthesis sulfur carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83430"
FT                   /protein_id="ADI83430.1"
FT                   /translation="MNITVNGEAKSIATMNVHDFLHSIDIDPRRVAVELNMDILPKAEY
FT                   QATVLKDGDALEIVHFVGGG"
FT   misc_binding    complement(601406..601504)
FT                   /bound_moiety="thiamin diphosphate"
FT                   /note="thiamin diphosphate-responsive riboswitch;
FT                   KN400_R0061"
FT   gene            complement(601663..602193)
FT                   /gene="cbcE"
FT                   /locus_tag="KN400_0568"
FT   CDS_pept        complement(601663..602193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbcE"
FT                   /locus_tag="KN400_0568"
FT                   /product="menaquinol oxidoreductase complex Cbc5, membrane
FT                   protein subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83431"
FT                   /protein_id="ADI83431.1"
FT                   /translation="MKRTTERSPSHDNGISPPNRDLVRQEAVGRIRRYRVTASRGLWAM
FT                   ALFLAVSTAALWDFSFLPPMSDQVRAFLGKPPSATMISGVLMLYTFSAIILILARMMGG
FT                   AEQYSGFAHVGYLTAFYLFYHFARALNDNYWAVFVAGITILGLESYHIWNFCSEAIRKD
FT                   QEIIDTIDRNRRE"
FT   gene            complement(602229..603080)
FT                   /gene="cbcD"
FT                   /locus_tag="KN400_0569"
FT   CDS_pept        complement(602229..603080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbcD"
FT                   /locus_tag="KN400_0569"
FT                   /product="menaquinol oxidoreductase complex Cbc5,
FT                   cytochrome c subunit, putative, HAMP domain-containing, 2
FT                   heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83432"
FT                   /protein_id="ADI83432.1"
FT                   /translation="MPRSFAAKAIVPPAIAVTGFVIVCCILLYSVIKTDMLNDAIQHET
FT                   NLADTIVKSARYAMLKDDRETLRNIIDNVGQQKGVEHARIFNKKGVIMFSAHPEDIGKL
FT                   LDKKEAGCVACHSGPVPLTSMGRMDQARRFINEKGRHVIAITVPVYNEPECFNAACHVH
FT                   SPSQKVLGTLDIGLSEAPLQKTLNVMQGRMIVFCLMVLLLTVGGVSALLRRNVLLPVRE
FT                   LADYVSAVKRGDLSRKAPAYRDEVGELARAYQELAHQLKERRESPDEATQDGPAGDRGN
FT                   RS"
FT   gene            complement(603197..604186)
FT                   /gene="cbcC"
FT                   /locus_tag="KN400_0570"
FT   CDS_pept        complement(603197..604186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbcC"
FT                   /locus_tag="KN400_0570"
FT                   /product="menaquinol oxidoreductase complex Cbc5,
FT                   cytochrome c subunit, putative, 12 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83433"
FT                   /protein_id="ADI83433.1"
FT                   /translation="MRFRCLPLLAVCIISLAGFAYGITIKDAVFQTKDAGRVVFSHKAH
FT                   IGKKGIENNCKACHDGIFSLRKKVSYTMADMEKGKSCGACHNGKEGVFPLKECARCHAV
FT                   KEITYQVKSTGPTPFSHQKHLAVYDNCNACHPKLFNAGPNKRATMADMEKGKSCGACHN
FT                   GKTAFGLNECATCHMVKEVLLSSPGTGKIIFSHKLHAGKMKCDQCHNKLYVPGRNKPVG
FT                   MAAMEKGKSCGACHNGKSVFDVKQCAKCHPVKEVNYKVKGAGPATFSHALHLSMYTCSD
FT                   CHNKLYKTGRNTKVVTMHEMEKGKSCGACHNGKTAFSVREDCVKCHNM"
FT   gene            complement(604374..605030)
FT                   /gene="cbcB"
FT                   /locus_tag="KN400_0571"
FT   CDS_pept        complement(604374..605030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbcB"
FT                   /locus_tag="KN400_0571"
FT                   /product="menaquinol oxidoreductase complex Cbc5,
FT                   cytochrome b subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83434"
FT                   /protein_id="ADI83434.1"
FT                   /translation="MSAHNEHAEHKEFIYLTPMPIRIWHWINALGIVTLCLTGIQIRFP
FT                   EYVNIFGTYKAAIRLHNTAGITVSIFYAIWFAYYLIVKGNLFKLYVPNTYDIKMGIFRQ
FT                   VLYYFYYFFKGGQSPHHATPDDKFNPMQKVAYMGLMLALMPLVIVTGILILNVAPLREL
FT                   ILLMGGLKILVSAHFLIACCFFAFLFVHVYLATMGHTPLAHFKPMWDGWEEVEHH"
FT   gene            complement(605034..606083)
FT                   /gene="cbcA"
FT                   /locus_tag="KN400_0572"
FT   CDS_pept        complement(605034..606083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbcA"
FT                   /locus_tag="KN400_0572"
FT                   /product="menaquinol oxidoreductase complex Cbc5,
FT                   cytochrome c subunit, putative, 7 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83435"
FT                   /protein_id="ADI83435.1"
FT                   /translation="MRTLRKTAIVLSLLAILPAAALAEDKTADACLSCHSSKDIGKSGS
FT                   HLYIDAAKYSRTTHAIIGCTSCHDSVTASHPDDGIRPSRAACRECHSPIAKEYTASLHA
FT                   NNAGCADCHDPHTVKPPALTSGRDMNAMCAKCHETAKMIEVHSKWLPQADLHIDALPCI
FT                   TCHTGSENYVITLYIQKRAGEKPQSDFKTATYEDLSRTLPGDRDVKAIIDTNNDNYISL
FT                   AELRSFNKSARHDGMRLWGMMTPEKVTHTYQILDNRWDCTFCHASGPRAMQTSFVAFPD
FT                   KNGTYSRVAVEKGAVLDLLYGTPDFYMMGSTRSMALSIIGGLIVSGGIAFAGIHGTFRF
FT                   LTRKNRKEH"
FT   gene            complement(606174..606407)
FT                   /locus_tag="KN400_0573"
FT   CDS_pept        complement(606174..606407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83436"
FT                   /protein_id="ADI83436.1"
FT                   /translation="MKPTTITQAAALWLGSVVPALAASGAREDNSGVFVWIFLGFCALI
FT                   IVAQLMPAVLMMLGFAKGLQKEPTMAKEEARH"
FT   gene            complement(606481..606873)
FT                   /locus_tag="KN400_0574"
FT   CDS_pept        complement(606481..606873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0574"
FT                   /product="response receiver"
FT                   /note="domains: REC"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83437"
FT                   /protein_id="ADI83437.2"
FT                   /translation="MLGLLIADNDTEARKQMADLFIEAGYNVIVTNSAANAIYGILKRA
FT                   AQVVLMGSEFDEFKAGELVPLLKKCNRDLTIILVSDEASLPTMRKLRKEGIFYHALKPS
FT                   KPEDKEEIRQAVRCAFDSLLSCRPAR"
FT   gene            complement(606924..607166)
FT                   /locus_tag="KN400_0575"
FT   CDS_pept        complement(606924..607166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83438"
FT                   /protein_id="ADI83438.1"
FT                   /translation="MKTTSKALMVTLATGGTVWAASGAESEANGLLVTMFLAFGALIIV
FT                   FQLLPGLMLFAAMVKGLFIRPAKDIATGTSGNETA"
FT   gene            607684..609096
FT                   /locus_tag="KN400_0577"
FT   CDS_pept        607684..609096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0577"
FT                   /product="sigma-54-dependent transcriptional response
FT                   regulator"
FT                   /note="domains: REC, sigma54 interaction, HTH8"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83440"
FT                   /protein_id="ADI83440.1"
FT                   /translation="MENIDVLVVDDEAIIREGLRRILEKEGYHVETSASGQIALERLQD
FT                   ENYGLVITDLKMPGMSGMEVLKAIKVLQPEVPVIIITGFSTVDTAVEAMKNGAFDYIAK
FT                   PFTPDQITEKVRKALEQRAVLLENIFLKKELGEHHGFDIFVGESKEMQKVYRRIIQVAP
FT                   TDSTVLITGESGTGKELVARAVHNNSHRRDNPFVAVDCTSLAENLLESELFGHIKGSFT
FT                   GAIQTKTGLFKVADGGTLFLDEISNISLTTQAKLLRVLQEREITPIGGTQPIPIDIRLV
FT                   AATNKNLRTLVSQGTFREDLFFRLNIIPIDLPPLRERKGDLHLLIGHFLATFSEEMGRD
FT                   IRGLAPDALALLEDYAFPGNVRELENIIERAVVLAEGDLIQKEDLELRVATDSQAGVGG
FT                   YVPQNVEELKETKRQIRERAVEPIEKAFVLQALKRNNWNITRAAEETGMLRPNFQALLK
FT                   KLRISVRNQMTN"
FT   gene            complement(609193..610803)
FT                   /locus_tag="KN400_0578"
FT   CDS_pept        complement(609193..610803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0578"
FT                   /product="sensor histidine kinase, HAMP domain-containing,
FT                   2 heme-binding sites"
FT                   /note="domains: HAMP, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83441"
FT                   /protein_id="ADI83441.1"
FT                   /translation="MRLSLLAKFTIATSFVLLVTMGLFAYINVEQLEKLLFEEAVSDAD
FT                   KLSETIIRTTHYHMLEDNRERAYQIINEVGSQKGITQRIRMINKFGQVTHSTDQREIGY
FT                   FLDKKAEACNMCHSGPSPLVHATTMNRSRLFTDREGKQVLGLAKAIYNDERCFTAPCHY
FT                   HPKEAKVLGVLDVIVSLDPMHQKVYAYRNEIIVLTVLQITLIALCLTFFTQRFVNRPVR
FT                   QLVRLTQQVGEGDLDTRVTLSSHDELGELASAFNSMTVNLKKVHGELEDWGKNLEVKVE
FT                   ERTQELKNIQAQLVHSEKLASLGELVAGIAHEINNPLTGILVFASLMASDKKLDPSLKA
FT                   DLDLIVKETQRCAKIVKGLLDFSRESIPQKKPSSINAIMDATLTLVVHQSCFHDITVVK
FT                   EYNPDIPEMLLDPHQIEQVFINLLLNACHAIAGSGEVHIRTGFDHVNDEVSVAITDTGC
FT                   GIPDEIIGKIFDPFFTTKETKGTGLGLSVSYGIIEGHGGRIDVQSTVGAGTTFTVRLPL
FT                   LHEAPLEAAAAAGQRQQSA"
FT   gene            611001..614546
FT                   /locus_tag="KN400_0579"
FT   CDS_pept        611001..614546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0579"
FT                   /product="glycoside hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83442"
FT                   /protein_id="ADI83442.2"
FT                   /translation="MTGTKRRELYFPFELHVSGRAWQRLDLETAAKGLPPSGGRILFLR
FT                   RIAERLDVASEAKGRQVFAGALNLYTLLLRALRGMVALYDEKGLPGALLSSLGTAGAVC
FT                   GEDAVETVERSFVGLFPPAAVLLGGESPDRFLDVAAYREQRRCHVATELLLLRVASENR
FT                   ATDTFRHLFDDGELAAVSPYRRVMEAVEGTLGALPHVPGLGLTLPELLRAPLKAAPDSL
FT                   EGQLSFVREQWGTFLPSELVEDIAIAFGILEEETRARWGGAGPPQVLRFGPGAGFSGPD
FT                   DHYPEPERFSPDVDWMPNVVLIAKMVYVWLGQLSRWYGREITRLDQVPDAELDKLASWG
FT                   VTGLWLIGIWERSSASRAIKHRSGNVDAIASAYSLFDYRIADDLGGWDALHDLKERALR
FT                   RGIRLASDMVPNHTGIYSKWIVEHPDWFIQLDHPPYPTYRFTGPDLSGSPEVSVHIEDG
FT                   YWDRTDAAVVFKMYDHRDGSTRYVYHGNDGTSTPWNDTAQLDYLKPEVREAVIRTILHV
FT                   AHNFPIIRFDAAMTLAKRHYQRLWFPQPGHSGVPSRAEHGMTRAAFDAAMPEEFWRQVV
FT                   DRVAAEAPDTLLLAEAFWLMEGYFVRTLGMHRVYNSAFMNMLKMEENAKYRQTIKNVLA
FT                   YDHRILQRFVNFMNNPDERTAVEQFGKEGKYFGAAVLLVTMPGLPMLGHGQVEGFHEKY
FT                   GMEYRRAYWDEPVDEHLVSGHERWIFPLMRRRPLFSGSGNFVLYDFFVNGAVNEDVFAY
FT                   SNRRGDDRALVVFHNRFAATSGWIRSSCAKVANPETGDTAPVQTDLGTALGFNDDGRHY
FT                   YAFRDHAAGLEYLRNGRELCREGLFVSLEPYEFHVFLDFREIRDDDFGTWGHLCHRLSG
FT                   GGAPSIDEEVKLVRHGTLVARFVDLWDEPAVLDILASPGSVTAARRKVTAAFREKLVAF
FT                   LTELARETGASGEVGTVADTIMARLALRVTLGAVKPGKTDEHGPGTCAAPGDASLDRLI
FT                   RGCLAVVGEAGRLASAEGYRARSAEWFVTLGLRRALANILRAACDSGDSEASRADWAVL
FT                   LVEVLLGLGEEGLDTPEALDRCLAGLFADREAARLLGVHRSGGIDWFVQERFEALVGWI
FT                   LSLAGRDAAVSKQTGWHAGYRTMRAREVARLTAMARTAGYRVDLMRAALLETTERKRPR
FT                   ASKKPVSAPKPCGNR"
FT   gene            614583..615347
FT                   /locus_tag="KN400_0580"
FT   CDS_pept        614583..615347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0580"
FT                   /product="protein of unknown function DUF980"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83443"
FT                   /protein_id="ADI83443.2"
FT                   /translation="MGLFARWRRKRLRRGGFPPQWLKIVERNVPFYGRLCVDDQQELLR
FT                   HVQVFVAEKSFEGCSGIQVTDEIKVTVAALACLLILHRPGDYYPYLSSIVIYPDEYVGQ
FT                   RQRWDEGGVVTEGPEPRVGESWELGTVVLSWKDVVLDAQAPDDGFNVVFHEFAHQLDHE
FT                   DRLTDYDGFLPNEPEQSPWREILEREYRRLIDDDEAGRWTFLDPYGAESPAEFFAVATE
FT                   SFFEMPGELKARHTGLYELLRSYYRQDPAVWE"
FT   gene            complement(615317..616273)
FT                   /locus_tag="KN400_0581"
FT   CDS_pept        complement(615317..616273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83444"
FT                   /protein_id="ADI83444.2"
FT                   /translation="MRLDRCIHFARQAMAATAGTALLLAAPVQAMVSAAPQDYLTVEAH
FT                   EASPAERTLAPLFSPSFQYRDITVTTEGDRRLVTITSDRGITSRNVRKLNESLISRGIS
FT                   IYGAAYYGDFAWDRTVLDAAITMTRKVEGEPDTIEISDGTVRDIKTNKPLVPLTAAVYE
FT                   LHIPVSTGFATSWKKQRIIPAVDIPAPEPRTGRFPGSRVFQIRENEALRRNVLYAVKGE
FT                   LREVEQFFDRKLKEIHRTVIVAGDAEGMPAPAEVFGIKTSAQVIVLSGYSYVNKKLVST
FT                   EVTLRRASDPNLSDYIEIEVVETSPDEGYSQTAGSWR"
FT   gene            complement(616537..616612)
FT                   /locus_tag="KN400_R0009"
FT   tRNA            complement(616537..616612)
FT                   /locus_tag="KN400_R0009"
FT                   /product="tRNA-Thr"
FT   gene            complement(616759..618069)
FT                   /gene="thiC-1"
FT                   /locus_tag="KN400_0582"
FT   CDS_pept        complement(616759..618069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC-1"
FT                   /locus_tag="KN400_0582"
FT                   /product="4-amino-5-hydroxymethyl-2-methylpyrimidine-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83445"
FT                   /protein_id="ADI83445.1"
FT                   /translation="MAMTQLEYARNGIITDKMKEAALAEGVSPEFIKAGIADGTIIICH
FT                   NNKHHNGRPLAVGTGLRTKVNANIGTSADDTDITKELEKARVAVRHGADAIMDLSTGGP
FT                   VDEIRRAIIAETNACIGSVPLYQAALDAVRTKKKAIVDMTVDDIFEGIIKHAEDGVDFI
FT                   TVHCGVTRATVERMKNEGRIMDVVSRGGAFTVEWMTYNNAENPLFEHFDRLLDIVKAYD
FT                   MTLSLGDGFRPGCLADATDRAQIHELILLGELTQRAQDVGVQVMIEGPGHVPLNQIEAN
FT                   ILLQKRLCHGAPFYVLGPLVTDIAPGYDHITCAIGGAIAAAAGADFLCYVTPSEHLRLP
FT                   SVEDVREGVIASRIAAHAADIAKGVKGAMAKDIAMAKCRKKLDWEGQFEQALDPEKARR
FT                   MRDESGVAEHGACTMCGEFCAYKVMDDAMEKQRTATL"
FT   gene            complement(618119..619591)
FT                   /gene="thiE/thiD"
FT                   /locus_tag="KN400_0583"
FT   CDS_pept        complement(618119..619591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE/thiD"
FT                   /locus_tag="KN400_0583"
FT                   /product="4-amino-5-hydroxymethyl-2-methylpyrimidine-phosphate
FT                   kinase and thiamin monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83446"
FT                   /protein_id="ADI83446.1"
FT                   /translation="MASNGHTLRLVINRDKHDSVIRGLYLVTDHDDNLIPRVEAAIDGG
FT                   ARVVQYRNKNQDRESRLALGLELRELCRRRSIPFIVNDDLEMAVSLKADGLHLGQGDGD
FT                   PREARRVLGPGKIIGVSTHTLSEALEAQAAGVDYIGLGAMFPSRSKEVEHVAGSELLAA
FT                   IRSSISIPIVAIGGITRDNGASVIDAGADAVAVISAVLSHPDPALAATEIALLFNRRAP
FT                   FPRGSVLTVAGSDSGGGAGIQADLKTVTLLGSYGSSVLTALTAQNTRGVSGIHGVPPAF
FT                   VADQLDAVFSDIPVDVVKTGMLFSAETIVAIAAKLTEYRRRMVVVDPVMVAKGGANLID
FT                   RGAVSVLKERLFPLAYLVTPNIPEAERLTGANISDEESMREAARRLHRLGARNVLLKGG
FT                   HLLAGDSVDILFDGAAFHRFVSPRILSKNTHGTGCTFASAIATYLAQGDPLREAIARAK
FT                   RYITAAIRLAQPLGRGHGPVNHILAAEDVRDR"
FT   misc_binding    complement(619658..619759)
FT                   /bound_moiety="thiamin diphosphate"
FT                   /note="thiamin diphosphate-responsive riboswitch;
FT                   KN400_R0062"
FT   gene            619882..621030
FT                   /gene="alr"
FT                   /locus_tag="KN400_0585"
FT   CDS_pept        619882..621030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="KN400_0585"
FT                   /product="alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83448"
FT                   /protein_id="ADI83448.1"
FT                   /translation="MDSRPTIAEVDLAALRHNYDLVVRTIPRGCGILAVVKADAYGHGF
FT                   MDIARELETLGVTAFGVAFLAEGIQLRKSGIDRPVLILGGVYPGQERKCVGFNLSTALF
FT                   SLEQARVLDDAAGRLYRRARVHAKIDTGMGRLGIPHEEASAFFSALRELKHLDLEGIIS
FT                   HFASADELDEDGRRYSDLQASRFAAAVAAARHEGFEPRYVHIANSAAAFGMDLPFCNLV
FT                   RPGIVLYGALPSGDFEGKMALKPIMRLRSSIAMLKWVEPGTSISYARRFTAPDRRLVAS
FT                   IPVGYADGYSRSLTNRGEVVVRGRRAPVVGTVCMDWIMADVTHVSGVTVGDEVTLLGCD
FT                   QEGNCVRAEELAEWAGTIPYEIFCGISKRVPRVYLNPSIRHR"
FT   gene            621047..622084
FT                   /gene="selD"
FT                   /locus_tag="KN400_0586"
FT   CDS_pept        621047..622084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:621092..621094,aa:Sec)
FT                   /gene="selD"
FT                   /locus_tag="KN400_0586"
FT                   /product="selenide, water dikinase,
FT                   selenocysteine-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83449"
FT                   /protein_id="ADI83449.1"
FT                   /translation="MTEGIKLTSLVKAAGUAAKLGPAGLEQALSDMVREDDPNLLVGPE
FT                   TADDAGVYRIGEGLALVETVDIITPLVDDPYTFGRIAAANALSDVFAMGGRPVTAMNLV
FT                   FFPACALPGSVLSAILAGGHDALREAGACLVGGHTVEDDELKYGLAVTGLISPSRVVRN
FT                   ATARAGDRLVLTKPLGTGIVSTAIKADMAPAALTAEAVRWMTMLNAEAAGLMLECGASA
FT                   CTDVTGFGLVGHACEVARGAGVTLRLHLEQVPVLDGVMGLVADGLVPAGCYRNRDHYAP
FT                   FVGAPRSDDDRLLPLFDPQTSGGLLLSLSPSSAGRFLAAAGDRGLFALEVGEVLPAGEC
FT                   AVDIV"
FT   gene            622071..623351
FT                   /locus_tag="KN400_0587"
FT   CDS_pept        622071..623351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83450"
FT                   /protein_id="ADI83450.1"
FT                   /translation="MTSSDSNVDPGLGIAVDLGTTTLAASLVDLSSGERLASAGSLNPQ
FT                   REFGADVVSRLDAACRSGEALQRMAALVREELYRLAARLLDSAGEARDRLRMVAVAGNP
FT                   AMEHLLLGLPVVRLAYPPYRPLFSTSTHISAADLGWDLSGRVALFPLPGGFVGGDTVAF
FT                   LFGVPDVCAPCPGPRLFLDMGTNGEMVLQCGDVLLGTSAAAGPAFEGGGLACGMAALPG
FT                   AVNGIIRDGDRVRVTTIGGGQPLGICGSAVLDTVALLLEEGLLDSTGRLLPPEEIASPV
FT                   GARMGTVGGEPAFILHRDAARTIYLSQEDIRQVQLAKAAIRAGIEVLCERARIRCEDIE
FT                   EVVLTGSFGAVLSPRSLKFIGIFTGKMVQTTRFVREGALAGVEKALTAPEGFEAVDRLA
FT                   RALRVIPLSGTPAFEKHFLKHIDFPSR"
FT   gene            623404..624969
FT                   /gene="purH"
FT                   /locus_tag="KN400_0588"
FT   CDS_pept        623404..624969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="KN400_0588"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase and IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83451"
FT                   /protein_id="ADI83451.1"
FT                   /translation="MAKITRALISVSDKTGILDFARELAGYGVEILSTGGTAKLLRDAG
FT                   LAVKDVSDFTGFPEMLDGRVKTLHPKVHGGLLGMRSNPDHAATMKAHGIEPIDLVVVNL
FT                   YPFEATVAKPDCTLEDAIENIDIGGPTMLRSAAKNNADVTVLVDPADYRPVLDEMKASG
FT                   GAVSRETNFRLAVKVYQHTAAYDGAISNWLGARTGEGVAAYPDTLTLQFRKAQEMRYGE
FT                   NPHQGAAFYVERQVKEASVATARQLQGKELSYNNIADTDAALECVKQFTEGPACVIVKH
FT                   ANPCGVAVGGTLLEAYDRAYATDPESAFGGIIAFNRELDADTARAICDRQFVEVIIAPA
FT                   VTPEATEVVAAKKNVRLLECGTWPEKQQPRLDLKRVNGGILVQDTDLDLYAELKVVTKR
FT                   QPTEQEMKDLLFAWRVAKFVKSNAIVYGKGNMTIGVGAGQMSRVNSARIAAIKAEHAGL
FT                   EVTGAVMASDAFFPFRDGIDNAAAVGITAVIQPGGSMRDAEVIAAADEHGMAMVFTGMR
FT                   HFRH"
FT   gene            624998..626269
FT                   /gene="purD"
FT                   /locus_tag="KN400_0589"
FT   CDS_pept        624998..626269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="KN400_0589"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83452"
FT                   /protein_id="ADI83452.1"
FT                   /translation="MKVLVIGGGGREHALVWKIAQSPLVSKVYCAPGNPGIGLIAENVS
FT                   LAVDDLDGLAAFATEQSIDLTVVGPELPLSLGIVDRFEEKGLLIFGARRNAAIIEASKA
FT                   FSKDLMKKYQVPTAAYDVFTEVEPAVAFIDRVGVPIVVKADGLAAGKGVIIAHTREEAV
FT                   GAVTDMLSGNAFGDAGSRVVIEEFLTGEEASFLAFTDGKNIIPLASAQDHKAVFDGDTG
FT                   PNTGGMGAYSPAPVVTPAIHDKVMAEVMRRTVDGMAAEGRPYRGVLYAGLMINGDQVKT
FT                   LEFNARFGDPECQPLLMRMKSDIVPVLLAVARGDLSGIELEWHDKAAVCVVMAAGGYPA
FT                   DYRKGDEIRGLEDAARMEDLFVFHAGTSRKDGRIVTSGGRVLGVTALGATVGEAIDRAY
FT                   RGVQAISWDGVHYRTDIGAKALTR"
FT   gene            626284..626793
FT                   /gene="purE-1"
FT                   /locus_tag="KN400_0590"
FT   CDS_pept        626284..626793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE-1"
FT                   /locus_tag="KN400_0590"
FT                   /product="5-carboxyamino-1-(5-phosphoribosyl)imidazole
FT                   carboxymutase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83453"
FT                   /protein_id="ADI83453.1"
FT                   /translation="MENPQVLIIMGSDSDVPVMEEAAKALDAFGVTWEMRVASAHRSPK
FT                   KAADLASNAAARGVKAIIAGAGVAAHLAGVLAAETILPVIAVPMPGGALNGVDALYSMV
FT                   QMPGGIPVATMAIGKAGAKNAGLFAVQILALGDSAMASRLVEYKASMAEEVEAKDRDLQ
FT                   VKLGRA"
FT   gene            626926..627201
FT                   /gene="ppcA"
FT                   /locus_tag="KN400_0591"
FT   CDS_pept        626926..627201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppcA"
FT                   /locus_tag="KN400_0591"
FT                   /product="cytochrome c, 3 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83454"
FT                   /protein_id="ADI83454.1"
FT                   /translation="MKKVIASLALSVFCAGLAFAADDIVLKAKNGDVKFPHKAHQKAVP
FT                   DCKKCHEKGPGKIEGFGKEMAHGKGCKGCHEEMKKGPTKCGECHKK"
FT   gene            627400..628764
FT                   /locus_tag="KN400_0592"
FT   CDS_pept        627400..628764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0592"
FT                   /product="ResB-like family cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83455"
FT                   /protein_id="ADI83455.1"
FT                   /translation="MTTSDRGFLQALWDFFCSLKLAIFLLILLAATSIIGTIIPQQNPL
FT                   PPEYIAAIGGTGSMKFKVYSTLGFFDMYHSWWFILLLYLFTVNIVACSIKRLPRVWKTI
FT                   SEPTLVMDEGFERTLTLTHDFKKEGDAAALNEKMKVFLKSEFAEPVVTERDGEFHLFAQ
FT                   KSPYSRLGVYVVHLSIVIIFIGALLGSFFGYKAYVNIVEGSGASTVMSRKGVPIDLGFT
FT                   VKCEDFSVSFYDTGAPKEFKSLLTVIDGGKVVIDKRPVIVNEPLTYKGITFYQSSYGPA
FT                   DEGGLYHLTVRERKGGAPVRLSLSMGERKVLPDGSAVQLLEATDEIGRFIPQFRGPAVR
FT                   VAVEPKSGEPQAFIVFQNYPEFDVQRGADQIFTYEGADLKMFTGLQVAKDPGVWVVWLG
FT                   CTLMVVGCCMAFFMSHKRIWIRVRKGHVTLGGTANKNQPGFQLAFDTLVEKLKTL"
FT   gene            628786..629637
FT                   /locus_tag="KN400_0593"
FT   CDS_pept        628786..629637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0593"
FT                   /product="ResC/HemX-like cytochrome c biogenesis membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83456"
FT                   /protein_id="ADI83456.1"
FT                   /translation="MTSSMLFNITTFTYLVSMLAFFAFLASRNRHVGMAGSLISYFGFI
FT                   VHTAAILLRWKESYDIGHGHAPLSNLYESVVFFAWTIVLIFGIIDMKYKYRVVGAFVMP
FT                   FALLGMAWAQLTLNSGIEPLVPALQSNWLLYHVVTCFLGYAAFAVACGISIMYLIKAGK
FT                   EDSSQSAQAGGIISMFPPTKILDDLNYKAIMIGFPLLTLGIITGAAWANYAWGTYWSWD
FT                   PKETWSLIVWFVYAAFLHARFTRGWVGKRAAILSIVGFAATIFCYLGVNLLLSGLHSYG
FT                   GG"
FT   gene            629751..630764
FT                   /locus_tag="KN400_0594"
FT   CDS_pept        629751..630764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0594"
FT                   /product="cytochrome c, 11 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83457"
FT                   /protein_id="ADI83457.3"
FT                   /translation="MKALLAGSVCRLLAVSLVMSATSLWSAPIPGIPDGCATRCHRSKA
FT                   RDGVVHGPVASDDCIACHNPVGAAVHPKQQGAFRPVAKGAALCQICHESMASKKVVHPP
FT                   VGGGECLSCHDPHQSANPSLLKARGAALCFGCHDAAAFSFRHGHLPVTTGECLKCHDPH
FT                   QSDSPRLLRGSGAALCFRCHDEKMAAGRSIHQPVARGECCDCHNPHGSSFPKLLRNAYP
FT                   EALYLSYEQNDFALCFTCHSRQMADDRRTDTLTGFRNGDYNLHYLHINKPDKGRSCKTC
FT                   HDAHAAPQQRLVKERIPGFGSWDIPIRYTKTDTGGTCVVGCHKPKSYDRLRAVSNP"
FT   gene            630779..631771
FT                   /locus_tag="KN400_0595"
FT   CDS_pept        630779..631771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0595"
FT                   /product="cytochrome c, 8 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83458"
FT                   /protein_id="ADI83458.1"
FT                   /translation="MLGKGLWLAVCAVILLGTPATAGTIAFVAPTPNTWVGRSDHLVLK
FT                   LNNPEITAVRINVNGVVGDMLAISSPEYRKAFQDFLIVQPLWDQGRNEVSVEAYAGKER
FT                   VETTVATVYYAPGRDGATVPPEFKPFAFHVADTESRCAGCHNMAPSPAQLLSTQERENP
FT                   CFGCHRGMLKVAFVHGPAGTYSCVYCHKEKASPKYSVPKRDSALCVECHEDKSTDFAKR
FT                   KYVHGPIAGGMCEVCHDPHGSANRAQLRMPINTLCLSCHEAVARRPHILRTPSGEGHPV
FT                   SGRKDPSASASGRDMSCISCHNPHAADVRYFFVNNAEERMALCQMCHNK"
FT   gene            631827..632912
FT                   /locus_tag="KN400_0596"
FT   CDS_pept        631827..632912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0596"
FT                   /product="NHL repeat domain lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83459"
FT                   /protein_id="ADI83459.1"
FT                   /translation="MNVLKLIRRFVGAAVLCALCAGCAGQQVREERRYFWPPLPERPRI
FT                   EWLGAYSSQNDFPKQGFASFMAAIAGEEQAMSLTKPLDVYADGQNRIYVADPGLRGVVV
FT                   FNMKERSVSMLGGPQAANQFNTPVSVTGDSQGNIYVSDAEKGGILVFDRFEVPRRFIDT
FT                   KATVTRNTDIAVDEKRQRILVVDAREHRIAILDMQGGLLSAFGKRGIEDGEFNFPVAVA
FT                   INRKGEIIVGDAMNARVQIFDQDGKFLRKFGRRGDGPADFQIMKGVAVDSEDHIYVTEG
FT                   KGHKLIIFGTNGEYLLTVGGLYSAITTGKQAPGGFVIPQGVFIDDKDVIYVVDQLNRRF
FT                   QVFQYISDDFLKRNPIPGWQE"
FT   misc_feature    632931..633086
FT                   /note="conserved nucleotide sequence; KN400_R0139"
FT   gene            633489..634187
FT                   /gene="omcE"
FT                   /locus_tag="KN400_0597"
FT   CDS_pept        633489..634187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="omcE"
FT                   /locus_tag="KN400_0597"
FT                   /product="cytochrome c, 4 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83460"
FT                   /protein_id="ADI83460.1"
FT                   /translation="MRSEAKIGLALTALLVAVTAAGAASIKNTKHDLSSGSTGATFKAT
FT                   NTDQICVFCHTPHNSVQDIPLWNRGNPTATTFTLYSSSGMNNAPVKQGFTADSISLFCM
FT                   SCHDGATGLGGAVHNDPNGVAITMVGGNDVITGDANLGTDLSNDHPVNFLVTASGIAAD
FT                   GNLGALDTGTNPPTMKTADVTNGLPLFRSARGATTLECGSCHKVHDNTDAPFLRTTMAG
FT                   SKLCLGCHKK"
FT   gene            634340..636607
FT                   /locus_tag="KN400_0598"
FT   CDS_pept        634340..636607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83461"
FT                   /protein_id="ADI83461.2"
FT                   /translation="MGSMTLGRMHIGLASVSVLAGLVLCSPASVRAGISGEAELGYVRY
FT                   EADANGARVSDAHSFYQRYSLLYETSGELYKGRVGRYDLALGYEWGSFDTKIKNPSNPT
FT                   DPQTNYNPSVSAGHLLYRGEVVLDPLELPLRLRAYSYDTNRINMHEDLSGIDGSSIFAP
FT                   RLITNLYDGMHINSGATLVFGVKNGLTNGYNAIFRHIPLVMLDYRDDVNRDLKSLAPVD
FT                   TRMRRLAFVSLNKRDNWFHYRTTDFRDYLNTDQSFKETQMQIGTVDHLLARRWIDLTNW
FT                   VKISADGQFTKHASSMPANSFEAYELNLFAVASRKTWDARTFSSFSRLLDDEGITLERT
FT                   VPFYASGVLGADVDWKASLYSNEKKIQSPSGSVVNNSNYSASVRADMFRRSPFTLGVVV
FT                   RGESTESYGSKLLSFEGGVETASTARLSRDYSLSGSYTVKYFDATGGTGSGDGYLNQNV
FT                   LGRVAYAASPTWRFEVEEDLSAASGTNPRNFNNSAITVNSGFSSGTSTVSGSAISFQRR
FT                   NSEIDEYVRSVTTVSAAWRPFSRTSLSFSVSEDVLMQSGAPTDFLTTFRSTIDYSTPTF
FT                   LARMRNSYNVRMVGGESIDYLESVGILEYRPVRQLEGLLTYTYNVGDVDVNTRSEFLDL
FT                   RQRLGYSFYTLSGANRKLLELYEEFTYNRTLNTGTVANELNTTRRFTLGVRYFPLRSLF
FT                   VGADARYSLIEPGSITEQLYTGVVGLNFRKLQANLEYTYGKRDGSDNRIEKRIAANVKK
FT                   FF"
FT   gene            636682..637683
FT                   /locus_tag="KN400_0599"
FT   CDS_pept        636682..637683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83462"
FT                   /protein_id="ADI83462.1"
FT                   /translation="MADSITFSIIIPVKPGGTVRALDRLGSAEYPSSHMEVLVAEGTRP
FT                   SRQRNQAAAAAAGEILYFLDDDSLTSPDFLARAAAHLADPSIAAVGGPSLTPASDSRFQ
FT                   RAIGVVLASRLGGGGARNRYRATGSPRRTSERELILCNLAMRRDVFLAEGGLDERLYPN
FT                   EENELMDRISKRGMSLVHDPDLAVRRSQRPTFRAFVRQFFGYGRGRGEQTRIAGVRSVV
FT                   DFLPTVFLIYLLLLPVAPWAPCFLPAALYGAAVMVSALSGAVHSRLYAALPWLVVLYPT
FT                   LHLCYGAGLLKGLLAPRFRSGGGETAPVTIRCVKEFGTPWHLPAHGPREVPR"
FT   gene            637680..639179
FT                   /locus_tag="KN400_0600"
FT   CDS_pept        637680..639179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0600"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83463"
FT                   /protein_id="ADI83463.1"
FT                   /translation="MTASPLPHKRILLVFFLLVTVTVYGNTFFNQWTYDDIPVVLKNPD
FT                   AHSLAGFARNTMPGRPIRELTYIPDHLLFGDQPAGYRIQQLAWHGVNGLLLVALFHALG
FT                   VELPFALMGALLFLVHPLQSESVAGIAHRKELLALFFALGAVLCFVGSFAAAGGRRLAL
FT                   WLAALAAYGGALLANEATVTLPLVALLYEWLMVEPRKRVLLRRPLVTLLFLVAAGAALM
FT                   YRFRGLLAPEHLLTVYSKNSFGASENYLPLFMGAMKAFGFYLSKIVLPVRLAPEYVFRL
FT                   SESLWQPWALLSLGLLASVASATVFLRRRLPLVSFGIGWFLIFWLPVSNLVPVAYLAAD
FT                   RYMYLCLPGVGLVLAGCLQRWPHRRFVGASCLVIVVFAGLTVIQNGYWRSEHTLWRHAV
FT                   RVNPDSTWVRETVGLSYLLTGDYNQAAAHAREALRIDRFNIRAYLTLAKAEERRGNLAE
FT                   AVLNYEMFAMFGAMEYPDEAAEVRLYLPVLRQRQAVQKQHQ"
FT   gene            639188..640138
FT                   /locus_tag="KN400_0601"
FT   CDS_pept        639188..640138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0601"
FT                   /product="undecaprenyl-phosphate glycosyltransferase,
FT                   DPM1-like family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83464"
FT                   /protein_id="ADI83464.1"
FT                   /translation="MELSIVVPIYNEEETIPHLHARVSDALVGSGIDYELILVDDGSSD
FT                   GSFALLREIAQQDRRVKVIRFRRNFGQTAAMAAGFDAARGRVIVPMDGDLQNDPADIPM
FT                   LLATIDEGYDVVSGWRKDRQDTFVNRRLPSIIANALISRMTGVHLHDYGCTLKAYRREV
FT                   LDGVNLYGEMHRFVPALASQVGARVTEIPVRHHARLYGTSKYGISRTMRVVLDLMTVKF
FT                   LLTYSTKPIQLFGKWGIYTILAGFLTGGLTLSMKLFEGMSMNRNPLLILTAFLLFGGVQ
FT                   FIALGLLGEVNARTYHESQGKPIYVVREKINLDER"
FT   gene            640163..641314
FT                   /locus_tag="KN400_0602"
FT   CDS_pept        640163..641314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0602"
FT                   /product="glycosyltransferase, YqgM-like family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83465"
FT                   /protein_id="ADI83465.2"
FT                   /translation="MLAPTPFFADRGCHVRIYEEARTLIARGHQVRIVTYHLGRDMAGI
FT                   PTDRTLRVPWYTKLSAGPSWHKPYLDVLLCGTALRTARRLRPDLIHAHLHEGAFFGVFL
FT                   KKLMGIPLLFDCQGSLTMELADHGFVREGSLLYRFFALMEGGINRSADAIVTSSGPGRD
FT                   DLVTKWGVPAVKVTALMDGVDTAVFRPHDRTEVRRRLGIAPDVPLAVYLGVLNRYQGID
FT                   LLLSAMVILKSRGNPLRLLVMGFPEEGYRQKARDLGIADMVTFTGRIDYGKAPLYLSAG
FT                   DMAVSPKVSLTEANGKLFNYMACGLPTIAFDTPVNREILGETGIYARYGDAADLAAHLA
FT                   GLAGDAAARAERARLARERAEREHSWQARADVLEAVYRRMKRA"
FT   gene            641355..641993
FT                   /locus_tag="KN400_0603"
FT   CDS_pept        641355..641993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0603"
FT                   /product="helix-turn-helix transcriptional regulator,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83466"
FT                   /protein_id="ADI83466.1"
FT                   /translation="MNELREKDESYRSFLLLSAISSEEPLSQREIARQVGIALGLVNSY
FT                   LKHLVDKGFVRIKSFPRNRYAYLLTPRGLAEKSRLAYEHLSSFTTLFRVARQDYLALFR
FT                   ALKTQGVGRVAFCGVDEVAEIAYLSLREVGLELALVMDQATDGREFFGKPVVSIPHGLL
FT                   AGNHHIVITTFKRREALREELLQRGVASELLHQAGEPAGETQSIREEHP"
FT   gene            641990..643039
FT                   /gene="gmd"
FT                   /locus_tag="KN400_0604"
FT   CDS_pept        641990..643039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmd"
FT                   /locus_tag="KN400_0604"
FT                   /product="GDP-mannose 4,6-dehydratase and
FT                   GDP-6-deoxy-D-lyxo-4-hexulose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83467"
FT                   /protein_id="ADI83467.1"
FT                   /translation="MKRALITGISGQDGSYLAELLLGKGYEVHGVIRRSSSFNTGRIDH
FT                   LYRDPHEPDVRLFLHYGDLNDASSINRVLREVRPDEIYNLGAQSHVRVSFDVPEYTGEI
FT                   DALGTVRLLEGIRETGLNTRFYQASSSELYGKVVETPQKETTPFYPRSPYACAKAYAYY
FT                   ITVNYRESYGMYACNGILFNHESPRRGETFVTRKITRAAGRIKTGLQDRLYLGNLDAKR
FT                   DWGFAGDYVEAMWLMLQQQEADDFVVATGETWSVREFAERVFARLGMPLEWQGKGGHEK
FT                   GIDTNSGKIVIEIDPRYFRPAEVDLLLGDPAKARRQLGWQPRVDFQGLVDMMTDADLAL
FT                   AEREKRADG"
FT   gene            643032..643976
FT                   /gene="fcl"
FT                   /locus_tag="KN400_0605"
FT   CDS_pept        643032..643976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fcl"
FT                   /locus_tag="KN400_0605"
FT                   /product="GDP-L-fucose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83468"
FT                   /protein_id="ADI83468.1"
FT                   /translation="MDRNARIYVAGHRGLVGSAIVRKLTAEGYGNLLLRTSGELDLRDQ
FT                   AAVAAFFAAEQPDYVFLAAAKVGGIVANNTYPAEFIYDNLMIEANVIHSSYRTGVSKLL
FT                   FLGSTCIYPKMASQPIREEYLLTGPLEPTNEAYAIAKIAGISLCRSYNRQYGTRFIAAM
FT                   PTNLYGPNDNFDLEKSHVLPALIRKFHEAKIAGAPTVTVWGTGAPLREFIHVDDVADAA
FT                   LYLMRHHEGNDIVNIGSGEEISIRDLALLVKIVVGFEGELVFDASKPDGTPRKLSDVSR
FT                   LHSLGWRHRIGLEDGVRETYEWFVGQGFPAETM"
FT   gene            643973..644818
FT                   /locus_tag="KN400_0606"
FT   CDS_pept        643973..644818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0606"
FT                   /product="SAM-dependent methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83469"
FT                   /protein_id="ADI83469.1"
FT                   /translation="MIPVPVKNIARFLMHRRAWRFVSFDYCPVCDTRSMIVYSRELERW
FT                   LADLTASWEAGEDFKRMLAMRENFLCVTCMANSRMRMLARTVLDLCGHATSGDLARRLC
FT                   SDPLFSVYETAAYNIFRIDALKACPRYVVSEYLAPDRFGETIGGVRNESLECLTFPDDS
FT                   FDVVINSDVLEHVADLDKSLEEVRRVLKPGGYHVLTVPVDYSLEHTVERARMGQGGIEY
FT                   LKSPVMHGDTVRNTGVLVFRDFGRDAASCLSREGFPCLEMQLPGRHGEIISVFIGKKAA
FT                   "
FT   gene            644818..646218
FT                   /locus_tag="KN400_0607"
FT   CDS_pept        644818..646218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0607"
FT                   /product="lipopolysaccharide/O-antigen transporter,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83470"
FT                   /protein_id="ADI83470.1"
FT                   /translation="MDGKLTFRAVAEAVALLLGAASMIYMSRVVGPEYVGFSAATSAVL
FT                   LLLTRFADGGLTALSSQRLARDDDTLGALLALTVPPKIVLSCAVIAATLLVVRFAGIDP
FT                   RLAYFLSTAVFLIFFEVFSPAWVFVALGEINTASFIRVAQSSIYALVVFAFIRAPLDWQ
FT                   KLPYIMVLNSALGCVLALLFLGRHRVRALDRRQFGSTYGRKIRQAFAESRHFLKADLSL
FT                   YVFTTSDRLILYYFATPHAVGIYEAAYKIINPFYAISSIVTPTMFRPLAQSFKQGTPAA
FT                   VLSRFTFLMLVGTVPLGFFLLLFSESIIITLYGPSFSESIACLQVLGFAITLGYAAGAI
FT                   VLPFSAWNMAREYGATMTYGNIFNVLLNIALIPSLGGVGAALSTVAAKLAVALAAYRHF
FT                   RNVTDYPILSDLLLFAVMACVPLLLVLALGLAVENAVILMTVYAASYAVLVLVLVRTRY
FT                   SRLWKDAV"
FT   gene            646218..646940
FT                   /locus_tag="KN400_0608"
FT   CDS_pept        646218..646940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0608"
FT                   /product="SAM-dependent methyltransferase, type 11"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83471"
FT                   /protein_id="ADI83471.1"
FT                   /translation="MTITDDFIAKSKYSDLGRYCVTAFVKSVADGLAPGSSLLDAGAGE
FT                   CAYKGLFRHCDYKAADMAIGDSTWNYDHLDYKAPLDNLPIPDASFDAVLCTQVLEHLQK
FT                   PLECVKEMYRVLKPGGRLFLTVPMAQDEHQTPYDYFRYTSYGLKYLCTAAGFSEVSVVP
FT                   MGGMFLRWAYELPRALRMFPKARNSGVSGIRLAGVFLYPLRVALGLVIPVCQAMLLFLD
FT                   RFDTVRNDPWGWELTARK"
FT   gene            646952..647917
FT                   /locus_tag="KN400_0609"
FT   CDS_pept        646952..647917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0609"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83472"
FT                   /protein_id="ADI83472.1"
FT                   /translation="MREIPLVSVALATYNGERYLRRQLDSVLAQTYRNIEIVVSDDCSR
FT                   DGTVAILEEYRRAHGITFRVNERNLGFVRNFERALAGCRGEFIALSDQDDIWLPEKIET
FT                   LVREIGPHSLIYTDALLIDGDDQPLPGSLVEVSGVRPVSGTCFEYFVCNNCVTGCTAML
FT                   RRDLLATALPIPEAETYHDWWLAVAASRRNGVVYHAAKLTEYRQHAHNYTGANVRAGLP
FT                   ARIAAHLMGKTAAEKRGYYELLANRARRYRAMADRLNLTPAERSFLEEIGEYAESLLSG
FT                   GNRMKTFALALKYRETLFPAAGRWEKLLFVFSKLIAARAI"
FT   gene            647943..648746
FT                   /locus_tag="KN400_0610"
FT   CDS_pept        647943..648746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0610"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83473"
FT                   /protein_id="ADI83473.1"
FT                   /translation="MATRFLSSLKAAVKESGIFPSYLARKRAAARFLRGSGLEIGALHF
FT                   PLQVPPGVTVKYVDYVSREENIRKFPELDAASIVPTDYLEDGFTLASIPDCSQDFVIAN
FT                   HVLEHASNPLQVLSNWARVLRPGGTLFITVPIGSRCFDKGRPLTPLQHFIDDYELVRDG
FT                   TSQSLDERNRLHYREWLTISTPNSDARNRHYRNLSGEELESLVETMSAGKAEIHFHVFS
FT                   RESFVTLLDYFTTSIRSDFSVKAVIRSRGGAESLAILERSPRAGR"
FT   gene            648743..649606
FT                   /locus_tag="KN400_0611"
FT   CDS_pept        648743..649606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0611"
FT                   /product="dTDP-L-rhamnose--6-(N-acetylglucosamine-1-phospho)-4-N-acetylglucosaminyl-N-acetylmuramyl(pentapeptide)-diphospho-undecaprenol
FT                   3''-alpha-L-rhamnosyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83474"
FT                   /protein_id="ADI83474.1"
FT                   /translation="MKGDRLADIRTIGVVVLYRPDSSVLDAIASYRHQVHELIVVDNSE
FT                   EQDHKLHSRLRDRFGATIVGEGRNLGIAAALNRAAREALAEGFDLLLTMDQDSRAEPGM
FT                   VEQMLACLGSDWRERVGLIAPFHLTGARPAPGGTTPCSDVMTPMTSGCLVNLAAFREVG
FT                   PFRDDFFIDFVDNEYCLRLRKKGFQVVRANRALLHHRVGDLRRYGPFVATHHSPLRRYY
FT                   KTRNRCAVFAEYLRDFPVHCLFDLVRLGKEVASILIFEREKTAKLRMMWRGFLDFRRGR
FT                   FGPYGG"
FT   gene            649611..650807
FT                   /locus_tag="KN400_0612"
FT   CDS_pept        649611..650807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0612"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83475"
FT                   /protein_id="ADI83475.1"
FT                   /translation="MKIVFLAPFGIRPKGTVVARMVPLAAELQALGHRVTIVAPPYTNP
FT                   EDSGHTEEIRGVRLRNIRLAPGGAALSAPVMAWRMYRAAREEEPDLIHLFKPKGYGGLA
FT                   AMLHLLTASRSSPLFLDTDDWEGRGGMNALHDYSPAQRLLFAFQEEWLPPRVRGVTVAS
FT                   RELEARIAAMGVAPERLLYLPNCVDDQPLGNGARVRARLGIDGNAPVVLLYTRFFEFSQ
FT                   EDLHRVFAGLSRKVPGIRFLVVGTGRNREEELLAAAARAEGFADSLHIAGWVEPDELPH
FT                   WLAAGDVALYPFADTLVNRAKCPAKLTELMRAGVPVVADRVGQIAEYVEDGISGILCRP
FT                   SAPDEMIARIAELLADPVRRRAVGTAGRERILSRFNWRDAAARLDAFYDNLTRRRNLA"
FT   gene            650804..653239
FT                   /locus_tag="KN400_0613"
FT   CDS_pept        650804..653239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0613"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83476"
FT                   /protein_id="ADI83476.1"
FT                   /translation="MTTERKKDLLLMGALLAILVLFFAKILFTGKIIRAPDITNEFYWT
FT                   IKHYKEMGFLDLFRVHLRAGWDWLTNGGTTEGGGTLSLQFLFYRSLIFWLFPAPANVAW
FT                   FIVFHLFVGGAGTYFLCRAIGTGRAAALLGGLIFAIAPENASLINAGHAQKIATISFAP
FT                   WAFYFLERGYQSRRTIFFLASAVVLAIQFFNMHWQIAFYTCLAIGAYGLCRTAGIIAGD
FT                   PDSRTGKGIARLVGLNAVILCFFLSTVAISLIPLADWSRETTRGLQSGSNQGQGGLQVE
FT                   EAMSWSMPPEEAVTFVIPGFFGLSRQEGGYDDPSHGTYYWGRMVFTQTTDYMGLLPWLL
FT                   APLPFIFRRDRYAWLAFGAVVGGLFFSFGKYTPFYWLLYEHFPGIDHFRVPKMMLFVTT
FT                   LGLAVLAARGADLLLDDEVRATSAFSRYLAGAIALVPALLALLGITMAARPYVMDLLSP
FT                   MITQPTRFEQGPALVAQRLQTIQREIGIAAAFAAVYGAVLWSWARGWFSRRALPYLLVG
FT                   VFLVDVGRVNAKFMLLQDVPQKVKGEKSPVVEFLAPMPKTGRVLPIDGSDPMEYVSHGI
FT                   PVMFTSNPVQIARWQDFLESFSFDSAMPDMMNVRYLVHDAQQYEDDRQALGPRYVPVFA
FT                   SPDGSRLVLENRGVLPKAWLAPSALLLSDPRQILGIMQQPSYNPRSFAVVEEQPPIPMP
FT                   PPMAQPKGDAGEVTVTRYEANDIACDVRAGRNALLVLGEKFHAGWRARVDGTPTEIHRV
FT                   NYILRGVYLSPGRHRVEFTFDPLPFKVGKYLTLTSFAIFLLMVGREWLLSRTRRGGGE"
FT   gene            653242..654018
FT                   /locus_tag="KN400_0614"
FT   CDS_pept        653242..654018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0614"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83477"
FT                   /protein_id="ADI83477.1"
FT                   /translation="MSGAPEEGTETLDELRAYDLKILQQRDGYRFSLDPLLLCAFSCLT
FT                   EGGRGIDLGTGSGIIPLVLARRCPGSTFVGVEFQERMAHLAERNVHLNGLAERIAILRE
FT                   DVLGLRRRFPVSSFDLVLSNPPYRRRGTGKISPRAGRDDARHESTATLADFLESAKYLV
FT                   KTTGRICFIYHPARLPELMAHAASLKLACLRLRLVHGTRTAPARMAMVEFAKGRRGDLE
FT                   VLPPLVVRNDDYTYSAEVAELLGEYGPEGGYSTSEQ"
FT   gene            complement(653997..654476)
FT                   /locus_tag="KN400_0615"
FT   CDS_pept        complement(653997..654476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0615"
FT                   /product="protein of unknown function DUF721"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83478"
FT                   /protein_id="ADI83478.2"
FT                   /translation="MGDVRGRMGKPRVVGDLLADVLRGKPAERRLKEGRIWLFWDEAVG
FT                   ERIAARARPVAFRDGTLTLAVVSAPWMQQLSFLKGEITDRLNSLLGEPVVRDIYLKAGH
FT                   IAPPAQDGDTPSRPSRELSSAEERFIEDTTDQMDDEELREALASLMQRHYCSDVE"
FT   gene            complement(654469..654726)
FT                   /locus_tag="KN400_0616"
FT   CDS_pept        complement(654469..654726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83479"
FT                   /protein_id="ADI83479.1"
FT                   /translation="MHAFFMISGLTLTALLINIPLGYLRQGCEKFTFGWYFYIHISIPL
FT                   IIYLRVKAGFSWKFIPLTLGGAVAGQLIGGFIHRRRQNNG"
FT   gene            654807..655061
FT                   /locus_tag="KN400_0617"
FT   CDS_pept        654807..655061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0617"
FT                   /product="protein of unknown function DUF3343"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83480"
FT                   /protein_id="ADI83480.1"
FT                   /translation="MVREGERVAIFNSIHRVMKAEKLLKGQGMVILLIPAPRDLHADCG
FT                   LAIRYASADAVAVESSLREADLEPEEIHEKTAVGYSRLP"
FT   gene            655264..656622
FT                   /gene="ffh"
FT                   /locus_tag="KN400_0618"
FT   CDS_pept        655264..656622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="KN400_0618"
FT                   /product="signal recognition particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83481"
FT                   /protein_id="ADI83481.1"
FT                   /translation="MLENLSDKLDVLFKKLRGQGVMSEENIKEALREVRLVLLEADVNF
FT                   KVVKDFVERVRVRAVGTQVLQSLTPGQQVIKIVQEELVALMGGGEDNSLDLAAKPPVSI
FT                   MMVGLQGAGKTTSCGKLARLLKGQRRRPLLVPADVYRPAAIEQLKTLGRQLSVEVFDSR
FT                   ADQDPVDICREALRYATLNGFDVVILDTAGRHQIDEYLMNELVRIKEAAEPREILFVAD
FT                   AMTGQEAVNVASGFNDRLDITGVVLTKLDGDAKGGAALSIRAVTGKPVKLVGVGEKLDA
FT                   LEVFHADRLVSRILGMGDILTLVEKAQATFDSQEAERLQQKLKKSQFDLEDFRNQLQQI
FT                   KKMGSIESILGMIPGVGKAMKQLQGAQPSERELKRIEAIIGSMTPAERANHAIINGSRR
FT                   LRIAKGSGTTVQEVNQLLKRFTEAQKMMKQLQKLGPKGLMRGMKGMGKGMFPF"
FT   gene            656705..656971
FT                   /gene="rpsP"
FT                   /locus_tag="KN400_0619"
FT   CDS_pept        656705..656971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="KN400_0619"
FT                   /product="ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83482"
FT                   /protein_id="ADI83482.1"
FT                   /translation="MAIKIRLARAGAKKKPFYQIIVADVRSRRDGRFIENVGTYDPNQN
FT                   PAAVKFEEAKTLEWLGKGAQPTDTVKQILKKAGIWEKFVAKSV"
FT   gene            657024..657254
FT                   /locus_tag="KN400_0620"
FT   CDS_pept        657024..657254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0620"
FT                   /product="RNA-binding KH domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83483"
FT                   /protein_id="ADI83483.1"
FT                   /translation="MRELVETIARALVDDPTQVRTTEEMEDDATVIKLTVAKEDMGRII
FT                   GKEGRTAKAIRTLLNAVSTKDNKKAVLKIVE"
FT   gene            657275..657793
FT                   /gene="rimM"
FT                   /locus_tag="KN400_0621"
FT   CDS_pept        657275..657793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="KN400_0621"
FT                   /product="16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83484"
FT                   /protein_id="ADI83484.2"
FT                   /translation="MRQDDLKLLGKIVTTHGIRGQLKVASFSGEFDTILSLETVVLKGK
FT                   DGRMETFPVARATVHHDRVLLSLTPFTNINEVLHLIGCELYAHRDQFPPLEEGEYYWCD
FT                   LIGLQVVTAAGTVIGRLDSILPTESHDVYVVRGADREYLIPAVEDVVVQVDLEAGTMTV
FT                   SPPEGLLDL"
FT   gene            657790..658527
FT                   /gene="trmD"
FT                   /locus_tag="KN400_0622"
FT   CDS_pept        657790..658527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="KN400_0622"
FT                   /product="tRNA (N1-methyl-G37)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83485"
FT                   /protein_id="ADI83485.1"
FT                   /translation="MKFDILTLFPAMFDGPLTESIIRRAVERGVVDISLHNIRDYATDR
FT                   HRVVDDAPYGGGDGMVMKVEPLAACIEAVKAERPAARVILTTPRGRRFDHDAARELAGY
FT                   EELIIVCGRYEGIDERVRDLFVDDEFSIGDFVLTGGELAAMVMIDAVIRFIPGVLGSPG
FT                   SAEYDSFADGLLEYPQYTRPVEFRGVQVPGVLLSGNHAEISRWRRQKALELTRRVRPDL
FT                   LHKAELSSSDRDCLAMLEREGEP"
FT   gene            658524..659108
FT                   /locus_tag="KN400_0623"
FT   CDS_pept        658524..659108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0623"
FT                   /product="protein of unknown function DUF2168"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83486"
FT                   /protein_id="ADI83486.1"
FT                   /translation="MTCGECSRPAVSVALVHYPVYDKNRQVVATAVTNLDIHDISRSAR
FT                   TFGLNHYYLVTPVEGQKELAGRIIRHWREGWGASYNPKRKAALDLVRISNSIEEVLEEL
FT                   GNEYGAPARLVTTGARQHPRSIGYEQMASIMAHDREHPYLIVFGTGWGLTEDFFDRADF
FT                   VLAPIQGPGEYNHLSVRSAAAIIMDRLFGVR"
FT   gene            659183..659539
FT                   /gene="rplS"
FT                   /locus_tag="KN400_0624"
FT   CDS_pept        659183..659539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="KN400_0624"
FT                   /product="ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83487"
FT                   /protein_id="ADI83487.1"
FT                   /translation="MNKIDAIELEQMKKNIPPFKPGDTLKVHVKIVEGDKSRIQAFQGV
FT                   CISRQNGGIRESFTVRKISNNIGVERVFPLHSPTVDAIEVITRGHVRRAKLYYLRKLRG
FT                   KAARIREKKYVAAQ"
FT   gene            659594..660229
FT                   /gene="rnhB"
FT                   /locus_tag="KN400_0625"
FT   CDS_pept        659594..660229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="KN400_0625"
FT                   /product="ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83488"
FT                   /protein_id="ADI83488.1"
FT                   /translation="MSLTLFDHEPQPAVWDFESRAARRGYRTIAGIDEAGRGPLAGPVV
FT                   AAAVILPFGTDLPGVDDSKKLTPARRDDLFTLIQGTALAIGVGVADHKVIDRINILQAT
FT                   LAAMREAVECLTDPPDYLLVDGISPVPLPVAQQTIKKGDSASISIAAASIIAKVTRDRL
FT                   MAEYDQLYPGYGFAEHKGYGSASHMAAIAALGPSPIHRTTFRGVREHL"
FT   gene            660238..660624
FT                   /locus_tag="KN400_0626"
FT   CDS_pept        660238..660624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0626"
FT                   /product="protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83489"
FT                   /protein_id="ADI83489.2"
FT                   /translation="MPVGEGSHHNKILGVRGEDLAAAYLERLRYRIIDRNFRCRGGEVD
FT                   IVARDGKTLVFVEVKTRRTAGYGVPQLAVTPFKQRQISKAALAWLTRKGMLDVNARFDV
FT                   IAITILSPDAPRIEHITNAFELAY"
FT   gene            660693..661544
FT                   /locus_tag="KN400_0627"
FT   CDS_pept        660693..661544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0627"
FT                   /product="nitrilase/amidohydrolase superfamily protein,
FT                   class 8"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83490"
FT                   /protein_id="ADI83490.1"
FT                   /translation="MDFTVALAQIKPKLGCVADNCLMVRQAVERGIDEKADLVVFPELA
FT                   LTGYFLKDLVPDVALRLDAPEINALRELSRHISIAVGLVEVSADYRFFNTSLYLEGGEV
FT                   RHVHRKVYLPTYGLFDEQRYLARGEHFRAFDSRFGRMGLLICEDMWHLSAPYILAMDGA
FT                   TTVICLSSSPGRGLTEDDSLGSTIAWQKLTSTTAMFFNCRVLYCNRVGYEDGVNFWGGS
FT                   EVVAPSGAVTSRARILEEDFLVAGVDEGALRRERIFSPMMRDESLLITLSELRRIERER
FT                   GR"
FT   gene            661544..662365
FT                   /gene="nadE"
FT                   /locus_tag="KN400_0628"
FT   CDS_pept        661544..662365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="KN400_0628"
FT                   /product="NAD+ synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83491"
FT                   /protein_id="ADI83491.1"
FT                   /translation="MGGLMVNAALLRQVLVGFLREEVHKVGVRKAVLGLSGGIDSALVA
FT                   FLAAEALGPDNVHAIIMPYRTSNPESEAHARLVAEQLGINHEVIEITPMVDAYFTRFPD
FT                   ADNMRRGNKMARERMTILYDHSAALGALVLGTSNKTELLLGYGTLYGDMASALNPIGDI
FT                   YKTQVWQLSETMGVPRQIIEKKPSADLWAGQTDEQELGFTYREVDELLYCMIDLRMNRL
FT                   ELLARGFVADFIDTVSGKVQNSHFKRRLPVIAKVSNRTIDRDFRYSRDWGK"
FT   gene            662396..663256
FT                   /gene="rsmI"
FT                   /locus_tag="KN400_0629"
FT   CDS_pept        662396..663256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmI"
FT                   /locus_tag="KN400_0629"
FT                   /product="16S rRNA (2'-O-methyl-C1402)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83492"
FT                   /protein_id="ADI83492.1"
FT                   /translation="MPGILYIIATPIGNLEDITYRAVRILGEVDLVAAEDTRHTRKLLS
FT                   RYGITKPLTSYFDHNKSLKGEYLLTRLHDGQSVALVTDAGTPCISDPGYQLVRDAVSEG
FT                   ILVVPVPGPSAFVAALSAAGLPTDAFVFEGFLPTRGKRRLEKLANLKGEQRVVIFYEAP
FT                   GRLQAALADMREVLGDRHVVVARELTKIHEEFVRGRVSFVAEHFAAVDVKGEVVILVAP
FT                   APAPATPGEGELKDLLRHYLRRSDISFKDAVKRVSVELDISRAQVYEMALKLKNDDESV
FT                   GFEKR"
FT   gene            663522..665077
FT                   /locus_tag="KN400_R0010"
FT   rRNA            663522..665077
FT                   /locus_tag="KN400_R0010"
FT                   /product="16S ribosomal RNA"
FT   misc_feature    665077..665181
FT                   /note="trRNA_1; KN400_R0140"
FT   gene            665232..665308
FT                   /locus_tag="KN400_R0011"
FT   tRNA            665232..665308
FT                   /locus_tag="KN400_R0011"
FT                   /product="tRNA-Ile"
FT   gene            665314..665389
FT                   /locus_tag="KN400_R0012"
FT   tRNA            665314..665389
FT                   /locus_tag="KN400_R0012"
FT                   /product="tRNA-Ala"
FT   gene            665530..668487
FT                   /locus_tag="KN400_R0013"
FT   rRNA            665530..668487
FT                   /locus_tag="KN400_R0013"
FT                   /product="23S ribosomal RNA"
FT   gene            668597..668708
FT                   /locus_tag="KN400_R0014"
FT   rRNA            668597..668708
FT                   /locus_tag="KN400_R0014"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(668770..669516)
FT                   /gene="thiF-1"
FT                   /locus_tag="KN400_0630"
FT   CDS_pept        complement(668770..669516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiF-1"
FT                   /locus_tag="KN400_0630"
FT                   /product="thiamin biosynthesis thiocarboxylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83493"
FT                   /protein_id="ADI83493.1"
FT                   /translation="MLTSDQQERYARHLILEGVGPEGQEKLLNGKVLVIGAGGLGSPAA
FT                   FYLAAAGVGTIGIADSDRIELSNLQRQIIHSTAGIGRLKVESAREAMCELNPDVQVRTY
FT                   PVRVDDAILPTILADYDFVIDATDNFASKFLINDACVRAGKSFSHGGILRYAGQTMTVH
FT                   PHRSACYRCLFEEEPSSEIATSCSRAGVMGVLPGVIGSLQATEALKHVMGVGELLTGRM
FT                   LTYDSLALRFREVAVGRRRGCGACGQ"
FT   gene            complement(669588..670442)
FT                   /gene="rpoH"
FT                   /locus_tag="KN400_0631"
FT   CDS_pept        complement(669588..670442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="KN400_0631"
FT                   /product="RNA polymerase sigma-32 factor RpoH"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83494"
FT                   /protein_id="ADI83494.1"
FT                   /translation="MSMSLPVVADSLTVYLREIRKFPVLTPEEEYRFAVKFYEDKDLEA
FT                   AHSLITSNLRFVVKIAAEYRSYGLKMLDLIQEGNVGLMMAVRKFNPYKGIRLISYAVWW
FT                   IRAYIQNHIISAWSLLKIGTTQAQKKLFFKLNQAKNAIKGLTGTDDIEATATSLHVKES
FT                   EVLEMDQRMRGDFYLDAEIKNGDGLTILETLADERQNQEDTLAELQESELLKQHIAGAL
FT                   GKLNEKERFIVEQRVTADTPLTLQEIADRFSISRERVRQIEEAALRKIKSYLIPIIAET
FT                   RPV"
FT   misc_feature    complement(670468..670506)
FT                   /note="conserved nucleotide sequence; KN400_R0141"
FT   gene            670729..671802
FT                   /gene="ilvE"
FT                   /locus_tag="KN400_0632"
FT   CDS_pept        670729..671802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="KN400_0632"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83495"
FT                   /protein_id="ADI83495.1"
FT                   /translation="MEIRVAPLPAEQKKHKATDETALGFGRLFTDRMLVAEWKVGQGWV
FT                   DARIEPYAPFSLDPACAVFHYAQEIFEGLKAYKWADGSIALFRPEMNARRFNHSAERLC
FT                   MPEVPEDLFIGGIEQLVALERDWIPASAGTSLYIRPAMIAVEPALGVKPADHYYFFVIL
FT                   SPVGAYYASGFNPVKIMVEDQYVRAVPGGTGEAKTGGNYASSLRAGLEAKKKGFDQVLW
FT                   LDGVHRRYIEEVGAMNMLFAYGKTIVTSPLTGTILNGVTRDSVLKLAASRGYTIEERLI
FT                   DVNDLMADIRAGKVTEAFGSGTAAVVSPVGILAYKGESVTVGDGGVGPITRELYDTLTG
FT                   IQTGRIPDTFGWTRKIA"
FT   gene            671907..672071
FT                   /locus_tag="KN400_0633"
FT   CDS_pept        671907..672071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83496"
FT                   /protein_id="ADI83496.2"
FT                   /translation="MKRKPEANKLCLSCRRPCKQAAAVVISSCPRYYPGPKIKRENWKQ
FT                   LEFDLISLH"
FT   gene            672178..674775
FT                   /gene="clpB"
FT                   /locus_tag="KN400_0634"
FT   CDS_pept        672178..674775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="KN400_0634"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83497"
FT                   /protein_id="ADI83497.1"
FT                   /translation="MIRPEKMTIKTQEALAGAQQLAARQGNGSIEPEHLLVSLLEQEGG
FT                   LIAPIIQKVGGAPAALRSAADVLVKRLPQVSGATAQAYLSPALNRILDAAQREADTMKD
FT                   EFVSTEHLLLGFFADRQCAAARALLDAGVSRDNVLAALMEIRGGERVTDQNPEDTYQAL
FT                   AKYARDLTDLARQGKLDPVIGRDDEIRRVLQVLSRRTKNNPVLIGEPGVGKTAIVEGLA
FT                   QRIVSGDVPETLKDKRLVALDMGALIAGAKYRGEFEERLKAVIREVAKSEGKVILFIDE
FT                   LHTLVGAGAAEGAMDASNMLKPALARGELHCIGATTLNEYRKYIEKDAALERRFQQVYT
FT                   GEPSVEDTIAILRGLKEKYENYHGIRIKDSAIIAAATLSDRYITDRFLPDKAIDLIDEA
FT                   ASRLRIEIDSMPTEIDEVERRIIQLEIEKQALLRESQDPHSLERLKKLADELEELKAKS
FT                   AELKGHWQREKDIIGRVSSLRQRLEEKREEAKKAEREGNLARTAEIRYGEIPAIEKEIA
FT                   DRSAELEDIRKEGKMLPEEVDGELVAEIVSRWTGIPVSRMMEGEADKLVHMEDRLITRV
FT                   VGQDEALVLVANAIRRARSGLSDPNRPIGSFLFLGPTGVGKTETAKALAEFLFNDDQAI
FT                   VRIDMSEYQEKHTVARLIGAPPGYVGYEEGGQLTEAVRRRPYSIVLFDEIEKAHPEVFN
FT                   VLLQVLDDGRLTDGQGRTVDFRNTVIIMTSNLGSQWIQQYGSSDYARMKAMVTETLKEG
FT                   FKPEFLNRIDEIVIYHALPLEQIKKIVDIQVECLKQRLADRRIVLELSDKAREYLSREG
FT                   YDPAYGARPLKRTIQRKIQDPLALALLEGKFQEGDTVRVDLSVSGEELVITKK"
FT   gene            674893..675720
FT                   /locus_tag="KN400_0635"
FT   CDS_pept        674893..675720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0635"
FT                   /product="polysaccharide deacetylase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83498"
FT                   /protein_id="ADI83498.2"
FT                   /translation="MTARRICTIARALVAVIVLLAVSRPVTAVEAGEGGDDGYAALRQR
FT                   VVERFAGRAPTQWGERVAGVITHLRSGTNGVALTLDACGTARGKGIDSRLIAFLEREGV
FT                   PATLFVTGRWIEANPGEFRRLAANPLFEIANHGDRHRPASVAGRSAYGIAGTADVAALV
FT                   DEIELNARRIQEVTGRRPRFFRSGTAYYDEVAVEVAGVLGHRVAGFSVLGDAGATFSVE
FT                   QVRRALLAATPGDVVILHMNHPESGTAAGVEAAIPLLRTRGLRFVTLSEGMGD"
FT   gene            675796..676635
FT                   /gene="ispE"
FT                   /locus_tag="KN400_0636"
FT   CDS_pept        675796..676635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="KN400_0636"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83499"
FT                   /protein_id="ADI83499.1"
FT                   /translation="MKKLTLKAPAKVNYRLDVLRRRPDGYHDLRMIMQRIDLCDEIEIC
FT                   LTDGPGIRVVCGREGVPDGPGNIAWRAADALLALSADKPGIDISITKKIPVAAGLGGGS
FT                   SDAATVLMGVNELLGLDLPEKRLREIGVTLGADVPFFIFGRTALAEGIGEELTAIDRVP
FT                   AAWIVVVNPNVPVSTAWVYQNLQLTGEAARVKIPRFFESVAEVCAILSNDLESVTIPRY
FT                   PVIGEIKRELLAAGALGSLMSGSGPTVFALFEEEDAAVRAAEMMRARSWFAAAVRTI"
FT   gene            676691..676765
FT                   /locus_tag="KN400_R0015"
FT   tRNA            676691..676765
FT                   /locus_tag="KN400_R0015"
FT                   /product="tRNA-Gln"
FT   gene            676831..677775
FT                   /gene="prsA"
FT                   /locus_tag="KN400_0637"
FT   CDS_pept        676831..677775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="KN400_0637"
FT                   /product="ribose-5-phosphate 1-pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83500"
FT                   /protein_id="ADI83500.2"
FT                   /translation="MNQKIRVFSGNSNRSLAESICANLGLPLGKANVKTFSDGEVMVEI
FT                   GENVRGRDTYVVQSTCAPTNNNLMELLIMMDALKRASAATITAVIPYYGYARQDRKVAP
FT                   RTPITSKLVADLITTAGADRVVTVDLHAGQIQGFFNIPVDNLYAAPVILEHLKQRFPEN
FT                   SIVMVSPDAGGTERARAFAKRLGCTLAVIDKRRTGPNVAEVMHLIGDVTDKTAIILDDM
FT                   IDTAGTLTQAARALKEHGAKTIYACATHGVLSGPAIERINNSDIEAVVITDTVPLGDKE
FT                   QQTSKVKVLSVANLLAEAIRRIHEDESVSSLFV"
FT   gene            677816..678400
FT                   /gene="rplY"
FT                   /locus_tag="KN400_0638"
FT   CDS_pept        677816..678400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplY"
FT                   /locus_tag="KN400_0638"
FT                   /product="ribosomal protein L25"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83501"
FT                   /protein_id="ADI83501.1"
FT                   /translation="MEQKTMSIELREKNGKGVARKLRAQDVVPGVVYGKGIEPVSVKVA
FT                   AKDLAATIAGEGGLNSLITLSGGGSLNGNIVIVADMQRNPLKGDILHVDFHRISLDEKV
FT                   KVHVPLVMVGTAAGVKEGGMLDVVTYSLDVECLPTAIPEAINVDVTNLAIGHSIHVSEL
FT                   VLPAGIKVLNDPETPIVSIHGKAKEEAPAAE"
FT   gene            678434..679015
FT                   /gene="pth"
FT                   /locus_tag="KN400_0639"
FT   CDS_pept        678434..679015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="KN400_0639"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83502"
FT                   /protein_id="ADI83502.2"
FT                   /translation="MATKLIVGLGNPGPKYLWTRHNAGFMVLDRLAHAIGASVTRKSFS
FT                   GVFGEGAWHGERLLLLKPQTYMNLSGRSVAEALRFHKLPLCDTIVIHDDLDIPFGRVKV
FT                   KEGGGHGGHNGLRSLVQELGGAGFVRVRVGIGRPVHGDVVNYVLTNFSQDEMADLAHLL
FT                   DGTLDLLESLLTAGLPKTMSLYNNKDLLAP"
FT   gene            679057..680151
FT                   /gene="ychF"
FT                   /locus_tag="KN400_0640"
FT   CDS_pept        679057..680151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychF"
FT                   /locus_tag="KN400_0640"
FT                   /product="GTP-dependent translational factor YchF,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83503"
FT                   /protein_id="ADI83503.1"
FT                   /translation="MGFNCGIVGLPNVGKSTIFNALTSAGAESANYPFCTIDPNVGIVQ
FT                   VPDVRLDRLAEIVSPERILPTTIEFVDIAGLVKGASQGEGLGNQFLGHIRSVDAIVHVV
FT                   RCFEDENVVHVSGSVDPLRDIDIIQTELALADLDSVDKKLQRVEKQAKSGDKRLKEESE
FT                   FYARLKAALEQGIPARHVQVADEELPWLRDLHLLTDKPVLYVANVAEDDLDGAHPAVAK
FT                   VRELAEREGARVVTICGRIEAEIAELEGDEKRVFLEEMGLAESGLDRLIRMGYELLGLI
FT                   TYFTAGKKEVRAWTIPTGTKAPQAAGVIHTDFEKGFIRAEVIAYADYIAAGGETGAKEK
FT                   GLMRLEGKEYVVQDGDVMHFRFNV"
FT   gene            680297..680650
FT                   /gene="rpsF"
FT                   /locus_tag="KN400_0641"
FT   CDS_pept        680297..680650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="KN400_0641"
FT                   /product="ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83504"
FT                   /protein_id="ADI83504.1"
FT                   /translation="MVRMYETIVIVQPELGDDELKGLTAKVTDIIGSFKGVLHRLEDWG
FT                   VRKLAYPVKKSVRGRYYYVRFDGDAPLIAELERRLRLDDKVLRYQSVKLEKEAAAPAPK
FT                   AAPVESAPAVEAE"
FT   gene            680671..680982
FT                   /gene="rpsR"
FT                   /locus_tag="KN400_0642"
FT   CDS_pept        680671..680982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="KN400_0642"
FT                   /product="ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83505"
FT                   /protein_id="ADI83505.2"
FT                   /translation="MSEERTERPERTERPERPQQRGSGPRKRRPFQRRKVCRFCADKTL
FT                   VIDYKDPRVLRSFITERGKIVPRRISGNCSAHQREITEAIKRARNIALIPIASTHVIA"
FT   gene            680995..681939
FT                   /locus_tag="KN400_0643"
FT   CDS_pept        680995..681939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0643"
FT                   /product="membrane protein DUF2232, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83506"
FT                   /protein_id="ADI83506.1"
FT                   /translation="MENSLRSTLLDIVKGCIATVALFIAYLELPVIGMLAGVVVPLPAL
FT                   LYDLKRGKWSGLAIVLASALIFMLIAGPAGALLYVLQAGIFSLALPRFLTMGGGPARAL
FT                   ASAVAVTVAVITAAAVGYGVTRGVTVEGQVAESLQSSITQAIQLYEKSGVSGADLDELR
FT                   EGMEQAAKSLAQLYPSLFVVGIAMAGGLNLLLLQRFGRRLGLAVPGGSFGKYRNPDHLV
FT                   WLPICAGFALLAGHDAVTTIALNVLVLTGFLYFIQGMAIIIHLFDRYAAPAFLRYLLYF
FT                   LLFVQAYLVVAVALFGLLDLWGNFRRPRIPTNL"
FT   gene            681960..682406
FT                   /gene="rplI"
FT                   /locus_tag="KN400_0644"
FT   CDS_pept        681960..682406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="KN400_0644"
FT                   /product="ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83507"
FT                   /protein_id="ADI83507.1"
FT                   /translation="MKVILKENVENLGHIGDIVKVAPGYARNYLIPRNFAIEATEKNAK
FT                   ALEHAKRQLEYKRNKVLEQARLLVAKIEGLSLSISHQAGEEGKLFGSVTNMELAELLKA
FT                   QGVEIDRKKIVLAEPIKHVGEFTAVVKVHPEVAANLKVVVTKAE"
FT   gene            complement(682631..683485)
FT                   /gene="omcX"
FT                   /locus_tag="KN400_0645"
FT   CDS_pept        complement(682631..683485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="omcX"
FT                   /locus_tag="KN400_0645"
FT                   /product="cytochrome c, 12 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83508"
FT                   /protein_id="ADI83508.1"
FT                   /translation="MNAVRRIRLVAVSALTLAATLCLGTLDSQAAQPAAKLVQDDCVKC
FT                   HIQPPADVASAGAGHKKITCFDCHAGHRPQSKNNIPQCSQCHSGKKHYELANCMGCHTN
FT                   PHTPLNIVLSGNITDPCLTCHSQQISQLKEFKSKHTNLYCSTCHNVHGKIPACTQCHKP
FT                   HYAEQTQADCKKCHKAHMPKNVVYGKEVPNKDCGACHKKAVDLLSASTAKHKSLACVYC
FT                   HQEKHKMVPTCQSCHGTPHPAPMMAKFGTCGDCHSIAHDLNHWSAQKGEPAKAAPAKDK
FT                   KKK"
FT   gene            complement(683749..684639)
FT                   /locus_tag="KN400_0646"
FT   CDS_pept        complement(683749..684639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0646"
FT                   /product="RNA pseudouridine synthase, RluA family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83509"
FT                   /protein_id="ADI83509.1"
FT                   /translation="MLTYQITDIDHCRSAESFLRNLLPAAPSAYIRKLISAGHLKINGG
FT                   AVAPDTLLAAGNTATIKESDRTRQLLAAAKPQLDILWEDDYCVIVNKPAGLPVHRTAEA
FT                   GEANLVELAEHFMAGRGTAVKLRPVNRLDRGTSGATILAKSSSSAGMLGRYVKEEGLDK
FT                   LYLAVTDGSLPDAGTIDTPLDGKDAHTDFRTLARDTAVSFALVIPISGRMHQIRKHLSA
FT                   IGHPVRGDRRYRGTLLTGYPGHLLHAFRVALIHPVTGRKLIVHAPLPPAFIQYLPTGAP
FT                   LVWHDLLREIASRPD"
FT   gene            complement(684725..685435)
FT                   /locus_tag="KN400_0647"
FT   CDS_pept        complement(684725..685435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0647"
FT                   /product="cytidylate kinase-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83510"
FT                   /protein_id="ADI83510.1"
FT                   /translation="MPEKLLVPSIEQRIAGMLEVTRRMKDESEGRKKGKIRPTVTISRE
FT                   FGCEAFPMAERLKEILDRQSGEPWVIMDKGLLEEAAKRLDVSTEVFSSLGHRPRFLDDM
FT                   IATLTPHWKSERDYFRILCDQIASLADAGNVILIGRGSTVITQSMANCFHFRIYASHEY
FT                   KVRSIARRAKLPLQEAEHLVERKQKERDRFIRDFLDRDISDLSLYHLAINNDRNSSDLI
FT                   ARTIADYLVARKSG"
FT   gene            685646..686389
FT                   /locus_tag="KN400_0648"
FT   CDS_pept        685646..686389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0648"
FT                   /product="protein of unknown function DUF3108"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83511"
FT                   /protein_id="ADI83511.1"
FT                   /translation="MRIYAVLAAAVVVLWGNSTVGAAPKVPEKLVYELSWTGVPVGTAT
FT                   QEISDAGDLRTIVSTARSNDWLSVFFPVEDRIVSSYDRHRAPFPGLARHYRLQTREGNR
FT                   RRDREIVFEHERGVARFTDHKTGEKANIPIPVDTIDVYGSFYYVRYLPLEVGTSHHLNI
FT                   LDSKRQRLIEVRVLRKEKLKTVLGEVETIVIQPLVYSEGVFEGKGTVHIWLTDDERRIP
FT                   VRARTRVTVGSVTATLVDGTFEKKR"
FT   gene            complement(686457..688109)
FT                   /gene="hcp"
FT                   /locus_tag="KN400_0649"
FT   CDS_pept        complement(686457..688109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hcp"
FT                   /locus_tag="KN400_0649"
FT                   /product="iron-sulfur-oxygen hybrid cluster protein
FT                   (prismane)"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83512"
FT                   /protein_id="ADI83512.1"
FT                   /translation="MGMFCNQCEQAAKGVGCEIMGVCGKNPEVAALQDLMLYGLKGLAI
FT                   YADKARELGARDEAIDLFMIEGLFTTVTNVDFDPVSLAGKLRTCYDMKEKAKSLYETAY
FT                   REKNGGHAPAIAAGPAAWVIASDLEGLVKQGLEHGINTHHTDADVRSAIEILIYGLKGM
FT                   AAYADHAYILGKKDEEVFAFFHKAMAATADPAKGLMDFVGLSMECGKLNIKVMGMLNEG
FT                   HVDHYGHPVPTKVPTGTRRNKGILVSGHDLRMLEELLKQTAGKGIDIYTHGEMLPAHGY
FT                   PGLKQKYPHLYGNFGGAWQDQAKEFPLFPGAIIFNTNCIQRPADSYKDRLFSWGQVGWP
FT                   GVKHISGWDFSEVINKALECPELADAPEKEILTGFGHNAVLGVADKVIEGVKAGAIKHF
FT                   FLIGGCDGAKPGRNYYTELAEKVPQDCVILTLACGKYRFNKLEFGDIGGIPRLLDIGQC
FT                   NDAYSALQIALALANAFNCGVNDLPLSMILSWYEQKAVVILLSLLHLGIRNIKIGPSLP
FT                   AFVTPNVLNFLVENFNLGPITTVEADLKAALGQ"
FT   gene            688323..688664
FT                   /locus_tag="KN400_3419"
FT   CDS_pept        688323..688664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_3419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_3419"
FT                   /db_xref="EnsemblGenomes-Tr:ADN78315"
FT                   /protein_id="ADN78315.1"
FT                   /translation="MCSGIIRIVSLLTLVAALLVCSGIAECSVFATDMPIADTCCPVQP
FT                   QEQDTDRDNMPVPCSDAACACPSCLVADEHVHHAPAIPHAEGSCGAVAVRSLPPSPVAP
FT                   PIEYPPESA"
FT   gene            688811..689194
FT                   /locus_tag="KN400_0650"
FT   CDS_pept        688811..689194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0650"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83513"
FT                   /protein_id="ADI83513.1"
FT                   /translation="MRKNMLMAVTMLVLALGALTLTGCNEQIFNVNDVASDPAAYTGTI
FT                   TIAGVMGGTSQADRTVFGIMDLKELACTTPGCNKIFIPIRANGTVPALGDEVRVTGSFR
FT                   TEPGGLIFVAEKMKVVKNHKIGG"
FT   gene            689195..690358
FT                   /locus_tag="KN400_0651"
FT   CDS_pept        689195..690358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0651"
FT                   /product="ABC transporter, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83514"
FT                   /protein_id="ADI83514.1"
FT                   /translation="MNITKLVVKNITRRRGRFVFTLLGITIGIASFVAFLALGGGLKDE
FT                   VRREAAALGANLVVTPNGSCAYEQVSILTGEQLPSTITMEEVGRVAAIQGLTAVPVLTE
FT                   KTAIRNRPVGVAGVLPDAMKPFKGWEVRSGEYFANNDERVVVVGAAAAESFGLKPGDEV
FT                   TIRGTRLPVKGVLKETGSKDDTTLFLALSVAQELFKAAGKASFVAVKVDDLSRTDDYIM
FT                   KIKETVNAGVVSDKQMLKSVLGIIGTVNVTLQLIAAISVLAAAFGIVNTMMTATYERRR
FT                   EIGILQAIGARRREIFAIFLMESGFYGLLGGICGVAGGLAASILVGPMVNQNAFLAFVK
FT                   GNDPAAVLDPKLMVGSVAFSVAVALVAGLYPAWRAARLTPVEAISHE"
FT   gene            690351..691028
FT                   /locus_tag="KN400_0652"
FT   CDS_pept        690351..691028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0652"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83515"
FT                   /protein_id="ADI83515.1"
FT                   /translation="MSDAIIRTENLTKTYGSGQVTTHALRGVSLEIPRGAFCAIVGPSG
FT                   HGKSTLMHLVGGLDRPSAGQVAVDGIELTGLANSDLARLRAEKIGFVFQFFNLLGSLTA
FT                   EENVAAAMMFAGIPEKQQKERARELLELVGLGEKLGARPRQLSGGQQQRVAIARALAND
FT                   PDILLMDEPTGNLDSAAEAEVLAAVAELHRQGKTVVIVTHNPEIARQAQMVVEIRDGRL
FT                   ASA"
FT   gene            691184..691774
FT                   /locus_tag="KN400_0653"
FT   CDS_pept        691184..691774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0653"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83516"
FT                   /protein_id="ADI83516.1"
FT                   /translation="MGEEQERWDQRYLSEECLLGERPSGLLAEWIDELKRLCPGRRALD
FT                   IACGEGRNSIFLARHGFAVTGLDISPVGLDKARRWAAREKLSVDFRLTDLEGYRITGTY
FT                   DLIINFNFLLRDLIPHEVASLAPGGMLIFDTILQSPTAPVPHKKEYLLQPGELERLFAP
FT                   FPGTVLYSAEFPDDATPTAKLIFRNTPDAQADR"
FT   gene            691865..695428
FT                   /locus_tag="KN400_0654"
FT   CDS_pept        691865..695428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0654"
FT                   /product="DUF748 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83517"
FT                   /protein_id="ADI83517.1"
FT                   /translation="MKRWHKAAIGAGACIILLVGFIGLILPGIVKTRAMEGVEAATGRK
FT                   LVVGDISINPFTWTVEVRDVSFTEPDKTTVFASFSSARVQVSPASIFRMAPVVREARLS
FT                   SPHVRLVRVGPNTYNFSDLLGKKKAEPKKDEGLPRFSLNNITIANGSLDFLDQGERIMR
FT                   RHEVRRLDLGIPFLSTIPYFADRYITPRFSALVNDAPVRAEGKLRPFAKAAEYDLNVDL
FT                   RDLAIKRFASYIPADLPILVQDGTLSTTLGITYRVAEGKDPDLMVSGSARLAGVKVAEH
FT                   GGVPLLALAGLEARLNRARVLAGEFPLSLVTLERPEIHLARDAAGIWNLQRLAGKKTAA
FT                   PAAEEKPASPGRKPLVSVAEFRLADGAVQLDDRLPAGGFAARVEKIAMTVKGFSTAPGT
FT                   AADCMLSLATGRGEEARVEGRVTPDPLALTGTVQVAGIDLGAYYPYLSPYLTAPVTGKL
FT                   DAGADIGFSTPDGVRVDKGRIRLASLRVPFEGKDEARLAEVAGEDIAFVQKDANLTVGA
FT                   VRLRDGEIRFSRNGKGEWSPLTLVRPPGSAPAKQPARSREKAAAPFSYRIGTVSLSGLT
FT                   ASFTDGTIEDRPTFTLRRIAAGAENLTGPKFGQIPFRFAARYGKEGELKATGRVRPEPL
FT                   TVNGNVTIRQLPLTDFDYYLPKNLLAILADGTLDTTMAVSLARSGGKLTGSFAGGLGVR
FT                   SFYLLDGDGEDLLRWESLQLDKVKGNIDPFTLDIREVALNQFYSKIVIDPDGRLNLQKL
FT                   FAPAPEPAEGAAKPEAVAAVAQPAPPPELPARQRAITIGAVTMQAGTLDFSDRHMPKPY
FT                   ATTFYNLGGRVSGLTSEESKFADVDLRGNLENHSPISITGRINPLRDDLYADIKVRFTD
FT                   IELSPMTPYSGTYLGYAVDKGKLFLDLQYTIENKQLNSENKVFIDQLTFGNRIESDKAT
FT                   SLPVRLAVALLKDRKGEIHLDLPVTGRTDDPQFSVWRVVLQILKNLLVKAATSPFALLQ
FT                   SAFGGGADLSVISFGYGSAELAPAEQDKLRKIAQALADRPAIKVEVAGYVERDKDAEGY
FT                   RSELLRRKVRAEKFLEMVKKKQNKPGDSAETVVVAPEEYERLLTAVYKKEKFPKPRTII
FT                   GTVKELPVEEMTKLILANTVVGDAELKTLADERSAAVRTFLVEQGKLDSARVFQKSGDI
FT                   FKRPDKQGERGARVEFGAAVD"
FT   gene            695770..696840
FT                   /locus_tag="KN400_0655"
FT   CDS_pept        695770..696840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0655"
FT                   /product="sensor histidine kinase"
FT                   /note="domains: HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83518"
FT                   /protein_id="ADI83518.1"
FT                   /translation="MLSVLRDNIFSLFMQHLPGVSFIKDLAGHYLYANDQWKRLVSSDT
FT                   AEDRPGGPDGGQFEENDQRVITEAAGIQTVETVQAEDGVHHWIMSEFPIRDEQGEVVLL
FT                   GGIGLDITRRLRLEEELNIYRERLASLAVELAVAEDRERSRIAGELHDQVGQNLFLAGL
FT                   KLGSLKISSLGDDDRRVVEEIRHLIGGALQDIRSLTCQLRPPLLAHGGLVAALCWLGEQ
FT                   FREDFGLQVDIFDDQHEKPLSPEVSSTLFQVVRELLLNTAKHASAPRAAISVTTEADSI
FT                   MVSVEDGGVGFDVSSVSLNCGKSGGFGLFNARQKIEYLGGTLTVQSEPGCGTRTVIRVP
FT                   LKGEQHGTPHAERGAS"
FT   gene            696840..697487
FT                   /locus_tag="KN400_0656"
FT   CDS_pept        696840..697487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0656"
FT                   /product="helix-turn-helix transcriptional response
FT                   regulator, LuxR family"
FT                   /note="domains: REC, HTH_LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83519"
FT                   /protein_id="ADI83519.1"
FT                   /translation="MLRVLLVDDHRIVLEGLRALVSEHSDLEVVGVACDGATAIELTRQ
FT                   LRPDVVVMDITMPGMNGIDATRRIVAEFPRTRVLVLSMESERRFVLEVLKAGAHGYLLK
FT                   DCSQDELVLAIRHVAAGEPYLGPRITEMIIRAYMERIPDDSLLTHTLLSLREREVLQLI
FT                   AAGKSTKEIAFAFGVSLKTIETQRHSIMKKLNLYSIAELTKYAIREGLTPLR"
FT   gene            697785..699380
FT                   /gene="mcp34H-6"
FT                   /locus_tag="KN400_0657"
FT   CDS_pept        697785..699380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp34H-6"
FT                   /locus_tag="KN400_0657"
FT                   /product="methyl-accepting chemotaxis sensory transducer,
FT                   class 34H"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83520"
FT                   /protein_id="ADI83520.1"
FT                   /translation="MKWFEELKVSTKLAVSFMVVIILTTFLGIFSIFEMSRVNETGTDM
FT                   AENWIPSLNAISAMQLDFASYRRLELQHILEMESAGQKTYEERMAGLVKSIAEHQKEYE
FT                   PLLATPEEKQVFQEFSTKWQEYLNESKPVIELSRQNKTQEAAALLNSNSRKLYNEAGAL
FT                   IDKLKTMNTQGAKDASARGDKLYASARIWIIGSLIACIVLAVVMGLVITRVLLRQLGGE
FT                   PTAIADIANRLADGDLRIAFDTTGKTETGVYAAMKNMVEKLKGVVADVKSAADNVAAGS
FT                   QELSSSSEEMSQGATEQAAAAEEASSSMEQMSSNIRQNADNATQTEKIALKSAADAKQG
FT                   GTAVAETVVAMKEIASKISIIEEIARQTNLLALNAAIEAARAGEHGKGFAVVAAEVRKL
FT                   AERSQKAAGEISELSASSVQVAEEAGEMLTRIVPDIQRTAELVQEISAACKEQDTGAEQ
FT                   INKAIQQLDQVIQQNASASEEMASTSEELASQAEQLQATISFFRTDDRGASSRSAVHRP
FT                   VAKKKAAIPHLGHA"
FT   gene            699412..699878
FT                   /pseudo
FT                   /gene="cheW34H-4"
FT                   /locus_tag="KN400_0658"
FT                   /note="scaffold protein CheW associated with MCPs of class
FT                   34H; frameshifted"
FT   misc_feature    699924..699970
FT                   /note="palindrome; KN400_R0142"
FT   gene            complement(700020..701018)
FT                   /gene="hpnH"
FT                   /locus_tag="KN400_0659"
FT   CDS_pept        complement(700020..701018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpnH"
FT                   /locus_tag="KN400_0659"
FT                   /product="diploptene adenosyltransferase and reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83522"
FT                   /protein_id="ADI83522.1"
FT                   /translation="MRFPWRLNYDLTRYIISNKLNKVEKFPLVLMLEPTHLCNLACSGC
FT                   GRIREYADTIQQMMSLEECLRSVDECPAPVVTITGGEPFLYTHIYELIPEVLDRGKHVY
FT                   LCTNGLLLEKALENVKVHPNFYLNVHMDGLEETHDRILERKGTFKVAIEGIRKAKAKGF
FT                   RVCTNTTIFKDTDLVEIEMLFSLLTDLGVDGILVAPGFDYEAVGEDLFLQRREIQKKFE
FT                   EVYRMSKRFRFWSTPMYLRFLKGEKQLECTPWGNPTRNPLGWKAPCYLITDTHHPTFRE
FT                   MMEKTQWDRYGVGKDPRCAQCMMHCGFEPTVVSEIGKSWKDILEMAIWNMT"
FT   gene            complement(701103..703016)
FT                   /gene="dxs-1"
FT                   /locus_tag="KN400_0660"
FT   CDS_pept        complement(701103..703016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs-1"
FT                   /locus_tag="KN400_0660"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83523"
FT                   /protein_id="ADI83523.1"
FT                   /translation="MSTLLDTITCPADLKKIPRDQLPALAEEIRAFLLETVSRTGGHLA
FT                   SNLGVVELSIALHYCFDSPTDRFVWDVGHQAYTHKILTGRRDRFHTQRQYGGISGFPKR
FT                   SESSHDAFDTGHSSTSISAGLGMAMARELRGGSNKVVAVIGDGSMTGGIAFEALNQAGH
FT                   LKKNLIVVLNDNEMSISPNVGAFSSFVSRKLTGSYFRELKKEVQGLLQNIPAIGKDILQ
FT                   FARRAENSLKGFLTPGMLFEALGFDYIGPIQGHNLPQLLEVFENARGLDGPVVVHVMTT
FT                   KGKGYVPAETNPSAFHGVGPFDVATGKTTGSKPGAASYTGIFGDTLAQLARENEKIVAI
FT                   TAAMPDGTGLTGFAKEFPERFFDVGIAEQHAVTFAAGLAAEGFRPVTAIYSTFLQRAYD
FT                   QVFHDVCLQNLPVVFALDRGGVVGDDGPTHHGVFDLSYLRHLPGMTLMAPKDENELRHM
FT                   LKTAVSHDGPIALRYPRGAGCGIPLDQELREIPIGTGEILAEGDDVAIIAIGITVLPAL
FT                   EAARTLAEKGIRATVINARFVKPLDREMILQAARRTGCIITAEENALQGGFGSAVLELL
FT                   ADEGMTGVRVKRLGIPDRFVEQGPQPQLRADLGIDAAGIAAATEAFLAAKGAPAPALSM
FT                   VK"
FT   gene            complement(703068..704054)
FT                   /gene="hpnA"
FT                   /locus_tag="KN400_0661"
FT   CDS_pept        complement(703068..704054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpnA"
FT                   /locus_tag="KN400_0661"
FT                   /product="NAD-dependent nucleoside diphosphate-sugar
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83524"
FT                   /protein_id="ADI83524.1"
FT                   /translation="MKVFVTGATGFIGASIVRELLKDGCHVRVLARPGSDRRNLAGLDV
FT                   EICEGDLRDRQALEHGLAGCEVLYHAAADYRLWTRTPAAMYAANVDGTRNILEAALRRG
FT                   IARVVYTSSVGTLGNPGNGTPGTETTPVTFADMVGHYKKSKFLAEREAEAFIARGLPLV
FT                   IVNPSTPVGPHDVKPTPTGKIIVDFLNRKMPAYLDTGLNIIDVEDCARGHLLAARHGRI
FT                   GEKYILGHENLTLREIFALLARLTGIPAPRVRLPHTPILMAAYVNEALAKLTGKEPLIP
FT                   LAGVQMAKKFMFFESSKATGELGLQRRPAVDALRRAVEWFRANGYAR"
FT   gene            complement(704128..706167)
FT                   /gene="shc-1"
FT                   /locus_tag="KN400_0662"
FT   CDS_pept        complement(704128..706167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="shc-1"
FT                   /locus_tag="KN400_0662"
FT                   /product="squalene cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83525"
FT                   /protein_id="ADI83525.1"
FT                   /translation="MKISKNPISHALTSFNDAARETADNSAARKSGKIHHLPATIWKKK
FT                   ESTVSSPLDIAIERTQEFFFREQLPAGYWWAELESNATITAEYIMLFHFMGLVNREKER
FT                   KMANYLLRQQTTEGYWTIWHGGPGDLSTTIEAYFALKLAGYPADHPSMSKARAFILEHG
FT                   GILKARVFTKIFLALFGEFSWLGVPSMPIEMMLLPAGFTFNMYEFSSWSRATIIPLSIV
FT                   MAERPVRKLPPWARVQELYVRPPRPTDYTFTKEDGILTWKNIFIGIDHVLKVYEASPIR
FT                   PGRKKAMAIAEKWVLEHQEPTGDWGGIQPAMLNSVLALHVLGYANDHPAVAKGLQALAN
FT                   FCIEGEDELVLQSCVSPVWDTALGLMAMVDSGVPTDHPSLSKAAQWLLDREVRRPGDWK
FT                   IKCPDLEPGGWAFEFMNDWYPDVDDSGIVMMAIKNVKVKDQRAKEDTITRGIAWCLGMQ
FT                   SKNGGWGAFDKDNTKHILNKIPFADLEALIDPPTADLTGRMLELMGTYGYPKDHPAAVR
FT                   ALKFIRETQEPDGPWWGRWGVNYIYGTWSVMSGLAAFGEDMSQPWIRKAVDWLVEHQNE
FT                   DGGWGECCESYADPRLAGVGPSTASQTGWALLTLLAAGEVASSSVVRGVQYLLDTQKPD
FT                   GTWDEDAFTGTGFPKFFMIKYHIYRNCFPLMALGRYRTLAGKGL"
FT   gene            706396..709095
FT                   /gene="hpnN"
FT                   /locus_tag="KN400_0663"
FT   CDS_pept        706396..709095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpnN"
FT                   /locus_tag="KN400_0663"
FT                   /product="efflux pump, RND superfamily, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83526"
FT                   /protein_id="ADI83526.1"
FT                   /translation="MQHTNDRKRFTGLFGVVARHPRLVLGVSLLLAVLSVLYTWQEMSF
FT                   LTGRDDLMPKNAPFQQDYRANRAEFGDREEIVVVVESGDQARASGFAERLAADLSADRT
FT                   RFRDVFHPNGLPFFREHGLLLLPLDELRSLRENLTLAEPVLKDLASTPSVQTLFTHLTT
FT                   RMDVYTAADDSSAGRDRERAGLVFMLDKLGSGIASFGGGKGSFSLEEVFLGGDSALARA
FT                   QRMQIVTVRPVRDAASFVPAEEAIRVVRARVAELKARPEFAGVTVGLTGTPVLEYEEMA
FT                   TSERDITLATGLSLALTVVLLLAAFRGVLNVAAAMVSLVVAICVSFGVATLVVGHLNIL
FT                   SMVFAVMLIGIGIEYGIQVVLRYQEELGLGAGELEAVNTGLSRNMLAIVMAAATTAAAF
FT                   FTFAFTDFRGIAELGIIASLGIAVCVAVTFTTLPAALVLLVPLRKTRETEREARAAGLL
FT                   RRSPRFARLEAFLFGHPRIVVGITVLLCLASLYPLADTRFDYNLLNLQARGLESVEYAY
FT                   KLMKSRENAGYFAEVTAATPAEARMLTARLEQLPTVDHVVSLLTFVPDDQDAKLRELAV
FT                   LRDELADVNPVPYEEDLRVMELPTVFENFRTSVERFKVRLEAEKRPEAVRVGAFLATLD
FT                   RFFADLEKEKDRNALGMLRDFQGGMLASFPEQIQQLKASLAVRPVTEADVPQQLRERFV
FT                   GKSGTYLLQVAPRQEIFEREPLKRFLDQVRSVAPRANGEPVMVYESMTIMRDAYLRAFV
FT                   YAFGAIVLILFITFRSLVYTLVGLVPLVVGMLLMVGGMWLAGIPFNSANIIVLPLILGI
FT                   AVDSGIYIINRFRREEGDAASVIMSSTGLGVIYNTLTIMASFGALMVARHQGVFSIGAV
FT                   MSLGMVACQAAFILVLPAVLTLVGKRSD"
FT   gene            709088..709657
FT                   /locus_tag="KN400_0664"
FT   CDS_pept        709088..709657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0664"
FT                   /product="rRNA methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83527"
FT                   /protein_id="ADI83527.1"
FT                   /translation="MTRGLSGAVPLAHFFLRERVKPGDRVVDATCGNGHDTLFLAELVG
FT                   PEGRVWAFDIQDAALAATAKRLEAAGCGERVELVNGGHERLAELVPGPVTAVVFNLGFL
FT                   PGAENGTITTPATTGAALDQATELLLPGGIVTVAVYTGHPGGPEEEAAVDAWAASLPPA
FT                   RFNVWRCRQGNRSSAAPYLVVAECRA"
FT   gene            complement(709670..710035)
FT                   /gene="yciH"
FT                   /locus_tag="KN400_0665"
FT   CDS_pept        complement(709670..710035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciH"
FT                   /locus_tag="KN400_0665"
FT                   /product="translation initation factor-related protein
FT                   YciH"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83528"
FT                   /protein_id="ADI83528.1"
FT                   /translation="MKGKSSSGATLVWSSEHGRICSGCGKPVASCSCREKGAAPAGDGI
FT                   VRVRRETKGRGGKTVTVITGVPLNEAGVRELAGELKRRCGTGGTVKEGVVEIQGDHADL
FT                   LVAELTRRGFIVKRAGG"
FT   gene            complement(710032..710265)
FT                   /locus_tag="KN400_0666"
FT   CDS_pept        complement(710032..710265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0666"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83529"
FT                   /protein_id="ADI83529.1"
FT                   /translation="MKHLMTYPVLIPLALILGMAPFVPEPHLVEKFRMLSAGTLTRPID
FT                   IFDLLWHAWPLALLGFKAGRDLGRRFSGGKEQ"
FT   gene            complement(710300..711214)
FT                   /locus_tag="KN400_0667"
FT   CDS_pept        complement(710300..711214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0667"
FT                   /product="carbohydrate kinase, PfkB family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83530"
FT                   /protein_id="ADI83530.1"
FT                   /translation="MVVTGLGQCCWDTLAEVEEYPSPDSKAESGQWVEQGGGPAATALV
FT                   TVARLGLQCRFAGVVGDDAAGALIRHALHAEGIDVTHLLTRPGAASQRAFIMVERTGGR
FT                   RTIVWQRPTGAHLAPAELEEPFWSGSAFLHLDGLMEEASLHGVREARRRGIPVMVDAGR
FT                   MRPGMRELAKLCDYLVAAEQFFLDLGWDGSEEQFARLADGLGAPTVTVTLGDRGSLTRH
FT                   DGTTCHVPAFPVTTLDTTGAGDVFHGGYLFGLLKGWPLRETVIFASAAAALSCLHLGAQ
FT                   RGAPRLDEVIRFLVDRGIPVPAV"
FT   gene            711359..713167
FT                   /locus_tag="KN400_0668"
FT   CDS_pept        711359..713167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0668"
FT                   /product="sensor histidine kinase, PAS, PAS and PAS
FT                   domain-containing"
FT                   /note="domains: PAS, PAS, PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83531"
FT                   /protein_id="ADI83531.1"
FT                   /translation="MNSDRLALILETATDGFWDWDLRADRLFLSEGYRTLIGYSSDETF
FT                   IDSVFIEAIVHPDDRPACVPVIRDLMDGSRISATLEYRILRGDGATVWVQARGTAVDHD
FT                   DAGRPARMVGTIFDITARKRNEEQLVLMGAVVDDATDEIFWADRQGRLVYVNRAACENL
FT                   GYSREELLSMTVSDVDPLVPSDRWPVMWETVRLQGGFVMDSVHRTRDGRDIPKEISVRY
FT                   ASIGGREIVYGFARDISERKRVEEALRTSEHRLRLMVEHLPAGAAHREGDRLLVNRAVE
FT                   EITGYRRHELDTLDKWFSTIYGEQAAEVRAVYEADRAAGMRVPRIMPVRRKDGTIRHLE
FT                   FFGYQYESGEVWLLHDVTDRRAVEEEIRRLNADLEARVRERTADLESFCHSVSHDLRAP
FT                   LRHIAGYARMLQEDYRDRLDDTGRHCLSRIGRAAVNMGELVDGLLSLSHISREDIERRN
FT                   VSLSSIARSVGRELSEREPDRKVELEVADGINGCGDPRLLRILFENLLGNAWKFTARVE
FT                   RPKVEFRMESRDGKNVYVVRDNGVGFDMRYVHKLFGSFERLHGPEEFSGPGMGLAIVRR
FT                   IVERHGGTVRAESEIGRGAAFSFTLG"
FT   gene            complement(713154..713798)
FT                   /locus_tag="KN400_0669"
FT   CDS_pept        complement(713154..713798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0669"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83532"
FT                   /protein_id="ADI83532.1"
FT                   /translation="MTDERRPDPVVPDLLARPYWIFDMDGTLTEPVHDFAAIRAALGVP
FT                   AGCDILGHLDTLPEGESRRLHGLLDEIEIELAGRAEASAGARRLVQALDRRGVRMGIVT
FT                   RNTRQVALRVLEHIGVGSYFPAGSILGRHDALPKPEPDGILRLAASWGTTGRSAVMVGD
FT                   YLFDLQCGRSAGALTVHVDRTRAFRWPQFTDLAVASLEELAELVERGISRE"
FT   gene            complement(713795..714514)
FT                   /locus_tag="KN400_0670"
FT   CDS_pept        complement(713795..714514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83533"
FT                   /protein_id="ADI83533.1"
FT                   /translation="MRHYLRIITAALAGHLLAAAGAAHGWHDETHLAVARAAGYHKWYN
FT                   AAGPDIAKQKAGNIEQRNHYCNNNRGEAVTVGTVLGQIARYNDPSDEEGHLYGAIIAAL
FT                   RGYERSSREGKYAEYHLAYAAHYLADLSMPLHNTPYDDFNRRRHERNDGIVEKSVLRDV
FT                   ERIQRLMAPVALGRESFEADLAREITRIANGASRLAERMRRENRDMTPEEAYGQLAQSA
FT                   ALLEAVLGRVQQQGGER"
FT   gene            714645..715403
FT                   /locus_tag="KN400_0672"
FT   CDS_pept        714645..715403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0672"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83535"
FT                   /protein_id="ADI83535.1"
FT                   /translation="MPLKGKVAVVTGGAQGIGKAVVKKLMEKGCAVVMADTDWEAGEET
FT                   AAGFAGLGRVLFVPADVGREDDVRVLVERAASHFGRLDILVCNAGVFRSVPLEHCSLDE
FT                   WQRLIGTNLTGAFLCAKHAAPFLACHGGSIVTIASTRAFMSEPDTEAYAASKGGLVALT
FT                   HALAVSLGPGVRVNCISPGWIETCEWQKASRRRPAAHSEEDRSQHPAGRVGTPEDVASL
FT                   AAWLVSPEAGFVTGANFVVDGGMTRKMVYV"
FT   gene            complement(715407..716549)
FT                   /gene="hpnI"
FT                   /locus_tag="KN400_0673"
FT   CDS_pept        complement(715407..716549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpnI"
FT                   /locus_tag="KN400_0673"
FT                   /product="glycosyltransferase HpnI"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83536"
FT                   /protein_id="ADI83536.1"
FT                   /translation="MTPDTLLPLLAVLPPLAYGLLALFCARAWFGRQRPGPGHTPPVTI
FT                   LKPVKGMDAESFENFASFCRQEYGGPWQMLFACASADDPVIPVIRRLMAEFPDRDIDLV
FT                   VDGTIHGPNYKVSNLINAFPRARHDILIVCDSDIRVTSDYLGEVTAPFADPAVGLVTSL
FT                   YRSPGVRGAATALEAMGFTVEMVPNVMVAQRLEGLSFALGASMAVRRTALESIGGFPAL
FT                   THYLADDYQLGNKIHRAGWRLELSDCFVESVMHRENLTTVLSRQLRWCRTMRASRPGGY
FT                   LGSGITQPVPLACLALLVSGCSAAGWGAVILLYLTRALVAVTFSRRYLRDGIFPRWLWL
FT                   LPLRDILAFATWALSFAGNRVRWRGNLFRLLPGGKIVEIG"
FT   gene            716751..718919
FT                   /locus_tag="KN400_0674"
FT   CDS_pept        716751..718919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0674"
FT                   /product="HEAT-like repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83537"
FT                   /protein_id="ADI83537.1"
FT                   /translation="MTDTNSDIRIAGIEPGILSSFIIELNILRRAVSAYPEGHPAIRSA
FT                   AEKVAGQTDLLLAGEGSATMGIARDTILFGGHPLDRRNLVFRDLARFLSERGLTLLTVK
FT                   RGVSPDELVRFCSLLGLRREEIRQRGGLGRMMTEAAILGLEVTGLDYGLFHVTEDERVT
FT                   APSADQDDLSLWERYVRGMLDGTLDPFGTVTEHHGTLAPEELARLMNGCLAGSSENRQK
FT                   SYDAVITAFLRTVREAEQHPVGDDSQTARLAELAELLTPELRRQFLGSTFASLARHPAM
FT                   AERVAAALSDGAVMEAFTGLTERGSSIPAVLLDLFQRFGLAAPSTAVGRAPSSHPAGAA
FT                   EMARRLETVLREGDSRAFVPLPYEEDLSRLTRAGVQRAVAPELESLRLELESENAAVKA
FT                   GEVIMEIIRLEPDGADPFASNLAELAEYYLATGDFGSLGGLFLRIHALEKAGAGAALRE
FT                   AIGAPAFVAALIDAPAIWGKVRYDEIRQIISQLGSPCVTPLLDRLAVEESMTLRRWYME
FT                   CLMGLGDAAGAAAVALLEDGRWFFVRNLLILLRQLDYSAGAAPARKLLAHPHPKVRQEA
FT                   ARTLLRFRDTQAEQWLFRGLDSSDRETLLMAVPLVDGNASRRVRAQLIELLRRGGAAAD
FT                   PEVRCATVRALAETGDPAALPELTRILGSRSLLRSAALNQVKLEVIRSLPRFPGQEPLR
FT                   LLRDAAAAGGEIAGAARVALRLAEARDR"
FT   gene            718916..720031
FT                   /locus_tag="KN400_0675"
FT   CDS_pept        718916..720031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0675"
FT                   /product="cyclic diguanylate phosphodiesterase"
FT                   /note="domains: HD-GYP"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83538"
FT                   /protein_id="ADI83538.1"
FT                   /translation="MNEATRQRLLGALRSLVTAISGAALYATRHPRVILLRSEAFAELS
FT                   AALEADEALSLVVIDGEILVEGTSLDGGLFLQRLAGMLTSRGIGHLKFLRGVTEEELAA
FT                   LASILAGSGTAGGEFHSSPHVRFGRVEVRYSGGTDGTGHASGLPAMEIGRFMELYEGVA
FT                   RHRRSHVNGLADLVAGFITALREQASPLAALAPLRDVDEYTFTHSVNVCVLNLAQAMAL
FT                   GIDGPLLQEIGIAGMLHDIGKMFVPPEILTKPGQLDDDEWAVMRRHPLMGARCLAETPG
FT                   VPRLAVVATFEHHLKHDLSGYPSVAAGWRQSLCSEMTTLSDFFDALRTRRAYRDSMELR
FT                   QIAGILLEKRGRDFHPLLTRNFLLVLSRLAV"
FT   gene            complement(720028..721941)
FT                   /locus_tag="KN400_0676"
FT   CDS_pept        complement(720028..721941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0676"
FT                   /product="response receiver sensor protein serine/threonine
FT                   phosphatase, PP2C family, PAS and PAS domain-containing"
FT                   /note="domains: REC, PAS, PAS, PP2C"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83539"
FT                   /protein_id="ADI83539.1"
FT                   /translation="MGIPLRVLIIEDSEDDMLLVLRELRKGGYEPDHVRVETAAEMGAA
FT                   MAARDWDLALSDYVLPRFSGMDALRLWREREEDLPFIVVSGKIGEETAVAAMKAGANDY
FT                   LIKGSTSRLVPAIARELQEAEVRRKRREAEQALARSEERYRRLVAAVSNYTYTVELAEG
FT                   HVIRTSHGQGCLPVTGYTSDEYDTSPTLWYEMIHGEDRDRVLASIARLEARKGVVTLEH
FT                   RIVRKDGEIRWVRNTIVPTWDDTGRLTAYDGLIADITERKEGELTRQIQTVALKAAANA
FT                   IVICDPEGRIIWANPAFTRLTGYLLDEVAGRGIGILNSGVHGEEFYRDLWHTIRSGTVW
FT                   HGEMINRRRDGSLYPEEQTITPVRDERGAIRCFIAIKQDIAERKQAQEALLENARLACD
FT                   MQLARQIQRSLLPETPPPVPGCRCAGRWVPAAHVGGDYYDFFPREDGSLDLVIADVSGH
FT                   SVGAALIMTELRSVIRSLVHAGGTPAQIVGSLNALLHEDLSRAELIITLFYASYSPATR
FT                   TLAFASAGHSPPLVCRREGECRQIDAEGLILGVHPLVEYEQKEVTMAAGDILLLYTDGI
FT                   TEATGSDGEFFGTARLARAMEEESEREPEEILDAILARLRMFSGGVPSGDDICMALLKV
FT                   GD"
FT   gene            722136..723419
FT                   /gene="omcJ"
FT                   /locus_tag="KN400_0677"
FT   CDS_pept        722136..723419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="omcJ"
FT                   /locus_tag="KN400_0677"
FT                   /product="cytochrome c, 6 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83540"
FT                   /protein_id="ADI83540.2"
FT                   /translation="MKSLQAGCLSAVLAAICIATPAGAFHSGGAAQCEGCHTMHNTSEG
FT                   AAMTGSSARFQSGPFLLRGSDQSSACLNCHQQAGDTGPTSYHVSTAENDMPVGSPPLQL
FT                   TPGGDFGWLKKSYSWAPAPGSASVEIRGEQHGHNIVAADFNYVADTTNINAPGSSTPYP
FT                   SDSLHCSSCHDPHGAYRIVENGVQATSGKPIRGSGSYGSLPDAGSAVGTYRLLAGVGYK
FT                   PKSLAGGPAFTHAAPFAVTPVVYNRSEESSDTRVSYGKGTSAWCTNCHALMHSGPGSSL
FT                   HPADKQLGDVAQTYNAYRKTGSLDGTVATAYLSLVPFELGDVTDLTALKDATATTAGPA
FT                   ATDKVSCLSCHRAHASGFSHMTRFAIDSNHITVADASGNAIWPDPVMNPSQAQGRTVAE
FT                   TRQAYYGRHPQAFSPYQRVLCNKCHARD"
FT   gene            723883..729633
FT                   /locus_tag="KN400_0679"
FT   CDS_pept        723883..729633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0679"
FT                   /product="cytochrome c, 35 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83542"
FT                   /protein_id="ADI83542.2"
FT                   /translation="MAVSSEVTVNTRSWKIAMMWCMVVFAGISPFLAGVGEVQAAIQCY
FT                   QCHGTAATSDYRPVDSAFRSISTGGVKGNHRTHMASNATADSCTICHGNSGYQASHRDG
FT                   TIAIASNINASPAVGTYSRGTSFAQSASVVPGTCSNVNCHFETVTPTWGSTPLASTADC
FT                   GTCHGSAPATGSHPVGGSKHGAYYGTGTSSCGKCHPDHGAKVGAARFAHATSAGRDLQV
FT                   SFAAAPNSGSGSYSGPVNDYLPSQSNAFGSCSSTYCHSPGTKSSAFDAPNQSAAWGGSL
FT                   TCNGCHKSDRSSGTAMTSGSHRAHVDGFGLGYATVRCVKCHGATVTSAMAIGTYGNHVN
FT                   KLVNVAFDSTTTAKNGTYGGVSSPMTKAPGSAYGSCTNVYCHSSGQGNSGSWPPTYTTP
FT                   TWGSAATGQCGTCHGINGDTHSGYGTPTIMTSGSHTRHLAYTFGITSDETRCAVCHATT
FT                   LTGFTPTACSSSVCHNQISQKHANYEVNVGFPDYYGATAAYGGTPKPGDGYGSCTNIYC
FT                   HSDGRDTLHYAQTPLTWGGASLGCTGCHGSATAPQNGSGGTTLSGKHAVHVNNAAIFGT
FT                   DNSLGCVQCHNRTVSDNSTLLGTTGTQYHVNKTRDYYGTMAGSYNAGTKVCSNVYCHSS
FT                   GQATPVYRTVAAWTSATGYGCNSCHGADSAFTAAAGEPNYANGGAGTATANSHQRHVAS
FT                   LGITATTGCSACHCRTVDATVTNKLRNYSTLHLNQARNVAMKAINGKSGTYDSNAKTCS
FT                   ATYCHGTSPSPAWGGSTACNSCHSARATDAHWAANSAHKIHWEGSVLPSSYAMTPGNGT
FT                   GDAATYRFACSSCHSPAGGSAHAGGALAASQAAQVYFGYSAAGVRGSYTGTGTAYSNDN
FT                   GFNWTAGSSGCTATYCHSGGAGQAGRSAVAWSTSAKISYNCNLCHGNAVAPNNDWRRGA
FT                   PLYASGSITYKGQAKGNAHGAHISAQTSLPAVYMQCAHCHAATTATSTAISDKRKHLNK
FT                   SYDVSAGGTFRDGDNTANSTAVTIAYSYNVAGSSCSNVSCHPVGLDVTTTPSTPLTRST
FT                   SKAAWNSSYKCTDCHRIPMQDTDTYHHAMYDYGRTYPTTIPDGSATSGTNYTSRTCTMC
FT                   HVDHTIFSPDLNVNSAGRSYNLRTAIGSTPTTTANFTNSDYSASGGGICISCHSTERTK
FT                   STVRRKQETNATKTPPVTLANYSGSAHQYNVPASFFSDGSRFQGNCSKCHNALVNETSV
FT                   FMSYTGSGDSFGNHNSGIRRLQGSLGATGGEVAEEQICYRCHSLSSDADPGGGPPKAVA
FT                   NKDYYGVAPMSLASQDIFAANRDFRAANPTYSLTNKLYFKPAAAETPAEAMPNQHNTGD
FT                   SFSGGTWVGRAMSPWETTVAYETKDQGTNLEGTSYWRMVTFTSPAVYSTTTVPAGNWLI
FT                   NLYCRESSTAQNARVRYMVYKWNNPADTMGATIIARGTYATELSTARAPGTVRQIPVSV
FT                   GTLTLNAGEKIVVDLSLETTTTSTNGYTASFYFGSRAPSELTLPGSVAWTYADPGAPGY
FT                   GHATQHYSGIHLPSRQNETLAYIAQNRHIECVDCHNPHATRNGLHGDYGIATGGSSTTL
FT                   VNSNKNWVPNQWVGDYINIISGTGAGQTATISGNNATTVTVAGWTAPASGSVYRIIANN
FT                   NAVSRSQRGVSGASVSYSGAWTNGTYTMISEAAYEYQICFKCHAATDPTTNTLRYWNVT
FT                   SPSLGAARWTNIGLEFNPNNASYHPVIQPLPSTGNRRLQATALTGGWQPGEVMTCSDCH
FT                   GRDTSTSATAQGPHGSTVKWLLTGMYQNWPFTSAAANGTSSGGTLLTGTGTATPPANNF
FT                   CFNCHTWAAGGNGHVKSSGGHSRPCVNCHIRVPHGGKVPRLLTGANAPSRYKPDGNGGA
FT                   FSGSYLTSAILPASGYMGANNVSCSSICGAKHTDNSIKAYSW"
FT   gene            729723..730247
FT                   /locus_tag="KN400_0680"
FT   CDS_pept        729723..730247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0680"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83543"
FT                   /protein_id="ADI83543.1"
FT                   /translation="MILLAIVLAVCSACAVGDTGEVEATIRRYNDLLVQGYRVQNMNPL
FT                   MEVTTHEHALKLYHHMAALGEGQLRMESKLKRIRFLNIERRGNSEATVETEETWDFTHY
FT                   RMATNEKYAEEKDFIYRMGYVLNKENGRWLITGVNTISGTSTNNVVPWPVLDRKGKVVN
FT                   QAPGGAQGRHP"
FT   gene            730250..731578
FT                   /locus_tag="KN400_0681"
FT   CDS_pept        730250..731578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0681"
FT                   /product="ResB-like family cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83544"
FT                   /protein_id="ADI83544.1"
FT                   /translation="MERIKRFFLARGTVISFILLALCAITLAAFIPQRFLTSPEEMLAW
FT                   QSAHPLFARWSGLLGLHHIYTHPGFALILAGGTISLALSTRNQALTAWQRTVRPAGGTA
FT                   GDRRFSVARAPDEVSRLLMTKGFIGQGIFDGEIRLVRHPWGYWGNTLLHFGMVLTIVAS
FT                   LCIALTQQQGVIHLAEGTIQHPSHPLLREEHGLLAGPLHLPDAVRLNRISYRFGADLAV
FT                   RELASTLTFLSDTGIAETRTVAINRILNHRGIRFYQGVEFGHAFFVEVTGPTGEPKVFQ
FT                   LQFMHPDRPDLPSYNDFPNLLGDGSLVRAKYLVDGEGKTFDRVRPLLTLRLDRDGQEVG
FT                   RLPLQPGGEGAIGQYRFRLLGFAPWSRLIMVNVTGMPLIFAGFFVICLGGVLHYFTPPR
FT                   QVSLAEGGAGGTTVSWRAARFSGFYRDEPDSLKRMVEREGMHD"
FT   gene            731571..732401
FT                   /locus_tag="KN400_0682"
FT   CDS_pept        731571..732401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0682"
FT                   /product="ResC/HemX-like cytochrome c biogenesis membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83545"
FT                   /protein_id="ADI83545.2"
FT                   /translation="MTDQASVYVTMNWLAVCCYVVATVFNASGIIFRKAVVEQRSYWPL
FT                   WLGLAVHSVSLIYWWRVVGHGPYMAPSEVLLSDAWIAMVLFLGFQRVFPRIRPASLVVL
FT                   PLVFLMVALANFYNPGIRSLPPTFSSIWLVLHISFYKIALGALIIALAFSIFYLLKARP
FT                   TPPDWLRRLPDLEDLDLHAYRFAGFGFIFWAIGMLAGSIWAYKSWGRYWGWDPVETWSL
FT                   ITWLIFGTYLHLRRFFRMGGRAAAWFFIFGFIVALVALFASSHMGTSIHSEYFQ"
FT   gene            complement(732466..733752)
FT                   /locus_tag="KN400_0683"
FT   CDS_pept        complement(732466..733752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0683"
FT                   /product="membrane protein, major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83546"
FT                   /protein_id="ADI83546.1"
FT                   /translation="MTTPTDRHTDRPGTVPAADRRFHYGWVIVAVGFLIIFACIGLARY
FT                   AYTMLLPSMQAGLGLSYDRMGFIGTGNFCGYLLSVILAPRLIRRFRPRAVISGGLALIT
FT                   LAMPAMGLSSGFAAPFALYALVGMGTGFANIPTMVLIGHWFRSDRRGTAAGLMIAGNGA
FT                   AIVLAGVLVPRLNGIFGANGWRAGWLLLGCVALGVAVLSAWLVRNHPSDMGHEPLGRSA
FT                   ALAPEDLVPHERPGDGMLLMRLGLLYLAFGATFMIYGTFIVTTMVREFGFSEARAGLYW
FT                   SWAGFFSCFSGVVFGALSDRIGRRHGLALVFAVQSTAYLIAGTKPGGVGLVVSIVLYGL
FT                   AVFAIPAIMAAAVGDYLGAPRAAGAFATVTIFFAMGQTLGPALAGMIGKAAGSFSGAYL
FT                   LAASITVCALLFALFLPRPEDTTTPHRAQ"
FT   gene            complement(733761..734081)
FT                   /gene="sugE"
FT                   /locus_tag="KN400_0684"
FT   CDS_pept        complement(733761..734081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="KN400_0684"
FT                   /product="quaternary ammonium compound resistance
FT                   transporter SugE"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83547"
FT                   /protein_id="ADI83547.1"
FT                   /translation="MTWGILVLAGLFEVGWAIGLKFTEGFTRLWPTVLTVLAMIASFWL
FT                   LEIAMRTLPVGTAYSVWVGVGAVGTVLLGIVLFGEPANPARLISVALIVAGIIGLKLSS
FT                   PA"
FT   misc_feature    complement(734104..734148)
FT                   /note="conserved nucleotide sequence; KN400_R0143"
FT   gene            complement(734157..734489)
FT                   /gene="emrE"
FT                   /locus_tag="KN400_0685"
FT   CDS_pept        complement(734157..734489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrE"
FT                   /locus_tag="KN400_0685"
FT                   /product="small multidrug resistance family transporter
FT                   EmrE"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83548"
FT                   /protein_id="ADI83548.1"
FT                   /translation="MHKWLYLLVAIISEVAGTTALKSAEGFTRLWPSCVVVVGYASAFY
FT                   FLSLTLKSIPVGIAYAIWSGLGTALIAVVAWVFMGQRLDLPAVFGILLIIAGVLVLNLC
FT                   STSATH"
FT   gene            complement(734729..737908)
FT                   /locus_tag="KN400_0686"
FT   CDS_pept        complement(734729..737908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0686"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83549"
FT                   /protein_id="ADI83549.1"
FT                   /translation="MDKPETAPLAPFPPGATYEPSLDRLMRLAAWAGAIRGDGTPVNFT
FT                   SILVGAILVEDETGAWFTRYARETGERAEAIADLVQTSEAMRPRVEEQAAAGTLPEARE
FT                   FYSSSVRDILGSALRLATRDGAEPRPLGTRHLLAALAFRLSDYHRRQLIGWGVGIAAWQ
FT                   RSTLDFLQRAFPSEDSTWVSLALEQAEAPPTEPPPAGTIFKSFAAEAPVPPVSAGPDIL
FT                   IARFTADDPTSATDLMDVRQEARAFARLAAGRAIRPPLSIGVFGEWGSGKTFFMKLMHE
FT                   HVARISRDADSEGPFHGNIVQIRFNAWHYVESNLWASLVDYIFTELDRWLKERPENPNE
FT                   TVDLLFDHLSTSRTLRLEAMDELVLRRRQRQEAEENLKTVRARFETALARQAVATAGEF
FT                   WTAVGTTMGKDRETRETIDRAGRALGVPELSASARQLSEVLQETATQAGRARTLGRSAV
FT                   AMLGRPRWLAALALILVAAPVAVVWFRDILGRTEVLSWLKEVNAAVLGLSSVMASVAGF
FT                   AGTALKRTATALDTLEGFRATLETAIAERTEEFRKNSNEAALLTDAEREAARLRSDVEQ
FT                   AERRLADADRRAADAARDFQGATARGRLNAFIRDKVVSGDYAKHLGIIATIRKDFGQLA
FT                   QLMADVDRDRELAEEYERARLDYARRVEELIARSGDVLTDEEIAALRASTTFDAESLRL
FT                   FERIILYIDDLDRCPPEKVVEVLQAIHLLLCFPLFVVVVAVDARWVSRSLKEVYPELLA
FT                   ETVIIPGTGATAPARPGAPAGEARHDATDRRTAPNNSDRERAASSQDYLEKIFQLPYWV
FT                   RAMDADACRTYIRGIVAAESTAHAARSAVSPEPAPSAPLSQPSIEQTAAATEATPLMGV
FT                   ESLPPEATPQPDTADGSSLEREARTMALTSHEAAFMAELAPHAGGTPRRGLRFVNVYRL
FT                   IRTSLPLHEHETLVGDKGEQTAYRALLAQLAIVTGAPGIASVYFDHLAALAADNLSENN
FT                   EKKGLVDLIAALGEDTRITAGTEAAPLLGALQALHDSVAPQGLGNDPALLATLHNTASV
FT                   ARRYSFTARPH"
FT   gene            complement(737936..738322)
FT                   /locus_tag="KN400_0687"
FT   CDS_pept        complement(737936..738322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83550"
FT                   /protein_id="ADI83550.1"
FT                   /translation="MKKQALIATVAAGILSLVAGVAPATDQERVSENVREKVRTEAKEQ
FT                   ERVYGSQLMTRKERAEYRARMRAAKTVQEREQIRKEHHERMKERARERGVTLPDEPPVP
FT                   GGGMGPAGMGAPGKGMGPGGGRNR"
FT   gene            complement(738339..739346)
FT                   /locus_tag="KN400_0688"
FT   CDS_pept        complement(738339..739346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0688"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83551"
FT                   /protein_id="ADI83551.1"
FT                   /translation="MGTVKITSWNVAHLERLTRAHPTAKERRRRDAVVREIRELAPDIL
FT                   CLLEGPAGEAGIDLVANDLLDGEWVAVKAADGNYATRGDQWIWFLVRQDLADRASLLPV
FT                   GTWDTFAGVSWTCHLWGEFTEGTHRHYRHPQVLILDWNGLRVEFIGLHLKSKFINQGER
FT                   LWRDERERFIREALTARIKMATEAVNVRAYIDAKFRQVGNPALFVLGDFNDGPGKEYFE
FT                   EQYLFFDLIANIQGNVFATSRFLNHGLFDIPDELCWTVRFRDFVQPDRRPEILLDHILF
FT                   TQGLVNGSLPWQVKPHAGKVEHEVHELVNAGLPKDSQTSDHRPVSLLVTTGPNP"
FT   gene            complement(739420..739923)
FT                   /locus_tag="KN400_0689"
FT   CDS_pept        complement(739420..739923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0689"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83552"
FT                   /protein_id="ADI83552.1"
FT                   /translation="MRKGLSAIVVGIALLGLDPCLPSDGVRGESGGGTIVPGQRIERFS
FT                   IGDPAPDNRTLRTIRKSKGIGITTAGGIIGRITVSSPRYEVERNRLKAGATLAEVLRFY
FT                   GRGEKTMKGSVIVLTYPDQGVEFVIDPTDERVRSITVFRPVVQKPSAEQYRKLYEHREK
FT                   LKAK"
FT   gene            complement(739939..741534)
FT                   /locus_tag="KN400_0690"
FT   CDS_pept        complement(739939..741534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83553"
FT                   /protein_id="ADI83553.1"
FT                   /translation="MHGKTQQPNQTSPRVDLTAILEVLKSVGLVVGGIGGGAILFFWIG
FT                   NAIIVARLRAYNLYGVVHYTDEYVTEAGFQFFQDIFTFFQDWRLIPFFVILMALLLLTV
FT                   PVGGGKAANERPAGKGRITRSVSLILRYRINYIIFLTLALSAAFILTSGWFVRKLSSDI
FT                   VCQERVLADLSKDLGGMVLILLPRKGALERADEFQQRFYEELTFGVEPTLHWMNYALAE
FT                   ISRREGTPLSLEVFQKRFSIREPSPFRSDADFEKSETYVALRNVWLSHALQQRLRERVN
FT                   LTLQDFRSLLSGHLTSEGDTSSLVLIPANYELAGESMRRLTRLRENISAFFVPGDEDTS
FT                   RICTSLGSLKPIAFGQFMISYSFWVLIGILVYLLLNSTRLIRLPLWEGGYFVVIFLLFL
FT                   TVLITLPTAYGRFKFEFKVQRLKDIVFTGEDKGVHPLRKKLDEARQRGAELYILGPTKG
FT                   REIIIGAFEHPEEADAGSTRIIMLERSAYSYMSVEPVRPEKIPGIIRLLRQQAGTTKHE
FT                   NVALAAERGGDGPP"
FT   gene            complement(741602..743878)
FT                   /locus_tag="KN400_0691"
FT   CDS_pept        complement(741602..743878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83554"
FT                   /protein_id="ADI83554.1"
FT                   /translation="MEKETKLSAETVKALLNEDINREDFQFVLQQLLDAWRPILEEELK
FT                   LSESAERLVAVAEKQPHSCEDEQLLADRLFAPLATADVALRTLTPQAREALGPIDQWQW
FT                   CLRKILCCLRFGWLLSRSRTFPVSVYYLYRYWLCIRRLFQNDPTGRQPTPEERADFRKL
FT                   TAGFAEVFRPWLVQEAKAMDHSMELADGAVSGQVDCHSGGDAAEALFEKFLTVDNARLL
FT                   MGAEIFEKLSKDPRFWLCRCWCICAFRFGWCLGRSRSLIDLVRCLVAYFRCLRRCFQPL
FT                   VCELTDPIGCVAEEVNTDLKALVVAVKGTATGGGFLRYVLEWSRDGIAWHASDFHYPPI
FT                   PPGGGTQGNSPVAGGLLAYFDTTARDEGAYTIRLTVYGVQGTTCVRTITFSLFKQDVRI
FT                   LGFDGAFTLDTTAYDPAAMFVETVPALCTRPSGIHEISFGECLSIWGSAFVGGCEGRKI
FT                   KRYLIDYKPGFETDPTTGGWINIWKVEYNTVWQYRDMNMRKDTSVLTASWVTDCVVPVP
FT                   FPPYCLMNVPEARLSPSCWQTHVSTCGLSGLVTLRLVVEDTGGTLYYDTQKVWIDNKPI
FT                   CAMIRIDAVPRCADIRVSAFATPPDCAVPWNLPLSGIAWDEYIDPALPLTRPNDNFDFY
FT                   WVKVSKQGGTEVQIPVSWSMGTPCFFGTNRVGDPGTSCTPCDPANPLPAAVFGTLAQFD
FT                   LRAIDPLCSASVGYPVPADLLLPRGECCVYVFKLRVQDRTYTPGGPHWREALWPVRICN
FT                   DLKPA"
FT   gene            complement(743932..744741)
FT                   /locus_tag="KN400_0692"
FT   CDS_pept        complement(743932..744741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0692"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83555"
FT                   /protein_id="ADI83555.1"
FT                   /translation="MKKKGKFLLFTMDEFDQWLLETRFSRSVKLVQNHHTYLPGYVQFT
FT                   GSNHFGLLEGMEHFHMAERGFSEIAQNLTSFPDGTVAVCRSIDKVPCGIKGANQEGICL
FT                   ENLGNFDAGGDTMTPAHRDAIVKINALLCREFNLTPNTDSIVYHHWYDLNSGKRTGGSG
FT                   TTKTCPGTAFFGGNSMDAAAATFIPLVAQTLAQLTGGTAPSAPVPLKSGEVVASSLNVR
FT                   AGRGTEFPVVKGLKRGVRVNVFETADGWVRIHPTEQQWVAERYLRYA"
FT   gene            complement(744757..745590)
FT                   /locus_tag="KN400_0693"
FT   CDS_pept        complement(744757..745590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0693"
FT                   /product="peptidase, C14 family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83556"
FT                   /protein_id="ADI83556.1"
FT                   /translation="MPKGIALALGLNAVDPKHYGGWAGKLNACEADAEDMAAIAAERGF
FT                   AVTTLMTKAATRAKVIDAIGKAAKALGKGDIFMLSYSGHGGQVPDTSNDEPDGVDETWC
FT                   LFDGELIDDELYALLGKFAAGVRVLVFSDSCHSGTVVKMAYYNGTTAARSAGPDEGEIR
FT                   YRAMPQSVAMRTYRANREFYDTIQQKTKKVDLADVKASILLISGCQDNQLSQDGAFNGA
FT                   FTGQLLRVWKNGLYKGSYRSFHKAIVRRMPPDQTPNFFTAGTPDPAFLKQRPFTV"
FT   gene            746057..746326
FT                   /locus_tag="KN400_0695"
FT   CDS_pept        746057..746326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0695"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83558"
FT                   /protein_id="ADI83558.1"
FT                   /translation="MMKPVYLFFLLVFVVPGVTGGILAANRARNVFVWSLLSAVFPIFL
FT                   LVIYFHKPLREVEGKFRRCGGCGEFIPWRETACRYCGREQPTHP"
FT   gene            746402..748171
FT                   /locus_tag="KN400_0696"
FT   CDS_pept        746402..748171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0696"
FT                   /product="sensor histidine kinase response receiver, PAS
FT                   domain-containing"
FT                   /note="domains: PAS, HisKA, HATPase_c, REC"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83559"
FT                   /protein_id="ADI83559.1"
FT                   /translation="MTQSGPEDGSGNSRIGAAEMPEADTEKQQPASDAPSQELRDIRAQ
FT                   LELSLERYANLYHFAPVGYATIDAVGVIADANRTLAGMIGADCREMVGLLFSDFVHKDD
FT                   VTSFVSHLARCTGQREGVTGEFRLSGRNGISVDVQLSSMPLTPPGGRVSCRTAITDITM
FT                   IKRKERELNESREELCWAKEAAEDASRAKSEFLANMSHEIRTPINGVLGMLQLVLDTEL
FT                   GDEQRHCLEMAKRSADALLRLVNDILDFSRIEARKMVFESRPFDLTACVNSAVEILAFE
FT                   ARRKGLAVMVRMGPDVPAAVVGDEARLRQVLVNLIGNAVKFTDRGKVEVTAARAERQSD
FT                   PLRTAIRISVRDTGIGIAPQERERLFRVFSQVDGACNRRFGGTGLGLALTRDIVEAMGG
FT                   AIDVESQSGQGSTFTITIPLLLAVTASSPFLPADTLRIAEASAGGGTGAPVTPPISIQY
FT                   EEARKVKILLAEDDPITRKFMEIMLERRNFEFESASDGHEAVEKWEAGEFDVVLMDVQM
FT                   PRLDGYEATGLIRERERDRGRRTPIIALTAHAMRKDEDRCLDAGMDGYLSKPIDFTKLM
FT                   ECIGEILARRGRG"
FT   gene            complement(748181..749293)
FT                   /locus_tag="KN400_0697"
FT   CDS_pept        complement(748181..749293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0697"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83560"
FT                   /protein_id="ADI83560.1"
FT                   /translation="MARMAVLSALILCLWGCSMPRGWEAILVLTDLSAGRGPSGLKERT
FT                   PPPRRLTVPYAVEGRNYQGDLYLPCERIRAGLVLLPGAAEEGKDDPRLQAFAETLARAR
FT                   FAVLVPDLGGFRSLRAGSRDIGETADAILWLSSRPGLSPGGKCGVAALSYAGGPALLAA
FT                   LEPRAGQRVRFLVTVGGYYDLRNVLTFFTTGWYRDGDRWRRGTPNNYGKWVFVLANTDR
FT                   IKNVRDRTALEKLARRKMDNPAARTDDLVRGLGPEGKSLYDFFANTDPRQVPALVERLP
FT                   TPIRRDLAALDPSRRDLRGLTARLIIIHGRDDDIIPAAESEALARAVPRDRRGLFVLDG
FT                   LMHVELKPKLTDAFRLWRAVSAILRERDRA"
FT   gene            complement(749305..749787)
FT                   /locus_tag="KN400_0698"
FT   CDS_pept        complement(749305..749787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0698"
FT                   /product="desulfoferrodoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83561"
FT                   /protein_id="ADI83561.1"
FT                   /translation="MDRRTFLKTAALGAMAAGIAREAAAAGRYYPVKADQSLFETINRA
FT                   KDPAKKSPLEQKHVPVITAPKAVKAGEPFTVEVAVGEVVHPMGPTHWIQFIELNVGNEP
FT                   AGRVDMQPRGFLSPKATFTVTIPKEAAPEGKITLVVNERCNLHGYWEGSIDIAVTG"
FT   gene            749964..750509
FT                   /gene="rpoE"
FT                   /locus_tag="KN400_0699"
FT   CDS_pept        749964..750509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="KN400_0699"
FT                   /product="RNA polymerase sigma-24 factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83562"
FT                   /protein_id="ADI83562.2"
FT                   /translation="MTLDTTDELNRFLAGVERRAFRMARLATSDDDEALDVVQDAMLGF
FT                   VRNYARKPEAEWPPLFHRTLQSRIVDWHRRSTLRNRFRAWFGKNDDEDGGDPLDGIPDV
FT                   NSPDPARQLLDRDLGQAIEAALRKLPTRQRQAFLLRNWEGLDTSETAFAMGCSEGSVKT
FT                   HLSRAVHALRGMLEEYGP"
FT   gene            750506..750871
FT                   /locus_tag="KN400_0700"
FT   CDS_pept        750506..750871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83563"
FT                   /protein_id="ADI83563.1"
FT                   /translation="MKHDERDERMIQTVRRELDRSTSDLDGAIAGRLAEIRAKAVAEAG
FT                   RRHFPFLPRWVTVGGVATLTAAAVAGIIWFSSPSVEPVPVAVQDDPEQIELIAANDHIQ
FT                   LYEDIEFYHWLAAQENQ"
FT   gene            750868..751425
FT                   /locus_tag="KN400_0701"
FT   CDS_pept        750868..751425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0701"
FT                   /product="protein of unknown function DUF3106"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83564"
FT                   /protein_id="ADI83564.2"
FT                   /translation="MRSYARGPNVGEVMGSWRVILVCMMLGMAVSPAWGDGGGVSWERL
FT                   TPEQREVLQHFAERWNSFPPERQERLLDSAERWRAMAPEARRNALERYRHWHDLTQEQR
FT                   DLIRKRIKEFHKLAPADQERIKRSYQRFQNLPPQEREVLKGKWRSLSPEEKRQFKEKWR
FT                   SMTDEQRREFLRDRSTDDSGAR"
FT   gene            751468..751587
FT                   /locus_tag="KN400_0702"
FT   CDS_pept        751468..751587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83565"
FT                   /protein_id="ADI83565.1"
FT                   /translation="MRQMVLRVALTGKERARLHRLQDNASRDIYRKKHNRRVQ"
FT   gene            complement(751797..752492)
FT                   /locus_tag="KN400_0703"
FT   CDS_pept        complement(751797..752492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0703"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83566"
FT                   /protein_id="ADI83566.1"
FT                   /translation="MVDNVLAILRMGDELADLAVDLFDGVTDPTGIAPATTRIVARAEE
FT                   LLSARGNGRDDIRIACGPGCMTCCTVNVSVLVPEAWTIAVWLRQHHDAGEVDRLAVRLT
FT                   AAARAIRWLDDADRIRSGVTCPFLDERGWCSIHPVRPLMCRALTSTDPAQCRRALESRT
FT                   SDEEVPLECNLLQKYLMEQAYRSLAAALERRGIDSAGRELVGTVARFLNEPWLADKFLV
FT                   GRLITLPES"
FT   gene            752738..752971
FT                   /locus_tag="KN400_0704"
FT   CDS_pept        752738..752971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0704"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83567"
FT                   /protein_id="ADI83567.1"
FT                   /translation="MKTNDLVPIHDAARELGTTHLRLLMLVKQGTLAGELCDGEWFLPR
FT                   HAVEQFRAFGGDSRADLACRATCKAPSCGCKG"
FT   gene            753029..753634
FT                   /gene="cheD64H"
FT                   /locus_tag="KN400_0705"
FT   CDS_pept        753029..753634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheD64H"
FT                   /locus_tag="KN400_0705"
FT                   /product="protein glutamine deamidase and protein glutamate
FT                   methylesterase CheD associated with MCPs of classes 40H and
FT                   40+24H"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83568"
FT                   /protein_id="ADI83568.1"
FT                   /translation="MRHQRLEGRHIIRIAPGEYHVTTGGGVISTLLGSCVAACLFDSES
FT                   GVAGMNHFLLSNHRYSRTMPFCFTEAGRYGIHSMELLINSLMRHGARRENLRAKAFGGA
FT                   SILVNRAEVGNFSCVGSVNARFVREFLANEGIPLLSADLEGERGRVIYFDTTDFSVFVR
FT                   KIRLQRSLVVAKRDRNVWEHGVQAHDVEPDSVDLWLPG"
FT   gene            complement(753644..754075)
FT                   /locus_tag="KN400_0706"
FT   CDS_pept        complement(753644..754075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0706"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83569"
FT                   /protein_id="ADI83569.2"
FT                   /translation="MKRMKRTAGALLLGLALLLGGCGGGEVRISAEIPVVYPVDYAPAI
FT                   TWLSFWKDADRYFVPGSIDFTDPDADTDIMTIVVSDSLGRVMARTVADLDDYVGYTGGT
FT                   VSFSIDYLTYPPGTYTFTIYLTDRGGNLSNPVYGTFQVW"
FT   gene            754300..755778
FT                   /gene="ppk-2"
FT                   /locus_tag="KN400_0708"
FT   CDS_pept        754300..755778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk-2"
FT                   /locus_tag="KN400_0708"
FT                   /product="polyphosphate-dependent AMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83571"
FT                   /protein_id="ADI83571.1"
FT                   /translation="MFESAELDHAVDKKTWKARVPPLREALLDAQYDLLEARGFPVVIL
FT                   ISGVDGAGKGETVNILNEWLDPRHVETNAPGDASDEERERPPMWRFWRSLPPRGKIGIF
FT                   FGSWYSGAISDHMEGRSKQAKLDQALERIRRFERMLADEGALVLKFWLHLSRDQQERRL
FT                   KALEKNPRTRWRVTARDWKNFKVYERFRDLATHVLRATSTAEAPWTVVSGVDPRYRSLT
FT                   VGNAILSALRARLATPENPHPPRTALPVSPATDAVMLLRSLNLSRTITKKRYEEELEEL
FT                   QGRLSLLTREPRFRKRAVVAVFEGSDAAGKGGAIRRVTQALDAKIYRVVPIAAPTEDEL
FT                   AQPYLWRFWRTIPRLGRFAIFDRSWYGRVLVERVEGFCSRGDWMRAYSEINDFEEQLVE
FT                   SRIVVAKFWLAISPEEQLRRFREREETGFKRFKITEDDWRNREKWGEYETAVCDMIDRT
FT                   STEIAPWTLVEAENKQYARIKVLRTLCERIEAVL"
FT   gene            complement(755793..756467)
FT                   /locus_tag="KN400_0709"
FT   CDS_pept        complement(755793..756467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0709"
FT                   /product="iron-sulfur cluster-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83572"
FT                   /protein_id="ADI83572.1"
FT                   /translation="MEHMDGAISLPFQKPVAATHRWALALIMILTIAVGWRYPLVGFVV
FT                   PAAMAASIAGSFFRGRYVCGNFCPRGSFFDTLFRLVGGPRDVPAFLRGSAFRWTFLALL
FT                   MGFLGWQISRDPADPAHWGFVFWMACALTTGIGIVLGLAFRARTWCLVCPVGTMSNAIG
FT                   GGNWQMTIAESCVGCGSCERHCPMGLTIAAHRQDGTLPHRDCLKCSSCVDACPKDALGW
FT                   PS"
FT   gene            756635..757462
FT                   /gene="lpxC"
FT                   /locus_tag="KN400_0710"
FT   CDS_pept        756635..757462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="KN400_0710"
FT                   /product="UDP-3-O-(3-hydroxyacyl)-N-acetylglucosamine/UDP-3-N-(3-hydroxyacyl)-2-N-acetylglucosediamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83573"
FT                   /protein_id="ADI83573.1"
FT                   /translation="MNKRQTTINRIFKLSGIGLHTGREVTLEFIPRREFGIAFVYQGQL
FT                   IPARYDMVADTRLSTQIAADGKSVSTIEHLMAAFYYSGITNCLVYIDGPEVPIMDGSAW
FT                   EFYHEIWRAGVYEFPETGVYLKVLRPVEVSHNDAWVRVKPLNTLDITMTIEFRPPVGKQ
FT                   RKRLMDVENAVSIINSRTFVLHEEIEAIRKAGLAKGGSLDNAVVIGGEEILNPNGLRYK
FT                   KELVNHKILDLIGDLFTCGYRMLGKVEANKTGHYLNNRLLREIFADPDNYAIY"
FT   gene            complement(757546..757974)
FT                   /gene="rnk-1"
FT                   /locus_tag="KN400_0711"
FT   CDS_pept        complement(757546..757974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnk-1"
FT                   /locus_tag="KN400_0711"
FT                   /product="RNA polymerase-binding protein Rnk"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83574"
FT                   /protein_id="ADI83574.2"
FT                   /translation="MKKKAEERSIYITEFDLTRLEELLDKIDTEGSRDSRHLQELEDEL
FT                   LRAEVVEPQQIPADVVTMNSRVALKDLATGEEMVYELVFPSDARLEENRISILAPVGTA
FT                   LLGYRAGDTITWKVPGGTRKIKITKILYQPEAAGDFHR"
FT   gene            758172..759209
FT                   /gene="mreB-2"
FT                   /locus_tag="KN400_0712"
FT   CDS_pept        758172..759209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB-2"
FT                   /locus_tag="KN400_0712"
FT                   /product="cell shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83575"
FT                   /protein_id="ADI83575.2"
FT                   /translation="MASLREDMFGQASGDFAVDLGTTTTRVYRRGAGIVLSQPSMVAFR
FT                   RGDGGPARLLDAGSGARRMFGRTPAGIDVVRPLREGVVVDPAAGAHMLRSFFDSIPGCA
FT                   HRSLRIIIGVPAGGSGRDRDNARAVARMAGAGEVYLMEEPLALAIGAGADAADLWGTLV
FT                   VDVGGGTTEVALVASGGIQCLRSVPVGGDAMDAAIVGYLERERGVLVGERTAEELKIRL
FT                   GAATADSPAERARVRGRGVARGLPVEISVSSREVCAALRAPVAAIVAAVRSCLDGIPPA
FT                   VSLDLLDRGILMGGGGSLLHGLDRALEREVLLPVTRVSDPFSCVARGSAAVLDYLGVLR
FT                   RVERG"
FT   gene            complement(759218..761224)
FT                   /gene="ehrA-2"
FT                   /locus_tag="KN400_0713"
FT   CDS_pept        complement(759218..761224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ehrA-2"
FT                   /locus_tag="KN400_0713"
FT                   /product="Ech-hydrogenase-related complex, NuoL-like
FT                   integral membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83576"
FT                   /protein_id="ADI83576.1"
FT                   /translation="MTDGGGMVSPGMLLLCASALAALSGVPLLVRSLSPAAGQKAATVL
FT                   MLLATVIGLGSAVATLVTGRTETFLLSWGLPFGPAEMAVDPLSAFFALPILLVAACCAV
FT                   YALGYWPARDNPRTVRSLTFFFGLLVAALIGVIVARNGVLFLVAWEIMAVSAWFVLTAD
FT                   HAKPEVRDAGTLYLITTHIGTLALFALFSLLKGTAGSYLFPAPASLAAGGGIGAGIFLT
FT                   ALLGFGIKAGLMPLHVWLPSAHANAPSHISAIMSGVILKLGIYGIVRTVSFFAQIPLWW
FT                   GIVLLVAGMASGIAGVAFALGQHDLKRLLAYHSIENIGIIAMGIGVALVGAATGVPSLA
FT                   LLGMAGALLHVLNHATFKALLFLGAGSVIHAVGTRKIDRMGGIARVMPRTALLFLTGAV
FT                   AICGLPPLNGFVSEFLIYLGVFREAVHGTGAAAAVTSLAGPALALVGGLAVACFVKVFG
FT                   VVFLGLPRSEEAARAHEAGRPMLAPMAVLGAVCVVVGLAPAAVGALLDAAVRSWRPELA
FT                   LTAPALADLAPLGWLMAVAAGTLATVAVLALLYARRLAAVPRGASPTWGCGYLAPTPRM
FT                   QYTASSFAEMLVRLFGGILRPHGTQPGIRSCAPAPSELHTHVPETVLEHLYLPFITWAN
FT                   GKLAPLRRLQHGQLHLYILYTLITLVTLLLFGM"
FT   gene            complement(761229..761906)
FT                   /locus_tag="KN400_0714"
FT   CDS_pept        complement(761229..761906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0714"
FT                   /product="helix-turn-helix transcriptional regulator, MerR
FT                   family, PTSIIA domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83577"
FT                   /protein_id="ADI83577.1"
FT                   /translation="MLLNAAEAARLLSTDEKTVKRWIRRDGLPATPVDGEPRINRIDLL
FT                   EWATERGIKVLPEAYAGAGDEPGLFPSLSSALQAGGIHCNVPGDDKLTVLRNVVDLLPL
FT                   PQQVDPEFVLQVLLAREALGTTAIGDGIAIPHMRNPILLHVAGSSITLCHLATPVDFGA
FT                   LDGKPVQILFTLTSPTVKAHLHLLSRLAHALRDPRLREALKRPCDPAGILAAVAEIERS
FT                   LGG"
FT   gene            complement(762007..762345)
FT                   /locus_tag="KN400_0715"
FT   CDS_pept        complement(762007..762345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0715"
FT                   /product="toxin, MazF family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83578"
FT                   /protein_id="ADI83578.1"
FT                   /translation="MFKRGGIYSVNLAQEGDGTPETCPCVVVSNNISNEFSPVVTIIPL
FT                   SFRNLEKIYEFETFLPATKTGLAADSKLSSHIIITIDKAKVVGERLGFLSKTLMEQVEK
FT                   ALRFQLEL"
FT   gene            complement(762338..762574)
FT                   /locus_tag="KN400_0716"
FT   CDS_pept        complement(762338..762574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0716"
FT                   /product="antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83579"
FT                   /protein_id="ADI83579.1"
FT                   /translation="MPSTRLNISLPTHIVDDIKALYGPRGLSQFLEEAAQEKLAAVKRE
FT                   AYKGLIEGYRSTADETVEVLKKLEAAVTEERDV"
FT   gene            762718..764703
FT                   /gene="ehrA-1"
FT                   /locus_tag="KN400_0717"
FT   CDS_pept        762718..764703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ehrA-1"
FT                   /locus_tag="KN400_0717"
FT                   /product="Ech-hydrogenase-related complex, NuoL-like
FT                   integral membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83580"
FT                   /protein_id="ADI83580.1"
FT                   /translation="MESALEGADPASQILAAIVLVALSGVPGVLARRFVPGQILAAVMA
FT                   VAASLLGLTGTIRTLLEHRTTAFSLAWTLPFGPADLAVDPLSALFLIPVFLVFGCGSLY
FT                   ALGYWPAAANRSTEPALTFFYGILAAAMAGLVVARNGVLFLMAWEAMALSAWFLLATEH
FT                   RDPAVRQAGIVYLAATHAGTAALFVLFCVLRGVTGSFVFPAPHSLDPALVPATVLFLAA
FT                   LAGFGAKAGIMPLHIWLPAAHASAPSHVSALMSGVMLKMGLYGLVRTISFFAPVPLWWG
FT                   GLILVLGAVSALAGIVLAASQRDLKRLLACSSIENIGIIALGIGTALVGEATGNVPLYT
FT                   LGMTGALLHLLNHSLFKPLLFFGAGAVIHATGTREMDRMGGLARLMPRSALFFLVGSVA
FT                   ICGLPPLNGFVGEFLLYAGFFGEAVADPVPLLALSAPLLAVVGGIATVSFVKLYGVIFL
FT                   GVPRCGAHHHSHLPDWRMGAPMGLLALLCLAAGIAPGPVLSLVEPAVGAFGMVPPAPLE
FT                   TLVPLGWLTLGAGMLGAAVILSGLLLMFRLKRTPAARGTTWGCGYPAPSPRMQYTGVSF
FT                   ADSLVRQFEGVVAPRREGPAVAGFFPAPVLFRFVPTETILERVIMPLFRVAGFSFAFLR
FT                   RLQHGRLHLYMLYILTTLFLLMVWAH"
FT   gene            764719..765627
FT                   /gene="ehrB"
FT                   /locus_tag="KN400_0718"
FT   CDS_pept        764719..765627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ehrB"
FT                   /locus_tag="KN400_0718"
FT                   /product="Ech-hydrogenase-related complex, NuoH-like
FT                   integral membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83581"
FT                   /protein_id="ADI83581.1"
FT                   /translation="MLDIIIHLLLAILMPPLLLGVIVKTKAAFAGRVGAPLLQPYYDIA
FT                   RLLRKGSVFSDTTTWVFRAGPVVTLAAPAVAALLVPLGNHPAPVSFAGDMILFAYLFGL
FT                   ARFFTTVAALDTGSSFEGMGAAREVTFSCLAEPTLFFALITLARMSGSLSLTPMLTHAT
FT                   AADWLTAGASLLLLVGALFLVLLVENCRIPFDDPTTHLELTMIHEVMVLDHSGPAFGLI
FT                   LYGAALKLFVLGAFFMNVALPVRTGNTLADWGIFVASMLVLAVAVGVVESVMARLRLIR
FT                   IPQLLVAATILSAFSMLLILR"
FT   gene            765631..766272
FT                   /gene="ehrC"
FT                   /locus_tag="KN400_0719"
FT   CDS_pept        765631..766272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ehrC"
FT                   /locus_tag="KN400_0719"
FT                   /product="Ech-hydrogenase-related complex, HyfE-like
FT                   integral membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83582"
FT                   /protein_id="ADI83582.1"
FT                   /translation="MVSLADQLLVLVMLINFVVLGSSRMAFCIRAAAVQGVILGVLPGI
FT                   IHSFSWHLVAISGGIILAKGLVIPWLISDAVRKARIKREVEPFIGYVPTLILGAVATAL
FT                   AFVFSERLPLAPEHQDLLFVPAAIATLMTGFLVLTTRRKAISQVIGYLVLENGIFIFSL
FT                   LLTTAMPVMVEAGVLLDLLVGIFVMGIVINHISREFSSVDTSRLSALKEE"
FT   gene            766277..767713
FT                   /gene="ehrD"
FT                   /locus_tag="KN400_0720"
FT   CDS_pept        766277..767713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ehrD"
FT                   /locus_tag="KN400_0720"
FT                   /product="Ech-hydrogenase-related complex, HyfF-like
FT                   integral membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83583"
FT                   /protein_id="ADI83583.1"
FT                   /translation="MLTAAVLLPLVGALAAWIVPDNRLRPLVLPAVAVPHFLLTLALLA
FT                   WTPPPSPQGWIFLDPLGKIVLLCISTLFLICAVYAVGYLAYRRDRSNRVLCMGLLACLS
FT                   AMTLVTASQHLGLLWVAVETTTVTMAPLIYFNRNARSIEATWKYLLICSVGIALALLGL
FT                   FFLAYATLVAHRDATLLLGPILASARELNPGWLHASFIFMLVGFGSKMGIAPLHSWKPD
FT                   AYGEAPGLVGALLAGGLVNCAFLAILRVYQISLASGGEYLFFQKALLTMGLISMGLAAV
FT                   FMARQADFKRMLAYSSVEHVGILAVALGLGKGALFGALFHLLNNGLTKGVLFLSSGNIH
FT                   RSFNSKSTEVVRGALARLPWSAGLFLAGFIAITGSPPFSPFVSEFSIVSSAFVEGRYLV
FT                   GGLFLFFLAVIFIGMALTVLPLVMGEPPADAERTDYRDRLLTVGPPLALLGLILMLGVW
FT                   LPEPLLRLLGEGAALLEAKS"
FT   gene            767710..769227
FT                   /gene="ehrL"
FT                   /locus_tag="KN400_0721"
FT   CDS_pept        767710..769227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ehrL"
FT                   /locus_tag="KN400_0721"
FT                   /product="Ech-hydrogenase-related complex, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83584"
FT                   /protein_id="ADI83584.1"
FT                   /translation="MSARFLTLHNGSAVPFHEVPRLELTAFLQQMIDATDRGWRVSSYF
FT                   GIPTGTGATLCCALSSSSDGSIALATADAAGSFPSIARFCPQVQLFEREIAEQCGLPAE
FT                   DHPWFKPVRFHRAFVPGRDAWGRAAGEPIPVGVMDYYRVEGDEVHEVAVGPVHAGIIEP
FT                   GHFRFQCHGEEVFHLEISLGYQYRGIEQGLMGGPDPRTPFRMETIAGDTTIGHMQAYCM
FT                   ALEALAGTRVPARAEALRGIALELERLANHTGDLGAIAGDVGYLPTASFCGRIRGDFLN
FT                   MSAVLCGSRFGRGLVRPGGVLFDLGPAERDDLLARLDAVQSDLQGAVEILWDAPSVMSR
FT                   LENTGTVPADTARELGLVGPAARACGLNRDVRRDHPYGIYRMAQIPVVTAHHGDVCARS
FT                   TVRWLEAGKSLDFIREQLKQLPGGGCRNEAGSLQPDRIAVALTEGWRGEVCHVAITGAD
FT                   GRFLRYKVTDPSFYNWPGLAMALRGEQISDFPLCNKSFNLSYCGFDL"
FT   misc_feature    769272..769447
FT                   /note="conserved nucleotide sequence; KN400_R0063"
FT   gene            769469..770224
FT                   /gene="ehrS"
FT                   /locus_tag="KN400_0722"
FT   CDS_pept        769469..770224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ehrS"
FT                   /locus_tag="KN400_0722"
FT                   /product="Ech-hydrogenase-related complex, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83585"
FT                   /protein_id="ADI83585.1"
FT                   /translation="MLREIIARLKQGHRTMAYPKEPVSLPQRFRGYPEFPATVERSDAR
FT                   ACAEACPHGAITCDNGMALDTGRCLFCPECAAGGLVSFTTDHRLAATKREHLIVRPGGE
FT                   HHLARPLEPSLRSLLGRSLKFREVSAGGCNACEADTNVLSTIGWDLGRFGIQFVASPRH
FT                   ADGLWVTGPVTENMREALLMTWEAIPAPKIVVACGACAIGGGPFAGSPEAHNGVADILP
FT                   VDLFIPGCPPHPATILDGLLRLIGRIEGA"
FT   gene            complement(770293..770787)
FT                   /locus_tag="KN400_0723"
FT   CDS_pept        complement(770293..770787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0723"
FT                   /product="cytochrome p460, 1 heme-binding site"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83586"
FT                   /protein_id="ADI83586.1"
FT                   /translation="MKFMLAVLALTLAGAAASGAGELPVAPNGIACLTDYRAWEAVAPS
FT                   WRDDRGQIRVILGNPTAMKALRSGTRPFPDGSTFAKLAWSAKKHPKFPLATVPDAFAQV
FT                   EFMVKDGEKFKPTGGWGFARFVGQELKPYGKDASFVLECFGCHTPVKDNDFVFTHLATI
FT                   P"
FT   gene            complement(770879..771139)
FT                   /locus_tag="KN400_0724"
FT   CDS_pept        complement(770879..771139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0724"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83587"
FT                   /protein_id="ADI83587.1"
FT                   /translation="MSPHDPNPKRPRYPMPDFFRQALEEHGLMADYLARPAYQRNDYIG
FT                   WVNRAKRSETKEKRLHQMLDELEKGGVYMNMAHPPSRKDKE"
FT   gene            complement(771289..771627)
FT                   /locus_tag="KN400_0725"
FT   CDS_pept        complement(771289..771627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0725"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83588"
FT                   /protein_id="ADI83588.1"
FT                   /translation="MRIKDPFSYSARWDSVGLDCAYCVHFAGPSSWPDTDRTSRCRLHA
FT                   IPLDIGLGRCGYKEDEWFCRDFSDDGRAHGTAVEEFEALKAGLQSETLYGAYGLRGYLK
FT                   EIEFKRLR"
FT   gene            complement(771941..773560)
FT                   /gene="mcp40H-23"
FT                   /locus_tag="KN400_0726"
FT   CDS_pept        complement(771941..773560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp40H-23"
FT                   /locus_tag="KN400_0726"
FT                   /product="methyl-accepting chemotaxis sensory transducer,
FT                   class 40H"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83589"
FT                   /protein_id="ADI83589.1"
FT                   /translation="MSVSIGRRLTLNMVWGVFVVLVLVIGNWIGMGHLEQLQATSHEAM
FT                   ARSRSAQETKVIGEKLYRFVLESVANPDMAGSSSKGWLNRKAEGMAKLKQLAEQTGDDA
FT                   ALGALVASADKAFRGTVTLYETKLIPALERGANHEDIMDIDDEISMESDNLSISLLKVA
FT                   ETLEKRAIAASAQYDSFSAKLKTFSLALGGIGIVLLVVFSSWLSRSIMRPLRQVIAMME
FT                   DVAEGEGDLTKRLEHRSNDELGKLCTEFNSFVGKVHDTISRTSSVARDVTGSVAEISRT
FT                   AERLAEGAEEVASQAVMAATASEEMAATSCEIAGNCQTAAQSSSRARETAARGFAMVEN
FT                   TIAVMNQIARRVRVSAESVQGLGARSDQIGEIVMTIQDIADQTNLLALNAAIEAARAGE
FT                   QGRGFAVVADEVRALAERTSRATREIGEMIKGIQGETRTAVLTMEEGVKEVEAGTREAA
FT                   KSGEALNEIMQGIEQLNQQMGQIACAAEQQTSTTMEISGSIQRIKDVAQETAGGAHDSA
FT                   RTSTRLTDLSHDLDRLVSQFRV"
FT   gene            773980..774519
FT                   /locus_tag="KN400_0727"
FT   CDS_pept        773980..774519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0727"
FT                   /product="protein of unknown function DUF2284"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83590"
FT                   /protein_id="ADI83590.1"
FT                   /translation="MADQAVLQKLFQDGGARDYRWIDPEEIVVGQWVRMKCMFGCSDYG
FT                   RNASCPPNTPPVGECRDFFREYRLGAIFRFTKQLDDPEERHGWSRELNQKLLELERAVF
FT                   LAGYPKAFLMFMDNCKLCRECARTRAGCRNLKHARPSAEAMGVDVFATVAKFDYPIDVL
FT                   GRYTDEMNRYAFLLIE"
FT   gene            774538..774846
FT                   /locus_tag="KN400_0728"
FT   CDS_pept        774538..774846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0728"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83591"
FT                   /protein_id="ADI83591.1"
FT                   /translation="MPGKVALAAIILLAAVSAVHAADPPAPSQPAPVATSASPERDESD
FT                   RVSPVNLLPATDPTDRNLSRPGAAPRPAPAPAANGSIQHEFHGGFTTIFSTTNGIPR"
FT   gene            complement(774895..776235)
FT                   /locus_tag="KN400_0729"
FT   CDS_pept        complement(774895..776235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0729"
FT                   /product="membrane protein, major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83592"
FT                   /protein_id="ADI83592.2"
FT                   /translation="MGASAQMEKVGTRLRLMLRALNSRNYRLFFAGQSVSLVGTWMQQV
FT                   AMSWLVYRLTGSALLLGVVGFVSQIPTFLLAPVAGVLADRWKRRPLLLATQTLAMVQAA
FT                   VLAVFVLTGTTPVWLIVALSALLGVVNAFDIPIRQSFVVELVEKKEDLGNAIALNSSMV
FT                   NGARLIGPSIAGVLVATLGEGICFLINAASYLAVIIAIAAMRLKPVPQRPGRKHILHEL
FT                   REGFGYAFDFKPIRYILMLLGLVSLMGMPYVVLMPIFAKEVLHGGAHTFGFLMASVGIG
FT                   AFGSTLYLASRTSVLGLGRVIAVAACVFGFGIAGFALSSSLVLSPLFLALAGFGAMAQV
FT                   ASSNTILQTIVDDDKRGRVMSFFTMSFMGATPIGSLMAGAVANRIGAQNTLLIGGAACL
FT                   LGGALFGRELRNLRPLVRPIYARLGIIPEVAAGMQAAADLTCPPEDP"
FT   gene            complement(776509..777054)
FT                   /locus_tag="KN400_0730"
FT   CDS_pept        complement(776509..777054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0730"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83593"
FT                   /protein_id="ADI83593.1"
FT                   /translation="MKRTRYLVGIILTAIALAGCGDDKNDTGTAGSEYVFPAGTATLAF
FT                   TAMSTAQLSVPVSGIELTLALPAGMGVTTTTGGTGQIVNSTLTPGSALSGTNLAYGNYS
FT                   ASTRKAYLSMATTSSSYRSGEFLRLACTVDTGTSITLSGLRALNTPVTLVRAVGYDALT
FT                   NSTVDLTGKLAVTLDAVR"
FT   gene            complement(777089..783667)
FT                   /locus_tag="KN400_0731"
FT   CDS_pept        complement(777089..783667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0731"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83594"
FT                   /protein_id="ADI83594.1"
FT                   /translation="MHNQTRSATVFTPLQRPISRFPGRCRPLGTLGIVLGVILALMVIL
FT                   GGVAQAAITARITMTTYPEFASQNTPPGHITFMRASIPNAGNNYDAAVAWQDITGNVTN
FT                   LAVNLGTTPGYFTMGFNDNSYMSASSCTSNVNFSTSSAYMTDGGSFDVLITCTVPDTTP
FT                   PTPQSAATNAAGTTVTITFDESIEASDGWASTTDFTVTVNSTPVAVSGLSFSGASVTLT
FT                   LATPVGIGQTVKVGFDDSNMGLVDAAWNQVASFSNLAVTNNSTVVTNAAPTFVGATTAL
FT                   TVNANSGAADIKGLLHVSDSDGSQTLTWSQNTAPSHGSLSFAGATASSGSADITPGGTI
FT                   TYTPAANYAGSDSFAVRVSDGTDTATRTITVTINAVAPGAPTIGAATAGDTQVSVAFTA
FT                   PASTGGAAITGYTVTASPGGATGTCASSPCTVTGLTNGTAYTFTVTATNSAGTGSASAA
FT                   SNSATPKAAQTITFTNPGGQNFGTTPTLTATATSNLAVSFSSATVGLCTITSEGALTFV
FT                   ATGTCTIEANQAGNSVYAPAPTVSRSFAVNAVAPGAPTIGSATAGNAQASVTFTAPAST
FT                   GGAAITGYTATSNPGGLTGTCVGSPCTVTGLTNGTAYTFTVTATNSAGTSSASAASNSV
FT                   TPKAAQTIAFANPGAKNFGTTPTLTATATSGLTVSFTSATTEVCTITSGGALSFVTAGI
FT                   CTINADQAGDSSYLAATTVSQSFAVNAVVPGAPTSVTASPDDGQATVSFTAPASTGGAA
FT                   ITGYTVTSTPGSITGTCAASPCLITGLTNGTAYTFTVTATNSAGTSSASAASNSVTPTP
FT                   GPAVISVAVPANGSYGTGSSLDFTVTWDSTATITGTPRIALTIGGTTVYADYASSPTAT
FT                   TSLFRYVVTAGKNDTDGITIGALTLNGGSIRNSSGVDATLTLNSVASTTGVLVDTTIPT
FT                   VSSVTVPGNGTYTAGQNLDFTVSFSENVTVTGTDSTLGLTVGAAARTATYLAKTATAIT
FT                   YRYPVQSGDLDSDGITVGGLALNGSTIIDVAGNGANLTLNGVGATAGVLVDAEAPAVTA
FT                   FTVAARAAGLTVPIASFTAADGSGSGVAGYLITTSDTPPPAGDPGWSALAPTTYAVATV
FT                   GTYTLYPWVKDAAGNVSAVHGAPATVGVYPVLYAVPGGRESGFCESWANACELRYALAN
FT                   AVNGQDIWAAAGTYTPTAGTDRSATFQLVSGVALYGGFAGTETARAERNFRANVTILSG
FT                   DLGAQGTAGDNSYHVVTGADSATLDGFTISGGNASGNLQDGYGGGMYNDYINSPAVANC
FT                   IFTGNYASLGGAMFNLGSSPTVTNCSFSGNTASSYGGGMYNTDANPVLTNCTFSNNLSY
FT                   GYGGGMVNGALSNPTLTNCTFSGNAANISGGGMYNTHGNPSVKNCTFSGNSAGTSGGGM
FT                   YNANNSPVVRNSIFWGNSNGEISDNASTPTVSDTVVQGGYPGGSNIMTADPLLAPLADN
FT                   GGVTRTMALLSGSPAIDAGDCSTGPAADQRGMSRPQDATCDMGAFERGVPDAVAVEGGA
FT                   GQSAAVNAAFAAPLRLKVTDSLGAVLDGINVAFAGPGSGAGIAAGGPATTDSAGIASFT
FT                   ATANGTVGSYSVTATVDSLSAGFPLTNIKGDQAISFNPPATATFGDAPITLSATGGASG
FT                   NPVTFTVASGPGSLAGTTLTITGTGSIVVTASQAGNANYNAAPDVQRTITVGQAGQTVA
FT                   FGAAPTVVVNGSGTVSASATSGLTVAFSSTTPAVCSVSGTTVTGLTAGSCTIAANQAGN
FT                   ANYNAAPQITQTFAVGKGSQTVSFGAAPSLTVGGTATLSATATSGLAVTFASATPTVCS
FT                   VAGSTVTGKALGTCSITASQPGNADYNAAPQAIQGITVVYGTTPPMMALSILSDNAVTT
FT                   DTTQNICGIATDPAGIRSVTVNDEDVSVNPDGSFSYPVQLVAMANSIRIVVTNNAGISS
FT                   AVTRTINLDASAPRLTVASPDDNAVIWQQHITVSGSVTPLDPTTVVSWSVNGSAPQVAA
FT                   LSGVDYSFTTNLQEGMNTILITASNAAGQTVETKRTVTRATVFSLAVTDPDADIRTALG
FT                   TYTLTGEVADNTSPVAVTVAMDGRVYTPTVVNGAFRQQLTFSEAKVYQVAVTGVDQNSN
FT                   TLTVQRNIIYAQPSATGTTGAGVTIVDALQALRMTVGIIRPDSSQIARLDVAPMVNGAS
FT                   VGDGRIDITDVIVILRMALGMIH"
FT   gene            783871..784299
FT                   /locus_tag="KN400_0732"
FT   CDS_pept        783871..784299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0732"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83595"
FT                   /protein_id="ADI83595.2"
FT                   /translation="MALKCAVGGGRISLQQTDALGLSGIRLLHTPCRKLRDGEWVSRHN
FT                   GLSVAVDLSAAFQALAAESCARVFNEATPGSAKPIDCINDIMGTYPRIGQKRTIRHHRG
FT                   VPFDAAKKPCRDIGRASFGVRWRDNSMNMDKLLKAFAA"
FT   misc_feature    784392..784426
FT                   /note="palindrome; KN400_R0144"
FT   gene            784489..786138
FT                   /gene="mcp40H-24"
FT                   /locus_tag="KN400_0733"
FT   CDS_pept        784489..786138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp40H-24"
FT                   /locus_tag="KN400_0733"
FT                   /product="methyl-accepting chemotaxis sensory transducer,
FT                   class 40H"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83596"
FT                   /protein_id="ADI83596.1"
FT                   /translation="MAAWQSLKVKYKIFTLILVCCVGLIAVGLLGFGGMRSMGKSLGEL
FT                   NEEQKSVATLSAMKNDFLEMRLAIVYMLALTDSAKLAEKERDFGAAAARIKERLASLEH
FT                   HNFAAEEKKKITEFRDGYEAYLAEGTKSAAMAKAAAETGNAAGREEAVRYAVTTAAPLY
FT                   NKPAQALAELVEISIKEGGEVYDADMASYRRSVLVMGVILMVVVAVSAVAGLAIASSIS
FT                   GPLNRILEVLQRVAAGDLTARAEIDSRDEMGLLGRELNVTAEKIGKIIGQLAQAAGSVA
FT                   SASAQLHATAEQMATASEEVAAQAETIATAGEEMAATSNDIAHNCVTAAEGSTQANDAA
FT                   EGGAQVVQAAIAAMDRIAERVHASAKTVEGLGVRSEEIGEIIGTIEDIADQTNLLALNA
FT                   AIEAARAGEQGRGFAVVADEVRALAERTSKATRQISEMIRAIQHDTQSAVHSMEEGVSD
FT                   VQAGTAEAARSGQALQMILAKIGDVTNQISQIATAAEEQTATTGEISNNMHQISQVVQD
FT                   TARGAQDTVAAANSLSRLSEDMQGMVQQFRLA"
FT   gene            complement(786219..787061)
FT                   /locus_tag="KN400_0734"
FT   CDS_pept        complement(786219..787061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0734"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83597"
FT                   /protein_id="ADI83597.1"
FT                   /translation="MTRILAVALLLTTACAQAGGGLLSAPTTVVPCSAPWNQAVEESVP
FT                   TGDGQGHGPDIGSEEWKSAIEFRLGVRGNPDVPDRTGDAWCGYIDRLVRERAPAGATAP
FT                   EGPSYDCDTVTPGSIEALVCGDRELSALDRKLADVYAAASARAVNEHPPRLGAEQRGWI
FT                   KGRNDCWKSDTVRECVRDEYLRRTAELQATYRLVPGIGPVRFVCDGNPANEVVATFFQT
FT                   EPATLIAERGDEVSLMFVQPSGSGAKYQGRNETFWEHQGEASITWGYGAPEMRCVKAP"
FT   gene            complement(787078..787422)
FT                   /locus_tag="KN400_0735"
FT   CDS_pept        complement(787078..787422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83598"
FT                   /protein_id="ADI83598.1"
FT                   /translation="MDTNNTHKTKCDLNLEEDVSIHIFTASAAMVGVCLTVIGLLRVAL
FT                   TIRGGVTLADDMLALDAFLFLASCILSYFALRTRSSRRMHRVERWADSIFITGLVLMVS
FT                   VCAIIVYEIV"
FT   gene            787644..788330
FT                   /locus_tag="KN400_0736"
FT   CDS_pept        787644..788330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0736"
FT                   /product="protein of unknown function DUF554"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83599"
FT                   /protein_id="ADI83599.1"
FT                   /translation="MILTGTIANVATICAGALIGRYAGRFVPARTRRTVMAGLGLTVLL
FT                   IGLQLALKSRQPLLVIGGLIIGGILGEMLQIEARLEDFGRWLQARFSSAGNIAEGFVSA
FT                   SLLYCVGAMAIMGSLQDGLGDKPSILYAKAALDGVASIALASTLGIGVLFAALPVALYQ
FT                   GGITLAADVARGVLTEPVIVEMNAAGGLLIVAIALDMMELKRIPVGNLLPSVFVVVGLA
FT                   WAFGLA"
FT   gene            complement(788570..790228)
FT                   /locus_tag="KN400_0737"
FT   CDS_pept        complement(788570..790228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0737"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83600"
FT                   /protein_id="ADI83600.1"
FT                   /translation="MSRIIPLIVGAVLFCFSAASYALPAQLPLSKDLTVRLSALSAQGQ
FT                   LQTVAEVVARTDALGKIAFDFPTVPSSATTPFLHIRIMDGENVLRQAIVPSPQPGGTVD
FT                   AGVSEVTDLQARALLKATALSGRLTPVHMLVAHTLLRTPTISTTDAEAIGSAIVAGADA
FT                   LFAVLATDGLSSDQHAAFLGSLRNGLADAAGIYRKSVDDSIVFDQNVEAYRRGEAYAVL
FT                   LQSLIDAGIDAGINLETVSTAFAAAGAATEAALESNPAVGAVARAGMRLGYVTGMLSLS
FT                   NYRSIRELVAGFRHAGCSPPRFSRLHSVFDLVWQDTTTSLKAADRDLLASSSENDLQGL
FT                   RTQEFNAAARQDLQGLKLALESYDLRTIPESVELMLEITSRMAGQGGVMAGMTPEHLME
FT                   ILGRSTSASPESPPVPVDVPTLTPYELAAWAYIHTEPGFAYTPIAGLIDQLESKPTATP
FT                   QFDKLAEPYKSLALLTYDLILISRLYWQEQQDAETALEANQTDPPRWHPLATVRQISEN
FT                   NRQRLALARRHISGVSPEAKDALIYLVHANRFVRF"
FT   gene            complement(790248..790385)
FT                   /locus_tag="KN400_0738"
FT   CDS_pept        complement(790248..790385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0738"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83601"
FT                   /protein_id="ADI83601.1"
FT                   /translation="MRRALKILFLFLMTIVLTTMCGCGGSGSSGNGNGKGTGSLTGSGK
FT                   "
FT   misc_feature    complement(790517..790639)
FT                   /note="conserved nucleotide sequence; KN400_R0145"
FT   gene            complement(790685..791575)
FT                   /locus_tag="KN400_0739"
FT   CDS_pept        complement(790685..791575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0739"
FT                   /product="transposase of ISGsu7"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83602"
FT                   /protein_id="ADI83602.1"
FT                   /translation="MSATISPATGKAYGVQRVCLAWGVPRSSFYSRAGRKTLPAVLLKR
FT                   GPKTPLSDDEVLSLIRTDLETSPFVGEGHRKVWGRLRFVKGIKVGRKRVLRLMRENNLL
FT                   SPHRVVQGQPKDHAGKIITAAPNVMWGTDGTKIFTLEEGWCWLFTAVEHWNAECVGWHV
FT                   TKNGDRFAALQPLAMGIKARFGSVGAAAARGLALRMDHGSQYLSEHFQNQIKFWGIAPS
FT                   FSFVAEPQTNGVTERFNRTIKEQVIYGRHYRTIEEVRMAVADFMDRYNRLWLVEKLGFR
FT                   SPRQAFEEYQLKKAA"
FT   gene            complement(791572..791934)
FT                   /locus_tag="KN400_0740"
FT   CDS_pept        complement(791572..791934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0740"
FT                   /product="protein of unknown function of ISGsu7"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83603"
FT                   /protein_id="ADI83603.1"
FT                   /translation="MEKDVSVSGAAEGERSSTGAAPEVKRWSANRKKEVVLRLMRGEPI
FT                   DALSRELGIEIYRLEEWHQKALQGIESALKAREGDPLAAELDAAFKRIGEITMENELLR
FT                   EKARRAHPLAQRRSKK"
FT   misc_feature    complement(792004..792032)
FT                   /note="conserved nucleotide sequence; KN400_R0290"
FT   misc_feature    complement(792313..792394)
FT                   /note="conserved nucleotide sequence; KN400_R0146"
FT   gene            complement(792405..793742)
FT                   /locus_tag="KN400_0741"
FT   CDS_pept        complement(792405..793742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0741"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83604"
FT                   /protein_id="ADI83604.1"
FT                   /translation="MKLTVPPLEIAEDEGFSSEKDIFKRVEFGERLAKLIENANDNLVL
FT                   ALDSQWGEGKSTFIQMWRGYVEHQRNDKFKTIYFDAFANDYQKDPFLALASGIYEILPH
FT                   KSTSTKNQFTKKAGDAAKAFTRGAIKIGVKVATGGLIDGSVVDSAEKDISKLISDQVDN
FT                   IIADRFKSTEKDKLAIKAFKQHLGEVASEQGNGRPLVFIIDELDRCRPDFALDLIEQVK
FT                   HLFSVKGITFLIVLNREQLEEYVKSRYGIGVDASLYLQKFINIWLNLPRKYEKHLDQGV
FT                   QYFRFALGKMLEAGEQVPNHSTKTVLEELVRYHKPSYREIERILSYFALVNNMADQSYI
FT                   APFQYIMAFVCYLKGTNSGLLEQIFKRSIVVEDLLKITKLDLFDEKSDERHLYGLANYI
FT                   RYDLSPENIRNQMIQDKIISPERLGFGCNDIVADVTAWFREINISS"
FT   gene            complement(793839..794495)
FT                   /locus_tag="KN400_3420"
FT   CDS_pept        complement(793839..794495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_3420"
FT                   /product="DUF74 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_3420"
FT                   /db_xref="EnsemblGenomes-Tr:ADN78316"
FT                   /protein_id="ADN78316.1"
FT                   /translation="MDIQEAWKKAYDLHYKSKNEDNKNEALILYREISSQHPYSEEGKY
FT                   SLCQIENLRKSNPELFNEDSNTSAANPITLITDKSICTTCHSTISGYNEDGMCAACFVQ
FT                   YLNENIIMTTTNNIDGFKVTKYIDIKSVEIIMGTGFISETFSDIADIFGARSVLFEGKL
FT                   ADAKRIATEQLRYAAYKIGGNAVIGIDLDYTEFSSNRVGVIISGTIVKIIPITNI"
FT   misc_feature    complement(794519..794592)
FT                   /note="conserved nucleotide sequence; KN400_R0147"
FT   gene            complement(794744..795295)
FT                   /locus_tag="KN400_3421"
FT   CDS_pept        complement(794744..795295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_3421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_3421"
FT                   /db_xref="EnsemblGenomes-Tr:ADN78317"
FT                   /protein_id="ADN78317.1"
FT                   /translation="MEQIQCWLITILDKVVLATLVGLITSGIFLYILSRFRPTIDISPE
FT                   IACGADTTDGRAIYRIKVINRTKAPIVDIKAQLHIFKNHQTATGEIWKSKPIALRRSDP
FT                   IVIDKYDRSDRDANYAYRFVTYDDLEAIWHNDNVQFIRFRIYARHSISGFGVFAYKDYR
FT                   LKRHSIKAGEFSKGDTFEIK"
FT   misc_feature    complement(795381..795440)
FT                   /note="conserved nucleotide sequence; KN400_R0148"
FT   gene            complement(795455..796522)
FT                   /locus_tag="KN400_3422"
FT   CDS_pept        complement(795455..796522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_3422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_3422"
FT                   /db_xref="EnsemblGenomes-Tr:ADN78318"
FT                   /protein_id="ADN78318.1"
FT                   /translation="MKKRAKMLFDKSLDSLLLSIEHFNRPWDRGRPEAVLILMDRAFEL
FT                   LMKAIILNKGGKIREPFQKETIGHEKCVRKCITDAQVKCMTEEQGLTIQIINSLRDAAQ
FT                   HDIVEVAERDLYLYSQAGVTLYRDMIMDQFNEDLRDHFPERVLPVSTEIPKDLHAIVEA
FT                   DFEEIKELVRPGARRHIEAMAKLKALAIIESSLEGVRLQPSEPELMKLAKEVKAGKSWQ
FT                   DIFPGVASLQLATDGEGLNVHVRITKKEGDAVHVVPEGTPGATVLAVKRVNELDFYSLG
FT                   IKNIADQLGISDKKALALVDKLGLQSSEDFFKVIKIGKNEFKRYSGRALKTLREELPKV
FT                   NIDEVWQEYVAKRRG"
FT   gene            complement(796794..799031)
FT                   /gene="mcp64H-8"
FT                   /locus_tag="KN400_0744"
FT   CDS_pept        complement(796794..799031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp64H-8"
FT                   /locus_tag="KN400_0744"
FT                   /product="methyl-accepting chemotaxis sensory transducer,
FT                   class 40+24H"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83607"
FT                   /protein_id="ADI83607.1"
FT                   /translation="MSLSFRNARLRAKHILAFSTMALIVAVTGIFGIWRVDSVVTQVKT
FT                   MLRGRALQEKAVLNMQLSQKSCRVNLVEAAMVRTDPDEFEEHVNNYRAKNELFKKYSNA
FT                   LLNGDPALGIPPAPAGSPIATYATAVLASWGEFEKAADQLIAHKQRLLKGLRSGVVDQA
FT                   AKDALADETLNRLALETIRDTSENAKLDIDDLADYLESQTYAGLKTTETIRQSTRYTFI
FT                   TVILMAVAAAIGLGLLFTRMIVGRVKRVAAALQSGARGDLTAAVPVDSRDELGTLGDDF
FT                   NTMADRLSGMLTSVRKAVGELHSLSDKIAVAAGKVTEGEEIQAKGVNAASSAISEINAS
FT                   IREVADGVANLSLSAADTSSSILEMTASVEEVAINADSLSSLVDEVSSSVIQMAASIKQ
FT                   IDGSVQSLMEISTTTASSVAQMDTAIGQVEVNARETAALSLDVEREAERGKRAVEDAIA
FT                   GIVAIQRSSRITTEVIDVLSRKVEDIGGIISVIDEIAEQTNLLSLNAAIIAAQAGEHGR
FT                   GFAVVAGEIKDLSDRTRTSTREIAEVIMGVQSETRRAVEAISRADKSIADEERLSANAD
FT                   EALGKIVMRAREASSRVAEIARATVEQATGSKIIRDAINRVTDMTSQIASATSEQGAGG
FT                   DLIMTAVERMRDATAQVRNSTREQSATGNIIARSTENITDMIDQFRSASEEQFRGSEQI
FT                   VRSMEEIQQSATMSLEVSRVMEEAAITLSRQVKVLETEMEGFHIRGQSSSR"
FT   gene            799259..799933
FT                   /locus_tag="KN400_0745"
FT   CDS_pept        799259..799933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0745"
FT                   /product="outer membrane channel, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83608"
FT                   /protein_id="ADI83608.1"
FT                   /translation="MKKHTIAIAAFALCTLPAVAGATPARPGGYVSGFFGVSAASDADV
FT                   TSIDNQFGDVFNDRVEYDPNIYVGGTGGYDFGHFRLEGELSYKHAEISSITDDTGFRFR
FT                   GVDGNLGALAFMANAFVDLHNNTPVTPYFGGGIGFAVLSLSDTYGNDTSGRLLLYPEDD
FT                   TTVFAYQAGGGVEIAINPSLSLDLGYRYFGTTKGTFDSDWITTTKLKYESHNGMVGFRV
FT                   KF"
FT   gene            800038..800742
FT                   /locus_tag="KN400_0746"
FT   CDS_pept        800038..800742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0746"
FT                   /product="AzlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83609"
FT                   /protein_id="ADI83609.1"
FT                   /translation="MTEERSRGVVRDGLGAAWPICLGYAPIGLALGVLAQKAGLGPLET
FT                   GIMSVLVFAGGSQFIAVAMIKSGAALAAIVATTFMVNLRHALMTSALAVPLQGVRRRFL
FT                   ALFAYGVTDESFAVNMARFRADGWDRWRALVVNQTANLTWILSTIAGAYAGEFVPAGAL
FT                   GIDYALTAMFICLLIFQLRSRFYVIVAAFSGLVATALYVTIPGNSHIVIAAVTAATAGY
FT                   AVRRNRAARGVV"
FT   gene            800742..801062
FT                   /locus_tag="KN400_0747"
FT   CDS_pept        800742..801062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0747"
FT                   /product="AzlD family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83610"
FT                   /protein_id="ADI83610.1"
FT                   /translation="MDFQTYLAVVAGMALATYLPRMIPLVLLSNRQIPPWLADWLDLIP
FT                   AAILGALLAPGLLAGETRALELGRPELIAALPTFAVALKTRSLGLTVVVGMLCYWLIGK
FT                   VV"
FT   gene            complement(801076..801987)
FT                   /gene="rarD"
FT                   /locus_tag="KN400_0748"
FT   CDS_pept        complement(801076..801987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rarD"
FT                   /locus_tag="KN400_0748"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83611"
FT                   /protein_id="ADI83611.2"
FT                   /translation="MTNPPDHEAREARTGVIFGLAAYLLWGFFPIYFKALAGVTPLEVL
FT                   SHRIAWSVATLAVMLTVARRWDGVRAAFSQPRTLMTLCATTLLIAVNWLVFIYAVGAGK
FT                   VLQSSLGYFINPLVSAFLGVVFLHERLSPKQKASFILAAAGVAILTLRHGEFPWIALSL
FT                   GLSFGLYGLLRKKAPVDSLAGLTVETLLLFPLALCYLGWLAYQGKSAFVSGPTHITVLL
FT                   ACAGVLTSTPLIWFAAATKRLRLATVGLMQYVVPTLHFVLAVFAFGETFTPTHLASFAL
FT                   IWTGLVLYTYDAAKLIFGNGGR"
FT   gene            complement(802035..802343)
FT                   /locus_tag="KN400_0749"
FT   CDS_pept        complement(802035..802343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0749"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83612"
FT                   /protein_id="ADI83612.1"
FT                   /translation="MELRLPKNETVAIEGNPQGLVLYCKEGIIWLTQEGDDRDRFLGAG
FT                   DMFCFTHGGKAVLEGHRDALVAIVPAAHGPAAAPAGAREPSSGFHAGIRLVYHGSGQ"
FT   misc_feature    complement(802516..802545)
FT                   /note="conserved nucleotide sequence; KN400_R0149"
FT   gene            802553..803143
FT                   /locus_tag="KN400_0750"
FT   CDS_pept        802553..803143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0750"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83613"
FT                   /protein_id="ADI83613.1"
FT                   /translation="MDKNETRATIIRIGTDLISRQGFNATGIDAVLKEAGVPKGSFYYY
FT                   FRSKEEFGLAVIDHFVERYDQRLDTFLNDEEVTPLNRIRNYLESALARLEQNQCSKGCL
FT                   IGNLGQELADQHERFRGRLDEIFRSWKDRFAACLREAQRGGELAPELDAGVAAGFILSG
FT                   LEGAILRTKVMKSPQPLRDFIEILFASVLRRQA"
FT   misc_feature    complement(803236..803350)
FT                   /note="conserved nucleotide sequence; KN400_R0150"
FT   gene            803385..804392
FT                   /gene="acuI"
FT                   /locus_tag="KN400_0751"
FT   CDS_pept        803385..804392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acuI"
FT                   /locus_tag="KN400_0751"
FT                   /product="NADP-dependent menaquinol:acrylyl-CoA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83614"
FT                   /protein_id="ADI83614.1"
FT                   /translation="MDTTTQFKALVVEKTADKQFVREVRPRSIDDLPPGDLVVRVHYSS
FT                   LNYKDALSATGHSGVTRQFPHTPGIDAAGEVVACDSGAFAPGDRVIVTGYDLGMETDGG
FT                   FGQYIRIPSAWAVPLPEGLSLRESMALGTAGFTAALSVLGLERAGVTPDRGEILVTGAT
FT                   GGVGSIAVAILAAAGYRVTASTGKEFEEEYLRELGATEVIGREELTAGAEKALLAERWA
FT                   GAVDVVGGPTLAAVLKSVKYGGVVTCCGLVGSPDLPVNVYPFILRGVSLLGIDSVQASP
FT                   GIRREVWQRLAGAWKPAGLAGMVTECSLQGLEVMIQTILHGGITGRVVVNLLES"
FT   misc_feature    complement(804421..804588)
FT                   /note="conserved nucleotide sequence; KN400_R0151"
FT   gene            804629..805210
FT                   /locus_tag="KN400_0752"
FT   CDS_pept        804629..805210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0752"
FT                   /product="flavodoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83615"
FT                   /protein_id="ADI83615.1"
FT                   /translation="MNIVTLLGSPRSRGISAAIAARFTDTAAGLGAQTRTFELNRLAYR
FT                   GCQGCYACKKTLDHCVLTDDLAQVLDAVRGADVVVLASPVYYGDVTAQLKGFIDRTFSY
FT                   LKPDYLSNPQPSRLSPKKLVFVLTQGHPDEGMFADIFPRYEGFLTWLGFVDARLIRACG
FT                   FGPSTVDKVPEQYLREAEQAAREIVGQGKG"
FT   gene            805282..806481
FT                   /locus_tag="KN400_0753"
FT   CDS_pept        805282..806481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0753"
FT                   /product="membrane protein, major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83616"
FT                   /protein_id="ADI83616.1"
FT                   /translation="MESREHRAGRLLLIACAISFVCFFGSYMRIPIVPLFATSMGADAA
FT                   QVGLINSAFMLMAGALSIPSGLVSDRLGRRIPLLGGLLLLAGSSFLLYWSNSPLQMAGV
FT                   YLLFGIGLSAFSPTLMSYVADVTPPEVLGQAYGWYTMALYGGMTLGPAAGGFLGTALGL
FT                   RPVFLVSGGLILAMFVVALFLLPATPRAASGAAPHRAILPTLRGLMGNRRLLACLAATM
FT                   GTCFGFGMFVTFMPLYIRSQGMHSGHVGFVFAAQSLANAVSRLPSGKLSDRVADRSRLV
FT                   AGGLAVFAVALAAFGLCRSVVPLMGVAALMGMSMGVAFTAVSALIADVVPREQRGLAMG
FT                   CYNTCVYAGMMLCAAGMGPVIREEGFRTGFFLNGVVGLATLILFVALYRRPVSVVGPSA
FT                   "
FT   gene            806526..807353
FT                   /locus_tag="KN400_0754"
FT   CDS_pept        806526..807353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0754"
FT                   /product="iron-sulfur cluster-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83617"
FT                   /protein_id="ADI83617.1"
FT                   /translation="MDETISAEVGRFVAESPDNRFPDGSGPYFDQPLVGFAAAGDPLFT
FT                   EYKRIIGEFHLTPAELLEGAATVIVWVLPVTESTRVSNRLETTWPSRSWALTRTHGETL
FT                   NGALRRHLVAYLEGLGHRAVAPQYSPAWREFSDTPVGIASTWSERHAAYAAGLGTFSLS
FT                   DGLITGRGIAHRVGSVVTTLALPATPRTARTYRHNCLWYREGTCGVCIGRCPVGAITFA
FT                   GHDKARCRELVYGSAPALLAERYGVSHTGCGLCQTRVPCEAGVPRGKKPAGSP"
FT   gene            complement(807408..809432)
FT                   /locus_tag="KN400_0755"
FT   CDS_pept        complement(807408..809432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0755"
FT                   /product="sensor histidine kinase, HAMP domain-containing"
FT                   /note="domains: HAMP, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83618"
FT                   /protein_id="ADI83618.1"
FT                   /translation="MKPLRFPIRLKLTFATLIPLFVATSICWLIGVYIINSRIVAQAQE
FT                   KVRTDLNAARAVYDGEVEHIRDVVKFTATNPFTAAILEKSDRDTLRSLLAPLLKAEGLD
FT                   ILTAVDAGGKVIFRASNAEAHGDLKSSDAVVSRALHGELVSGTDVLTPEELVKEGTALA
FT                   ARAAIEIVPTPRARARKDELVERTGMVMVAASPVRDERGRIVGALYGGVLLNGNNELVD
FT                   RIKKIVFEAVRFQGRDVGTATIFLGDLRIATNVYTAPDRRAIGTRLSEEVFNRVILSRE
FT                   KWVGRAFVVNDWYFSSYEPILSPGGVPIGSLYVGMPEKPYSEMKREIALIFGVVLFCGS
FT                   FIGLAISSFIASRLARPIGELETVARRITAGERDLEIAIHTRDEIGDLAGEFAQMTRTL
FT                   AQREEDIRKLNRELEQKVLDRTAQLEEKNLLLVKTQEDLVRAAKLADIGMLAAGVAHEI
FT                   NNPMAIIRGNAELLQMALPDEDPNREEVDTIAQQVGRVERIIGSLLKFARQQQRRLGTV
FT                   SLPPLLDDILKQMGHQVPLTRIEIRKAYAVDLPPLAGDPDQLRQVFTNLVLNAIQAMPD
FT                   GGSLTVATARDEEAGTCTVSVSDTGRGIAPENLKRIFSPFFTTKSEGTGLGLSVSYGIV
FT                   KDHGGNILVESTEGEGTTFRVVLPLQQGGTERSEGAPGA"
FT   gene            complement(809429..810826)
FT                   /locus_tag="KN400_0756"
FT   CDS_pept        complement(809429..810826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0756"
FT                   /product="sigma-54-dependent transcriptional response
FT                   regulator"
FT                   /note="domains: REC, sigma54 interaction, HTH8"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83619"
FT                   /protein_id="ADI83619.1"
FT                   /translation="MLKAKILICDDEEGIRRYLQKMFQAKEFEVETFADGTSLLARIEA
FT                   GTDGDADILLQDVRMPDMDGIEVLKRVKKLRPSLPVVVMTAFGTIDSAVDAIKLGAYDY
FT                   VTKPFPREKILGVIDNALELDLLMKENKALKEELARPDTPDNIIFTSAKFREVYELTLQ
FT                   VAGSDANILILGESGTGKELIAGAVHYNSPRRGRRFLSINCAALSDTLLESQLFGHVRG
FT                   AFTGAITTQKGLLEEADGGTLFLDEIGDVSAAVQAKLLRVIQERDFIPVGATKAKNVDI
FT                   RFVAATNKDLAKEVREGRFREDLYYRLNVITINLPPLRERTEDIIPLAEHFLQKYSRRV
FT                   RKELKGISPEAAQVLQAYHWPGNVRELENVVERAAILARGEFVTPDVLPMYRQAAGAPA
FT                   PIAPPKEDRLISLEVIEKEHIERVLHQTGWHKSRSAEILGISRKTLDRKIVEYALTLPG
FT                   GVPADDE"
FT   misc_feature    complement(810890..810941)
FT                   /note="conserved nucleotide sequence; KN400_R0152"
FT   gene            811109..814141
FT                   /gene="fdnG"
FT                   /locus_tag="KN400_0757"
FT   CDS_pept        811109..814141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:811679..811681,aa:Sec)
FT                   /gene="fdnG"
FT                   /locus_tag="KN400_0757"
FT                   /product="periplasmically oriented, membrane-bound formate
FT                   dehydrogenase, major subunit, selenocysteine-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83620"
FT                   /protein_id="ADI83620.2"
FT                   /translation="MGISRRQFLQGGALAGAALALSGTPGEASADSPDLRTKGTKVTTT
FT                   VCPFCSVGCGLIVHTKDGKVINAEGDPQHPINQGSLCPKGGALFQIANNDKRLQKVMYR
FT                   APGSDKWEEKSWDWALDRIALRMKETRDKSFKKTELNKKDNKEYVVNRTDGMAFFGGAG
FT                   LDNEECYLWTKFARAMGVGQLEHQARLUHSSTVAGLAASFGRGAMTNHWIDLKNSDVIF
FT                   AIGCNPAENHPISFKWIEAALDNGAKLISVDPRFTRTSSKADIYAQIRPGTDIAFLGGM
FT                   INYAIQNRMIHEEYVREYTNATFIVSEQFDFQDGMFCAFDDQEKVYDLKSWAYSTGADG
FT                   KPKRDMSMKDPKCVYQLMKNHYKRYDIDTVCAITGTPKEDYLKVVKAFCATGRPDKSGT
FT                   ILYAMGITQSTHGSQNVRAVALLQMLLGNIGIAGGGVNALRGESNVQGSTDYGLLFHIL
FT                   PGYLKSPEFDNVDLKAYVEKWTPKTKDPKSANWWGNTPKYTVSLLKAWYGDNATAENDF
FT                   CYDYLPKRMGNYSYVKIMEKMAKGELEGLVCMGMNPAVGGPDSVAAREALGKLKWLVTA
FT                   DLWETETSIFWKRPGVDPKSIQTEVFMLPAASSIEKEGSISNSGRWAQWRYAAVHPLGD
FT                   SRSDLHIIDEFYKRIKALYLKDGGAFPEPLTKLAWNYGTGHEPDVHLVAKEINGYFTKD
FT                   VTIKEKDKVLEFKKGDQVPMFKYLQDDGSTVSGCWIYCGSYTNEGNQMARRDPSDPTGL
FT                   GLFPKWTWCWPVNRRIIYNRASVNPAGEPFNPKRPVIAWDALEKKWKGDVPDGPWPPMK
FT                   DDKEGKYPFIMLPEGHGRLYALDMKDGPFPEHYEPVESPAKNLLSKVQTNPVVKVPSNV
FT                   SSDTSKFPLIGTTYRVTEHWQAGAMTRSLPWLVELVPDMFVEISETLAKQKGISQGDMV
FT                   KVSTERGSIQAKALVTSRLKPFNVQGKLIEQVGMPWHFGYAGLATGDSGNVLTPTVGCA
FT                   NTGIPEFKAFLCNIEKGGKAA"
FT   gene            814138..814971
FT                   /gene="fdnH"
FT                   /locus_tag="KN400_0758"
FT   CDS_pept        814138..814971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdnH"
FT                   /locus_tag="KN400_0758"
FT                   /product="periplasmically oriented, membrane-bound formate
FT                   dehydrogenase, iron-sulfur cluster-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83621"
FT                   /protein_id="ADI83621.1"
FT                   /translation="MSAGAIDYSKTKTFLIDTTKCTGCRGCQVACKQWNQLKAENTTFF
FT                   TGEGYQNPPGMSEFTFTRVKFKDYQKHGQNEFAFYKEMCMHCNDPACASVCPVGAFEKT
FT                   AEGPVVYHSKKCIGCRFCMVACPFGIPKYEWSKAFPLVKKCTGCYSRVKNGLDPACATA
FT                   CPTAITYGPRDEMIKEAEKRMSARPDRYVKVVYGKEEAGGTTVLYLTQQPLDELGFKPV
FT                   TKRPLPSYTWQALRLVPGIFLTVGGTLSLITWFQHRKDRVRKEEEEQKNRKEGNQ"
FT   gene            814968..816173
FT                   /gene="fdnI"
FT                   /locus_tag="KN400_0759"
FT   CDS_pept        814968..816173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdnI"
FT                   /locus_tag="KN400_0759"
FT                   /product="periplasmically oriented, membrane-bound formate
FT                   dehydrogenase, cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83622"
FT                   /protein_id="ADI83622.1"
FT                   /translation="MTAARIVINEIKGYHRFIKFLMVLVGAAAVASAVRFIFGLGATTN
FT                   LNDLYPWGLWISFDVVTAVPLAAGAFTIGIVAHVFHIKKLEPLVRPAIVTGFLGYSLVC
FT                   VGLLLDLGQPQRGPYVLFNWNVHSPMFEVSMCVMAYTTVLFLEFLHPVSERFGWHIPLR
FT                   LLRTLELPFAILAAMISTLHQSTLGTFFLIAVDKLHNLWYNPLLPLQFWLSAIFTGLSI
FT                   VIFEASLVHKYMGQPDESDLLATLTKIIPWIMGVYIAVKAYALAFLSHGPLFDRPVLTA
FT                   LFSVEVIVGLLIPFAMFLTKRIRTDKQMQLRAASLVIVGLILNRFNVSMFAMHQPGQPV
FT                   YFPNFIESVVTIGIIAAHILFFVLIAKYFPIFEHHPEATDYTIPDRFRKIEKHGHGTAS
FT                   EA"
FT   gene            816234..817670
FT                   /gene="fdhD/mobA-2"
FT                   /locus_tag="KN400_0760"
FT   CDS_pept        816234..817670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhD/mobA-2"
FT                   /locus_tag="KN400_0760"
FT                   /product="formate dehydrogenase accessory protein FdhD and
FT                   molybdopterin nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83623"
FT                   /protein_id="ADI83623.1"
FT                   /translation="MKTIHIYTNGRLEEKRGDIVREFPLVLQVNGREIATLIASPHDLR
FT                   FLVAGFLRNQGFVESAADFHMLAVCDEFGIANVRIRQELPERLKPVLTSGCGTGITFTL
FT                   ETGGREAAVAPSPAVAPEAVFRLMEELARQADNYRNHGGIHSAAVGDGEGNLLLFAEDI
FT                   GRHNTLDRIAGEALLKGIDLAGRILVTSGRVSTEMASKCARLGIALVASRTSATDMAAT
FT                   LCHEAGICLLGYVRGGKFTVYTHSDRLLVPEQAAASLPGPVPRGRIPGVTGVILAGGQS
FT                   SRMGSNKALLPYRGGRFIESIHRQLSEYFDEVIVVTNTPEQYEFLPCRKVTDIHEGMGA
FT                   LAGIHAGLHHSSNPAAFVVACDMPYLNGDLIRHLASMADPGGVLIPESPTGLEPLHAVY
FT                   GKGCLAAIEATLLSGQRRIVSFFGRTNVNRVNVAQIAAFDPEFNSFRNINTPTDYYRLR
FT                   EIERGEALPAPADERAGASA"
FT   gene            817697..817876
FT                   /gene="fdnT"
FT                   /locus_tag="KN400_0761"
FT   CDS_pept        817697..817876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdnT"
FT                   /locus_tag="KN400_0761"
FT                   /product="twin-arginine translocation pathway protein,
FT                   TatA/TatE family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83624"
FT                   /protein_id="ADI83624.1"
FT                   /translation="MFGFGMPEMIIILVIALVVFGPGKLPQLGQSLGASIRNFKKASLE
FT                   EPEKITVKEKDEHA"
FT   gene            818028..818222
FT                   /locus_tag="KN400_3423"
FT   CDS_pept        818028..818222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_3423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_3423"
FT                   /db_xref="EnsemblGenomes-Tr:ADN78319"
FT                   /protein_id="ADN78319.1"
FT                   /translation="MWRKIKSTNKSSCLRCVAWLVEAMMHTCKKVIAIMTQGLLFLRQK
FT                   YTVQIDKTMQCEEKVYIIH"
FT   gene            818433..819536
FT                   /gene="hybS"
FT                   /locus_tag="KN400_0762"
FT   CDS_pept        818433..819536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hybS"
FT                   /locus_tag="KN400_0762"
FT                   /product="periplasmically oriented, membrane-bound
FT                   [NiFe]-hydrogenase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83625"
FT                   /protein_id="ADI83625.1"
FT                   /translation="MGKEAVLRGGVSRRDFMKTCVAATAIMGLPYSMHTKVAEAAQKAG
FT                   RPPVIWLHFQECTGCSESLLRSGHPDVSELILDMISLDYHETLMVGSGHQAEQSLHDSM
FT                   KANHGKYILVVEGGIPTKDNGIYCKVGGKTAVDSLTTAAEGAAAIITIGTCASYGGIQS
FT                   APPNPTGAVGVRDLIKNKPIVNIPGCPPNPYNFLSTVLYYLTFNKLPELDALGRPKFAY
FT                   GRKIHEHCERRPHFDAGRFATAYGDKTHAEGYCLYKLGCKGPATFANCSVTRFNDVGVW
FT                   PVSVGHPCIGCTEPDILFKKPIAEKLQIHLPTPPDTYAPAELGQKGPGVSPAATGLVGL
FT                   AGGVALGAGAMLAKKLPSGEEGHEKHD"
FT   gene            819520..820437
FT                   /gene="hybA"
FT                   /locus_tag="KN400_0763"
FT   CDS_pept        819520..820437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hybA"
FT                   /locus_tag="KN400_0763"
FT                   /product="periplasmically oriented, membrane-bound
FT                   [NiFe]-hydrogenase, iron-sulfur cluster-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83626"
FT                   /protein_id="ADI83626.2"
FT                   /translation="MKSTTRRDFLKMMGMTGAACLACAAPLSASTGPAGESETAIAMLY
FT                   DATKCVGCKACMAACKRVNMEQNNLSYEYLPTDGDKLWDAPKDLSGDTRTVIKLYKESD
FT                   TRFSYVKHSCMHCTKPGCVSACPVKAMTKDPVTGVVAYNKNACIGCRYCQVACPYNIPR
FT                   FQWDKALPQIVKCDFCKDTNLKAKGMPACSETCPAGAIAFGKRTDLLAEAHNRIKENPD
FT                   RYIPKVYGEKEVGGANHLYLAAFPFQKLGLPELKEESPAAFSEHIQHTIYKGFIAPVAL
FT                   YGTLAAIALRNKKKQEDLGHGEDD"
FT   gene            820439..821767
FT                   /gene="hybB"
FT                   /locus_tag="KN400_0764"
FT   CDS_pept        820439..821767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hybB"
FT                   /locus_tag="KN400_0764"
FT                   /product="periplasmically oriented, membrane-bound
FT                   [NiFe]-hydrogenase, cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83627"
FT                   /protein_id="ADI83627.1"
FT                   /translation="MGSHHDEYQVQPGKILTRPFFILLFFVLVGLALIAYRFFAGVGAV
FT                   TGLSDGYPWGIWIAYDVATGTAFACGGYALALLIYIMNRWKYHPLIRSAILTSVFGYCL
FT                   AGFSVMVDLGRYWNAYGFFMPSRWQGNSVMFEVALCVMSYSTVLIIEFLPAVLYTLEHS
FT                   KWKWVRESSHWLYARLIPDTDALRNGLTNVSKAAGHLQVRLDKVLIFFIVLGITLPSMH
FT                   QSSLGSMMIIAGEKLSPLWQTGFLPLLFLINCIFIGYSTVMFESILSSFGFKRAYEVHE
FT                   LSGIARIVPWVAGLWMAIRFGDLIWRNQIPTILTFDKNALFFLLEVLLIGGGAFMMLSR
FT                   KNRLSPRLLFLSGALLMLGGGLYRFNVYLIGFNPGEGWSYFPSVAEFLITVGIIAIEIL
FT                   GYLTLVKIFPVMPNPKKHFAEEGEEMVEETAGQVAPGGVYAGK"
FT   gene            821852..823534
FT                   /gene="hybL"
FT                   /locus_tag="KN400_0765"
FT   CDS_pept        821852..823534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hybL"
FT                   /locus_tag="KN400_0765"
FT                   /product="periplasmically oriented, membrane-bound
FT                   [NiFe]-hydrogenase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83628"
FT                   /protein_id="ADI83628.2"
FT                   /translation="MSKRITIDPITRIEGHLRIDVEVNGGQVAKAWSSAQMWRGIETIL
FT                   KGRDPQDAWSYAQRFCGVCTTVHAISSIRSVENALNVEVPLNAQYIRNIMIAQHSVQDH
FT                   IVHFYHLSALDWVDIVSALKADPKKASSIAQSLSDWPGNSEKEFKAVQDKLKAFVASGQ
FT                   LGIFASGYWGHPAMKLPPEVNLIAVAHYLKALDYQRRASQAVAILGGKNPHVQNLVVGG
FT                   VATAVNMENIATLNMERIAFLRTLMEETREFVQKVYYPDLVAIASFYKEWFKYGAGVTN
FT                   YLAVPEFAEDTRNTKFGLPGGTIYGGDLGTFKAITTHQDAALIQGVTEGVAHAWYEGSD
FT                   SLHPWEGETKPQYTDFQENGKYTWCKSPRYNGKPMQVGPPAQVMAAYATGHPKVKKLVD
FT                   DAAAKLGIGPKELHSTMGRLFCRGVRAHVMADYSLEYLDKLVANIGKGDSTYANHTEIP
FT                   DGEYKGVGFHEAPRGALSHWIVIEKKKIKNYQAVVPSTWNASPRDENGVAGPYEACLVG
FT                   NPVAQPDKPLEVLRTIHSFDPCIACAVHTIDPAGKEITKVKVL"
FT   gene            823579..824061
FT                   /gene="hybP"
FT                   /locus_tag="KN400_0766"
FT   CDS_pept        823579..824061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hybP"
FT                   /locus_tag="KN400_0766"
FT                   /product="periplasmically oriented, membrane-bound
FT                   [NiFe]-hydrogenase maturation protease"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83629"
FT                   /protein_id="ADI83629.1"
FT                   /translation="MRTLIFGAGNLILTDEGFGVHCINHLEENYVFPPEVELYDGGTLG
FT                   IMVTHKIEEADRVILVDTVETAGNPGEVFRFEKEDIMLNRLPVKLSPHQIGIQEMLFIS
FT                   EMRGACPDRISLLGVIPSSLDPGSDLSPVLSECLPRVAGLIVDELRSLGHEVHARN"
FT   gene            824120..824293
FT                   /gene="hybT"
FT                   /locus_tag="KN400_0767"
FT   CDS_pept        824120..824293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hybT"
FT                   /locus_tag="KN400_0767"
FT                   /product="twin-arginine translocation pathway protein,
FT                   TatA/TatE family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83630"
FT                   /protein_id="ADI83630.1"
FT                   /translation="MFGFGMPEMIIILVIALVVVGPSKLPQLGQALGSSIKSFKKGMNE
FT                   DEVKVINKTNEA"
FT   gene            824328..824525
FT                   /locus_tag="KN400_0768"
FT   CDS_pept        824328..824525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0768"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83631"
FT                   /protein_id="ADI83631.1"
FT                   /translation="MLTVIIGAVALFAAGVLFSLPEVHHVYGFGGIALGALLACTTLLA
FT                   ETRALSDFWSRFRPRGGGEV"
FT   misc_feature    complement(824648..824691)
FT                   /note="palindrome; KN400_R0153"
FT   gene            complement(824707..825084)
FT                   /locus_tag="KN400_0769"
FT   CDS_pept        complement(824707..825084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0769"
FT                   /product="response regulator, putative"
FT                   /note="domains: REC"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83632"
FT                   /protein_id="ADI83632.1"
FT                   /translation="MFGGSVLICDDEEGMLRYLKKMIEAAGLRVETFGNGTSLLARIEG
FT                   GDPGDASLLLQDMRLPDADGLEILHRVKELRPALPVVMMTAYACDEVVRAAFDGGASDF
FT                   LPKPFTREAVLGVIRTTTAEH"
FT   gene            complement(825298..826218)
FT                   /locus_tag="KN400_0770"
FT   CDS_pept        complement(825298..826218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0770"
FT                   /product="protein of unknown function DUF2860"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83633"
FT                   /protein_id="ADI83633.2"
FT                   /translation="MRIVLAFLFCAVVALPAWGAGFTGRVDGGVLAVAKADNLWGRGKN
FT                   HIDSIHAKPKTVTHLYPIALVDLRYRAEGSANEFFLSTPPDEAGSVALGLKRTLGFGTA
FT                   TGALFYQFAGRVWENPYVTDREDTDNRIYGVRLGIEDMGPARLGITYRATLNDVDRDLI
FT                   GDLSPDLERDGSTHRLTLSGKIEASREITVTPSVSYERGAADGESNRYHSGEARLSVGW
FT                   RKGDLSLSGRVSGSYAGYDAVHPIYDQTRTEWGYGAGATASASNVAGLRNVSATLGVIW
FT                   EQTLANIDFFGTRSTLAFGTIGYSF"
FT   gene            complement(826366..826674)
FT                   /locus_tag="KN400_0771"
FT   CDS_pept        complement(826366..826674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0771"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83634"
FT                   /protein_id="ADI83634.1"
FT                   /translation="MKFPRLVPSKIKRHGLLLDRPASDPLPCKTCDGACCRAFPSVPIS
FT                   WPEYERLHALGATRLHFSLTGRHLLLIENGCEFLADGRCAIYPDRPDVCRRFICEEC"
FT   gene            complement(826804..827574)
FT                   /locus_tag="KN400_0772"
FT   CDS_pept        complement(826804..827574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0772"
FT                   /product="protein of unknown function DUF833"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83635"
FT                   /protein_id="ADI83635.1"
FT                   /translation="MCLILFALDAHPRYRLVLAANRDEFYARPTAPAAFWDDAPQVLAG
FT                   RDLTAGGTWCGVTRDGRIAAVTNYRDPGAHRVGARSRGELVAGFLSGDEAPSRWLEHLQ
FT                   RNGHDYNGFNLIFGDGNGLHYHSNRGAAASPLSPGIHGLSNHLLDTPWPKVARGRDALA
FT                   RLLATADEPAVDDLFAILANRTPAPDHLLPDTGVSLDWERLLSPLFITSPTYGTRSSTV
FT                   ILVDRSGQCTFVERSYNGAADHPRTVEYRFEVIT"
FT   gene            complement(827630..828184)
FT                   /locus_tag="KN400_0773"
FT   CDS_pept        complement(827630..828184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0773"
FT                   /product="NosL family protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83636"
FT                   /protein_id="ADI83636.1"
FT                   /translation="MRQFRKLFCLALSLTMTIVVFTAGVGAASSHGKDVSAHKSCQYCG
FT                   MDREKFAHSRMLIEFEDGTTVATCSLHCVAVDLANNIDKAPKSIMVADYSTKQLIDAEK
FT                   AYWVIGGSKQGVMTRNAKWAFAAKDAAEAFIKENGGRPASFDEAIKSAYEDMYSDTKMI
FT                   RDKRKQMKMKRDGHAKGSDMK"
FT   gene            complement(828313..829995)
FT                   /locus_tag="KN400_0774"
FT   CDS_pept        complement(828313..829995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0774"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase family protein, rhodanese homology
FT                   domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83637"
FT                   /protein_id="ADI83637.1"
FT                   /translation="MKMSIVVIGANAAGAKAASKAKRINPTAEITLIDRGTFISYGACG
FT                   IPYFVSDTVEDVKELMSTPVGVVRDHQFFRKVKGVTVKTATEVIAIDRAAKTVCMRDCQ
FT                   TSRETKLPYDRLVLATGSTPFIPQISNVNLANVLTVKSIEDAELLKSLAVPGTRACIVG
FT                   GGLIGLETAEALRHKGLQVAVVEMRDQMLPGVLDWEMAALVEKQLRQQGVTVMTGSAVT
FT                   GLVGDAAVEAVQIGDVRIPADLVVLAPGVAPNVELARGAGLEIGPTGAIAVDTRQCTTD
FT                   PDIYACGDCCETTHLITGKKVFIPLGSTANKQGRVAGINAAGGEATFAGVIGTSILRVF
FT                   AVNAGKTGLTEAEAKAHGFEVETVLSPSHDKAHFFPGAKPIILKLVAERGTGRILGLQA
FT                   VGEGAVDKRLDAAATAITFGATAEQVAQLDLAYAPPYSAAMDNLIVAADILKNKLAGHA
FT                   RGITPREVKRKFDEGDDFILLDVRSPAEHNAVGIEGAKLIPLGMLREKLEELPRDKEII
FT                   AFCKISLRGYEAQKILDAAGFRNAKFMDGGILAWPFALRTSDK"
FT   gene            complement(830058..830366)
FT                   /locus_tag="KN400_0775"
FT   CDS_pept        complement(830058..830366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0775"
FT                   /product="rhodanese homology domain superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83638"
FT                   /protein_id="ADI83638.1"
FT                   /translation="MRSNELLKRRKANNPPTVIDVRTGFEFKAGHVPGAVHAPAWKILL
FT                   MLARLPADKSAELVVTCEHGPRAQMAKGLLGLYGYRNVELLDGHMSAWRQAGHPLEK"
FT   gene            complement(830376..830609)
FT                   /locus_tag="KN400_3424"
FT   CDS_pept        complement(830376..830609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_3424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_3424"
FT                   /db_xref="EnsemblGenomes-Tr:ADN78320"
FT                   /protein_id="ADN78320.1"
FT                   /translation="MSRRAFRGMYHHFPPTSLQYTKQPRPYRVAPDGRGRVRAQAIRDI
FT                   WSVCMPRRLHCRPAVFILNLCRYYEIDFPPEI"
FT   gene            complement(830809..831282)
FT                   /locus_tag="KN400_0776"
FT   CDS_pept        complement(830809..831282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0776"
FT                   /product="long-chain acyl-CoA thioesterase, BFIT_BACH
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83639"
FT                   /protein_id="ADI83639.1"
FT                   /translation="MTHATETHHREWTLIETLLPQDTNPAGSIFGGVIMGLMDKAAAIA
FT                   AWRYTRREVVTAGAEHISLLRPVRLAEVVKVEARVVCTGRTSIDVDVVVETENVLTGES
FT                   AVAATGFFTMVALDKEGKPTEVPRWEPRTEEERRLCETARERRAQRVRTSEQR"
FT   gene            complement(831298..831906)
FT                   /locus_tag="KN400_0777"
FT   CDS_pept        complement(831298..831906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0777"
FT                   /product="membrane protein, MarC family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83640"
FT                   /protein_id="ADI83640.1"
FT                   /translation="MSIYANFFVAIWLKFFFLLTPFFVMSVFLSMTQEIAPRDRRRLAL
FT                   KVTVAVLVACFTLFFFGNHLFSLFGITIDSFRIGAGALLFLSAVQMVQGDAAVSPSDRQ
FT                   GDISVVPLAIPVTVGPATTGALLVMGAELQGAWQTVIGCAALAAAVLCIGALLGSAASI
FT                   EHVIGKRGITILSKLTGLMLAALAAQIVFTGIKSFLAIH"
FT   gene            complement(831908..832681)
FT                   /locus_tag="KN400_0778"
FT   CDS_pept        complement(831908..832681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0778"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83641"
FT                   /protein_id="ADI83641.1"
FT                   /translation="MSDVKPLIQLENITKRFKSLTAVNGVNLAVHPGEKLVIIGPSGSG
FT                   KSTLLRSINFLEEIDEGTIRFEGNEVGYVRRHGKLHLDKQPVICALRAEIGMVFQHFHL
FT                   FPHMTVLGNVMEGPLTVQKKSAAESREIALAMLAKVGLTDKKDVYPATLSGGQKQRVAI
FT                   ARAIAMRPKLMLFDEPTSALDPELVGEVFDTIHALADEGMTMIIVTHHMGFARELADRV
FT                   IFMEKGNFLAEGTPQEFFAEGMNNERIQSFLNRIL"
FT   gene            complement(832668..833690)
FT                   /locus_tag="KN400_0779"
FT   CDS_pept        complement(832668..833690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0779"
FT                   /product="ABC transporter, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83642"
FT                   /protein_id="ADI83642.1"
FT                   /translation="MNLKPYTLGRVATALLFLWITTATALASEADYDALFREANDLMGA
FT                   GDLPAAMEVLKKVPAPRAGEEGDAFVRSRMQIAKLHFAAKEMDEALAAAREVLSLYPDN
FT                   SEAKNFTASVEREKKPGYVTFLQDCLKFLPVLLKGAVMTLLLVLCTMFISPIGGLLIAL
FT                   GRISTFRPLSALCWFVIWLFRGTPLLLQLFFIYYGLPSLGITLKPITAAVIGLGLNYSA
FT                   YLGEIIRGAIQSIDHGQTEAAKALGMTYGQTMRRVVIPQTYKRLMPPIGNEFIALIKDT
FT                   ALVSTIAMVELMRAADQMFNTYFNVTALILAAVIYLIFTTFFTFLFEKIEHRAGIYERR
FT                   "
FT   misc_feature    complement(833653..833838)
FT                   /note="conserved nucleotide sequence; KN400_R0064"
FT   gene            complement(833827..834618)
FT                   /locus_tag="KN400_0780"
FT   CDS_pept        complement(833827..834618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0780"
FT                   /product="amino acid ABC transporter, periplasmic amino
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83643"
FT                   /protein_id="ADI83643.1"
FT                   /translation="MKKLVLLMVSALLVAFAATAFAADGSWNRVKSAGKLVIGLDDAFP
FT                   PMGYRDASGKLIGFDIDAAEEVGKRLGIKIEWQPTAWDGVIHSLNSKKFDAIWNGMTIT
FT                   DERAKQVAFTKPYIMDGQIAVVKFSEKRFKKIADLKNVKIGAQKGSSALNAVKKLPTAP
FT                   AELKEYEDNPKALLDLEAGRIDVVVIDNVTGRDFIAKRPGQFKVVPGFISKEPFGVAFR
FT                   KEDKELREKVQKTLDKMVKDGSLAKISRKWFAEDITNPKKW"
FT   gene            complement(834813..836246)
FT                   /locus_tag="KN400_0781"
FT   CDS_pept        complement(834813..836246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0781"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83644"
FT                   /protein_id="ADI83644.2"
FT                   /translation="MKMPRSGRTLMFHAAALALAMAPVAAAAAAGENGGDGKGRRYQLC
FT                   RFDENWSYLRAPSRSDDLWDPVKYLPLTSSGDAYLSLGGDARLRYEYFNNANWGRGPQD
FT                   NDGYLLQRYLVHADLRLTDAARLFAQLQSSLEEGRSGGPRPTDEDQLDLHQLFVDATPA
FT                   VGDTRPLTVRVGRQELTFGSSRLVSVRESPNNRRSFDGVRIIGRVAGMRLDAFATRPVE
FT                   TKPHVFDNRSDDAQAFWGAYGVAPLPVLPGGSIDLYYLGLYRRGARFDQGRARETRHAG
FT                   GTRIWGAAGAWDYNAEFVFQWGSFGNGRIRAWTAASDTGYTLRNAPWQPRLGLRANIAS
FT                   GDSDPTDRTLGTFNPFYPKGNYFSEAGLMGPANLMNLHPEITVKPARNLSMRLDWDVIW
FT                   RHSRHDGIYANSLSVVRSGTTGGSRSVGSQLQCQVDWQVDRHLLLTANYSRFFAGPFIR
FT                   ESGPGKDVDYVGTWATYRF"
FT   gene            complement(836568..837284)
FT                   /locus_tag="KN400_0782"
FT   CDS_pept        complement(836568..837284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0782"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83645"
FT                   /protein_id="ADI83645.1"
FT                   /translation="MSLNDAKVVVIGGSSGMGLAVAKMAADEGARVVIAGRSEEKLRQA
FT                   ADEIRQPVETRSLDVTQEQAVQAFFVETGELDHLVVTAATGVAGSFLELETPSFRQIFD
FT                   SKFWGQYFAARYGAQRIREGGSITFFSGVAAAKPVDGLSAYAAVNGAVEALCRSLAVEL
FT                   APLRVNAVSPGIVDTPAYAGMSPAERKRMFDALAARLPARRIGRPEDVAAAVISLMKNG
FT                   YVTGSVVYVDGGHRLV"
FT   gene            complement(837287..839704)
FT                   /gene="ppsA"
FT                   /locus_tag="KN400_0783"
FT   CDS_pept        complement(837287..839704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppsA"
FT                   /locus_tag="KN400_0783"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83646"
FT                   /protein_id="ADI83646.1"
FT                   /translation="MSWIRWFSEITIDDVPLVGGKNASLGEMFGELRPLGVRIPNGFAI
FT                   TAEAYWHLIRSAGILEEMKQALAELVKEDVDDLALRGRRLRELVYGAPLPGELAEEIRE
FT                   AYRGLCAEYGDNCDVAVRSSATAEDLPTASFAGQQETYLNVRGEAQLLDACRRCFASLF
FT                   TDRAISYRIDQGFDHFKVGLSVGVMKMVRSDLASSGVIFTLDTETGFRDTVLITGAWGL
FT                   GENVVQGAVNPDEFTVFKPALRQGFRPIVRRRLGEKKIRMIYGTGTSKHLTKNVEVPRE
FT                   ERRRFCLSDDEVLELARQALMIESHYEKRAGREMPMDIEWAKDGESGRLFIVQARPETV
FT                   ESRKRLDFLETYILEQKGEVLATGTSVGGKIAAGPARVITDIHKLGDFSPGEVLVADTT
FT                   TPDWEPVMKTAAAIVTNKGGRTCHAAIVSRELGIPSVVGTGDGTERIASNREITVSCAE
FT                   GEVGRIYSGELPFRVERVDLAGMRRPHTRIMMNLGNPEEAFSLCRIPNDGVGLARMEFI
FT                   ITNHIKIHPMALVHPLRVEDEASRREIARLTAGYADPPAYFVEKLAEGIGTIAAAFHPK
FT                   PVIVRMSDFKTNEYASLLGGRAFEPDEENPMIGFRGASRYYDERYREGFALECRALKRV
FT                   RDEMGLVNVIPMIPFCRRIVEAEKVLAEMAANGLVRGENGLEVYVMCEIPNNVIMIDEF
FT                   SRLFDGFSIGSNDLTQLTLGVDRDSALVAHVFDERDPGVMELIGRVVEGARRNGRHSGI
FT                   CGQAPSDYPEFAAFLVEQGIDSISLNPDSILKITMRVLEMEEQLAQQGNKRS"
FT   gene            complement(839726..840337)
FT                   /gene="wrbA"
FT                   /locus_tag="KN400_0784"
FT   CDS_pept        complement(839726..840337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wrbA"
FT                   /locus_tag="KN400_0784"
FT                   /product="NAD(P)H:quinone oxidoreductase flavoprotein WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83647"
FT                   /protein_id="ADI83647.1"
FT                   /translation="MNVLIVYYSMYGHIHRMAEAVAEGVREVPGAEAVLRRVPETLSPD
FT                   VLEKMGAVEPQKAFAHIPVATVDELASADAIIFGTPTRFGNMCGQMRQFLDATGGLWVK
FT                   GSLVGKAAGVFTSSATQHGGQESTILTFHTFLLHQGMVIVGLPYAFAGQTRIDEITGGS
FT                   PYGASTIAGGQGERLPSENDLAGARFQGRYVAQIAAKLNG"
FT   gene            complement(840426..840818)
FT                   /gene="fxsA"
FT                   /locus_tag="KN400_0785"
FT   CDS_pept        complement(840426..840818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fxsA"
FT                   /locus_tag="KN400_0785"
FT                   /product="cytoplasmic membrane protein FxsA"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83648"
FT                   /protein_id="ADI83648.1"
FT                   /translation="MLLRLFLIFSVVPIIELYLLIRVGKLIGALPTVALLLVVSLAGAW
FT                   LVRSQGFVILRRIQDELAMGRLPAAGLLDGALVLLGGLLLLTPGFFSDVVGLFFIIPPT
FT                   RAVIKQFLGLWLQNRLARGQFVIRRF"
FT   gene            complement(840862..841746)
FT                   /gene="citG"
FT                   /locus_tag="KN400_0786"
FT   CDS_pept        complement(840862..841746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citG"
FT                   /locus_tag="KN400_0786"
FT                   /product="2'-(5''-triphosphoribosyl)-3'-dephospho-coenzyme
FT                   A synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83649"
FT                   /protein_id="ADI83649.1"
FT                   /translation="MNSSRIFEIEQFAQSLVKGGAMALYLTPKPGLVDMANQGSHPDLT
FT                   LDKMERSLHILGDYLAELIRSLTDGERFLCQAVIGRRAEEVMMEELGSNTLKGYFFLSG
FT                   LLLVARWRCDSDDEKRLSRAVSELGEEFFALRREQATNGHSARSRFGTGGVVHEVLDGL
FT                   PSLFTCAVPVYLAAIERTGCFTSASFAMLARLMQTVDDTTTLHRCGTMGLARLRRDGQT
FT                   LERLIAEGGDPVAFLTELDRKYVRMNLTMGGVADVLGLAYGYLVATGRLAGASETTRSR
FT                   NSKPRLRLCMGDA"
FT   gene            complement(841718..842233)
FT                   /gene="citX"
FT                   /locus_tag="KN400_0787"
FT   CDS_pept        complement(841718..842233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citX"
FT                   /locus_tag="KN400_0787"
FT                   /product="apo-citrate lyase
FT                   2'-(5''-triphosphoribosyl)-3'-dephospho-coenzyme A
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83650"
FT                   /protein_id="ADI83650.2"
FT                   /translation="MDVPSKTWRGCAVLSPGLSARRQDVLSLYLDAGYPTTLILSLATP
FT                   EGGLDDRLEAALSITFRNLVKVLPELLNLKKSGDKDDTYAIMHVPLDAIEVKRRCIALE
FT                   MGTPFSQLIDLDVYDGSGTRISRALLGLTPRPCLACGQRAADCIRHRHLTPAEIPGRLH
FT                   ELLAHLRD"
FT   gene            complement(842455..843417)
FT                   /locus_tag="KN400_0788"
FT   CDS_pept        complement(842455..843417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0788"
FT                   /product="diguanylate cyclase, CAP_ED domain-containing"
FT                   /note="domains: CAP_ED, GGDEF"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83651"
FT                   /protein_id="ADI83651.1"
FT                   /translation="MSRNHLPFSAGELEALPLFRFVPLECIEGILEHSCVVSLERGERF
FT                   EPAGPLGRTIHLILDGRLALYYDVRERDDTPLHLERGDIVGQSLVSGEPEVPCTLVAAE
FT                   ETRLMILEEDLIWSLAQASHAAACNLLGILLRGRGGSPQESFSGTVRDYALRNQAVVDP
FT                   LTGFQSRRWLEGILSRQVDRFTANGRPLSLVMIDIDGFRAFNERHGRAGGDRALHDVAK
FT                   TLRNSLRPGELVARYGGDTFAVLLPETEPSTAWMIADRLRQRLMRTVIDMGDGAMLPPL
FT                   SISAGVAEATPGIDGPTIADNALAALDRAKAAGGNTVSR"
FT   gene            complement(843440..843985)
FT                   /locus_tag="KN400_0789"
FT   CDS_pept        complement(843440..843985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0789"
FT                   /product="carbonic anhydrase, beta-family, clade D"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83652"
FT                   /protein_id="ADI83652.1"
FT                   /translation="MTLLDTILDANRKFVRPGAFPPLAKNPKKQFAIFTCMDTRLVDFL
FT                   EPAMGIRRGDAKVIKNAGNTIVDPISGGVIRSLVAAVFMLGVEEIFVIGHRDCGMAAVD
FT                   SGDLRQRMVARGIDPSVIEAQVPDLAQWMGAFSCPEENVARVTSVIRQNPLIPRDVPVH
FT                   GLIFCPNDGHLEVIVRGY"
FT   gene            844179..845579
FT                   /locus_tag="KN400_0790"
FT   CDS_pept        844179..845579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0790"
FT                   /product="peptidoglycan-binding outer membrane protein,
FT                   OMP_b-brl, OmpA and OmpA domain-containing"
FT                   /note="domains: OMP_b-brl, OmpA, OmpA"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83653"
FT                   /protein_id="ADI83653.1"
FT                   /translation="MKVRTIVGVAFAVALLVASTAAAENRAGFFSLSPYFGGYTFDGEQ
FT                   HIRTAPTFGIRGGYNLTPTWGVETVFGFSPAEETKGSQVDVDSYTYRLEGLYHFMPESS
FT                   LVPFLAVGAGGTTLDYAAGSNGRDRTDGILTYGGGVKYFITDVVAVRGDVRGIFDLGYS
FT                   YSNVEYTVGLSYLFGGAAPAARAVPAPQAAPAPPAPEPAPVVEPEPAPLPMAAEPTPGL
FT                   MKYCITLNIEFDIDKADVRPQYHDEVKRVADFLKEYPSTTAVIEGHTDNVGDDAYNMRL
FT                   SQRRAESVVNYLVDNFGIDRTRLSARGFGKTRPIADNSTEAGKQRNRRIEAIIDCALED
FT                   PKVIAALPDRLCIALKVQFDTDKWDIKPQYRGEIAKVGDFMTRNPTTTAIIEGHTDRVG
FT                   TADHNMKLSLRRAEAVVNYLVEHFGIERSRLSAKGYGFSRPIAYNSTAEGRALNRRINA
FT                   IIDCVIKK"
FT   gene            complement(845655..847025)
FT                   /locus_tag="KN400_0791"
FT   CDS_pept        complement(845655..847025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0791"
FT                   /product="sigma-54-dependent transcriptional response
FT                   regulator"
FT                   /note="domains: REC, sigma54 interaction, HTH8"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83654"
FT                   /protein_id="ADI83654.1"
FT                   /translation="MNETILVVDDEQDIRTALAGILEDEGYRTAFARDGVEALETVQKD
FT                   RPDLVLLDIWMPRLDGMETLQRLKTADPGLTVVMMSGHGTIETAVKSTKMGAFDFIEKP
FT                   LSLEKILVTVRNGLDAGRLRAENDSLRALSFRGHEIMGESEAMGRLREQVRLAGPADAP
FT                   VLITGENGAGKELAARSLHYHSPRRDRPFVELDCAALPEELIESELFGHEKGFAGAATQ
FT                   KKGKLDLANGGTMFLDEIGDMPPRAQAKLLRLIQERKFERAGGTRSIEADVRIMAASTR
FT                   NLEEEVRAGRFSPDLFYRLNVVSLAVPPLRERQDDIVPLVEHFLDIFARREGQERKTMP
FT                   PEALAILARHDWPGNVRELRTIVERLVIMTPGRVITPDSIPPSIGEGAGREGVLPRSEA
FT                   ALEPSSLREAREEFEREFIIQKLEEYGWNISRTADAIELERSNLYRKMKSYGIDAKK"
FT   gene            complement(847036..849282)
FT                   /locus_tag="KN400_0792"
FT   CDS_pept        complement(847036..849282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0792"
FT                   /product="sensor histidine kinase, HAMP and PAS
FT                   domain-containing"
FT                   /note="domains: HAMP, PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83655"
FT                   /protein_id="ADI83655.1"
FT                   /translation="MDKRTTDSTPTATPAERERIKRRREGIVIALSVLLILILTRVEIH
FT                   LSRISSDVPMGSNFLIFGVINVIILLIILLIYLLFRNVAKLLMERRGKALGANLRTKLV
FT                   IAFVSLSIIPTMLLFFVSATYVNQSIRNWFNTQIENSLSESLEVAQTYYKNSAANALYY
FT                   GNQISAIIRDQRLLNDENLPRMKELIRQKQKEYNLGIVEVYSAQNEELVRAANPGLPLG
FT                   EFTNPSSEDIKQGLNGKELTRVNTVGKADLIRGIVPIYSTYRADEVVGAVVVNYFVPYS
FT                   LVEKMREITASYEQFRQLKILKNPIRSGYILALFLITMVIIFLAVWFGLHLANSLTTPI
FT                   QELAEATRQVAEGNLNIRLGQRTDDELGMLVAAFNKMTDDLRSNQLALKNANDELSRSN
FT                   QELEQRRRHMEIVLRNVAAGVIAVDRGGTITTINPSAARLLQIDMPRAVGHNFREVLKG
FT                   EQLDIVKGVLRDMVMAKKDSISRQITVPVRDSRATFLFNLSVLRDESGEFLGTVVVFDD
FT                   MTQLIKAQRMAAWREVARRIAHEIKNPLTPIQLSAQRLRKRYLPRFGDEDRVFDECTAM
FT                   IVKSVDELKTLVDEFSNFARMPAAHPSPNDLNAVIREAVTLFREGHRGVAFGFSADDRL
FT                   PLLQLDRDQIKRVFINLLDNAVAAMGGTGEVRIMSRFDPELKMAVVTVADTGPGIPPED
FT                   KTRVFEPYFSTKASGTGLGLAIVSSIITDHHGFIRVRDNEPRGTKFVIELPVTG"
FT   gene            complement(849438..850040)
FT                   /locus_tag="KN400_0793"
FT   CDS_pept        complement(849438..850040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0793"
FT                   /product="organic solvent tolerance ABC transporter,
FT                   periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0793"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83656"
FT                   /protein_id="ADI83656.1"
FT                   /translation="MKWILLPILFVTLAVSGTALAQPSPTETVKKTVDDVIKIVSDKEL
FT                   KKPQNEKRRRQEIKRAIGTVFDSAEMAQRAMARHWRDRNAAEKKEFVDLFENLLENSYA
FT                   GKIESYNQEKVVYLKEAIDGDYAEVRSKIVTARRDEYSLDYRLMLKGGKWVVYDIVIEG
FT                   VSLVSNYRTQFNKIITNQGYAELVKKLRSKNKEISMP"
FT   gene            complement(850062..851420)
FT                   /locus_tag="KN400_0794"
FT   CDS_pept        complement(850062..851420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0794"
FT                   /product="efflux pump, RND family, outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0794"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83657"
FT                   /protein_id="ADI83657.1"
FT                   /translation="MKALRRTALALAVTLLPLAAAWGADAGAGTKLTLDDCIKKALTAA
FT                   PELGEAQADIDATSAKLDEAKAHRYPQIEFLGLIGPVPQARGNQVYSPDGINDTERWTW
FT                   FQRGDATLVQPLYTFGKISENMKAASHGIEVDRAKKDQKGTDVALQVKEYYYGILLARE
FT                   LRELVLETRDILDDAKTKARKLIDKGSPNADELDIYKLDAFRGEVAKYLEEATKGEQLA
FT                   LAALKTRMGLSPAEAVDIDAERLQPAGATLGDLTAYVEEARTRRPEFRQLNEGIKAREA
FT                   LVEAAKANYWPDLFLGGYVSAAYADKRTRIDNPFVPDDFNHVWAGIALGVKWKLDFGIT
FT                   GAKVAGERAQYNRLLSTKAYADEFIPLQIRKAWLEAREAEASATAMKEAYTNAKRWVVA
FT                   SVANYDFGVGPAQEIFDGLQNYARMRAAYFQAIYNQNMALARLDHAVGQAPLN"
FT   gene            complement(851466..851915)
FT                   /locus_tag="KN400_0795"
FT   CDS_pept        complement(851466..851915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0795"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein, MCE family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83658"
FT                   /protein_id="ADI83658.1"
FT                   /translation="MKRVTLELIVGIFVLVGIICLAWLSVRLGQMELLGGDHYQVSADF
FT                   DSVSGLKKGATVEIAGVEVGRVDRIELDSSNDRARVYLRIRDGVKLQDDVIASVRTSGI
FT                   IGDKFIKLKPGGADKLLADGGRIRDTESTVDLEELLSKYIHGNVE"
FT   gene            complement(851928..852674)
FT                   /locus_tag="KN400_0796"
FT   CDS_pept        complement(851928..852674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0796"
FT                   /product="organic solvent tolerance ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83659"
FT                   /protein_id="ADI83659.1"
FT                   /translation="MIRLVDVHKSFGSQVVLDGLTMEIPEGKITAVIGPSGEGKSVLLK
FT                   HMIGLMKPDRGEVFVEGENITTMRRYQMNRVWEKFGMLFQNAALFDSLTVFENVAFPLE
FT                   EKTHLSRSEISDRVHDALEHVGLRNVDKKFPDELSGGMKKRVGLARALLLNPRIILFDE
FT                   PTTGLDPIICRAIHELIRETHERFGYTAVIVSHEIPEIFDISENVAMLYRGKIIEQGTS
FT                   EDIRRSEHPVVRQFISGSLEGPIQFI"
FT   gene            complement(852678..853451)
FT                   /locus_tag="KN400_0797"
FT   CDS_pept        complement(852678..853451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0797"
FT                   /product="ABC transporter, membrane protein of unknown
FT                   function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83660"
FT                   /protein_id="ADI83660.1"
FT                   /translation="MLVSSIEKIGALTLFVVREMGKMLIFLTYALVNIVIRPGKPIHIY
FT                   KQIHFIGAKSLFVIVLTAAFTGMVLGLQGYYTLAKFGSEGMLGSAVALSLIRELGPVLS
FT                   ALMVVGRAGSAITAEIGIKKITEQIDALKTMALEPFKYLVSPKILAALIALPLLCAIFD
FT                   VVGIYGGYVVGVKLLGVNPGAYFSEMERSVEWKDVWSGIVKSFSFGGIIAWVCCYKGYH
FT                   ASHGAEGVSRATTEAVVMSSVLVLIWDYFLTSVML"
FT   gene            complement(853553..855178)
FT                   /locus_tag="KN400_0798"
FT   CDS_pept        complement(853553..855178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0798"
FT                   /product="aldehyde dehydrogenase family 11 protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83661"
FT                   /protein_id="ADI83661.1"
FT                   /translation="MSIAERIPTFFPSPDEIPPQQLLSAPVELRDYLLNGELRHWQGAV
FT                   QDVFSPVCVRTPGGPERVRIGSFPLMGEADAHAALDAATAAYDCGRGRWPTMGVADRIR
FT                   HVQHFASLMKEQREAVVRLIMWEIGKTRSDAEKEFDRTVVYITDTIDALKELDRVSSRF
FT                   VIEQGIIGQIRRGPLGVALCMGPYNYPLNETFTTLIPALIMGNTVVMKPPRHGVLLFAP
FT                   LLAALREAFPPGVVNVLLGAGRALTPTLMRSGRIDVLAFIGTSKAANTLLKDHPRPNRL
FT                   RLVLGLEAKNPAIVLPDADLNLAVEECLAGSLAFNGQRCTALKLLFVHESVAQQFIALF
FT                   SRALSAIGTGMPWQAGVMITPLPEEGKTAYLEELLADASARGAAVVNEGGGTVTGTYFH
FT                   PALVYPVAPGMRLYTEEQFGPVVPIVPFTDIEEPIRAIRESDYGQQVSIFGRNSALLAP
FT                   LIDHLVNQVSRVNINSQCQRGPDVFPFTGRKDSAVGTLSVSDALRAFSLRTLVAARNHE
FT                   INKEIITDIVRERRSTFLSTDFIL"
FT   gene            complement(855289..855648)
FT                   /locus_tag="KN400_0799"
FT   CDS_pept        complement(855289..855648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0799"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0799"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83662"
FT                   /protein_id="ADI83662.1"
FT                   /translation="MEQYTRYSVGIVGATLVVFLAAAALMPGRATALEEDPSGMYRCMT
FT                   LSRDSDGDLNGDGAVTIQDALAALRIAVGQATPTDEQATRGDVYPRINGAPCPDGKIDL
FT                   RDVMAIVKKANGVQN"
FT   gene            855736..856494
FT                   /locus_tag="KN400_0800"
FT   CDS_pept        855736..856494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0800"
FT                   /product="FMN-dependent polypeptide cyclic thioester
FT                   oxidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0800"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83663"
FT                   /protein_id="ADI83663.1"
FT                   /translation="MGQPIITRDAGRYFLTDRIRHEVDWWNTPQARGEEPPPVQKPVAP
FT                   GAMVIPLPPPATWGIPPCSLADGIARRESRRRFRAVPLTPEELAFLLWATQGVRARLNE
FT                   AAVLRTVPSAGCRHPFETYLAILSVTGIEPAVYRYLPLDHALVLEREVPDLAATVTAAA
FT                   HGQRFAGEAAVTFVWTAIPARTEWRYAEASYKVIALDAGHVCQNLYLACEAIGAGTCAI
FT                   AAYRQALADELLEVDGREEFTVYLAPVGKV"
FT   gene            856539..857504
FT                   /gene="sppA"
FT                   /locus_tag="KN400_0801"
FT   CDS_pept        856539..857504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppA"
FT                   /locus_tag="KN400_0801"
FT                   /product="signal peptide peptidase SppA"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0801"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83664"
FT                   /protein_id="ADI83664.1"
FT                   /translation="MRMIIAFLLGCLGMFLTTGCAFVSVPLMSAPQPLAEQVLEGEGTK
FT                   KILIVDISGAIGDQAKGGGLLSRGTPSTVSLVREVLLKAERDPKVAGLILRINSPGGTV
FT                   TASDIIRHDLLAFKERRNLPVSACIMGIGASGGYYVATAADGITAHPTALTGSIGVLLM
FT                   TFNVEGLLGKVGVEEKTIKSGGKKDLLSPFRRATPEEERLVQGVIDQFHGRFVDVVQAR
FT                   PGNRLSRHDLLTLADGRIFSAADALAAGLIDRIGYLDDVIASLRDRIGDPDARVVTYFR
FT                   PGSYQGSIYAESAAEPSMADLLGGFDMTGGGQFMYLWRPW"
FT   gene            complement(857529..858137)
FT                   /locus_tag="KN400_0802"
FT   CDS_pept        complement(857529..858137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0802"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0802"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83665"
FT                   /protein_id="ADI83665.1"
FT                   /translation="MTHQIDELIRRIKELQEELETEFKQKREEFQFVIEEKRIRFAEEV
FT                   ARQQRRLKTGLFRYLIEARPLNILTAPIIYAGFIPFMALDLFLFIYQTICFPVYGIPKV
FT                   KRADYLIFDREDLPYLNIIEKFNCFYCSYGNGLAAYAREISARTEQYWCPIKHARRIKA
FT                   AHDRYPRFFEFGDAESFSKGLERLRQELEKEREQGEERR"
FT   gene            complement(858343..860532)
FT                   /locus_tag="KN400_0803"
FT   CDS_pept        complement(858343..860532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0803"
FT                   /product="sensor histidine kinase, Cache_1, HAMP and PAS
FT                   domain-containing"
FT                   /note="domains: Cache_1, HAMP, PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0803"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83666"
FT                   /protein_id="ADI83666.1"
FT                   /translation="MKLRTKLIILVSILVIILMVVTSRITLGYLERHLHDSIAAQQTST
FT                   VVHVATDVDSTLRSMLELLTASARVFPSAALTDPSGAKAFLESRTGLRTLFNNHLFVVD
FT                   AAGNLLAEVTNQEVRRVENFSDHAFFNKARATRKPLISELTTCCTGTVNLREIVFISPI
FT                   LGKNGSFKGALLGGIDLSEENALSRFGRITMGNEGFIRIIDRNHMVLIHAEREHTLIKA
FT                   VPEVARLVDAAREGYVGTRETKGRYGDILLTSVTKLGSKDWVVAASYPLAVAYEPVKVV
FT                   RRLFIISTVVAILGVLVVVSLSMQYLTRPILALERHINELSGKKGTERLVPVSNEDELS
FT                   RLTETFNTMLAEIDRQTESLRESEDRFRGAFEQAAVGMAIIDREGLLIRTNRRFCDITG
FT                   RHDDDLAGLDCLALVHPEDRNAAREIMPTMAATEGEPLTRELRFTHGTGRTVWANTAFS
FT                   PVRGRSGTDDSFIMVVEDVTERKRAEEEILRLNSDLEQRVADRTAALENANRELEAFSY
FT                   TVSHDLKAPARHISGIVDMVLEDWGGCMEPAHRELMERVAAAAGRMQSMIDGLLELSRV
FT                   GSDELRRQEVRPADLAREICIELTAAEPARRVDWSVKDVPPANADPELLMTVLENLLGN
FT                   AWKYTSRNERAEVEFGCEYCSGKHMYYVRDNGAGFDIRDAQRLFAPFQRFHPASEFEGN
FT                   GIGLATVARIIHRHGGTIRAESAPGQGATFYFSLS"
FT   gene            860848..861126
FT                   /locus_tag="KN400_0804"
FT   CDS_pept        860848..861126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0804"
FT                   /product="peptidylprolyl cis-trans isomerase, PpiC-type"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0804"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83667"
FT                   /protein_id="ADI83667.1"
FT                   /translation="MPTATARHILVSSEAECLQLKSEIEAGAEFADVARRHSLCPSRAQ
FT                   GGDLGTFTQGQMVKEFDDIVFSGEINKVLGPVRTQFGYHLIEITKRW"
FT   gene            861160..861582
FT                   /locus_tag="KN400_0805"
FT   CDS_pept        861160..861582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0805"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0805"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83668"
FT                   /protein_id="ADI83668.1"
FT                   /translation="MTELDKALTVLRQDMTDAKSQSAFYDLFLNATFYVPILDEAAEVE
FT                   DNAAQKGEVLPLVIEAEGNDYLMLFDTKERLQEWTQADARYVEVPGYVLAATTMPPLHW
FT                   ALNAGTEYSKQFLPDEIAWLRDVVERCNAAAAKQQG"
FT   gene            861695..862603
FT                   /locus_tag="KN400_0806"
FT   CDS_pept        861695..862603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0806"
FT                   /product="pirin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0806"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83669"
FT                   /protein_id="ADI83669.1"
FT                   /translation="MTARRISRVFKSRPTVEGAGVHIKRAFGYSQVPLFDPFLMLDDFH
FT                   TANPAEYLPGFPWHPHRGIETITYVLEGLVEHGDSMGNKGVIGAGDVQWMTAGSGIIHQ
FT                   EMPQPSPTGMMWGFQFWANLPADRKMMDPRYRDVKAADIPEVVLDRGIRVKIVSGTVNG
FT                   VQGPVRDIIIDPEMLDVSVPAGEVFTHPVKKGHTAVAYVLDGEGYFDDRRDPFAFEMTG
FT                   SGWMDVTRRCVCGPETVILYERDGAAVAVTAGDRPVRFLFISGKPLNEPVAWYGPIVMN
FT                   TNEELRTAFEEYEKGTFIKHR"
FT   gene            862749..862943
FT                   /locus_tag="KN400_0807"
FT   CDS_pept        862749..862943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0807"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0807"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83670"
FT                   /protein_id="ADI83670.1"
FT                   /translation="MLIRVQYPDGRYDYVKHTRLDDLIDSVKISRFLRSSGWVVIGEDP
FT                   VRRRGNRAPYVGPERRLAA"
FT   gene            863270..863659
FT                   /locus_tag="KN400_0809"
FT   CDS_pept        863270..863659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0809"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0809"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83672"
FT                   /protein_id="ADI83672.2"
FT                   /translation="MKAWPVRMRSSVLKKMIAVMLLVALVAIAGNGRCFALDAGNSLQP
FT                   SYGKAGETVLKSCCGEETPCCPTDNDSASDHCSTCFSCPCSAPLSSHGALVSYAPLIAS
FT                   ISFLEHRNAPPDVYLSIFVPPQILA"
FT   gene            863786..865093
FT                   /locus_tag="KN400_0810"
FT   CDS_pept        863786..865093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0810"
FT                   /product="efflux pump, RND family, outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0810"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83673"
FT                   /protein_id="ADI83673.2"
FT                   /translation="MVRASRFVSGVVHLFLTAVILAPLGASGEVRTLTLPQAVEYALAH
FT                   NGELKALRNEKDVARAGLERAVLLPNPTLELSADSGVMTGSPDETALSIGISQEFLTGG
FT                   KRAKRRAVAEREAEAVHFQIADRERQLSLEVKSFFSELILAQKRRELAGRAVELNGKLL
FT                   EITRERLAAGDIPELEVNLARVEVARSEGRKIEAEREFAPLLARLRTLLGVPTGEEIGF
FT                   DGIPEQRPLSIPLDELIRLALENRPDLKVFQATSAQGEAAVELAEAERIPNVTLGLGFT
FT                   HERSTDATGSGDEKTRDNLLGVTLSIPLPLFDRNQAGIREARAVRQGADNRLEFARSSV
FT                   PREIEGDYARLAAAEKTLMLYADGILPQLEDNLKLVQEAYRLGEVGILAVIEEQKKYIE
FT                   VNDDYLVALADRQAALARLEASVGTDFQNRTSGGAQ"
FT   gene            865090..866358
FT                   /locus_tag="KN400_0811"
FT   CDS_