(data stored in ACNUC17686 zone)

EMBL: CP002032

ID   CP002032; SV 1; circular; genomic DNA; STD; PRO; 2306092 BP.
XX
AC   CP002032; ACVK01000000-ACVK01000086;
XX
PR   Project:PRJNA33329;
XX
DT   30-MAY-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Thermoanaerobacter mathranii subsp. mathranii str. A3, complete genome.
XX
KW   .
XX
OS   Thermoanaerobacter mathranii subsp. mathranii str. A3
OC   Bacteria; Firmicutes; Clostridia; Thermoanaerobacterales;
OC   Thermoanaerobacteraceae; Thermoanaerobacter.
XX
RN   [1]
RP   1-2306092
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Held B., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Kyrpides N., Mikhailova N., Zhou J., Hemme C., Woyke T.;
RT   "Complete sequence of Thermoanaerobacter mathranii subsp. mathranii
RT   mathranii str. A3";
RL   Unpublished.
XX
RN   [2]
RP   1-2306092
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Held B., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Kyrpides N., Mikhailova N., Zhou J., Hemme C., Woyke T.;
RT   ;
RL   Submitted (11-MAY-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 6f15b363975d181cc95b3ee24eb3d9ad.
DR   BioSample; SAMN02598500.
DR   EnsemblGenomes-Gn; EBG00001107182.
DR   EnsemblGenomes-Gn; EBG00001107183.
DR   EnsemblGenomes-Gn; EBG00001107184.
DR   EnsemblGenomes-Gn; EBG00001107185.
DR   EnsemblGenomes-Gn; EBG00001107186.
DR   EnsemblGenomes-Gn; EBG00001107187.
DR   EnsemblGenomes-Gn; EBG00001107188.
DR   EnsemblGenomes-Gn; EBG00001107189.
DR   EnsemblGenomes-Gn; EBG00001107190.
DR   EnsemblGenomes-Gn; EBG00001107191.
DR   EnsemblGenomes-Gn; EBG00001107192.
DR   EnsemblGenomes-Gn; EBG00001107193.
DR   EnsemblGenomes-Gn; EBG00001107194.
DR   EnsemblGenomes-Gn; EBG00001107195.
DR   EnsemblGenomes-Gn; EBG00001107196.
DR   EnsemblGenomes-Gn; EBG00001107197.
DR   EnsemblGenomes-Gn; EBG00001107198.
DR   EnsemblGenomes-Gn; EBG00001107199.
DR   EnsemblGenomes-Gn; EBG00001107200.
DR   EnsemblGenomes-Gn; EBG00001107201.
DR   EnsemblGenomes-Gn; EBG00001107202.
DR   EnsemblGenomes-Gn; EBG00001107203.
DR   EnsemblGenomes-Gn; EBG00001107204.
DR   EnsemblGenomes-Gn; EBG00001107205.
DR   EnsemblGenomes-Gn; EBG00001107206.
DR   EnsemblGenomes-Gn; EBG00001107207.
DR   EnsemblGenomes-Gn; EBG00001107208.
DR   EnsemblGenomes-Gn; EBG00001107209.
DR   EnsemblGenomes-Gn; EBG00001107210.
DR   EnsemblGenomes-Gn; EBG00001107211.
DR   EnsemblGenomes-Gn; EBG00001107212.
DR   EnsemblGenomes-Gn; EBG00001107213.
DR   EnsemblGenomes-Gn; EBG00001107214.
DR   EnsemblGenomes-Gn; EBG00001107215.
DR   EnsemblGenomes-Gn; EBG00001107216.
DR   EnsemblGenomes-Gn; EBG00001107217.
DR   EnsemblGenomes-Gn; EBG00001107218.
DR   EnsemblGenomes-Gn; EBG00001107219.
DR   EnsemblGenomes-Gn; EBG00001107220.
DR   EnsemblGenomes-Gn; EBG00001107221.
DR   EnsemblGenomes-Gn; EBG00001107222.
DR   EnsemblGenomes-Gn; EBG00001107223.
DR   EnsemblGenomes-Gn; EBG00001107224.
DR   EnsemblGenomes-Gn; EBG00001107225.
DR   EnsemblGenomes-Gn; EBG00001107226.
DR   EnsemblGenomes-Gn; EBG00001107227.
DR   EnsemblGenomes-Gn; EBG00001107228.
DR   EnsemblGenomes-Gn; EBG00001107229.
DR   EnsemblGenomes-Gn; EBG00001107230.
DR   EnsemblGenomes-Gn; EBG00001107231.
DR   EnsemblGenomes-Gn; EBG00001107232.
DR   EnsemblGenomes-Gn; EBG00001107233.
DR   EnsemblGenomes-Gn; EBG00001107234.
DR   EnsemblGenomes-Gn; EBG00001107235.
DR   EnsemblGenomes-Gn; EBG00001107236.
DR   EnsemblGenomes-Gn; EBG00001107237.
DR   EnsemblGenomes-Gn; EBG00001107238.
DR   EnsemblGenomes-Gn; EBG00001107239.
DR   EnsemblGenomes-Gn; EBG00001107240.
DR   EnsemblGenomes-Gn; EBG00001107241.
DR   EnsemblGenomes-Gn; EBG00001107242.
DR   EnsemblGenomes-Gn; EBG00001107243.
DR   EnsemblGenomes-Gn; EBG00001107244.
DR   EnsemblGenomes-Gn; EBG00001107245.
DR   EnsemblGenomes-Gn; EBG00001107246.
DR   EnsemblGenomes-Gn; EBG00001107247.
DR   EnsemblGenomes-Gn; EBG00001107248.
DR   EnsemblGenomes-Gn; EBG00001107249.
DR   EnsemblGenomes-Gn; EBG00001107250.
DR   EnsemblGenomes-Gn; EBG00001107251.
DR   EnsemblGenomes-Gn; EBG00001107252.
DR   EnsemblGenomes-Gn; EBG00001107253.
DR   EnsemblGenomes-Gn; EBG00001107254.
DR   EnsemblGenomes-Gn; EBG00001107255.
DR   EnsemblGenomes-Gn; EBG00001107256.
DR   EnsemblGenomes-Gn; EBG00001107257.
DR   EnsemblGenomes-Gn; EBG00001107258.
DR   EnsemblGenomes-Gn; EBG00001107259.
DR   EnsemblGenomes-Gn; EBG00001107260.
DR   EnsemblGenomes-Gn; EBG00001107261.
DR   EnsemblGenomes-Gn; EBG00001107262.
DR   EnsemblGenomes-Gn; EBG00001107263.
DR   EnsemblGenomes-Gn; EBG00001107264.
DR   EnsemblGenomes-Gn; EBG00001107265.
DR   EnsemblGenomes-Gn; EBG00001107266.
DR   EnsemblGenomes-Gn; EBG00001107267.
DR   EnsemblGenomes-Gn; EBG00001107268.
DR   EnsemblGenomes-Gn; EBG00001107269.
DR   EnsemblGenomes-Gn; EBG00001107270.
DR   EnsemblGenomes-Gn; EBG00001107271.
DR   EnsemblGenomes-Gn; EBG00001107272.
DR   EnsemblGenomes-Gn; EBG00001107273.
DR   EnsemblGenomes-Gn; EBG00001107274.
DR   EnsemblGenomes-Gn; EBG00001107275.
DR   EnsemblGenomes-Gn; EBG00001107276.
DR   EnsemblGenomes-Gn; EBG00001107277.
DR   EnsemblGenomes-Gn; EBG00001107278.
DR   EnsemblGenomes-Gn; EBG00001107279.
DR   EnsemblGenomes-Gn; EBG00001107280.
DR   EnsemblGenomes-Gn; EBG00001107281.
DR   EnsemblGenomes-Gn; EBG00001107282.
DR   EnsemblGenomes-Gn; EBG00001107283.
DR   EnsemblGenomes-Gn; EBG00001107284.
DR   EnsemblGenomes-Gn; EBG00001107285.
DR   EnsemblGenomes-Gn; EBG00001107286.
DR   EnsemblGenomes-Gn; EBG00001107287.
DR   EnsemblGenomes-Gn; EBG00001107288.
DR   EnsemblGenomes-Gn; EBG00001107289.
DR   EnsemblGenomes-Gn; EBG00001107290.
DR   EnsemblGenomes-Gn; EBG00001107291.
DR   EnsemblGenomes-Gn; EBG00001107292.
DR   EnsemblGenomes-Gn; EBG00001107293.
DR   EnsemblGenomes-Gn; EBG00001107294.
DR   EnsemblGenomes-Gn; EBG00001107295.
DR   EnsemblGenomes-Gn; EBG00001107296.
DR   EnsemblGenomes-Gn; EBG00001107297.
DR   EnsemblGenomes-Gn; EBG00001107298.
DR   EnsemblGenomes-Gn; EBG00001107299.
DR   EnsemblGenomes-Gn; EBG00001107300.
DR   EnsemblGenomes-Gn; EBG00001107301.
DR   EnsemblGenomes-Gn; EBG00001107302.
DR   EnsemblGenomes-Gn; EBG00001107303.
DR   EnsemblGenomes-Gn; EBG00001107304.
DR   EnsemblGenomes-Gn; EBG00001107305.
DR   EnsemblGenomes-Gn; EBG00001107306.
DR   EnsemblGenomes-Gn; EBG00001107307.
DR   EnsemblGenomes-Gn; EBG00001107308.
DR   EnsemblGenomes-Gn; EBG00001107309.
DR   EnsemblGenomes-Gn; EBG00001107310.
DR   EnsemblGenomes-Gn; EBG00001107311.
DR   EnsemblGenomes-Gn; EBG00001107312.
DR   EnsemblGenomes-Gn; EBG00001107313.
DR   EnsemblGenomes-Gn; EBG00001107314.
DR   EnsemblGenomes-Gn; EBG00001107315.
DR   EnsemblGenomes-Gn; EBG00001107316.
DR   EnsemblGenomes-Gn; EBG00001107317.
DR   EnsemblGenomes-Gn; EBG00001107318.
DR   EnsemblGenomes-Gn; EBG00001107319.
DR   EnsemblGenomes-Gn; EBG00001107320.
DR   EnsemblGenomes-Gn; Tmath_R0001.
DR   EnsemblGenomes-Gn; Tmath_R0002.
DR   EnsemblGenomes-Gn; Tmath_R0003.
DR   EnsemblGenomes-Gn; Tmath_R0004.
DR   EnsemblGenomes-Gn; Tmath_R0005.
DR   EnsemblGenomes-Gn; Tmath_R0006.
DR   EnsemblGenomes-Gn; Tmath_R0007.
DR   EnsemblGenomes-Gn; Tmath_R0008.
DR   EnsemblGenomes-Gn; Tmath_R0009.
DR   EnsemblGenomes-Gn; Tmath_R0010.
DR   EnsemblGenomes-Gn; Tmath_R0011.
DR   EnsemblGenomes-Gn; Tmath_R0012.
DR   EnsemblGenomes-Gn; Tmath_R0013.
DR   EnsemblGenomes-Gn; Tmath_R0014.
DR   EnsemblGenomes-Gn; Tmath_R0015.
DR   EnsemblGenomes-Gn; Tmath_R0016.
DR   EnsemblGenomes-Gn; Tmath_R0017.
DR   EnsemblGenomes-Gn; Tmath_R0018.
DR   EnsemblGenomes-Gn; Tmath_R0019.
DR   EnsemblGenomes-Gn; Tmath_R0020.
DR   EnsemblGenomes-Gn; Tmath_R0021.
DR   EnsemblGenomes-Gn; Tmath_R0022.
DR   EnsemblGenomes-Gn; Tmath_R0023.
DR   EnsemblGenomes-Gn; Tmath_R0024.
DR   EnsemblGenomes-Gn; Tmath_R0025.
DR   EnsemblGenomes-Gn; Tmath_R0026.
DR   EnsemblGenomes-Gn; Tmath_R0027.
DR   EnsemblGenomes-Gn; Tmath_R0028.
DR   EnsemblGenomes-Gn; Tmath_R0029.
DR   EnsemblGenomes-Gn; Tmath_R0030.
DR   EnsemblGenomes-Gn; Tmath_R0031.
DR   EnsemblGenomes-Gn; Tmath_R0032.
DR   EnsemblGenomes-Gn; Tmath_R0033.
DR   EnsemblGenomes-Gn; Tmath_R0034.
DR   EnsemblGenomes-Gn; Tmath_R0035.
DR   EnsemblGenomes-Gn; Tmath_R0036.
DR   EnsemblGenomes-Gn; Tmath_R0037.
DR   EnsemblGenomes-Gn; Tmath_R0038.
DR   EnsemblGenomes-Gn; Tmath_R0039.
DR   EnsemblGenomes-Gn; Tmath_R0040.
DR   EnsemblGenomes-Gn; Tmath_R0041.
DR   EnsemblGenomes-Gn; Tmath_R0042.
DR   EnsemblGenomes-Gn; Tmath_R0043.
DR   EnsemblGenomes-Gn; Tmath_R0044.
DR   EnsemblGenomes-Gn; Tmath_R0045.
DR   EnsemblGenomes-Gn; Tmath_R0046.
DR   EnsemblGenomes-Gn; Tmath_R0047.
DR   EnsemblGenomes-Gn; Tmath_R0048.
DR   EnsemblGenomes-Gn; Tmath_R0049.
DR   EnsemblGenomes-Gn; Tmath_R0050.
DR   EnsemblGenomes-Gn; Tmath_R0051.
DR   EnsemblGenomes-Gn; Tmath_R0052.
DR   EnsemblGenomes-Gn; Tmath_R0053.
DR   EnsemblGenomes-Gn; Tmath_R0054.
DR   EnsemblGenomes-Gn; Tmath_R0055.
DR   EnsemblGenomes-Gn; Tmath_R0056.
DR   EnsemblGenomes-Gn; Tmath_R0057.
DR   EnsemblGenomes-Gn; Tmath_R0058.
DR   EnsemblGenomes-Gn; Tmath_R0059.
DR   EnsemblGenomes-Gn; Tmath_R0060.
DR   EnsemblGenomes-Gn; Tmath_R0061.
DR   EnsemblGenomes-Gn; Tmath_R0062.
DR   EnsemblGenomes-Gn; Tmath_R0063.
DR   EnsemblGenomes-Gn; Tmath_R0064.
DR   EnsemblGenomes-Gn; Tmath_R0065.
DR   EnsemblGenomes-Gn; Tmath_R0066.
DR   EnsemblGenomes-Gn; Tmath_R0067.
DR   EnsemblGenomes-Gn; Tmath_R0068.
DR   EnsemblGenomes-Gn; Tmath_R0069.
DR   EnsemblGenomes-Gn; Tmath_R0070.
DR   EnsemblGenomes-Gn; Tmath_R0071.
DR   EnsemblGenomes-Gn; Tmath_R0072.
DR   EnsemblGenomes-Gn; Tmath_R0073.
DR   EnsemblGenomes-Gn; Tmath_R0074.
DR   EnsemblGenomes-Gn; Tmath_R0075.
DR   EnsemblGenomes-Gn; Tmath_R0076.
DR   EnsemblGenomes-Tr; EBT00001698576.
DR   EnsemblGenomes-Tr; EBT00001698577.
DR   EnsemblGenomes-Tr; EBT00001698578.
DR   EnsemblGenomes-Tr; EBT00001698579.
DR   EnsemblGenomes-Tr; EBT00001698580.
DR   EnsemblGenomes-Tr; EBT00001698581.
DR   EnsemblGenomes-Tr; EBT00001698582.
DR   EnsemblGenomes-Tr; EBT00001698583.
DR   EnsemblGenomes-Tr; EBT00001698584.
DR   EnsemblGenomes-Tr; EBT00001698585.
DR   EnsemblGenomes-Tr; EBT00001698586.
DR   EnsemblGenomes-Tr; EBT00001698587.
DR   EnsemblGenomes-Tr; EBT00001698588.
DR   EnsemblGenomes-Tr; EBT00001698589.
DR   EnsemblGenomes-Tr; EBT00001698590.
DR   EnsemblGenomes-Tr; EBT00001698591.
DR   EnsemblGenomes-Tr; EBT00001698592.
DR   EnsemblGenomes-Tr; EBT00001698593.
DR   EnsemblGenomes-Tr; EBT00001698594.
DR   EnsemblGenomes-Tr; EBT00001698595.
DR   EnsemblGenomes-Tr; EBT00001698596.
DR   EnsemblGenomes-Tr; EBT00001698597.
DR   EnsemblGenomes-Tr; EBT00001698598.
DR   EnsemblGenomes-Tr; EBT00001698599.
DR   EnsemblGenomes-Tr; EBT00001698600.
DR   EnsemblGenomes-Tr; EBT00001698601.
DR   EnsemblGenomes-Tr; EBT00001698602.
DR   EnsemblGenomes-Tr; EBT00001698603.
DR   EnsemblGenomes-Tr; EBT00001698604.
DR   EnsemblGenomes-Tr; EBT00001698605.
DR   EnsemblGenomes-Tr; EBT00001698606.
DR   EnsemblGenomes-Tr; EBT00001698607.
DR   EnsemblGenomes-Tr; EBT00001698608.
DR   EnsemblGenomes-Tr; EBT00001698609.
DR   EnsemblGenomes-Tr; EBT00001698610.
DR   EnsemblGenomes-Tr; EBT00001698611.
DR   EnsemblGenomes-Tr; EBT00001698612.
DR   EnsemblGenomes-Tr; EBT00001698613.
DR   EnsemblGenomes-Tr; EBT00001698614.
DR   EnsemblGenomes-Tr; EBT00001698615.
DR   EnsemblGenomes-Tr; EBT00001698616.
DR   EnsemblGenomes-Tr; EBT00001698617.
DR   EnsemblGenomes-Tr; EBT00001698618.
DR   EnsemblGenomes-Tr; EBT00001698619.
DR   EnsemblGenomes-Tr; EBT00001698620.
DR   EnsemblGenomes-Tr; EBT00001698621.
DR   EnsemblGenomes-Tr; EBT00001698622.
DR   EnsemblGenomes-Tr; EBT00001698623.
DR   EnsemblGenomes-Tr; EBT00001698624.
DR   EnsemblGenomes-Tr; EBT00001698625.
DR   EnsemblGenomes-Tr; EBT00001698626.
DR   EnsemblGenomes-Tr; EBT00001698627.
DR   EnsemblGenomes-Tr; EBT00001698628.
DR   EnsemblGenomes-Tr; EBT00001698629.
DR   EnsemblGenomes-Tr; EBT00001698630.
DR   EnsemblGenomes-Tr; EBT00001698631.
DR   EnsemblGenomes-Tr; EBT00001698632.
DR   EnsemblGenomes-Tr; EBT00001698633.
DR   EnsemblGenomes-Tr; EBT00001698634.
DR   EnsemblGenomes-Tr; EBT00001698635.
DR   EnsemblGenomes-Tr; EBT00001698636.
DR   EnsemblGenomes-Tr; EBT00001698637.
DR   EnsemblGenomes-Tr; EBT00001698638.
DR   EnsemblGenomes-Tr; EBT00001698639.
DR   EnsemblGenomes-Tr; EBT00001698640.
DR   EnsemblGenomes-Tr; EBT00001698641.
DR   EnsemblGenomes-Tr; EBT00001698642.
DR   EnsemblGenomes-Tr; EBT00001698643.
DR   EnsemblGenomes-Tr; EBT00001698644.
DR   EnsemblGenomes-Tr; EBT00001698645.
DR   EnsemblGenomes-Tr; EBT00001698646.
DR   EnsemblGenomes-Tr; EBT00001698647.
DR   EnsemblGenomes-Tr; EBT00001698648.
DR   EnsemblGenomes-Tr; EBT00001698649.
DR   EnsemblGenomes-Tr; EBT00001698650.
DR   EnsemblGenomes-Tr; EBT00001698651.
DR   EnsemblGenomes-Tr; EBT00001698652.
DR   EnsemblGenomes-Tr; EBT00001698653.
DR   EnsemblGenomes-Tr; EBT00001698654.
DR   EnsemblGenomes-Tr; EBT00001698655.
DR   EnsemblGenomes-Tr; EBT00001698656.
DR   EnsemblGenomes-Tr; EBT00001698657.
DR   EnsemblGenomes-Tr; EBT00001698658.
DR   EnsemblGenomes-Tr; EBT00001698659.
DR   EnsemblGenomes-Tr; EBT00001698660.
DR   EnsemblGenomes-Tr; EBT00001698661.
DR   EnsemblGenomes-Tr; EBT00001698662.
DR   EnsemblGenomes-Tr; EBT00001698663.
DR   EnsemblGenomes-Tr; EBT00001698664.
DR   EnsemblGenomes-Tr; EBT00001698665.
DR   EnsemblGenomes-Tr; EBT00001698666.
DR   EnsemblGenomes-Tr; EBT00001698667.
DR   EnsemblGenomes-Tr; EBT00001698668.
DR   EnsemblGenomes-Tr; EBT00001698669.
DR   EnsemblGenomes-Tr; EBT00001698670.
DR   EnsemblGenomes-Tr; EBT00001698671.
DR   EnsemblGenomes-Tr; EBT00001698672.
DR   EnsemblGenomes-Tr; EBT00001698673.
DR   EnsemblGenomes-Tr; EBT00001698674.
DR   EnsemblGenomes-Tr; EBT00001698675.
DR   EnsemblGenomes-Tr; EBT00001698676.
DR   EnsemblGenomes-Tr; EBT00001698677.
DR   EnsemblGenomes-Tr; EBT00001698678.
DR   EnsemblGenomes-Tr; EBT00001698679.
DR   EnsemblGenomes-Tr; EBT00001698680.
DR   EnsemblGenomes-Tr; EBT00001698681.
DR   EnsemblGenomes-Tr; EBT00001698682.
DR   EnsemblGenomes-Tr; EBT00001698683.
DR   EnsemblGenomes-Tr; EBT00001698684.
DR   EnsemblGenomes-Tr; EBT00001698685.
DR   EnsemblGenomes-Tr; EBT00001698686.
DR   EnsemblGenomes-Tr; EBT00001698687.
DR   EnsemblGenomes-Tr; EBT00001698688.
DR   EnsemblGenomes-Tr; EBT00001698689.
DR   EnsemblGenomes-Tr; EBT00001698690.
DR   EnsemblGenomes-Tr; EBT00001698691.
DR   EnsemblGenomes-Tr; EBT00001698692.
DR   EnsemblGenomes-Tr; EBT00001698693.
DR   EnsemblGenomes-Tr; EBT00001698694.
DR   EnsemblGenomes-Tr; EBT00001698695.
DR   EnsemblGenomes-Tr; EBT00001698696.
DR   EnsemblGenomes-Tr; EBT00001698697.
DR   EnsemblGenomes-Tr; EBT00001698698.
DR   EnsemblGenomes-Tr; EBT00001698699.
DR   EnsemblGenomes-Tr; EBT00001698700.
DR   EnsemblGenomes-Tr; EBT00001698701.
DR   EnsemblGenomes-Tr; EBT00001698702.
DR   EnsemblGenomes-Tr; EBT00001698703.
DR   EnsemblGenomes-Tr; EBT00001698704.
DR   EnsemblGenomes-Tr; EBT00001698705.
DR   EnsemblGenomes-Tr; EBT00001698706.
DR   EnsemblGenomes-Tr; EBT00001698707.
DR   EnsemblGenomes-Tr; EBT00001698708.
DR   EnsemblGenomes-Tr; EBT00001698709.
DR   EnsemblGenomes-Tr; EBT00001698710.
DR   EnsemblGenomes-Tr; EBT00001698711.
DR   EnsemblGenomes-Tr; EBT00001698712.
DR   EnsemblGenomes-Tr; EBT00001698713.
DR   EnsemblGenomes-Tr; EBT00001698714.
DR   EnsemblGenomes-Tr; Tmath_R0001-1.
DR   EnsemblGenomes-Tr; Tmath_R0002-1.
DR   EnsemblGenomes-Tr; Tmath_R0003-1.
DR   EnsemblGenomes-Tr; Tmath_R0004-1.
DR   EnsemblGenomes-Tr; Tmath_R0005-1.
DR   EnsemblGenomes-Tr; Tmath_R0006-1.
DR   EnsemblGenomes-Tr; Tmath_R0007-1.
DR   EnsemblGenomes-Tr; Tmath_R0008-1.
DR   EnsemblGenomes-Tr; Tmath_R0009-1.
DR   EnsemblGenomes-Tr; Tmath_R0010-1.
DR   EnsemblGenomes-Tr; Tmath_R0011-1.
DR   EnsemblGenomes-Tr; Tmath_R0012-1.
DR   EnsemblGenomes-Tr; Tmath_R0013-1.
DR   EnsemblGenomes-Tr; Tmath_R0014-1.
DR   EnsemblGenomes-Tr; Tmath_R0015-1.
DR   EnsemblGenomes-Tr; Tmath_R0016-1.
DR   EnsemblGenomes-Tr; Tmath_R0017-1.
DR   EnsemblGenomes-Tr; Tmath_R0018-1.
DR   EnsemblGenomes-Tr; Tmath_R0019-1.
DR   EnsemblGenomes-Tr; Tmath_R0020-1.
DR   EnsemblGenomes-Tr; Tmath_R0021-1.
DR   EnsemblGenomes-Tr; Tmath_R0022-1.
DR   EnsemblGenomes-Tr; Tmath_R0023-1.
DR   EnsemblGenomes-Tr; Tmath_R0024-1.
DR   EnsemblGenomes-Tr; Tmath_R0025-1.
DR   EnsemblGenomes-Tr; Tmath_R0026-1.
DR   EnsemblGenomes-Tr; Tmath_R0027-1.
DR   EnsemblGenomes-Tr; Tmath_R0028-1.
DR   EnsemblGenomes-Tr; Tmath_R0029-1.
DR   EnsemblGenomes-Tr; Tmath_R0030-1.
DR   EnsemblGenomes-Tr; Tmath_R0031-1.
DR   EnsemblGenomes-Tr; Tmath_R0032-1.
DR   EnsemblGenomes-Tr; Tmath_R0033-1.
DR   EnsemblGenomes-Tr; Tmath_R0034-1.
DR   EnsemblGenomes-Tr; Tmath_R0035-1.
DR   EnsemblGenomes-Tr; Tmath_R0036-1.
DR   EnsemblGenomes-Tr; Tmath_R0037-1.
DR   EnsemblGenomes-Tr; Tmath_R0038-1.
DR   EnsemblGenomes-Tr; Tmath_R0039-1.
DR   EnsemblGenomes-Tr; Tmath_R0040-1.
DR   EnsemblGenomes-Tr; Tmath_R0041-1.
DR   EnsemblGenomes-Tr; Tmath_R0042-1.
DR   EnsemblGenomes-Tr; Tmath_R0043-1.
DR   EnsemblGenomes-Tr; Tmath_R0044-1.
DR   EnsemblGenomes-Tr; Tmath_R0045-1.
DR   EnsemblGenomes-Tr; Tmath_R0046-1.
DR   EnsemblGenomes-Tr; Tmath_R0047-1.
DR   EnsemblGenomes-Tr; Tmath_R0048-1.
DR   EnsemblGenomes-Tr; Tmath_R0049-1.
DR   EnsemblGenomes-Tr; Tmath_R0050-1.
DR   EnsemblGenomes-Tr; Tmath_R0051-1.
DR   EnsemblGenomes-Tr; Tmath_R0052-1.
DR   EnsemblGenomes-Tr; Tmath_R0053-1.
DR   EnsemblGenomes-Tr; Tmath_R0054-1.
DR   EnsemblGenomes-Tr; Tmath_R0055-1.
DR   EnsemblGenomes-Tr; Tmath_R0056-1.
DR   EnsemblGenomes-Tr; Tmath_R0057-1.
DR   EnsemblGenomes-Tr; Tmath_R0058-1.
DR   EnsemblGenomes-Tr; Tmath_R0059-1.
DR   EnsemblGenomes-Tr; Tmath_R0060-1.
DR   EnsemblGenomes-Tr; Tmath_R0061-1.
DR   EnsemblGenomes-Tr; Tmath_R0062-1.
DR   EnsemblGenomes-Tr; Tmath_R0063-1.
DR   EnsemblGenomes-Tr; Tmath_R0064-1.
DR   EnsemblGenomes-Tr; Tmath_R0065-1.
DR   EnsemblGenomes-Tr; Tmath_R0066-1.
DR   EnsemblGenomes-Tr; Tmath_R0067-1.
DR   EnsemblGenomes-Tr; Tmath_R0068-1.
DR   EnsemblGenomes-Tr; Tmath_R0069-1.
DR   EnsemblGenomes-Tr; Tmath_R0070-1.
DR   EnsemblGenomes-Tr; Tmath_R0071-1.
DR   EnsemblGenomes-Tr; Tmath_R0072-1.
DR   EnsemblGenomes-Tr; Tmath_R0073-1.
DR   EnsemblGenomes-Tr; Tmath_R0074-1.
DR   EnsemblGenomes-Tr; Tmath_R0075-1.
DR   EnsemblGenomes-Tr; Tmath_R0076-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01071; OLE.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01315; CRISPR-DR2.
DR   RFAM; RF01352; CRISPR-DR43.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   SILVA-LSU; CP002032.
DR   SILVA-SSU; CP002032.
DR   StrainInfo; 268642; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085035
CC   Source DNA available from Christopher L. Hemme (hemmecl@ou.edu)
CC   Organism available from DSMZ: DSM 11426
CC   Contacts: Christopher L. Hemme (hemmecl@ou.edu)
CC        Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Thermoanaerobacter mathranii A3, DSM11426
CC   Culture Collection ID :: DSM 11426, AIP 130.05, CIP 108742
CC   GOLD Stamp ID         :: Gi02564
CC   Greengenes ID         :: 13781
CC   Isolation Site        :: Hot spring from Hverdagerdi-Hengil area in
CC                            Iceland
CC   Isolation Country     :: Iceland
CC   Oxygen Requirement    :: Anaerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Sporulation           :: Sporulating
CC   Temperature Range     :: Thermophile
CC   Temperature Optimum   :: 70 - 75C
CC   pH                    :: 4.7 - 8.8
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Habitat               :: Hot spring
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2306092
FT                   /organism="Thermoanaerobacter mathranii subsp. mathranii
FT                   str. A3"
FT                   /sub_species="mathranii"
FT                   /strain="A3"
FT                   /mol_type="genomic DNA"
FT                   /country="Iceland:Hverdagerdi-Hengil area"
FT                   /isolation_source="hot spring"
FT                   /db_xref="taxon:583358"
FT   gene            99..1430
FT                   /locus_tag="Tmath_0001"
FT   CDS_pept        99..1430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   tpd:Teth39_0001 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59790"
FT                   /db_xref="GOA:D7APY0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D7APY0"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADH59790.1"
FT                   /translation="MYGDHRQIWERIVEVIKSELTPTSYNTWLVHIKPLAIIDNVLFLS
FT                   TPNTFTKNIINGRYINIIYDAASKASNKLYEIKILSEDEEEYREIKESIEKENSTESTT
FT                   LSTLNPKYTFDTFVVGNSNKLAHAACLAVAQAPAKAYNPLFIYGGVGLGKTHLMHAIGH
FT                   FINKHQSGYKIMYVTSETFTNELVNSIKDDKNEEFRNKYRNIDVLLIDDIQFIAKKERT
FT                   QEEFFHTFNTLYEANKQIVISSDRPPKEIPTLEERLRSRFEWGLIADIQPPDYETRIAI
FT                   LKKKAQTENLNIPDEVLAYVAEKIQSNIRELEGALIRIVAFSNLTKANIDLELAKQALK
FT                   EIVSNKTREITVKLIQEEVCRYYNIKLEDFRSRKRTKNIAYPRQIAMYLARELTDLSLP
FT                   KIGEEFGKDHTTVIHAYEKISNEIKEDELLSRQIEELKKRIKGY"
FT   gene            1667..2779
FT                   /locus_tag="Tmath_0002"
FT   CDS_pept        1667..2779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: tpd:Teth39_0002 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59791"
FT                   /db_xref="GOA:D7APY1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D7APY1"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADH59791.1"
FT                   /translation="MKFVCDKNSLFEGVNIAIRGVSSRTTLPILQGIKITALKDQVKFS
FT                   GTDLDIGIECQIPAMVEEEGEIVVPAKIFSELVRKLPEEDVKIESDSQNTVNVICDSIN
FT                   FTIAGSDAVEFPEIPQVSKENSFKLTKNILKDLIKKTVFCIAHEQTRPILTGVLFEVFP
FT                   NEIKAVALDGFRMAIYTYQSEEKFFEEGIEKYSIVIPGKTLEEIYKILEDEETEIDIYH
FT                   TANQVLFQIENTKVISRLLEGSFINYNAVLPKDYKTEVVVKREVLTESIERASLIAESK
FT                   NNLIKFEIGDKFITVSSNSEKGKMVEKIEVNVKGMFLEIAFNSRYLLDSLRAIDEEEIT
FT                   LYFINSINPLIIKPIGSKDYLYMILPVKLN"
FT   gene            2800..3006
FT                   /locus_tag="Tmath_0003"
FT   CDS_pept        2800..3006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0003"
FT                   /product="S4 domain protein YaaA"
FT                   /note="TIGRFAM: S4 domain protein YaaA; PFAM: RNA-binding
FT                   S4 domain protein; KEGG: tpd:Teth39_0003 RNA-binding S4
FT                   domain-containing protein; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59792"
FT                   /db_xref="GOA:D7APY2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D7APY2"
FT                   /inference="protein motif:TFAM:TIGR02988"
FT                   /protein_id="ADH59792.1"
FT                   /translation="MIEVPIETEYITLGQFLKYMKICETGGQAKQFILEGKVKVNGAIE
FT                   LKRGKKLRKNDIIEVEGKTYIIK"
FT   gene            3017..4105
FT                   /locus_tag="Tmath_0004"
FT   CDS_pept        3017..4105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: tex:Teth514_0004 recombination protein F;
FT                   TIGRFAM: DNA replication and repair protein RecF; PFAM: SMC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59793"
FT                   /db_xref="GOA:D7APY3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D7APY3"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADH59793.1"
FT                   /translation="MYVKELFVDNFRNLEKQRIEFCEGINIFYGLNAQGKSNLLESIRL
FT                   LSMGRSFRGSKSTELVRFGENYFYVKAIICQENNDKKIEFGYKKDGNKVIKVNSNKIKS
FT                   ISELLGQLLTVIFSPEDLNIIKEGPSHRRKYLDSCISIIEKNYLYNLMQYNKILMNRNK
FT                   LLKNIKEGKSKNILEIFDDQLVEYGAKIIMVRQNYLKNLEINIKKFLLEISNEKAEIVY
FT                   LNSVGLKDASDEETVKKRLKEKLSKNIDLDLKYLTTQVGPHREDFKIIINGYDSRVYSS
FT                   QGQQRTAALCLKLSEFEILKKATNEKPVLLLDDVMSELDENRKKYVLEKLKGFQTFITH
FT                   TTKRDLKGDCYFKISNGVVIKE"
FT   gene            4117..4374
FT                   /locus_tag="Tmath_0005"
FT   CDS_pept        4117..4374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59794"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:D7APY4"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0005"
FT                   /protein_id="ADH59794.1"
FT                   /translation="MYVHLGGNVVVSDKDIIAIFDMDVVTTSEATLQFLKIAEEEGFIV
FT                   RISSEKPKSFIITERDKRSVIYLSPISAFTLIKRTQKIDA"
FT   gene            4387..6642
FT                   /locus_tag="Tmath_0006"
FT   CDS_pept        4387..6642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0006"
FT                   /product="Alpha-glucosidase"
FT                   /EC_number="3.2.1.20"
FT                   /note="KEGG: tpd:Teth39_0006 alpha-glucosidase; PFAM:
FT                   glycoside hydrolase family 31"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59795"
FT                   /db_xref="GOA:D7APY5"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR030458"
FT                   /db_xref="InterPro:IPR032513"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="UniProtKB/TrEMBL:D7APY5"
FT                   /inference="protein motif:PRIAM:3.2.1.20"
FT                   /protein_id="ADH59795.1"
FT                   /translation="MIKTSEGIIVRNEKRKLELRVLSDKIINVFVSDKEEKRKDTIAIE
FT                   RKEYDIPKFTLKEELESILIETNSLKVKIDKNDLSVSFLDKNESIINEDYKGGVKFSET
FT                   DVRCYKKLREDHFYGFGEKAGYLDKKGERLEMWNTDEFMTHNQTTKLLYESYPFFIGMN
FT                   DYHTYGIFLDNSFRSFFDMGQESQEYYFFGAYGGQMNYYFIYGRDIKEVVENYTYLTGR
FT                   MSLPPLWVLGYQQSRYSYTPQERVLKIAKTFREKDIPCDVIYLDIDYMEGYRVFTWNKD
FT                   TFKNYKEMLKQLKEMGFKVVTIVDPGVKRDYDYHVYREGIEKGYFVKDKYGITYVGKVW
FT                   PGEACFPDFLQEEVRYWWGEKHREFIKDGIDGIWNDMNEPAVFETPTKTMPEDNIHILD
FT                   GEKILHKEAHNVYANYMAMATRDGLLRIKPNERPFVLTRAGFSGIQRYAAMWTGDNKSL
FT                   YEHLLMMMPMLINIGLSGQPFAGADVGGFEGDCNEELFIRWIEAAIFTPFLRVHSAIGT
FT                   KDQEPWSFGKKAEDISRKYIKMRYELLPYLYDLFYIASQKGYPIMRPLVFEYQDDENTH
FT                   KIYDEFLLGDNLLVAPIYLPSKEKREVYLPKGIWYDYWTGKEFKGESYYLVDAPIDIVP
FT                   LFVKKGGILLKQQPQSFVGEKEIKEIIIEIYKGEEGHYLHYEDDGKSFDYTKGIYNLFE
FT                   IGFKYQGGKIDIKFDRIHSGYEKGVKKYKFVLKNFDEIEEVKINGKKVDKEKCEVIL"
FT   gene            complement(6665..7396)
FT                   /locus_tag="Tmath_0007"
FT   CDS_pept        complement(6665..7396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0007"
FT                   /product="CobB/CobQ domain protein glutamine
FT                   amidotransferase"
FT                   /note="PFAM: CobB/CobQ domain protein glutamine
FT                   amidotransferase; KEGG: tex:Teth514_0007 glutamine
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59796"
FT                   /db_xref="GOA:D7APY6"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:D7APY6"
FT                   /inference="protein motif:PFAM:PF07685"
FT                   /protein_id="ADH59796.1"
FT                   /translation="MKLVIGHMYPDLLNLYGDLGNILTLKRRSEWRNIETEVKSITVDS
FT                   NTNFTDIDILFLGGGSDREQKIVSDDLTIKKGKNLKSAIEDGLTVLGICGGYQLLGNYY
FT                   QTSKGEKIEGVGVLDMWTVAGTKRMIGNVVIDANINEKNFKMVGFENHSGKTYLGKSSP
FT                   LGKVIIGSGNNGEDKTEGCIYKNVYGTYLHGPVLPKNPEFADILIETALKRKYGKVELT
FT                   PLDDSLEQQAKQSLIERFVKK"
FT   gene            complement(7408..8748)
FT                   /locus_tag="Tmath_0008"
FT   CDS_pept        complement(7408..8748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0008"
FT                   /product="domain of unknown function DUF1727"
FT                   /note="PFAM: domain of unknown function DUF1727; Mur ligase
FT                   middle domain protein; KEGG: tex:Teth514_0008 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59797"
FT                   /db_xref="GOA:D7APY7"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:D7APY7"
FT                   /inference="protein motif:PFAM:PF08353"
FT                   /protein_id="ADH59797.1"
FT                   /translation="MKFLSVNLGKLVNISCKITGKGGTSLPGKIALKSDSRLIKKLIEP
FT                   LKESKVMITGTNGKTTTSGLIAHILNTAGKSIVHNKEGANMKTGIATALIKSSDFLGNL
FT                   KKEAAVFEVDEANMPIVIEDINPNIVIITNFFRDQLDRYGELDITVEKVKNALLKLPQE
FT                   SIILLNADEPFTASIGDEIKSKVFYYGIDDNIEGINSSSFEQKYCPICGHKYEYRRIYY
FT                   GQLGDYYCPNCGKKRPNPHFKATNIFLNEDGINFNLYYKDKIFTFKSRLIGIYNVYNLL
FT                   AAISASILLNIDFNTISKATENYWPIEGRLQKTKIKNKKAIINLIKNPIGFESTLNMLS
FT                   QFNKPLNLLISINDNYADGRDVSWLWDVNLEDFLSKTKVNYIITSGLRAEDMAVRLKYA
FT                   NFDINKIKVINSVDKALDTISELTKEELIAVLPNYTSLYDVNKYLNS"
FT   gene            9102..11003
FT                   /locus_tag="Tmath_0009"
FT   CDS_pept        9102..11003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0009"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: tex:Teth514_0009 DNA gyrase subunit B; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   DNA gyrase subunit B domain protein; ATP-binding region
FT                   ATPase domain protein; TOPRIM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59798"
FT                   /db_xref="GOA:D7APY8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7APY8"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADH59798.1"
FT                   /translation="MAKDETYTASQIQILEGLEAVRKRPGMYIGSTGSRGLHHLVYEVV
FT                   DNSIDEALAGYCKNIVVTIHKDNSITVEDDGRGIPTDIHPKVGKPAVEVALTMLHAGGK
FT                   FNNDAYKVSGGLHGVGVSVVNALSEKLEVVVKQRGKIFRQTYERGVPKTDLEIIGETEE
FT                   TGTTITFKPDKEIFEETVFNYDVLAQRLRELAFLNKGINIKLIDERDGKEEVFNYEGGI
FT                   ISFVKYLNRNKEVLHEEPIYMEAKNTDYEVEVCMQYNDTYTENIFSFANNIDTREGGTH
FT                   LVGFKSALTKVINDYARKYGIIKDNEKNLQGEDVREGLTAIVSVKLKNPQFEGQTKTKL
FT                   GNSEMRSIVENVVIEKLSAFLEENPSVAKVIVEKATQAARAREAARKARELTRRKSALE
FT                   NTTLPGKLADCSEKDPSKCELFLVEGDSAGGSAKTGRNSRFQAILPLRGKILNVEKARL
FT                   DKILSNEEIRAMITALGTGIGDEFDISKLRYHKVVIMTDADVDGSHIRTLLLTFFYRFM
FT                   RPLIENGNVYIAQPPLYKITKGKKVYYAYSDKELDRILNEIGRENYTVQRYKGLGEMNA
FT                   DQLWDTTMDPEKRTILKVTLEDAIAADEIFTILMGDKVEPRREFIERYAKTVRNLDI"
FT   gene            11016..13433
FT                   /locus_tag="Tmath_0010"
FT   CDS_pept        11016..13433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0010"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: tex:Teth514_0010 DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59799"
FT                   /db_xref="GOA:D7APY9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D7APY9"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADH59799.1"
FT                   /translation="MSEDKVIPVDIEDEMKKSYIDYAMSVIVGRALPDVRDGLKPVHRR
FT                   ILYAMNELGLTPDKPYKKSVAVVGEVLGKYHPHGDAAVYDTLVRLAQDFSMRETLIDGH
FT                   GNFGSIDGDPPAAMRYTEARLSKIALEMLTDINKETVDFVPNFDETLKEPVVLPSRFPN
FT                   LLVNGSQGIAVGMATNIPPHNLGEVIDGIIAYIDNPYISVDELMKYIKGPDFPTGGVIL
FT                   GRDGIKETYETGRGKIVVRAKAEIEEHHGKTRIVITEIPYMVLKAKLIEKIAELVREKH
FT                   IEGISDLRDESDRNGMKVVIELKKDVNPKVILNKLYMHTQMQQTFGAIMLALVDGEPKI
FT                   LNLKQIIEKYVDHQADVVTRRTKFDLRKAEERAHILEGLKIALDHIDEVINIIRSSKTE
FT                   AIAKQNLMDKFGLSEKQAQAIVDMRLGRLTGLERQKVEDELKELMEKIKELKGILADER
FT                   KVLEIIKKELLEIKDKYATPRKTNIVAKEEELDLEDLVQLEDVVVTMTHYGYIKRMPLD
FT                   TYKAQKRGGKGILGISTREDDFVRDIFITTTHDRLLFFTNKGKVYSLRTIDIPETGRQA
FT                   KGTAIVNLIQIGQGEKVTAVIPLKKSQDIKYVVMCTKKGIIKKTSIEEFRSIKRNGIIA
FT                   ITLEENDELINTKLTNGEREIIIGTAKGYAIRFNEKDIRPMGRVAKGVIAISLREDDEV
FT                   VEMDLVHPGSEILVVTEKGFGKRTDLEEYRLQTRAGKGIIAIRLSEKTGKLVSIRSVNP
FT                   EDEFMIISANGILIRMKVSEISKMHRDTRGVTLMKLDDGDRVVSTARIENEE"
FT   gene            13650..14367
FT                   /pseudo
FT                   /locus_tag="Tmath_0011"
FT   gene            14409..15845
FT                   /locus_tag="Tmath_0012"
FT   CDS_pept        14409..15845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0012"
FT                   /product="prophage LambdaCh01, portal protein"
FT                   /note="KEGG: chy:CHY_1679 prophage LambdaCh01, portal
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59800"
FT                   /db_xref="InterPro:IPR021145"
FT                   /db_xref="UniProtKB/TrEMBL:D7APZ0"
FT                   /inference="similar to AA sequence:KEGG:CHY_1679"
FT                   /protein_id="ADH59800.1"
FT                   /translation="MITDLSFFDIGAKWPPDSEMERLQRYDQNRKLFEGRHELVFKDWI
FT                   RLLRDDKKATLEIILNWPKRLSTLWADLLLGEPPRITAGETGSKEQEQLDKIIKNNNFL
FT                   NTAYEVAIDLSRYGDGIFKTRYDKRAIIEAVPPSLWFLVVTADNIKDVQAHVIAWTFDI
FT                   ATPTLLSKDKKTTYLRLEIHERGKITNKLFELQDEIIKNEIDIKTFYPDLEPEIYTGID
FT                   DFLVVPVHNMQTSDRIYGLDDYSDLDSIIQEIEVRIAQISRILDKHADPNMYGPATALE
FT                   QNELGEWVVRGGGKYFPVEQGEQPPGYVVWDGKLDAAFREIDLLMEQFYALSETSAAAF
FT                   GQLKQGLAESGSALRRLMMAPLAKVNRIRMRFDPAIKKILRLASKLDALYGNGIELETI
FT                   NIAWNDGLPDDEKEQAEIYSMLVQNGLISRETALKHLFEFDAETLKQELAKIAVETAQE
FT                   APALFTTTLQTQQNQQQQSE"
FT   gene            15852..16802
FT                   /locus_tag="Tmath_0013"
FT   CDS_pept        15852..16802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0013"
FT                   /product="minor capsid 2 protein"
FT                   /note="PFAM: minor capsid 2 protein; KEGG: chy:CHY_1678
FT                   prophage LambdaCh01, head morphogenesis protein SPP1"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59801"
FT                   /db_xref="GOA:D7APZ1"
FT                   /db_xref="InterPro:IPR009319"
FT                   /db_xref="UniProtKB/TrEMBL:D7APZ1"
FT                   /inference="protein motif:PFAM:PF06152"
FT                   /protein_id="ADH59801.1"
FT                   /translation="MPNFDEEKLIQSLVELYRQGFLNILKVILEKEAKKQDTIYFKDIL
FT                   KQIMQILEQLDNNAAKWIEENVPKIYQQNYIAVMAFIQQLKGEAIQNPSFSQLHQRAVD
FT                   VLAQNLYDNLRDATQFVGRKFDDYFRKASLEAAGKKYVSGETWQQMKKDLMERLLSKGL
FT                   TGFKDRLGREWRLDSYAEMVARTLTREAATVATINACKEFDIDLVRISTHYPTCHLCAP
FT                   IQGKVYSLSGKDGRYPKYGEDGVVIPRHPNCRHVLMPYVRELDPNAEETEKYSNTSLTE
FT                   DPRSEKEKEAYKEAQEKRKQQFYNKVKREYLKNIV"
FT   gene            16865..18304
FT                   /locus_tag="Tmath_0014"
FT   CDS_pept        16865..18304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0014"
FT                   /product="protein of unknown function UPF0236"
FT                   /note="PFAM: protein of unknown function UPF0236; KEGG:
FT                   tte:TTE2708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59802"
FT                   /db_xref="InterPro:IPR009620"
FT                   /db_xref="UniProtKB/TrEMBL:D7APZ2"
FT                   /inference="protein motif:PFAM:PF06782"
FT                   /protein_id="ADH59802.1"
FT                   /translation="MENKTTQKGVSLVNKHIFEDIILQNALNFTREVIEIFSDLLNKGM
FT                   NITELAARIKELTDKLGREAIEAIIEELDKIIKEDKRRKEKWVVERKDKKRLTTILGDI
FT                   EYERTYYKSREDGRYTYLVDDALEIGRHDRIEKGVKIKLVENAIEESYERSSKKACPEE
FT                   LSKQTVLNAIREIGEVEVKREIKEKKEVRVLYIEADEDHVPLQDGSNETPRLIYIHEGK
FT                   EERNGRDVLRNVHYKAYVGEKAEDIWIDVANYIEENYKEEKIEKIYIAGDGAPWIKEGL
FT                   EWIAKSRFVLDRYHLNKYVLKATSKEPKYREKIWRAINEGDKEGVKKIFDELIKAAEEE
FT                   REKEKIKEARKYILNNWEGIEIYNKDKDVIGCSAEGHISHVFSVRLSRNPLGWSREGLK
FT                   LMAKLRVFSKNGGDLREVEWGKRKNINEGSYKLTKKQIKEAVRRIKTSTNEKINNITVL
FT                   NIGKVTPIYRILRAIKYAQVI"
FT   gene            18375..18881
FT                   /locus_tag="Tmath_0015"
FT   CDS_pept        18375..18881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpv:cgd7_5130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59803"
FT                   /db_xref="UniProtKB/TrEMBL:D7APZ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH59803.1"
FT                   /translation="MTLSLKNKKLYDEQARVIIENEKDYSVLIKKLAELRQIEWDNTHW
FT                   LIKKELILEARKEKELYREKYHVAKHGYTFDETIPRNQKEITEEHITKYKKFLLQTKKN
FT                   ADEIYTFRDPQRGDICWAFVKYEKRKVNLALFNEHMNRDASGWAFEDKEDWAKYLEKQP
FT                   YIRIL"
FT   gene            18891..19169
FT                   /locus_tag="Tmath_0016"
FT   CDS_pept        18891..19169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0016"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chy:CHY_1677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59804"
FT                   /db_xref="UniProtKB/TrEMBL:D7APZ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH59804.1"
FT                   /translation="MGILEQAKMEAESLDIFEEEEPDYFAVSYLLNILDILQEKQLIET
FT                   PEGKELQKKVLKYADKLAPFVKGPPNGETGWWWHMDKVAKGELKPQI"
FT   gene            19233..19580
FT                   /locus_tag="Tmath_0017"
FT   CDS_pept        19233..19580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0017"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chy:CHY_2147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59805"
FT                   /db_xref="UniProtKB/TrEMBL:D7APZ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH59805.1"
FT                   /translation="MSEKVSNKPWSNFSESDYDKEQWWEACLIHLVPKSEYTSKEQCKL
FT                   PVREPDGTLNRNGIHAAAAALAGARGGVDAPMEEKRKAAKKLVSLYRNVLNEEPPESIL
FT                   KLAGMKPNQSE"
FT   gene            19679..19879
FT                   /locus_tag="Tmath_0018"
FT   CDS_pept        19679..19879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59806"
FT                   /db_xref="UniProtKB/TrEMBL:D7APZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH59806.1"
FT                   /translation="MYIDGMKVRGLLRVEFYDAWDEFPYVDIKLVPTTINAEKEKAEEK
FT                   EIKFCINGQSIAQCSTEALDK"
FT   gene            20070..21110
FT                   /locus_tag="Tmath_0019"
FT   CDS_pept        20070..21110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0019"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   ate:Athe_2293 integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59807"
FT                   /db_xref="GOA:D7APZ7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7APZ7"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADH59807.1"
FT                   /translation="MEIKPNFSELAREYGVDRRTVKKYYEGYEGKPKTRNKQSKLDKYY
FT                   DEIKASGHPRFETPAGKQAQVDWKEDIKLVSRYGEEFVVNVNVFNYKLGYSRYCYFEYR
FT                   KAKTQQDVVECLINAFKATGGVPEEILFDNMKTVVDITNEGRKINNKIKAFANDFGFKI
FT                   RLCKPRHSYTKGKVESSNKFIDWLLPYNGEFENEEDLIKIIDEINKKVNQSTNQSTGIQ
FT                   TIILFQKEKEYLSPLPSNDIIESYMNFEQKATVHKDSMIYYKGSRYSVPPKYINKTVTL
FT                   KTVENELHIYFNTDLISVHILSVIKKVNYHESHYRELMENLIKNREDIEQICTNNLNEL
FT                   DKLLHR"
FT   gene            21119..21885
FT                   /pseudo
FT                   /locus_tag="Tmath_0020"
FT   repeat_region   21980..25625
FT                   /rpt_unit_range=21980..22009
FT                   /note="CRISPRS"
FT   gene            complement(25833..26102)
FT                   /locus_tag="Tmath_0021"
FT   CDS_pept        complement(25833..26102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0021"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="KEGG: ate:Athe_0128 CRISPR-associated protein Cas2;
FT                   TIGRFAM: CRISPR-associated protein Cas2; PFAM: protein of
FT                   unknown function DUF196"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59808"
FT                   /db_xref="GOA:D7APZ8"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:D7APZ8"
FT                   /inference="protein motif:TFAM:TIGR01573"
FT                   /protein_id="ADH59808.1"
FT                   /translation="MRIFVIVTYDINEKRVNKVRKILKKYFTWVQNSVFEGEITFGKLE
FT                   KCKRELLSVIKRDEDSVYFYEMEFKIVCNKKVLGQEKNYDSIIL"
FT   gene            complement(26287..27267)
FT                   /locus_tag="Tmath_0022"
FT   CDS_pept        complement(26287..27267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0022"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="KEGG: csc:Csac_2395 CRISPR-associated Cas1 family
FT                   protein; TIGRFAM: CRISPR-associated protein Cas1; PFAM:
FT                   protein of unknown function DUF48"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59809"
FT                   /db_xref="GOA:D7APZ9"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019858"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:D7APZ9"
FT                   /inference="protein motif:TFAM:TIGR00287"
FT                   /protein_id="ADH59809.1"
FT                   /translation="MQKSLYLTSNGRLRRHENTLYFETEVEKRSIDIENVEQIHIFGEV
FT                   DLNTKALNYISQYGIVLHFYNYYGFYAGSFLPRKKNVSGDVVVRQALHYLDREKRLFLA
FT                   YCFVESAVYHMMRNLRERKEAEAFLIAIEDEWEKGRFNISSIAELMGLEGRIRNIYYQS
FT                   FNWFLPEDFVMEKREKRPPTNPINALISFGNSLIYSHTLSQIYQTQLDPTISFLHEPSE
FT                   KRFSLSLDISEIFKPLIVDTVIFKLLNNSKLTLEHFDEDLNYCYLNHEGRKIFLKELQN
FT                   KLETTVRHRQLNRNVSYKSFIRLECYKLIKHFIGDQVYSPLKAWW"
FT   gene            complement(27273..27785)
FT                   /locus_tag="Tmath_0023"
FT   CDS_pept        complement(27273..27785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0023"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /note="KEGG: csc:Csac_0319 CRISPR-associated Cas4 family
FT                   protein; TIGRFAM: CRISPR-associated protein Cas4; PFAM:
FT                   CRISPR-associated protein Cas4"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59810"
FT                   /db_xref="GOA:D7AQ00"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQ00"
FT                   /inference="protein motif:TFAM:TIGR00372"
FT                   /protein_id="ADH59810.1"
FT                   /translation="MEDIQEISDVRFQGIKINYLYVCKRKLWLFSKNITFENTSDKVLL
FT                   GKVLHEYSYPKENAKEVLIDNLIMIDILSDGSIREVKYSSKMKEADIMQVMYYLYYLKQ
FT                   KGIQKQGIINYPKEKRKEVLELTPEYEEKVKQALKEIEEITTKPIPPPVQKQKICKSCA
FT                   YYEFCWG"
FT   gene            complement(27805..30138)
FT                   /locus_tag="Tmath_0024"
FT   CDS_pept        complement(27805..30138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0024"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: CRISPR-associated helicase Cas3;
FT                   CRISPR-associated HD domain protein; PFAM: helicase domain
FT                   protein; KEGG: csc:Csac_2397 CRISPR-associated helicase
FT                   Cas3; SMART: helicase domain protein; metal-dependent
FT                   phosphohydrolase HD region; DEAD-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59811"
FT                   /db_xref="GOA:D7AQ01"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQ01"
FT                   /inference="protein motif:TFAM:TIGR01587"
FT                   /protein_id="ADH59811.1"
FT                   /translation="MKIESYKDIELYAKRFKGDKGSEYQTIYQHTVDLLNNMEKLFEEY
FT                   EEEIGEGCKKLQIDYQKLKYLLKLAIIYHDLGKANSKFQQKIRERTKVHEVPQVKGLSK
FT                   EVPHNFLSTAFVDLEDEIEKGNITYEDFQNLLFTIAFSHDRDFDVDFQYFNKYICEDVS
FT                   KYIENQTLKPLLELLPSVPDRYKMVESSNYTYRVINQLRELMLKDSYDLSDKKVVFRIL
FT                   LKGLLHRLDHSSSAGINAEEAKINDFPEKVEVYLKRKGSFTGFKNFQKKAIELSEKSVV
FT                   LFAPTGSGKTEFGLNWAFKSKLIYTLPIRVSINAMYERLAKVFGEDKVGILHSDSMIYL
FT                   LEKHMDLERGNQELEALFDSVDLAKNLSLPIIVTTGDQIFTSALKWPGFEKIYSLFLYS
FT                   KIIIDEPQSYSPESLAIIIKTLEEIINLNGKFCLMSATINPLILKYLGDYAEYVQAYSD
FT                   EDLKRRYSHIISIKELSILDCVAEIIEHAKQKNVLVICNTVKRSQEVYQVIKENLKKFE
FT                   EIPVELLHSRFLEGQKRQKEQIVISDKRKNGIIISTQLVEASLDIDYDILFTELASADS
FT                   LLQRMGRVYRKRTYNELRPNVIILTKDPSGVGKVYQKEIVDRTEAFLKKFDGNKITEYD
FT                   KKELNEYVYDIDALSSTNFISKFKKAYELLELGFRADRKIEAQKIFRDVVTISGIPREI
FT                   FDKNIEEINEALKKINSKSTKSIEKLKLISSIKKYTVTAPAYFFARGGASCYDKDLGLY
FT                   ILDCEYDDQLGLIPPKELEQSDIW"
FT   gene            complement(30128..30874)
FT                   /locus_tag="Tmath_0025"
FT   CDS_pept        complement(30128..30874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0025"
FT                   /product="CRISPR-associated protein Cas5 family"
FT                   /note="KEGG: ate:Athe_0124 CRISPR-associated protein Cas5
FT                   family; TIGRFAM: CRISPR-associated protein Cas5 family;
FT                   CRISPR-associated protein Cas5; PFAM: protein of unknown
FT                   function DUF522"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59812"
FT                   /db_xref="GOA:D7AQ02"
FT                   /db_xref="InterPro:IPR013337"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQ02"
FT                   /inference="protein motif:TFAM:TIGR01895"
FT                   /protein_id="ADH59812.1"
FT                   /translation="MLNSLLKIKIYQPFANFRKPFSYGIVDSYPLPPPSTVKGWLHNIL
FT                   GAREGKYYKMAVSICGKFNSVVYDIQRIIKFDRLRGENDNAPVVNEVSARVVNGIIYVT
FT                   NLVDVQLCIHVNAERDVLEKIYKNIFDSYWGLGRKEDLMRIDEIKLFEPRKVEYRKYIK
FT                   KRPPEIGMYLKSSTAETLMIDGIRFRLNNRYEKTKDGLRIFTDKKDIVFIETLEQLNPM
FT                   AMVDKEVMVDDENIIIDLIGDEEYEN"
FT   gene            complement(30877..31806)
FT                   /locus_tag="Tmath_0026"
FT   CDS_pept        complement(30877..31806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0026"
FT                   /product="CRISPR-associated autoregulator, DevR family"
FT                   /note="TIGRFAM: CRISPR-associated regulatory protein, DevR
FT                   family; CRISPR-associated autoregulator DevR family; KEGG:
FT                   csc:Csac_2399 CRISPR-associated autoregulator DevR family
FT                   protein protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59813"
FT                   /db_xref="InterPro:IPR010154"
FT                   /db_xref="InterPro:IPR013414"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQ03"
FT                   /inference="protein motif:TFAM:TIGR02585"
FT                   /protein_id="ADH59813.1"
FT                   /translation="MNKNAGITITVVFEAMSLNYGESLGNISELKKLTRENKVYTYMSR
FT                   QALRFEKYRFMVENAGMKETPVTGDEQVVQFKKEATIAEYPEIDLFGYMKTSGQRQNAQ
FT                   TRTAVVKITPAVSLEEYKNDVEFATNLNLAKRANTNPNPYQLEQHKSLYTYTVAIDLDR
FT                   LGKDFNEKGEVVEEISAGEKLKRLYSSFDAIKFLSREIKGRRENLSPLFAIGGLYPIKN
FT                   PFFLNRIRLIKEDSAYAIDPRLLHSTCELTLPNGKKVFDYTLLGILEGFFVNEEELKKL
FT                   LPASSGTIDYFFENLKERARKYYEEGTV"
FT   gene            complement(31799..33445)
FT                   /locus_tag="Tmath_0027"
FT   CDS_pept        complement(31799..33445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0027"
FT                   /product="CRISPR-associated CXXC_CXXC protein Cst1"
FT                   /note="KEGG: csc:Csac_2400 CRISPR-associated Cst1 family
FT                   protein; TIGRFAM: CRISPR-associated CXXC_CXXC protein Cst1;
FT                   PFAM: CRISPR-associated protein, CXXC-CXXC region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59814"
FT                   /db_xref="InterPro:IPR010180"
FT                   /db_xref="InterPro:IPR019121"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQ04"
FT                   /inference="protein motif:TFAM:TIGR01908"
FT                   /protein_id="ADH59814.1"
FT                   /translation="MKERVYLGDWAYNAGIIGFIDIMLDGKDITSQNIITIGPNYIEFD
FT                   RNSLQGFSDKFFKKAYQRYPRTDELIDLGNKLLQRLENNDFDKNLKQEVSNFKKRVEGF
FT                   SKLKQLVDSRKLTLPRNFNKTDAEQYVSQITDLLNANKQGLIEDNVKTYLKNASSICGD
FT                   RSFLNRNFKGELKKKFFDDFEGPIVNQTNRQDKNHDCIFCGLRPAKKDALLDTGLVSFL
FT                   GANKDNKNFFWNFKPQLPICEICELIYFCIFAGLTEFRIGQTKKFYFVDRNTSVLELYQ
FT                   TNKLFMEMMSREENILKEKGILNFINDYLLLKLKEESKFRLANIMFIEIDLTSSVTPKL
FT                   YGFSITKQKAEFINSNFDIFKKIAGSFIKFKDNNIYPFSEFMQKFMNNTLSFQFLSFLE
FT                   GEYLSSQKPNSKINTNLSPYRLQMYNILTYKYLKSIKRGGELMDEKWLWKMYFFGQELK
FT                   KKFLSSKAENKITSLAYRLISALRIGDVNTFMNLIIRTYMSYNMEVPALFVSCINDRDN
FT                   FCALGYSFVNGLLGSEKDEKVENSEEVVGNE"
FT   gene            complement(33474..34259)
FT                   /locus_tag="Tmath_0028"
FT   CDS_pept        complement(33474..34259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0028"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /note="KEGG: csc:Csac_2401 CRISPR-associated Cas family
FT                   protein; TIGRFAM: CRISPR-associated protein Cas6; PFAM:
FT                   protein of unknown function DUF57"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59815"
FT                   /db_xref="GOA:D7AQC9"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQC9"
FT                   /inference="protein motif:TFAM:TIGR01877"
FT                   /protein_id="ADH59815.1"
FT                   /translation="MRAKFIFEIANPKTEIFELPIYYRTLFMSFLKNALSEYNQEYFKK
FT                   LYWWKDKKNKWQKPFVFAVNLPNMNFADDKVMFRGDIVLNLSTSDYEFLVNMYNSLINN
FT                   HLYPYNLTDNCKIKLKRMYLVKEPEQFNRVMAFKTFSPILIEKKGESKKIPVLPYEDGF
FT                   EDVFNEVIDFEIRNIRSLRGQNRGLQKKIIFKPINVQKTVIKHRISEFVENTNKNYMYL
FT                   TGFIGLFELSGTPEDLKEIYQNGIGFRRGQGFGFIEVAK"
FT   gene            complement(34430..35455)
FT                   /locus_tag="Tmath_0029"
FT   CDS_pept        complement(34430..35455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0029"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   tex:Teth514_0011 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59816"
FT                   /db_xref="GOA:D7AQD0"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQD0"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADH59816.1"
FT                   /translation="MSILHTPLKIKDITIKNRIMMSPMCMYTASTEGIPNDWHIVHYAT
FT                   RAIGGVGLIMQEATAVESRGRITDRDLGIWNDEQAKELKKIVDICKANGAAVGIQLAHA
FT                   GRKCDILYEDVVGPSPIKAGDNYKLPRELSIEEIKSIVKAFGEAARRAHLAGYDVVEIH
FT                   AAHGYLIHEFLSPLSNKRKDEYGGSIENRARFLIEVIEEVRKNWPQTKPIFVRVSADDY
FT                   IEGGINIDMMVDYINMIKDKVDLIDVSSGGLLSADINLYPGYQVKYAETIKKRCNIKTS
FT                   AVGLITTQELAEEILSNKRADLVALGRELLRNPYWVLHTYTSREDWPKQYERAFKKGSL
FT                   L"
FT   gene            36066..36569
FT                   /locus_tag="Tmath_0030"
FT   CDS_pept        36066..36569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0030"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="KEGG: tex:Teth514_0012 acetolactate synthase, small
FT                   subunit; TIGRFAM: acetolactate synthase, small subunit;
FT                   PFAM: Acetolactate synthase, small subunit-like; amino
FT                   acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59817"
FT                   /db_xref="GOA:D7AQD1"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQD1"
FT                   /inference="protein motif:TFAM:TIGR00119"
FT                   /protein_id="ADH59817.1"
FT                   /translation="MHIISVLVNNHPGVLSRVVGLFSRRGYNIESLAVGTTEREDISRI
FT                   TLTVGEDEYTVTQVIRQLNKLVDVLKVQNIGARDNVSRELLLVKVGYDSNTRDDIMHIV
FT                   DTFRAKVIDISIDSLIIELTGDNEKINAFINLINKFDVKELVRTGLVSLERGSKTLKEY
FT                   KGEL"
FT   gene            36569..37564
FT                   /locus_tag="Tmath_0031"
FT   CDS_pept        36569..37564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0031"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="TIGRFAM: ketol-acid reductoisomerase; KEGG:
FT                   tex:Teth514_0013 ketol-acid reductoisomerase; PFAM:
FT                   Acetohydroxy acid isomeroreductase catalytic domain
FT                   protein; acetohydroxy acid isomeroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59818"
FT                   /db_xref="GOA:D7AQD2"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQD2"
FT                   /inference="protein motif:TFAM:TIGR00465"
FT                   /protein_id="ADH59818.1"
FT                   /translation="MAKMYYDKDADLNLLKNKKIAIIGFGSQGHAHALNLRDSGLDVVV
FT                   GLYKGSKSKERAEKEGLTVLTVEEAAKVADIIMMLIPDEKQAEVYKESIEKNLTEGKAL
FT                   AFAHGFNIHFKQIIPPKNVDVFMVAPKGPGHLVRRVYQEGKGVPNLVAVYQDYTGKAFE
FT                   IALAYAKGIGGTRAGVIETTFREETETDLFGEQAVLCGGVTELMKAGFETLVEAGYQPE
FT                   IAYFECVHEMKLIVDLIYEGGFSYMRYSISDTAEFGDYMTGKRIITEETRKEMKKVLSE
FT                   IQSGKFAKEWLLENQVGRPQYNAMKDKEASHLIEKVGKSLREMMAWIKKE"
FT   gene            37583..38776
FT                   /locus_tag="Tmath_0032"
FT   CDS_pept        37583..38776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0032"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   tpd:Teth39_0015 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59819"
FT                   /db_xref="GOA:D7AQD3"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQD3"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ADH59819.1"
FT                   /translation="MGVKRVIVFDTTLRDGEQTPGVNFNINEKFEIAKQLATLGVDVIE
FT                   AGFPAASNGDFEAVKNVADKIKGVTIAGLARAVKEDIDRASNALKNAERSRLHVFIATS
FT                   DIHLKYKLKMSREETLKRAVEMVKYARRKFDEIEFSAEDASRTDWDFLVKVFSEVIEAG
FT                   ANVINIPDTVGYAMPREFGELVKYIKNNVPNIDGVIISAHCHNDLGLAVANSLSAIENG
FT                   ATQVEVAVNGIGERAGNAALEEVIMALNTRKDYFGLVHGINTKEIYNTSKLVSKLTGID
FT                   IPPNKAIIGANAFRHQAGIHQHGIINNRATYEIMKPEDIGINPDTFALGKLSGRNAFEL
FT                   KAKQLGYNLSPGELNEAFRRFKDLADRKKVIIDEDIRFVVEETLEEFRSFKEGEAWA"
FT   gene            38767..40023
FT                   /locus_tag="Tmath_0033"
FT   CDS_pept        38767..40023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0033"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /note="KEGG: tex:Teth514_0015 3-isopropylmalate dehydratase
FT                   large subunit; TIGRFAM: 3-isopropylmalate dehydratase,
FT                   large subunit; 3-isopropylmalate dehydratase; homoaconitate
FT                   hydratase family protein; PFAM: aconitate hydratase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59820"
FT                   /db_xref="GOA:D7AQD4"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011823"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQD4"
FT                   /inference="protein motif:TFAM:TIGR02083"
FT                   /protein_id="ADH59820.1"
FT                   /translation="MGLTLTQKILSAKIGREVKAGELIEVDVDMVLGNDVTAPVAIKEF
FT                   EKIGKEEVFDKTKIALVPDHFVPNKDIKSAEQVNIMRKFAKKHGIVNFFEVGQMGIEHA
FT                   LLPEKGLVLPGDVVIGADSHTCTYGALTCFSTGVGSTDMAAAMATGKAWFKVPEAIKFV
FT                   LKGNLQKWVSGKDVILYIIGKIGVDGALYKSMEFTGNIKALSIDDRFTIANMAIEAGAK
FT                   NGIFDFDEITEAYVKGRAKREYKVFERDEDAEYSEVYEINLDEIRPQVAFPHLPENTRS
FT                   IDEVGKVKIDQVVIGSCTNGRLSDMEIAYKILKGKKVHPDVRLLIFPATQEIYLECVKR
FT                   GYIEEFIKAGAAVSTPTCGPCLGGHMGILARGERALATTNRNFVGRMGHPESEVYLSSP
FT                   AVAAASAIAGYIVSPEEVE"
FT   gene            40023..40505
FT                   /locus_tag="Tmath_0034"
FT   CDS_pept        40023..40505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0034"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="KEGG: tex:Teth514_0016 3-isopropylmalate dehydratase
FT                   small subunit; TIGRFAM: 3-isopropylmalate dehydratase,
FT                   small subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59821"
FT                   /db_xref="GOA:D7AQD5"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011824"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQD5"
FT                   /inference="protein motif:TFAM:TIGR02084"
FT                   /protein_id="ADH59821.1"
FT                   /translation="MQGKAIKYGDNIDTDVIIPARFLNTSDPQELAQHCMEDLDKDFKN
FT                   KVKEGDILVVGENFGCGSSREHAPIAIKASGISCIIAKSFARIFFRNAINIGLPILECK
FT                   EAVDGIEEGDMVLVDTDNGIIKNLTKGTEFKAQPFPEFIKEIMKYGGLINYVRKKV"
FT   gene            40508..41575
FT                   /locus_tag="Tmath_0035"
FT   CDS_pept        40508..41575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0035"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydrogenase; KEGG:
FT                   tpd:Teth39_0018 3-isopropylmalate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59822"
FT                   /db_xref="GOA:D7AQD6"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQD6"
FT                   /inference="protein motif:TFAM:TIGR00169"
FT                   /protein_id="ADH59822.1"
FT                   /translation="MFKIAVLPGDGIGPEVIEEGLKVLSAIEKKYKLKFDVKKYHFGGE
FT                   AIDKYGVPYPEETKNACLSSDAVLLGAVGGPKWDNLEGDKRPEAGLLALRKSLGVYANL
FT                   RPAVLYPPLKEASPLKNELLKEGLDILVVRELTGGIYFGPRGTVTIDYGFKAYDTEVYQ
FT                   TSEIERIAVIAFEAALKRKKKVTSVDKANILDSSRLWRKTVDEVSKRYPEVELNHMYVD
FT                   NCAMQLVKNPSQFDVILTSNMFGDILSDEAAQIVGSIGVLPSASLREDKVGLYEPIHGS
FT                   APDIAGTKKANPLATILSVAMMLEYSFNLLDAANDIKDAVNKVLEAGYRTFDLGEGIIL
FT                   NTQEMGDKVVEYIKG"
FT   gene            41572..43251
FT                   /locus_tag="Tmath_0036"
FT   CDS_pept        41572..43251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0036"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="TIGRFAM: dihydroxy-acid dehydratase; KEGG:
FT                   tpd:Teth39_0019 dihydroxy-acid dehydratase; PFAM:
FT                   dihydroxy-acid and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59823"
FT                   /db_xref="GOA:D7AQD7"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQD7"
FT                   /inference="protein motif:TFAM:TIGR00110"
FT                   /protein_id="ADH59823.1"
FT                   /translation="MRILISESIKKGVEKAPHRSLLYALGLTYEEIKRPIIGVANSKNE
FT                   IIPGHIHLDKIAEAVKAGIRMAGGTPIEFSTIGVCDGIAMNHKGMKYSLGSRELIADSI
FT                   EIMATAHGFDGLVLIPNCDKIVPGMLMAAARLNIPAIVVSGGPMLAGKCNGDVCDLSSV
FT                   FEAVGAHKIGKISDEDLYKIELNACPTCGSCSGMFTANTMNCLTEALGMGLPGNGTIPA
FT                   VYSERIRLAKQAGMKIMELVERGIKPSDILTKEAFINAFSLDMALGGSTNTILHLKAIA
FT                   HEAGVEISLDEINDISGRVPNLCKLSPAGKYHIEDLYFAGGVSAVLKELTKANLINAEV
FT                   LTVTGKTLGENIKDAKILNHDVIRPIDNPYSSTGGLVIMYGNIAKEGAVVKASAVAEEM
FT                   LRHEGPAKVFDSEEEAIKAIYGGKIQKGDVVVIRYEGPKGGPGMREMLSPTSALAGMGL
FT                   DKDVALITDGRFSGATRGASIGHVSPEAMEGGEIAILQDGDIIEIDIPARKINVKLSEE
FT                   EIKERLKKWVRPEPKIKTGYMARYAKQVTSASKGAVFKGGAL"
FT   gene            43248..44912
FT                   /locus_tag="Tmath_0037"
FT   CDS_pept        43248..44912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0037"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="KEGG: tex:Teth514_0019 acetolactate synthase, large
FT                   subunit, biosynthetic type; TIGRFAM: acetolactate synthase,
FT                   large subunit, biosynthetic type; PFAM: thiamine
FT                   pyrophosphate protein TPP binding domain protein; thiamine
FT                   pyrophosphate protein central region; thiamine
FT                   pyrophosphate protein domain protein TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59824"
FT                   /db_xref="GOA:D7AQD8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQD8"
FT                   /inference="protein motif:TFAM:TIGR00118"
FT                   /protein_id="ADH59824.1"
FT                   /translation="MILKGAQVVIEVLKEVGIDTIFGIPGGAVIPIYDALYDSDLRHIL
FT                   ATHEQMAAHMADGYARVTGRVGVCFATSGPGSTNLVTGIANAYMDSVPVVAITGQVPTN
FT                   LIGKDAFQEVDITGITMPITKHNFIVKSPDKLTDTIRQAFAIAKSGRPGPVLVDIPKDI
FT                   QNADIEYVKGIGDSIDIKNDINGVVSQKELDKAIELILQSKKPVIFAGGGVIWGEASNE
FT                   LVEFAEKTNIPVATSLMGLGAFPEDHPLSLGLIGMHGSRFANLAVYKSDLVIAIGTRFS
FT                   DRVAGKAGGLAPNAKIIHIDIDPAELGKNVEVDVAIIGKVKEVLRLLMNKLSFIERKEW
FT                   LEEISFLREKHGLKYKNDEVLRPQWIVEKIQQLSNDDLIIATEVGQNQMWAAQYYKFKQ
FT                   PRTFVTSGGLGTMGFGLPAAIGAQVGKPDKRVVNIAGDGSLRMNIHALETAAVYNIPVI
FT                   TVLLNNRTLGMVRQWQNLLYNKRFSQTDLNANLNFANLANDFGVEGIRVTTKEEFEKAF
FT                   KKAYSQKRPFMIECIIDKDEMVLPFIPAGGTVENTIG"
FT   misc_binding    44910..45024
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam
FT                   (RF00050), score 115.80"
FT   gene            45110..46192
FT                   /locus_tag="Tmath_0038"
FT   CDS_pept        45110..46192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0038"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="1.1.1.193"
FT                   /EC_number="3.5.4.26"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibD; KEGG:
FT                   tex:Teth514_0020 riboflavin biosynthesis protein RibD;
FT                   PFAM: bifunctional deaminase-reductase domain protein;
FT                   CMP/dCMP deaminase zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59825"
FT                   /db_xref="GOA:D7AQD9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQD9"
FT                   /inference="protein motif:TFAM:TIGR00326"
FT                   /protein_id="ADH59825.1"
FT                   /translation="MEEYMKRALTLAKKGWGYTNPNPLVGAVIVKNGKIIGEGYHEYFG
FT                   GPHAEVNALKNAVENVEGSTMFVTLEPCSHYGKTPPCVEEIIKSGIKRVYIAMEDPNPK
FT                   VSGNGIKRLKEAGIEVHVGMMEKEARKLNEIFVKYITTKFPFVILKSAMSIDGKIACYN
FT                   GNSKWITNGKSREFAHKIRGRVSAIMVGVNTVIKDNPMLTTRLEGYKNPVRIIVDSRGR
FT                   IPLDSNVIRDKTAKTIIATTELMPNNVRKKLEDMDIEVIILKNDNGKVPLKELMIKLGE
FT                   RGIDSVLIEGGGTLNWSAFKEGIVDKVMFFISPRIIGGKNALTPVEGIGFSDIGNSIEL
FT                   KDVEIDRIDDDILITAYVRK"
FT   gene            46203..46826
FT                   /locus_tag="Tmath_0039"
FT   CDS_pept        46203..46826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0039"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number="2.5.1.9"
FT                   /note="TIGRFAM: riboflavin synthase, alpha subunit; KEGG:
FT                   tex:Teth514_0021 riboflavin synthase, alpha subunit; PFAM:
FT                   Lumazine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59826"
FT                   /db_xref="GOA:D7AQE0"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQE0"
FT                   /inference="protein motif:TFAM:TIGR00187"
FT                   /protein_id="ADH59826.1"
FT                   /translation="MFTGIIEETGTVKNITHGTFTKIVIKCSKVLEETKIGDSIAVNGV
FT                   CLTVTNISDESFAADVMPETMRASNLKDLKTGSIVNLERALQVGRRMGGHIVTGHIDCV
FT                   GKIIEKRQEKNAFIFKIAINEKFTKYIARKGSIAVDGISLTVVEDGYDYFTVSVIPHTM
FT                   LKTTLGYKGVGDSVNIEVDILSKYVEKLIGKKDIKDLLKENGFI"
FT   gene            46864..48054
FT                   /locus_tag="Tmath_0040"
FT   CDS_pept        46864..48054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0040"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="KEGG: tex:Teth514_0022 GTP cyclohydrolase II;
FT                   TIGRFAM: 3,4-dihydroxy-2-butanone 4-phosphate synthase; GTP
FT                   cyclohydrolase II; PFAM: 34-dihydroxy-2-butanone
FT                   4-phosphate synthase; GTP cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59827"
FT                   /db_xref="GOA:D7AQE1"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQE1"
FT                   /inference="protein motif:TFAM:TIGR00506"
FT                   /protein_id="ADH59827.1"
FT                   /translation="MFDRIEDAIEDIKQGKMIIVVDDENRENEGDLVMAAEKVTGEHIN
FT                   FMIKYGRGLVCVPMTEKRLNELGIYQMVENNTDHKETAFTVSVDYKECTTGISAFERAL
FT                   TVKKLVDDNSKPEDFTKPGHIFPLRAKDGGVLVRAGHTEAAVDLAVLAGLKPAGVICEI
FT                   IKDDGNMARLPDLLEFAKKFGLRIISIEDLIKYRMKNEILVRRVAQAKLPTKYGNFEIV
FT                   GYEEILTGKQHVALIKGDVNKEPVLVRIHSECLTGDILGSLRCDCGDQLHAAMERIGQE
FT                   GGVLVYLRQEGRGIGLLNKIKAYHLQDQGLDTVEANIKLGFPPDLREYNIAAQILKDIG
FT                   VKKIRIMTNNPQKITELSDYGLDVVERVSIEICPNHYNEKYLKTKKEKMGHLILEV"
FT   gene            48132..48596
FT                   /locus_tag="Tmath_0041"
FT   CDS_pept        48132..48596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0041"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /note="KEGG: tex:Teth514_0023 riboflavin synthase; TIGRFAM:
FT                   6,7-dimethyl-8-ribityllumazine synthase; PFAM:
FT                   67-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59828"
FT                   /db_xref="GOA:D7AQE2"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQE2"
FT                   /inference="protein motif:TFAM:TIGR00114"
FT                   /protein_id="ADH59828.1"
FT                   /translation="MKIYEGKLIAEGKKFGIVVSRFNEFITNKLLEGALDALKRHGALN
FT                   ENIEIAWVPGAFEIPLIAKKMAESKRYDAVIALGAVIRGETPHFDYVANEVSKGIAKIS
FT                   LDTEVPVIFGVLTTDTIEQAIVRAGTKGGNKGFEAAVTAIEMANLMEEIK"
FT   gene            complement(48615..49679)
FT                   /locus_tag="Tmath_0042"
FT   CDS_pept        complement(48615..49679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0042"
FT                   /product="sporulation integral membrane protein YtvI"
FT                   /note="KEGG: tex:Teth514_0024 hypothetical protein;
FT                   TIGRFAM: sporulation integral membrane protein YtvI; PFAM:
FT                   protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59829"
FT                   /db_xref="GOA:D7AQE3"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="InterPro:IPR014227"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQE3"
FT                   /inference="protein motif:TFAM:TIGR02872"
FT                   /protein_id="ADH59829.1"
FT                   /translation="MNNYLKYSDIIKKIILIVSVFIIFYLVIFKIIPFLMPFVMALIFA
FT                   VIIDPGVNFLEKKLKVPRGLASFILLLILIGVIGSLIAIIVTQLIYELSSLAEISTNYA
FT                   NTINDAILNLVDRIRTYYISLPPNITSLIESNMYSILNYISLFAKNLATWLLNFATKLP
FT                   NFFFMTLITLVATFFISKDKNLILDFIKRQIPSHWAQHAKNIQIDLLKTFFGYLRAVAA
FT                   IMLITFLEVSIGLVIIGFDYPFLLGLFVTIVDALPVLGSGSVMIPWALYNIIIIKNYMV
FT                   GIYLLILYILVVVVRQMIEPKIVGQSIGLHPLVTLLSMFIGVKLFGALGLIIGPVFVVV
FT                   FKALQRAEIIPPWK"
FT   gene            complement(49764..49934)
FT                   /locus_tag="Tmath_0043"
FT   CDS_pept        complement(49764..49934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59830"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQE4"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0027"
FT                   /protein_id="ADH59830.1"
FT                   /translation="MREIEYLLDLAEIKDTEYKNLLALLSLIDLLVEKGIITRHELAQK
FT                   SKEIAKIKTAL"
FT   gene            50072..50602
FT                   /locus_tag="Tmath_0044"
FT   CDS_pept        50072..50602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0044"
FT                   /product="signal peptidase I"
FT                   /note="KEGG: tpd:Teth39_0028 signal peptidase I; TIGRFAM:
FT                   signal peptidase I; PFAM: Peptidase S24/S26A/S26B,
FT                   conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59831"
FT                   /db_xref="GOA:D7AQE5"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQE5"
FT                   /inference="protein motif:TFAM:TIGR02227"
FT                   /protein_id="ADH59831.1"
FT                   /translation="MDKNVQKEILSWIFTIALAFLIALFIRTYVFELVDVPTGSMLDTI
FT                   QLNDKFIVNKFIYKFEPVKRGDIVVFRFPDNPKVNFVKRVIGIGGDVIEIKNGVLIRNG
FT                   EVVKEPYIKEPMKGNFGPYVVPPGHYFMLGDNRNESMDSRFWQHKYVSKDQILGKIVFR
FT                   IWPPNRVGSMSGK"
FT   gene            50872..52143
FT                   /locus_tag="Tmath_0045"
FT   CDS_pept        50872..52143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0045"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="TIGRFAM: seryl-tRNA synthetase; KEGG:
FT                   tpd:Teth39_0029 seryl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Seryl-tRNA synthetase,
FT                   class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59832"
FT                   /db_xref="GOA:D7AQE6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQE6"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ADH59832.1"
FT                   /translation="MIDVKRIRGNPEAIKRAIELKKDKADIDKFLKLDERRRQMLVELE
FT                   ALKNRRNVESDNIAKLKREGKDVSDLIAEMKELSSKIKEMEQEVKEVEEQLEGILWTIP
FT                   NIPHESVPIGDSDEDNVEVRRWGEPRKFDFEPKSHWEIGEELDILDFEAAARVTGSRFT
FT                   FYKGLGARLERALINFMLDLHVEKHGYTEVFPPFIVHRRSMLGTGQLPKFEEDAFKVYG
FT                   TDYFLIPTAEVPVTNMYRDTIIDGDKLPIYHCAYSACFRQEAGSAGRDTRGLIRQHQFN
FT                   KVELVKFTEPDKSYEELEKMTKDAEEVLQLLGLPYRVVAICTGDLGFTASKKYDIEVWM
FT                   PSYGRYVEVSSCSNCEDFQARRANIKYRPKDGSKAQYVHTLNGSGVAVGRTFAAILENY
FT                   QQEDGSVVIPEVLRPYMRVDIIKK"
FT   gene            52197..52286
FT                   /locus_tag="Tmath_R0001"
FT                   /note="tRNA-Ser1"
FT   tRNA            52197..52286
FT                   /locus_tag="Tmath_R0001"
FT                   /product="tRNA-Ser"
FT   gene            52319..52412
FT                   /locus_tag="Tmath_R0002"
FT                   /note="tRNA-Ser2"
FT   tRNA            52319..52412
FT                   /locus_tag="Tmath_R0002"
FT                   /product="tRNA-Ser"
FT   gene            complement(52439..53659)
FT                   /locus_tag="Tmath_0046"
FT   CDS_pept        complement(52439..53659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0046"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="KEGG: tte:TTE0026 transcriptional regulator;
FT                   TIGRFAM: cell envelope-related function transcriptional
FT                   attenuator, LytR/CpsA family; PFAM: cell envelope-related
FT                   transcriptional attenuator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59833"
FT                   /db_xref="GOA:D7AQE7"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQE7"
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /protein_id="ADH59833.1"
FT                   /translation="MKKTLKIIIFIVIGIILSVGVGTYIFYKNIHGPASHEKDTSAVNK
FT                   NKSQNNKIENIKRKNILFVGSDENNLSDTILIINYDPLNKKINILSIPRDTYYPRPGFN
FT                   APEEKKINAAFSEEKIDGLKNAVENLLNIKIDNYVILNYEGFKKIIDTIGGVEVDVPFN
FT                   MKYDDNSANPPLHINLKKGRQVLDGEKAIQFIRYRHGYVDGDLGRIKAQHQFLEALLKK
FT                   ILQPSILPKVPSLAITISQYLKTDLSASEITQYAYQFIKDKPSTIDAIALPGEGGYEGN
FT                   TSYFFVDSIKTQEIVKELFIDEVSNSNISTTSSLENKNIKIEILNGAGIPGLATKYAEI
FT                   LKNEGFNVVKIGNVVGMTFNSSRVYARTDEEKAKKVAKALFITNVEKDISPDVKVDVTV
FT                   ILGKDKK"
FT   gene            53877..56606
FT                   /locus_tag="Tmath_0047"
FT   CDS_pept        53877..56606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0047"
FT                   /product="protein of unknown function UPF0182"
FT                   /note="PFAM: protein of unknown function UPF0182; KEGG:
FT                   amt:Amet_0022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59834"
FT                   /db_xref="GOA:D7AQE8"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQE8"
FT                   /inference="protein motif:PFAM:PF03699"
FT                   /protein_id="ADH59834.1"
FT                   /translation="MKKPNIFLISLIILIFAILGIIVSLVNFIVDFQWFSDLHYLDVFF
FT                   KKFLTQFTMGVPIFILVFMVLYFYADKIIRDYVNFAQDIIVKKNVNIYRRVGIVVSLLT
FT                   ALFITLYAATNWWNDLLFFVNSVNFNETDPIFHKDISFYMFKLPLLYDIYNLLIVFIPV
FT                   MIVVIIIAYGLIYLSDKTRFYEISDRDGNLFKAIYNKDILIKAFKELVLLGFIFFVLMG
FT                   IGYYLKTFKLLYSTKGIVFGATYTDIHVSLQFYRALAIVSFVAAILLLVGFYRKNIKYI
FT                   VAAPAIIIILAAIMVLTETAVQNLIVSPNELDKEKKYINYNIEYTKKAFGLDRVTEKNY
FT                   DMKKELTPKVLEENKATIDNIMINDYRPVKQAYNQLQAIRLYYKFNDIDIDRYTINGKY
FT                   RQVFLAAREMDHESLSPQAKTWINLHLKYTHGYGVVMSLVNDVTPTGQPAMIIKNVPPS
FT                   TNTDIKIDRPEIYFGELTNNYAIVNTKTGEFDYPSGDKNVQTNYKGTTGIPMTFINRIL
FT                   FSIYTGDARILLSADITKDSKILIYRNIEQRVSKIAPFLLYDDDPYIVIDNGKLYWIID
FT                   AYTYSTNYPYSQPYGSMGINYIRNSVKVVIDAYNGDVKYYISDNNDPLVKVYSKIFPTL
FT                   FRDIKEMPHGLKQHIRYPQFLFDIQAEVYKNYHMTDPQVFYNKEDAWDIAKEKFEDKIE
FT                   YQESQYMIMKLPGETKEEYILMIPYTPATKANMVAWMAARMDGKNYGKLIVYKFPKNTI
FT                   IYGPLQIENMIDQDPNISKELSLWNQQGSTVNRGNLLSIPIDDSMLYVEPLYIQSQNQN
FT                   ALPEVKRVIVAYKDQIVMEDTLKNALNKLFNLNAQQISQQTVPSNTANDTQKQLIEKAH
FT                   ETYQNAMEAVKNGNWTDFGKYMDELKQILNELNESVKK"
FT   gene            56675..56751
FT                   /locus_tag="Tmath_R0003"
FT                   /note="tRNA-Arg1"
FT   tRNA            56675..56751
FT                   /locus_tag="Tmath_R0003"
FT                   /product="tRNA-Arg"
FT   gene            complement(56837..57958)
FT                   /locus_tag="Tmath_0048"
FT   CDS_pept        complement(56837..57958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0048"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   tpd:Teth39_0030 phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59835"
FT                   /db_xref="GOA:D7AQE9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQE9"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADH59835.1"
FT                   /translation="MRGHIRKRGTTYSIVVDVGRDENGKRKQKWISGFKTKKEAEKALA
FT                   EIIAKIEKNEFIEPSKITLQQFINEWLKIYGEPKWAPKTLISNKSLINNYIIPNLGHIE
FT                   LQKLKPVEIQKFYNFLKEKQLSNTTVNYVHKLLNQVLKFAVKWQYIAKNPCELVEAPKK
FT                   DKKEFVTWNFEHVKKAKKIFKDTPIYIHVMIALHTGLRLGEICGLRWEDIDFKNQTITV
FT                   RRTAQRIDGRFIFKEPKTETSKGIIAIPDFLVQILKQEKNKQLQNKLIFGEKYITEYEG
FT                   FISVWEDGRFKEPDYVTKKFKKILQKQSEIPVIRFHDLRHTHATLMLRSGVDLKTISKR
FT                   LRHGRISTTADFYSHVDLEMEREALRKLEANLS"
FT   gene            complement(58019..58786)
FT                   /locus_tag="Tmath_0049"
FT   CDS_pept        complement(58019..58786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0049"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="KEGG: tpd:Teth39_0031 phospholipase
FT                   D/transphosphatidylase; PFAM: phospholipase
FT                   D/Transphosphatidylase; SMART: phospholipase
FT                   D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59836"
FT                   /db_xref="GOA:D7AQF0"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQF0"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ADH59836.1"
FT                   /translation="MNGNYIKPFISDNVSCSLYLGRNAGERIKNYIRNAKKSIKIFSPY
FT                   FSAELIDLLLEKTESVKDIKLISSFKISDLYNPMNFNLLRKIILQKRYVDEDSVNKRKS
FT                   MYYFTMVMAIILVIYIIISAVLFSTKDINLFTSTPSIYFLLLIIILFLRKKITSTRIYT
FT                   YTYYTPFFVKFINNDGIFLHYKLFIIDDSYAFLGSLNFTSSGFFKNYESCITISDENIV
FT                   KLLSEYFEYIANSQINEIDISSLGRKLYKEPIN"
FT   gene            complement(58817..59170)
FT                   /locus_tag="Tmath_0050"
FT   CDS_pept        complement(58817..59170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dae:Dtox_3689 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59837"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQF1"
FT                   /inference="similar to AA sequence:KEGG:Dtox_3689"
FT                   /protein_id="ADH59837.1"
FT                   /translation="MSSINLLDTSLMRALMDETIPFHDVMNAFGIRTHIVFNLPASVLG
FT                   FTYVSRRGNYHLFLNGNVSYRTQVKTFLHEIQHILNDMPKCGYIIGINMEHLELEDEAD
FT                   EASLQLFRYLVKS"
FT   gene            complement(59176..59565)
FT                   /locus_tag="Tmath_0051"
FT   CDS_pept        complement(59176..59565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0051"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: tpd:Teth39_0032 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59838"
FT                   /db_xref="GOA:D7AQF2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQF2"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADH59838.1"
FT                   /translation="MLGERIKELRKKKGVTQKELALYLGVSDRAVGYYESGQRTPPPDI
FT                   LQKIADFFNVSVDYLLGRTGVYNPTDEITEAISDDPELFEFWNTLKEREDLKLLFKQTK
FT                   KLSPKDIKQIIRIIKAIEDEEDKEE"
FT   gene            59718..59921
FT                   /locus_tag="Tmath_0052"
FT   CDS_pept        59718..59921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0052"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: tpd:Teth39_0033 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59839"
FT                   /db_xref="GOA:D7AQF3"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQF3"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADH59839.1"
FT                   /translation="MNKLKELRIKYKLTQKELAKKLGVTPDYISQIEGGRIPGMETAIK
FT                   IANFFNTTIDDIFLANNRTKSS"
FT   gene            60014..60343
FT                   /locus_tag="Tmath_0053"
FT   CDS_pept        60014..60343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0053"
FT                   /product="excision promoter, Xis"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; KEGG: tpd:Teth39_2242 excision promoter, Xis"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59840"
FT                   /db_xref="GOA:D7AQF4"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQF4"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ADH59840.1"
FT                   /translation="MDNRITIKFEVDITDVIGQIMQLLNTSDKDKEEQEPLSLLDAYTI
FT                   DEAAKVLGVSKSYMYELAKHKDFPAMKIHGRKIIIPRRGLEEWMQKKFEEEKGTSKVIA
FT                   MGGRR"
FT   gene            60345..60473
FT                   /locus_tag="Tmath_0054"
FT   CDS_pept        60345..60473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59841"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQF5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH59841.1"
FT                   /translation="MWIEFKPIKNKNVLIKIAEALMKVVPIRIEKVSEGWKLMIKT"
FT   gene            60530..60988
FT                   /locus_tag="Tmath_0055"
FT   CDS_pept        60530..60988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tex:Teth514_0705 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59842"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQF6"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0705"
FT                   /protein_id="ADH59842.1"
FT                   /translation="MDVELVKKYYFEDKLKIVEIAKILGVNKSTISRVLKQFPEFEKEK
FT                   ERRKKESEKRAKEWRNEYKKQKRNEEKEEEEALYAGMMDLQRQNAMSMSKRRTLSTDTL
FT                   VKLCITHYDYNKEKERLVFNESAGKRPADLPRSVYVHKNVLKQFRVST"
FT   gene            61144..61473
FT                   /locus_tag="Tmath_0056"
FT   CDS_pept        61144..61473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_4498 FtsJ cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59843"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQF7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH59843.1"
FT                   /translation="MVFPAVYNINSMHKEHTIRNIIESIAEKYIKDVEKDGYLSYATYK
FT                   KIEYELNQKVGYKGITSYHFITGTIERKTKGEEIFIEIDYGSFSLFYNINVRVIKFGVS
FT                   NYENK"
FT   gene            61579..61701
FT                   /locus_tag="Tmath_0057"
FT   CDS_pept        61579..61701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0057"
FT                   /product="hypothetical protein"
FT                   /note="manually curated"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59844"
FT                   /db_xref="GOA:D7AQF8"
FT                   /db_xref="InterPro:IPR008690"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQF8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH59844.1"
FT                   /translation="MKGDENLNTLYTAGLAAGIFFGIVLGLMISFVILISSKKV"
FT   gene            61774..62268
FT                   /locus_tag="Tmath_0058"
FT   CDS_pept        61774..62268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0058"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ehi:EHI_188280 presenilin 1 peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59845"
FT                   /db_xref="GOA:D7AQF9"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQF9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH59845.1"
FT                   /translation="MRKFKPTVKKWLFPFNIYQKLVQQNPFIRKMKHIPPEAKIIISFF
FT                   VFFFLSLNILAYIFIKEIAYQGAKNVQILPAFISFLMFQVTFFILGSFSDDSISDVASF
FT                   LYSIIISVIMYHFFITYPIWLVVIMLSIYITILLEIRTFQLLSIFGLIVYSIILTILTF
FT                   A"
FT   gene            complement(62265..63089)
FT                   /locus_tag="Tmath_0059"
FT   CDS_pept        complement(62265..63089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0059"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE2082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59846"
FT                   /db_xref="GOA:D7AQG0"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQG0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH59846.1"
FT                   /translation="MTEKFLIGSRRGSIRNFSGNVPLNEIHVQFFSVPLDNIVIKLSGV
FT                   FVVKKLHNKLKEALKIYQEAKLSYSEVIFFPEKIYKRFYVTYYISVGVFAFSSIQIVNA
FT                   YSIHRKFGSLEVLFLILTILYLVSSSYIEKIIKSFSKLQIRNNIDLYITNLTTELIKPN
FT                   LSKIIRESTVNKESFQLKLNNSVLTSLTNGLLQIISFLAGFFAKALYESFKNGADCDNV
FT                   FRSLVTLVLLYFILLLVTHLLLDMFKSKNLYYIEMYDYQIKYAEYLKTQIKL"
FT   gene            63105..64115
FT                   /locus_tag="Tmath_0060"
FT   CDS_pept        63105..64115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQG1"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0039"
FT                   /protein_id="ADH59847.1"
FT                   /translation="MLSSNFTARFGEVIVRSGIASIPDAVFSFQKELGLSVGECWFIAQ
FT                   ILRFKWTTELPKPSLKKMADYTGVSVRTLHNYKNSLIEKGYLRIINRTDEQGRQTTNYY
FT                   DFTGLFERIIKILSSKEEPETNPFEEDILETGEEDYKEREGENFAQGGGKIFTLGGEKI
FT                   SPWRVKKQHPYKQNNKETEEYETEEYINNNPPNGGTNSQPSAGVVVEINEQYKKITGRD
FT                   KVSFFAALLEEYSAEKVMNAVAYLEKAMLRGKIDNPEGFIISALRENWDTQPFEQEQKL
FT                   KKEFTPPRNYFNSYTQRTYDVEELERRLLEYSRKEFFSNKELLEMDEETLFDDSS"
FT   gene            64158..64886
FT                   /locus_tag="Tmath_0061"
FT   CDS_pept        64158..64886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0061"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   csc:Csac_2637 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59848"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQG2"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ADH59848.1"
FT                   /translation="MNSKIISFWSARGSTGKTTLAAAFALALKKYKKDIVVADFKEVTP
FT                   HVHKYFGIELRDKSNIYEAVENGSSIADAVNEHLQKKQGIWILTGFGINDFTKFEEKHF
FT                   SAVLEVLKNEFEYVVIDTSAGIFFSSTYTALKNSDVIFAVTAPTVWNIEDTAQMIDFVS
FT                   NRWGVEKEKFKAILNAVGKEEIDTSTAEKILEIETFSVRYGQKNILRDVGKIIEFLFKK
FT                   DTEKTIDIKRAEEAKSFGVN"
FT   gene            64873..66018
FT                   /locus_tag="Tmath_0062"
FT   CDS_pept        64873..66018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0062"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   csc:Csac_2636 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59849"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQG3"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADH59849.1"
FT                   /translation="MALINPFVPEEISYQNRKEIDSSVNTAVDEIVAKIVEEHPDLVAG
FT                   VESGIQPRILLENKIRELVIDKKLYKGSVEEFTQRVFDVLFGYGPLQPYIEDPEVSDVL
FT                   VNSFNVVYIKKFGKKFRVPVDFGSEEKLTRYCYRIAAMCGGKLDENSNAEAVLTDRKRN
FT                   LRIVISLKPINVLSPSISIRKPTTSFTLEELVVKGMLSDEQKEFFKKAVIDRKTIVIAG
FT                   KGGSGKTTLLGALIDLIPHEERGLLIQETFEIKPKHPDIICKLVRISDNPEVKDYTLFE
FT                   LTKIGLLMSMDRIFIGEIKDREAMDFFNAVYTGHRGSMATVHANSAGEVLNRLILLMKR
FT                   SGTDVPVDDLREMLFASLDLIVFMEDYKVKEILDLRGGGVG"
FT   gene            66015..66908
FT                   /locus_tag="Tmath_0063"
FT   CDS_pept        66015..66908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0063"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aoe:Clos_1906 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59850"
FT                   /db_xref="GOA:D7AQG4"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQG4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH59850.1"
FT                   /translation="MIYLTFLESALLALVIYTAALGVERLKFKKRISKWQFKKTGVLSE
FT                   KGSKLLKSIDVILARSGIKSKLPFLDAKNMMIVSALLFAAGIYLFRRLGFAALFYASSI
FT                   VYVPYAAMMLMSSVNAKKIKKAYLSFLTTFMGFYNIEGNIINALKSTTPYISEPLRSII
FT                   KRNVFLYEKTQMSVDECLENMAAEAGNKEFRKFINFAKMNAKYGGNFNKALTKLREQGE
FT                   KIFSLESIKAANASVGSMVILVMIVINLLLMMNISADPDIVYIVKNTITGQAIAISNAV
FT                   SIVFGLYMIKNINSSS"
FT   gene            66918..67742
FT                   /locus_tag="Tmath_0064"
FT   CDS_pept        66918..67742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0064"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="KEGG: cac:CAC1978 hypothetical protein; manually
FT                   curated; PFAM: Type II secretion system F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59851"
FT                   /db_xref="GOA:D7AQG5"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQG5"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADH59851.1"
FT                   /translation="MAIIYSVFLTPVLAFLIYSLIKEYEIYSLKKRIYRIKPADEISKI
FT                   VGKTVRKDILQKINDKLKAAGNPLGLTAETYILARAGLFLFSIAYAYLTGMSGIQAVLL
FT                   VMLGFFGLDIYISSVKKDRQEKFRREMPEIVDLFELGAAADVPLEDIFLITAQSAQAKE
FT                   VRNALTKLAAEYIMTREKEGCLKRFCNEVNLPEANILAMALLQGERTGRTLEILSVLSS
FT                   SLFNTAAAKIARQDKAMEYKVLAATFFLMASIVTLYMYPYFTNIQGGLRLLF"
FT   gene            68005..68430
FT                   /locus_tag="Tmath_0065"
FT   CDS_pept        68005..68430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_2630 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59852"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQG6"
FT                   /inference="similar to AA sequence:KEGG:Csac_2630"
FT                   /protein_id="ADH59852.1"
FT                   /translation="MLNKSFWKKGSAEIVAFVLVLPFLILTIANTVNMLTDLTRYDVLR
FT                   QAAREAVLRMEIEGGLTSDGLYNLEAFLQSKGIDLNKVHIDYTPYSVPYGEEVKIRIAM
FT                   DTVMRRYTITLGGIKRVDENTQMVYGPISSVSKKYER"
FT   gene            68369..68926
FT                   /locus_tag="Tmath_0066"
FT   CDS_pept        68369..68926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_2629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59853"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQG7"
FT                   /inference="similar to AA sequence:KEGG:Csac_2629"
FT                   /protein_id="ADH59853.1"
FT                   /translation="MKILKWFMGLFHPSVKSMRDRKGISSIFLALLFLIPFMTFSMFLI
FT                   ESRLLYTIKSSADDAVVAAALAALKSANPVDIAYGEYVLDPNAARDTFYEYLKKNMKLD
FT                   ENMNPLPGSVSAGPVHVDEFIVYNPGGYPTFCPRGTFIKNTSIHVVISFKAKRPALTGL
FT                   FGKYVNIVIHRDVDNFYNLQEE"
FT   sig_peptide     68369..68494
FT                   /locus_tag="Tmath_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.731) with cleavage site probability 0.572 at
FT                   residue 42"
FT   gene            68930..69568
FT                   /locus_tag="Tmath_0067"
FT   CDS_pept        68930..69568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0067"
FT                   /product="SAF domain protein"
FT                   /note="KEGG: dae:Dtox_1485 Flp pilus assembly protein CpaB;
FT                   PFAM: SAF domain protein; SMART: SAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59854"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQG8"
FT                   /inference="protein motif:PFAM:PF08666"
FT                   /protein_id="ADH59854.1"
FT                   /translation="MFVKKKAILIALSLILAGGLSFFQYQYFKSMAESDKKIQVIAAVS
FT                   DIKAGEKIDTKLGIKVIPQSAYVKEMYLANNKVTGYAKVDIAAGSYVLKSMVSQEKIPV
FT                   LKEDMRRVTIGVNLTSSLAGKIKPGDVVDIGWVPNDEAKDGASKIVAEKVQIYDVVNKS
FT                   GEDVRKADKNNQYDKESLIPAAVTLIVTPEQAITIREYETKGSLFLIGY"
FT   sig_peptide     68930..69028
FT                   /locus_tag="Tmath_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.836 at
FT                   residue 33"
FT   gene            69610..69768
FT                   /locus_tag="Tmath_0068"
FT   CDS_pept        69610..69768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0068"
FT                   /product="transcriptional regulator"
FT                   /note="KEGG: ate:Athe_2770 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59855"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQG9"
FT                   /inference="similar to AA sequence:KEGG:Athe_2770"
FT                   /protein_id="ADH59855.1"
FT                   /translation="MLRIVVPETREEIEHYIEMLEYLLENVDKTEKDKQIHEQALKELK
FT                   EALKKFV"
FT   gene            69791..70234
FT                   /locus_tag="Tmath_0069"
FT   CDS_pept        69791..70234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0069"
FT                   /product="peptidase A24A prepilin type IV"
FT                   /note="PFAM: peptidase A24A prepilin type IV; KEGG:
FT                   tte:TTE2059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59856"
FT                   /db_xref="GOA:D7AQH0"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQH0"
FT                   /inference="protein motif:PFAM:PF01478"
FT                   /protein_id="ADH59856.1"
FT                   /translation="MEVNEIKHIPIVMILSYLSYTDLKKREVPDFAVLALFIYSLFTCT
FT                   SFKESILMAALVFILLLIPSILFEGSIGGGDIKLLTALAFFMGRDFSVLAFPMFILLVA
FT                   TLIYGLIKGKGLKYSVPLVPYVFVSYLFYFSLEVSWWNLHFSY"
FT   gene            70210..70884
FT                   /locus_tag="Tmath_0070"
FT   CDS_pept        70210..70884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0070"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   tpd:Teth39_0041 metal dependent phosphohydrolase; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59857"
FT                   /db_xref="GOA:D7AQH1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQH1"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ADH59857.1"
FT                   /translation="MEFALFVLDYDGYYRLEIAGGYCDGNCGVCRKCTNNRNIVTLIKE
FT                   ENAEFYQKYVLDHQIRTAELCKKAAEALFLTESKREIFIQSALLHDVGKLLIPFDVLSK
FT                   NGALSPFERRIIKLHPSKGAEWLRERGFSEEITAVIEAHHERVDGLGYPNGLKGDEIPF
FT                   LARVLAVCDTADAVISGRHYRAAFDKRAVIEELLRNSGSQFDPMVVRTMIEIIHEEEIA
FT                   NV"
FT   gene            70877..71914
FT                   /locus_tag="Tmath_0071"
FT   CDS_pept        70877..71914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0071"
FT                   /product="StbA family protein"
FT                   /note="PFAM: StbA family protein; KEGG: tpd:Teth39_0044
FT                   StbA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59858"
FT                   /db_xref="InterPro:IPR040607"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQH2"
FT                   /inference="protein motif:PFAM:PF06406"
FT                   /protein_id="ADH59858.1"
FT                   /translation="MFKIGLDLGYGYVKGVNEAGKTVLFPSLVGNAYQRNLIGLFGQNL
FT                   NNLIENMHVVLRNGKEEQEEYFIGDLARREGRNVSYAFDENKINHPNTKAVLASASALL
FT                   FPSDNEPVHIVSGLPLEQYIHQKDELREMLKNFKAIVEFKGYNILKIVKFDRVTVFPQA
FT                   AGAVYYAIMDDLQKYLIKGSYIGLIDIGYRTTDYIVFVVDGKLSLREDLSGTLDIGMSQ
FT                   LSNAADKLFTQKTGSKLDIPELIQLVNEESIFYRGKVLNFEKELNEVKLEISRVIQDRI
FT                   KAVWGSKLDFFNTIFLAGGGAVSLFDSLKNLYENTVLVKNSQFANAKGFLKVAELEEKK
FT                   ERDRG"
FT   gene            71911..72099
FT                   /locus_tag="Tmath_0072"
FT   CDS_pept        71911..72099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pcb:PC301248.00.0 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59859"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQH3"
FT                   /inference="similar to AA sequence:KEGG:PC301248.00.0"
FT                   /protein_id="ADH59859.1"
FT                   /translation="MTKERDLDYKGAWELMKQMVDYYTGEKKYLTRREIKYIIRVCENK
FT                   DEKVIKIIDDNKGGAKT"
FT   gene            72096..72365
FT                   /locus_tag="Tmath_0073"
FT   CDS_pept        72096..72365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0045 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59860"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQH4"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0045"
FT                   /protein_id="ADH59860.1"
FT                   /translation="MIKITLPKKKGMKEKVYEMWDELKITGHMLIEQKDKSYIVILEPE
FT                   KDISLSLLKQKLPKESIVEEVNFARDSTAEEDVFTDTNLEEMDV"
FT   gene            72667..72948
FT                   /locus_tag="Tmath_0074"
FT   CDS_pept        72667..72948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59861"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQH5"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0046"
FT                   /protein_id="ADH59861.1"
FT                   /translation="MKVYSFRTNKEDKDIEELLESLKEDKSQYIKDALRFYRDFGAKIA
FT                   KIEFILEKLEQSGIQAQTPLQSPEHEPVIENSDDEKILLESLQDILSL"
FT   gene            72992..73159
FT                   /pseudo
FT                   /locus_tag="Tmath_0075"
FT   gene            73431..73799
FT                   /locus_tag="Tmath_0076"
FT   CDS_pept        73431..73799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59862"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQH6"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0050"
FT                   /protein_id="ADH59862.1"
FT                   /translation="MKKVTVYLSEDTYEVLNNLSSRRKESMSLIARKILEKGLKEESAQ
FT                   DGIDAVTEAVRKAMRDVLRPTEDRLAKLMAKAAVAAATAMYMNVQTIADLGKHNAVEIY
FT                   NEARVKAAAYLKERDDNE"
FT   gene            73796..74989
FT                   /locus_tag="Tmath_0077"
FT   CDS_pept        73796..74989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59863"
FT                   /db_xref="InterPro:IPR041073"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQH7"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0051"
FT                   /protein_id="ADH59863.1"
FT                   /translation="MSSPFVMKIAFYTPTAKNQARNSAHVQYIATRPGADRGELSIGDE
FT                   LEPDTPEWHTKYMHERPGSHGLFTAEEEMPDLGEVQKELKNHNGIVWRMVLSLREDDAV
FT                   RLGYTTRESWEKVLRAVLPEAAAKMGILESNLRWAAAFHQVQGHPHVHVILWEKEPKRL
FT                   RGVLSQGERRDIRKIFIREIYAKERMALTAEKSAVRDLIRDTAKRDISELLKEVKKARI
FT                   EIKALNGEKPGLPPTLDQTTREELLEKLKELSKIMPQKGRIAFAYMPEEVKEKAKEIAD
FT                   WLLKQPGFSQSVERYMELAKELASHYTSNPEALEKAAEKAYEDIQKRTAQIVLKGAAAL
FT                   QEEKTVDTTRLTNSVWRSAWRALERERLRAEAESTIAAQKEMEKRRMAERRGESREV"
FT   gene            74979..76808
FT                   /locus_tag="Tmath_0078"
FT   CDS_pept        74979..76808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0078"
FT                   /product="TRAG family protein"
FT                   /note="PFAM: TRAG family protein; KEGG: tpd:Teth39_0052
FT                   TraG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59864"
FT                   /db_xref="GOA:D7AQH8"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQH8"
FT                   /inference="protein motif:PFAM:PF02534"
FT                   /protein_id="ADH59864.1"
FT                   /translation="MRFRAVAATLILILDFLFIPFLLLLPIYAKDYGLKEGPPKWEAYV
FT                   KEKPLSGIFLLLKREDVKTPWLWLQPAVFAALISVLFPIYTRKRRKTDELGLPEAAGRG
FT                   EYGTARWRTEKEVSKTFTVWNLNNNPPKGGFVVGFNPAAGKAWLDAGDTHLLVIGSTRS
FT                   GKSRRIILPTIWTLAKAGESMIVSDPKGELYGYSSEYLKRLGYKVILIDLRNPYRGDQW
FT                   NPVLEVADKLEAGDYSAASQSAWDIANIITNQQPHIGVDPIWPQSQESLTAALILAVAS
FT                   SAPKEAKHLGSAYEILHHLGAGGGELLDKYFRLLPKEHPAASAYGVAALSEDRLRSSIF
FT                   TGTAAQLRLWSDPAVVYLTSNKDHDLDAVGKEKAAVFIVIPDERSTRNVLAALYISQAY
FT                   QALVDLANKSGGRLSQRVNFILDEFGNLPPIPDFDKKITVAAGRNMRFLLAVQDISMIK
FT                   AKYKELAQTITGNCATWVYILTTDPETAKIISVKTGQYTIRTESYSSQVKHTDYSHGTS
FT                   EGLTGRPLLTQDEVLRWPEGQALILQARQNPAWLPLPDLSKWPAAKDLIPAALEETTRE
FT                   VVHAPVWIPDVESEGIKEKDVERTNENLLSKLR"
FT   gene            76821..77063
FT                   /locus_tag="Tmath_0079"
FT   CDS_pept        76821..77063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59865"
FT                   /db_xref="GOA:D7AQH9"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQH9"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0053"
FT                   /protein_id="ADH59865.1"
FT                   /translation="MPTLVTGAFQLLNDALTWILYLIPAASGAAIGYHALMKQMGDGDP
FT                   SVTAAHNRAIRNVLIAGAIGMSAASLVKVVLAYFK"
FT   gene            77105..77962
FT                   /locus_tag="Tmath_0080"
FT   CDS_pept        77105..77962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0054 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59866"
FT                   /db_xref="GOA:D7AQI0"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQI0"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0054"
FT                   /protein_id="ADH59866.1"
FT                   /translation="MFSAITNMISDAVTNFFQNLLESLVSMFTSFFGDEMAVALKILNT
FT                   PYITNGIKLAQIIAGTLLALKVAAEALKTYILYNSGDSSAQPLELVKRTAFAAAMVSTS
FT                   PWLVTKVYTFGADLAKEVAALPAVNLENPVSNIVSGISQMSTALLLILLAVIVIWILIL
FT                   IQTAIRAVEIAFIAVSGPIMAVGLTRPDEGVWSVWWRELVVLSLSQAVQTFMIRGFLST
FT                   IANMYFTSEILSKLMLIGWLWVAFKTPSVLKQFAYHSGLGSAVGHAGQTAGSMYIMRKI
FT                   IMKG"
FT   gene            77970..78269
FT                   /locus_tag="Tmath_0081"
FT   CDS_pept        77970..78269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="manually curated; KEGG: tpd:Teth39_0055 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59867"
FT                   /db_xref="GOA:D7AQI1"
FT                   /db_xref="InterPro:IPR024414"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQI1"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0055"
FT                   /protein_id="ADH59867.1"
FT                   /translation="MYQVPKNISARFEFFSGFGWKELFYVLLGLSLGFFVYLILSLFTH
FT                   SPVRYLVVFIFTGLAYFAVIPGPDGSSVLNLIKYYLKWSKKQKRYLYVQGGYTN"
FT   gene            78266..78892
FT                   /locus_tag="Tmath_0082"
FT   CDS_pept        78266..78892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59868"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQI2"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0059"
FT                   /protein_id="ADH59868.1"
FT                   /translation="MIGIFKKEKASGKDKAKIEEQKRKTVQEWLPVRDVAEDLMVLKDG
FT                   RYVCVLKVMPLNISLKSENEKKRIIQTVYEALNGFKDSMQIFSIGRPVDLDSYISYLQT
FT                   KSKEETNITKKRLLQEYLKYVASIVTSGEAVERRFFIMLSGKEKEELKAKAHELANNLE
FT                   KSGLKVELAQDQDIIDLLFSFSHPSQAAFERAPLFSGPYLPPVYS"
FT   gene            78907..80694
FT                   /locus_tag="Tmath_0083"
FT   CDS_pept        78907..80694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0083"
FT                   /product="type IV secretory pathway VirB4 components-like
FT                   protein"
FT                   /note="KEGG: tpd:Teth39_0060 type IV secretory pathway
FT                   VirB4 components-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59869"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQI3"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0060"
FT                   /protein_id="ADH59869.1"
FT                   /translation="MKKKENTSVLTGLVDMISPQALEFNARQIVFNDQLARIMVIAGYP
FT                   PKVSAAWLSRTAGMPGVICSVHLEPTDSIDLINSLNKAIGEYAGRLEMGGNALSMQRTE
FT                   QALKDAEELMRKIDQEQQQVFYVTVVLMILASDQQELDRRTRQVEASLAASGMRGRVLI
FT                   FRQEAGLKAAGPFCTLPNKVKETGARNMPAETAAASFPFTASGINDGSGVVLGKDRDGG
FT                   LVLVDIWKRGGDRTNSNWTILAKPGAGKSFTAKMLLLREYMQGSRIIIIDPEREYKDMC
FT                   RKLGGVWINCTGGEGKINPLQVRLRSIEEEEEKEVSNIQSPLALHIQTLRTFFSLYLRD
FT                   LTDTEKAALEDALVEVYKEAGITWDTDPKDIPNEKWPTVRELYKYLVKKAEENPEAYGR
FT                   LSVLLKRAAEGADSYLWAGPTAVEADSDFIVFDVHDLQNAEDQVKRAQYFNVLSFAWNI
FT                   LERDKRERTVLVVDEAWMLVDPQTPQAIAFLRDTSKRIRKYNGSLVVISQNVIDFLAPE
FT                   VQRYGQALLDNPTYKLLLAQGEKDLEAITTLMNLSEAEHDLLTNAKRGEGLFVAGTQRI
FT                   HIKIEAAPYELSYLTGGGS"
FT   gene            80694..81626
FT                   /locus_tag="Tmath_0084"
FT   CDS_pept        80694..81626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0084"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: tpd:Teth39_0061 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59870"
FT                   /db_xref="GOA:D7AQI4"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQI4"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADH59870.1"
FT                   /translation="MNVLGKVLLAFLPDDLESVIKFALLFILVPVVFLTLAFAGPITAV
FT                   EKIPLVSYEQAQMYISTAKKVSESTKNPYSEGVEIDWKQLVAIDAVRFRQDFSKANSQE
FT                   AEELAKLFIEKVGEVKVKEGDEVKVYPIYRLRSLDEVLNILHFSREEKEKVKEFLSIDF
FT                   SALLDYAPSVPEGFIPIEKNLKWPLPGTYTITSGFGPRIDPVYGVERFHSGVDIAAPAG
FT                   TPVRAALDGEVVYAGWNDGYGLVVFIWHSSSLETRYAHLSSIVVKQRQVVRAGDVIGYV
FT                   GSTGKSTGPHLHFEVRIGGKAVNPLDFFN"
FT   gene            81643..82734
FT                   /locus_tag="Tmath_0085"
FT   CDS_pept        81643..82734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0085"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59871"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQI5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH59871.1"
FT                   /translation="MLISLIATKQMAEQIKKALADAGDVVFEHVGKLDSESVKEIFYSA
FT                   SRVSADVLIVDLDVFSGKEIVSALQGFRIARPNTRIIVIAPDRKPGDEIISSIVGLGIY
FT                   DIAAEGKESNWSEIIKNILLSPPATYAQAARWHTGQLLNASIQTKERVIIEERPAGIVT
FT                   VAVSATAHGIGCTYTALSVASFLSRLGHSAAVIEDSQKPVFSFLCSVLKAKEGKVEGSY
FT                   TVHGIDIFPVDKSGDNGNWNYDMLLKKIKEGQYEYVVRDLGVLNSPRRREMYGADIAFV
FT                   VASAAKWRWHEVIERIDGDFDIIFPLASQNNVEEISFYAGIKGTALSYCPNPFAEENDS
FT                   VFLKLLAPVLPSRRKKRILFGVF"
FT   gene            82796..83950
FT                   /locus_tag="Tmath_0086"
FT   CDS_pept        82796..83950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbt:CLH_2144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59872"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQI6"
FT                   /inference="similar to AA sequence:KEGG:CLH_2144"
FT                   /protein_id="ADH59872.1"
FT                   /translation="MLYVEIYTRKWLGFNIYREVLGGYCMGGKFKWTKFENCDINDPFF
FT                   NSLKQDYPEFPQWFMKKSKNGESALVCEDEKGLSAFLYLKEEKEPIELIDQILPSKKRI
FT                   KIGTLKLDERIQGQRLGEGAIGVALWRWQESKAEEIYLTVFPKHTLLIELIEKFGFTYM
FT                   GKNKRGENIYLKSKKKIYYSDPFKAFPFLNPYFEKAGYIPIYDYYHDTLFPYSELYNTK
FT                   QEVEEKAAANGITKVFIGFPTSNLHHKVGEPVIIYRIDTKAEKNKQYKSAATSFCTLTN
FT                   LTIIKSDNIPNIDLDKFIKLAGNKTVYSPEELEQFFYEKKNIVLIEMVYNGFFGKGKNV
FT                   TFKELNEKGLFNDYPYNIVLSREQFISILEMGGKDVSNIIINKT"
FT   gene            83919..84296
FT                   /locus_tag="Tmath_0087"
FT   CDS_pept        83919..84296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0087"
FT                   /product="protein of unknown function DUF437"
FT                   /note="PFAM: protein of unknown function DUF437; KEGG:
FT                   eel:EUBELI_20476 F-type H+-transporting ATPase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59873"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQI7"
FT                   /inference="protein motif:PFAM:PF04266"
FT                   /protein_id="ADH59873.1"
FT                   /translation="MSQILLSIRPEYVESIFKGTKRFEYRKIKFARKDVNKILIYCTAP
FT                   VMKVVGEAEILDVIEDTPSAVWEKTKDYAGIDKKLFDDYYKNKEKAVAYRLGNVKKYLK
FT                   PIKLTDLGISFVPQSFVYIES"
FT   gene            84371..84787
FT                   /locus_tag="Tmath_0088"
FT   CDS_pept        84371..84787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tnp:Tnap_1798 LVIVD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59874"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQI8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH59874.1"
FT                   /translation="MKLNQIFRFRFAQIKNLVKRAPLLSQTCFFCLPPQRRLYACSPYG
FT                   QGAGLRSVSISSLAYARSGIPPRPLDLRLAGCFAFNCRGQTTIKNEKVCEGGAGSECEC
FT                   SFLNAKILLIRWVPLIITEFYKKYYQMIAKLFEM"
FT   gene            84817..85179
FT                   /locus_tag="Tmath_0089"
FT   CDS_pept        84817..85179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59875"
FT                   /db_xref="GOA:D7AQI9"
FT                   /db_xref="InterPro:IPR031451"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQI9"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2217"
FT                   /protein_id="ADH59875.1"
FT                   /translation="MTDIEEIKKFLNNVKELMKSGAFDFVPRKKNMDSIKEAGLTIKHV
FT                   KEIIMDLTYKNYYRGPSVDVGTNREGFIWEFGYDIEGTDFYIKLKIERRGEKECLVCLS
FT                   FHRTEQPLVYPYKLRR"
FT   gene            85185..85769
FT                   /locus_tag="Tmath_0090"
FT   CDS_pept        85185..85769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0090"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   tpd:Teth39_0073 XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59876"
FT                   /db_xref="GOA:D7AQJ0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR022452"
FT                   /db_xref="InterPro:IPR022453"
FT                   /db_xref="InterPro:IPR032758"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQJ0"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADH59876.1"
FT                   /translation="MKKFCPVCGKEQETKVIEKEEISTVRGDEIKALAKIRVCSVCGEE
FT                   LFDEELEEENIQRVYDIYRKKHGILSPDEIRNIRESYRLSQRAFAKLLGIGEASIARYE
FT                   TGALPEKSLSNMIMLLKDPENMEKLLEKNKEALTPREKMRLLRRLKEIKKDEEENAVKI
FT                   SKELYSLLEDKARREGKSTDKFIEEILRKVI"
FT   gene            85796..86788
FT                   /locus_tag="Tmath_0091"
FT   CDS_pept        85796..86788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0091"
FT                   /product="copper amine oxidase domain protein"
FT                   /note="PFAM: copper amine oxidase domain protein; KEGG:
FT                   mta:Moth_2367 copper amine oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59877"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQJ1"
FT                   /inference="protein motif:PFAM:PF07833"
FT                   /protein_id="ADH59877.1"
FT                   /translation="MRKIISMIIAILLIFLSIPAFAQTGGQEEQLPYQEWIDKGWIKAV
FT                   SPDENGHDKLGWYYIMPGKEKEIAYNDKLKNTDRLIIVDGSFYKNDLDYYYKEGRSAAA
FT                   LRDITTLRESYKELYGEIRYNHPDTLKYDFWKGLVTINLVSINGTPWQETKYRDILLQY
FT                   FYDRWEGLKDPAYNKYLIDPKWNGYTMECIYNWDGVDVWIGKDDITVRYELKEYKKKLP
FT                   TKVISDSGVAMIPLRGVMEELGAAVDYNAKTQQITIKDKGKTVVLKIGSDTALVDGRVV
FT                   KMPRKVYVKNGYTMLPLRFVAENLDHAVEYLNDGTIMIWRAKYTTPPSI"
FT   sig_peptide     85796..85864
FT                   /locus_tag="Tmath_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            86855..91891
FT                   /locus_tag="Tmath_0092"
FT   CDS_pept        86855..91891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0092"
FT                   /product="PKD domain containing protein"
FT                   /note="KEGG: csc:Csac_2638 PKD domain-containing protein;
FT                   PFAM: PKD domain containing protein; SMART: PKD domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59878"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQJ2"
FT                   /inference="protein motif:PFAM:PF00801"
FT                   /protein_id="ADH59878.1"
FT                   /translation="MFKRIVSVAVLITFLAGLVYIPKLENAYAAVIDDSGDLNLAIDTP
FT                   VTINDRSPVPNPIPKKSNDKKLYSGKWSVLVNGTLAGYDKVIKHIYTRGNAEQYNFIKY
FT                   STVSQWINVLGGNPTFVNTYLNQIRLSISGSNRVYIRYLTELCGAHVTGYRVLDGKAGK
FT                   GEVYVSTTRPPSANISISPTNPRESDNVKITVSGTSFFNFWNTDLKSALGLQDKIVYTV
FT                   DIDGERVISAKTLINQQGFTDVITRKFSAGQHTITLYVKDAVDRLTRKDYTFTVSATPT
FT                   PPPPPGNIQAKINLILDPPSLKAGTAGDVNATIDATSSVSSGTGPYSARFWLQVNGTDL
FT                   LGSDGTAVKDLSSLSQAKYTKLIANAKPGDKVWAKVRVYDQSINKSAETEITKVIGQYE
FT                   DVPTPEPTPPPAPEPVPPVAVINAPSEVIQGDDVYISSGSYDPDGTIVNYSWSIIPSSG
FT                   VVGTLSGESGTVFFDKVGTYTVRLTVTDNDGLTDTAQKTIEVKPAVPKAFFDYTGALKE
FT                   NRKVVLDASGSYTSPKYPMVWDATEWEITPASSGLTQDDIKIVPSTDMKTRTVLFKKAG
FT                   DYRVRVRVKNSAGNYSDWYERTLTVVEDLPPVADFFVMTTALRDPSNGNMAKIDLIDAS
FT                   YSPDGDKIVQRIWKYKYDSNNNGSFDDEQWITLDSGNNTHPVLYAKDVGKYLFELSVKE
FT                   DFGEETIPEFISPSDYKTSDTSNKPMKDKICEVINLQPVVDFEMYEKKKAELVIRVGKL
FT                   NNYDARVKQLEDGINNLLIPLLNSKKIDAKVIDSDFGTGTYGGNTSFDGSRYTVSSYVI
FT                   KATVDTAGRFGITTVEGFPGITTDDNKYLLYGGDVSTTSALVVKIDGNLYDLYNYTPTS
FT                   ITTENGKIVVNYGTINGVEIKVIYTIYDDKYVLINFVATNKTTVQKNIGFKVYYDTCVA
FT                   GNDGSPIKVTNKGFEIYNDTYQVRAVGILKDNPVITPPTDWRMETWRSSNYTYFPYDDG
FT                   RAHFSSSYYVGQTYQTGDTAISLWWHSQSVASNQQRSITTLLGIERPTEAKLDMLGDSL
FT                   LNVVFNNLNAGKYVLVFNDLSFLDYNDNNAKTKFANAINQLSSKLVIAGQTTFPASQAD
FT                   GLISLITNGGFKVIDNSISNQLTAIAEYIAKDLENQQRIIEKYVVLGESIEIKTYYNDP
FT                   ENDPKYEERWMYLHDPNYFENSLGLASFNGQYLSSPVTVFDKVGKYEVEYQARDNPKDD
FT                   DRFDNYRLWSYKPLSTMYIYVHRRPIAQFAVTMTPSGSNYIISITDQSYDLDHMSLPNK
FT                   GIQAWEWKWKEVNEIAWHNGKMSGTFPVGKTYLIYLRVQDLEGAWSEPKVQTITTQNIN
FT                   LPPVAQFTVNPVVQVVNKTITIVDQSYDPNGDAIAERQWRVQKPDGTWINYGSTVPTNI
FT                   PSLGIGTYTIELKVRDNPRVGTPRWSEPYTQTVTIIPENNKPVAKFTISPNPVVADEPF
FT                   TITDQSYDPDGDPIVARVWKVQKPDGTWVTINQWKPTFEEMGLGDDGTYKIQLRVLDDP
FT                   TGRNPNLTPMWSDPYTVTVQVQGKLIVIGSSNKTTYKAGEAMILYARTEGKAYRVEAKM
FT                   WYPKNEFTSSNVTTLVPDIPLTNPPQDVMTWHTRYTKAEGRDVVVIIPKNMPDGTYKIV
FT                   FTAYKQLASGGTKTATDVITVRVKGTIYDNSKSQIIGPKF"
FT   gene            91960..92193
FT                   /pseudo
FT                   /locus_tag="Tmath_0093"
FT   gene            92259..93086
FT                   /locus_tag="Tmath_0094"
FT   CDS_pept        92259..93086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2212 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59879"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQJ3"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2212"
FT                   /protein_id="ADH59879.1"
FT                   /translation="MSQEYDITAKNIFSNLADDIASYFLGLKFTKLDELNIEFTTIESR
FT                   ESDMVFKCTTENGDIALHIEFQTYNDSKMPYRMLRYATEIMEKHNLIPYQVVVYFSKNE
FT                   LKMDNNLDYHLGEENLLNFRYRIIDVGKIKFEDIVKTKYYDLYTFLPVADKDKRQKEKE
FT                   EYLRKCTEVIRDMPVDRGKKSYIVTAAEILAGIIYDEEVIEKIFSEVIGVSILEESKIY
FT                   KKILEKGKLEGKKEGEKEKSIKIAKELLKKGMSIDEIAEITELSKEEIKKLLN"
FT   gene            93569..93769
FT                   /locus_tag="Tmath_0095"
FT   CDS_pept        93569..93769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0095"
FT                   /product="YcfA family protein"
FT                   /note="PFAM: YcfA family protein; KEGG: ckl:CKL_4037
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59880"
FT                   /db_xref="GOA:D7AQJ4"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQJ4"
FT                   /inference="protein motif:PFAM:PF07927"
FT                   /protein_id="ADH59880.1"
FT                   /translation="MKPKELIKMLQKEGWIIKNQRGSHVHMIHPSKPGKIQIPYHNKDL
FT                   KPKTLNSILKQAGLKKEKGRF"
FT   gene            93771..94184
FT                   /locus_tag="Tmath_0096"
FT   CDS_pept        93771..94184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0096"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="PFAM: protein of unknown function UPF0150; KEGG:
FT                   csc:Csac_0081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59881"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQJ5"
FT                   /inference="protein motif:PFAM:PF03681"
FT                   /protein_id="ADH59881.1"
FT                   /translation="MDKYIFPAVFESDGKGGYTVTFPDLPGCITEGDALEEALYMAKEA
FT                   LELFIYNLEEDNEPIPEPTPPEKIKVPEGAFVTLIEAYMPPVRDEMANKSVKKTVTLPR
FT                   WLNEAAEKANINFSQVLQYALREKLNIKERNRV"
FT   gene            94860..95264
FT                   /locus_tag="Tmath_0097"
FT   CDS_pept        94860..95264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbh:CLC_2199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59882"
FT                   /db_xref="InterPro:IPR024307"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQJ6"
FT                   /inference="similar to AA sequence:KEGG:CLC_2199"
FT                   /protein_id="ADH59882.1"
FT                   /translation="MELSIEEIKNYFDFNNKKDDGQTHNHEFLGSTKLAAEDKKRKEGK
FT                   EEQHNHRFAGVTSQVIPDGDSHVHAILVSTDFYEDHHHEIGVITGPAIDVGDNKHVHFV
FT                   EGKTTVDDDHYHEFIFATLIEDPISDFEHY"
FT   gene            95452..95898
FT                   /locus_tag="Tmath_0098"
FT   CDS_pept        95452..95898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0098"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   tpd:Teth39_2202 CMP/dCMP deaminase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59883"
FT                   /db_xref="GOA:D7AQJ7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQJ7"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADH59883.1"
FT                   /translation="MINKFMKAAILEANKSYQLREVPVGAVIVKDDQIIGRGFNQKEAT
FT                   NDATAHAEIMAIKEACKTLGSWRLDDCSMYVTLEPCPMCAGAILEARIKRVYIGTESDK
FT                   SGAAGTVINLLNNPDLGSKTEVYFGIMEDECKMLLENFFKTLRE"
FT   gene            95903..95993
FT                   /locus_tag="Tmath_R0004"
FT                   /note="tRNA-Ser3"
FT   tRNA            95903..95993
FT                   /locus_tag="Tmath_R0004"
FT                   /product="tRNA-Ser"
FT   gene            96006..96100
FT                   /locus_tag="Tmath_R0005"
FT                   /note="tRNA-Ser4"
FT   tRNA            96006..96100
FT                   /locus_tag="Tmath_R0005"
FT                   /product="tRNA-Ser"
FT   gene            96363..96453
FT                   /gene="ffs"
FT                   /locus_tag="Tmath_R0006"
FT   ncRNA           96363..96453
FT                   /gene="ffs"
FT                   /locus_tag="Tmath_R0006"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            96762..98657
FT                   /locus_tag="Tmath_0099"
FT   CDS_pept        96762..98657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0099"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; metal dependent
FT                   phophohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; PAS fold domain protein; histidine kinase HAMP
FT                   region domain protein; KEGG: tex:Teth514_0032 putative
FT                   PAS/PAC sensor protein; SMART: metal-dependent
FT                   phosphohydrolase HD region; PAS domain containing protein;
FT                   PAC repeat-containing protein; histidine kinase HAMP region
FT                   domain protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59884"
FT                   /db_xref="GOA:D7AQJ8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQJ8"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADH59884.1"
FT                   /translation="MISNYNKKLFFVLFGFSMTVYALSIVHFLSGFENKIFIGGVILLI
FT                   SMGLSAILSKVLSRPLEKLNEGVKKIADGDFNFRLNITNSKEFAELSKNLNFVATELSQ
FT                   SYIKLKEQTENLMRQNKELQEFNAELEASYEQLEALAHELEVSERKYRLLVDNIRDILW
FT                   LTDKNFIIEFVNSRVVRYLNYTPQELIGKSLLEIVDEESKETLKEMMAGKINFSEINFK
FT                   SKEGLLVITETHVKRLKTDGEVVGIQGISRDITEVYHVKQQIAEKNNEILAINDVGKLL
FT                   TSGSDMKEVLNAIVEKVANMLNSPLCTIREYDKKSQKFILLIKGGELRNYPILNKIELP
FT                   REDMNDLINLKEIKIKRVEEFPHDKNLAPIFAAKEVFSAVIVPLVSRNETIGILTVWTS
FT                   TKTVKNMSLLRSIASAVSVAIENSRLYDEVKKLFIKTIEALAYAVEAKDVYTKGHSMRV
FT                   SQYAALIGEYIGLSREKIEQLRIAGILHDVGKIGTSDAILLKAGKLTDEEYKVIKSHPE
FT                   ISRKILMPIALPEEILEAVSKHHERYDGKGYPYGLKGEEIPIEAAILGVADAFDAMTSD
FT                   RSYRKGMNVEEAINELLKYKGTQFHPEVVDAFISLYMNEKHRLEEIKNQVFSNAS"
FT   gene            98716..100266
FT                   /locus_tag="Tmath_0100"
FT   CDS_pept        98716..100266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0100"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /note="TIGRFAM: DNA polymerase III, subunits gamma and tau;
FT                   PFAM: AAA ATPase central domain protein; KEGG:
FT                   tex:Teth514_0033 DNA polymerase III, subunits gamma and
FT                   tau; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59885"
FT                   /db_xref="GOA:D7AQJ9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQJ9"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ADH59885.1"
FT                   /translation="MYQSLYRKYRPKSFKEVVGQEHIVKTLKNQIKLNRIGHAYLFTGT
FT                   RGTGKTSIAKIFAKAVNCLNNTEGEPCNSCDICHAINNNTTMDVLEIDAASNNSVNDVR
FT                   ELRESVIYAPSQTKYKVYIIDEVHMLSTGAFNALLKTLEEPPSHVIFILATTEPDKLPD
FT                   TILSRCQRFDFKRIPTRLIAQNLDRICNDSGIKIEDKGLKTIALYGNGSMRDAISLLEQ
FT                   CISYKEGFITYEDVCEMLGVANDEMLFSLLDYINAKDVAASLKQLDKILSYGIDLGNFL
FT                   KSLTYILRDMVLYKTGGEELKEILYSNAETIKEKVQNFGTAFLTNALEKFTNLQREIKY
FT                   AIAPLTLLEITILRLIKPEISYDMLSLLSRVEQIEDKLTKGQFFLKEEKEEDENKERNT
FT                   LPKKEKTTQIIEQEDIDLEKVWNEVKETIKKERIALYAFIEKGTPYFKNGTIVVEYPEE
FT                   NALFKEELNKAENKSFIEEIVKKLVGKSIHLKFELKKNEEELLVQQVKEFFGEDIEII"
FT   gene            100333..100668
FT                   /locus_tag="Tmath_0101"
FT   CDS_pept        100333..100668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   tpd:Teth39_2199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59886"
FT                   /db_xref="GOA:D7AQK0"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQK0"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ADH59886.1"
FT                   /translation="MAKGGFPGGFNINNMIKQAQQMQEEIKKMQEQLVQKTVEATAGGG
FT                   MVKAVANGRKELVSIEINPDVVDKEDVETLEDLVLAAVNQALRNAEEMIASEMAKITGG
FT                   LNIPGLF"
FT   gene            100678..101277
FT                   /locus_tag="Tmath_0102"
FT   CDS_pept        100678..101277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0102"
FT                   /product="recombination protein RecR"
FT                   /note="TIGRFAM: recombination protein RecR; PFAM: TOPRIM
FT                   domain protein; Zinc finger C4-type, RecR; KEGG:
FT                   tpd:Teth39_2198 recombination protein RecR; SMART: Toprim
FT                   sub domain protein; Helix-hairpin-helix DNA-binding class
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59887"
FT                   /db_xref="GOA:D7AQK1"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQK1"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ADH59887.1"
FT                   /translation="MGYYSASLAKLIEELSKLPGIGPKTAQRLAFFIINMPTEEVKSLS
FT                   QSIIDAKEKIKYCKICYNITDTEVCNICSDEERDNSLICVVSHPMDVVAMEKIREYKGV
FT                   YHVLHGVISPIEGIGPEDIKIKELLDRVKNGNVKEVILATNPDIEGEATAMYIAKLLKP
FT                   LGVKVTRIAHGVPVGGDLEYTDVVTLSRALEGRREL"
FT   gene            101443..101844
FT                   /locus_tag="Tmath_0103"
FT   CDS_pept        101443..101844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0103"
FT                   /product="CrcB protein"
FT                   /note="KEGG: tpd:Teth39_2197 CrcB protein; TIGRFAM: CrcB
FT                   protein; PFAM: Camphor resistance CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59888"
FT                   /db_xref="GOA:D7AQK2"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQK2"
FT                   /inference="protein motif:TFAM:TIGR00494"
FT                   /protein_id="ADH59888.1"
FT                   /translation="MEYIYMGVGGFFGAVLRYLITIYFTKMHHTVFPIETFMINILGSF
FT                   LLSFITNFTMDKYKINTNLRLAITTGFIGAFTTFSTFSMETINLLKAREIYIALNYVIL
FT                   SIIGGLLMSYLGFEFADKIFEFLKEREKE"
FT   gene            101841..102227
FT                   /locus_tag="Tmath_0104"
FT   CDS_pept        101841..102227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0104"
FT                   /product="CrcB protein"
FT                   /note="KEGG: tex:Teth514_0037 CrcB protein; TIGRFAM: CrcB
FT                   protein; PFAM: Camphor resistance CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59889"
FT                   /db_xref="GOA:D7AQK3"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQK3"
FT                   /inference="protein motif:TFAM:TIGR00494"
FT                   /protein_id="ADH59889.1"
FT                   /translation="MIKSTLYVGIGGFFGAILRYEISRHIKEKRQIIIPIETFIINVLG
FT                   SFLLNFLSSPKINVNLDDDVKLFLTTGFLGAFTTYSTFSHETIDLIKNKKYFQAFKYMA
FT                   LTIVFGLIGGVVGYYIGNCVGNLI"
FT   gene            102282..103454
FT                   /locus_tag="Tmath_0105"
FT   CDS_pept        102282..103454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0105"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   tpd:Teth39_2195 metal dependent phosphohydrolase; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59890"
FT                   /db_xref="GOA:D7AQK4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQK4"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ADH59890.1"
FT                   /translation="MNLNYNDLLSAISLALDVQEYKNMGHARRVAYISLRIAKMLNLNE
FT                   EDIKKIYYSAFLHDIGKGDVYEDFNTDEWWKHSVRGSEVVKKLPFGKHFSEIIRYHHEN
FT                   YDGSGYFKLKGDAIPLGAQIIFIADQLDIRYTSLIGKEREYNIRNNTKEFIKNSSGKMF
FT                   NPLVANALFELTRQEKFWLDYKYFDIKSILKTIEPKDTISIEIDELEDIAEVFAQIIDN
FT                   RSRFTYNHSKGISDLAYHMAKVIGYDEETRRKIKIAGLLHDLGKLAVPNFILDKPDKLT
FT                   KEEFMVIKSHTYYTKKILKEIGGIDDIAEWAANHHEKLDGSGYPEGLKGDEIGEIDRHI
FT                   AVCDMYQALTEDRPYRKGLEPKQAIDIIARSVKNNKVSRKSLEILKEVVC"
FT   gene            103504..103776
FT                   /locus_tag="Tmath_0106"
FT   CDS_pept        103504..103776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59891"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQK5"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2194"
FT                   /protein_id="ADH59891.1"
FT                   /translation="MGMLFDYLKEIAVTKNIYDYNSENYQLVNEVKQTIKELKDAEIYF
FT                   QNVTDPDLVDYAIYRLESLKRKYIYLLKRAREEGINFDNFGSLLS"
FT   gene            103832..104104
FT                   /locus_tag="Tmath_0107"
FT   CDS_pept        103832..104104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0107"
FT                   /product="pro-sigmaK processing inhibitor BofA"
FT                   /note="KEGG: tpd:Teth39_2193 sigmaK-factor processing
FT                   regulatory BofA; TIGRFAM: pro-sigmaK processing inhibitor
FT                   BofA; PFAM: sigmaK-factor processing regulatory BofA"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59892"
FT                   /db_xref="GOA:D7AQK6"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQK6"
FT                   /inference="protein motif:TFAM:TIGR02862"
FT                   /protein_id="ADH59892.1"
FT                   /translation="MNISIEYNIIIAYLIGLFLLYFLGWLLVVPKKFLLKIIINGIIGG
FT                   FILLIINLLGKSIGLYIAINPVTALVAGFLGIPGIILLIILQYIA"
FT   gene            104186..104449
FT                   /locus_tag="Tmath_0108"
FT   CDS_pept        104186..104449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59893"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR012452"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQK7"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2192"
FT                   /protein_id="ADH59893.1"
FT                   /translation="MTVKSDMEKAIATAQAALGTYAQFASSTEDPAAKQMFQQMQQDMQ
FT                   RHVTMLTNRLNYINNHNKLNQQSQATQQATQQNQQNVLTNKK"
FT   gene            104811..106335
FT                   /locus_tag="Tmath_R0007"
FT   rRNA            104811..106335
FT                   /locus_tag="Tmath_R0007"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            106424..109394
FT                   /locus_tag="Tmath_R0008"
FT   rRNA            106424..109394
FT                   /locus_tag="Tmath_R0008"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            109427..109535
FT                   /locus_tag="Tmath_R0009"
FT   rRNA            109427..109535
FT                   /locus_tag="Tmath_R0009"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 65.98"
FT   gene            109545..109619
FT                   /locus_tag="Tmath_R0010"
FT                   /note="tRNA-Asn1"
FT   tRNA            109545..109619
FT                   /locus_tag="Tmath_R0010"
FT                   /product="tRNA-Asn"
FT   gene            109631..109705
FT                   /locus_tag="Tmath_R0011"
FT                   /note="tRNA-Gly1"
FT   tRNA            109631..109705
FT                   /locus_tag="Tmath_R0011"
FT                   /product="tRNA-Gly"
FT   gene            109829..110566
FT                   /locus_tag="Tmath_0109"
FT   CDS_pept        109829..110566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0109"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   tpd:Teth39_2190 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59894"
FT                   /db_xref="GOA:D7AQK8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQK8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH59894.1"
FT                   /translation="MLNGKVAIVTGGAGDIGREICIELAKEGASIAIHYNNSYDKAVGL
FT                   KEYIKNNFSYAEIFKADISDRQQVDNMIDSIYNRFGRIDYLINNAGIAQIKPFIEITEE
FT                   DWDKMMNVNLKGIFNCTQSVLRYMLPQKYGSIINISSIWGISGASCEVHYSASKGGIIA
FT                   FTKALAKELGPSKIRVNCIAPGVIDTRMNNILNREEKEHLIEGIPLMSIGKPQDVANAV
FT                   LFLLSDKSNFITGQVITVDGGFI"
FT   gene            complement(110590..111312)
FT                   /locus_tag="Tmath_0110"
FT   CDS_pept        complement(110590..111312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0110"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="KEGG: tpd:Teth39_2189 pseudouridine synthase; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase;
FT                   SMART: RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59895"
FT                   /db_xref="GOA:D7AQK9"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQK9"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ADH59895.1"
FT                   /translation="MAKMRIDKLLSNIGIGTRKEVKKFIKEGLVLVNGNTVKDAGLIVD
FT                   TEFDEILFDGEKINYKEFIYIMMNKPKGVISATYDPIEKTVIDLLPQELKARNPFPVGR
FT                   LDKDTEGLLLITNDGNLAHKLLSPKKNVIKKYYAEILGFVNERDIKAFKEGIVLEDGYK
FT                   TLPADLEILLSSEVSKVYVYIREGKYHQIKRMFESVGKKVVYLKRLAMGSLTLDENLKP
FT                   GQWRELSEEELSLLKKSI"
FT   gene            111365..112177
FT                   /locus_tag="Tmath_0111"
FT   CDS_pept        111365..112177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0111"
FT                   /product="Endo-beta-mannanase-like protein"
FT                   /note="manually curated; KEGG: tpd:Teth39_2182 glycoside
FT                   hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59896"
FT                   /db_xref="GOA:D7AQL0"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQL0"
FT                   /inference="protein motif:COG:COG3934"
FT                   /protein_id="ADH59896.1"
FT                   /translation="MFRVYDIGKEWNHDEIKSEFIEAKSLGINVMRINLFWEDFQPKPD
FT                   VISEEAVKKFDELIKICHEVDMKIAPTFFVGHMSGENWDVPWRESRNIYSDSFMLRHQI
FT                   KLVRFFAEKYKDESAILFWDLSNEPDNYIKAKSRHDAWLWNYVLSNEIKKYDFTYPIEL
FT                   YLSYMPDVYKTDRSYLIYKYAKELSGIEYNVKVESPYIEVKEFDYDGKTLVLFINHEDI
FT                   DIDTKINVREKTKNSEKIQDLISGRQINLEYLTIEANGVVAILLEKGV"
FT   gene            112186..113094
FT                   /locus_tag="Tmath_0112"
FT   CDS_pept        112186..113094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0112"
FT                   /product="glycosidase related protein"
FT                   /note="PFAM: glycosidase PH1107-related; KEGG:
FT                   tpd:Teth39_2181 glycosidase, PH1107-related"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59897"
FT                   /db_xref="GOA:D7AQL1"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQL1"
FT                   /inference="protein motif:PFAM:PF04041"
FT                   /protein_id="ADH59897.1"
FT                   /translation="MFRLTRLSDKPILSPVKEHEWERGAVFNAAVIYEDNKFHLFYRAS
FT                   NNKFVLNTEKPEERYKFISSIGYAVSEDGINFKRFDKPVLVGETPQEAWGVEDPRITKI
FT                   DNKYYMLYTGFGGRDWLDFRICMVWSFDLKNWKGHKIVLDEPNKDAALLSEKINGKYVL
FT                   FHRRMPDIWIAYSDDLVNWYDHKIIMSPKPHTWESKKIGIAGPPLKREDGWLLIYHGVD
FT                   DKNVYRLGAALLDLKDPSKVVARQKEPILEPELDWEINGLVPNVVFSCGAIEANDMYYV
FT                   YYGAADTHIGVAAIEKRKVKF"
FT   gene            113109..114008
FT                   /locus_tag="Tmath_0113"
FT   CDS_pept        113109..114008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0113"
FT                   /product="glycosidase related protein"
FT                   /note="PFAM: glycosidase PH1107-related; KEGG:
FT                   tpd:Teth39_2180 glycosidase, PH1107-related"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59898"
FT                   /db_xref="GOA:D7AQL2"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQL2"
FT                   /inference="protein motif:PFAM:PF04041"
FT                   /protein_id="ADH59898.1"
FT                   /translation="MIRLKRLSDKPVLVPKAENEWERAAVFNTAAIYDNGLFHLIYRAT
FT                   DIGPHAKYGKYTSRLGYAVSKDGINFMRLDKPVMSNETEQELRGLEDPRIVKIDGIYYM
FT                   MYTGFGDRFDDDYRICLATSKNLIDWERKGVVLDEPNKDASLFPEKVEGKYVMLHRRYP
FT                   DIWIAFSDDLKNWYDHKPILKPIPNTWESTRVGIGGPPIKTKDGWFLIYHAADDNNVYR
FT                   LGAVLLDLEDPSKVIARQKQPILEPELKWEKEGYIPNVVFSCGNAVKDDTIYVYYGGAD
FT                   TVIGVATLEMKDIIFNRL"
FT   gene            114215..115261
FT                   /locus_tag="Tmath_0114"
FT   CDS_pept        114215..115261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0114"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; transferase
FT                   hexapeptide repeat containing protein; KEGG:
FT                   tex:Teth514_1787 nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59899"
FT                   /db_xref="GOA:D7AQL3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQL3"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ADH59899.1"
FT                   /translation="MKALLLAGGLGTRLRPLTDDLPKPMVPIMGRPLLESIILNLKKSG
FT                   IDEVVISTYYKSQYIEDYFRQKEDLGVKIHYITEESPLGTGGAIKNAEKFFDDTFLILN
FT                   SDIVSDVNYADLIKYHKRKRAQVTIASIEVRDTSQYGVIEFDEKGFITAFKEKPKSGES
FT                   NSKYINAGVYVFEPDVLKEIPENTVVSVERETYPTLLEKGYRMAIYKFNGYWIDIGTID
FT                   KYKKVHEDILRGKSRFISTNFSRGIILGDNVKIHPTARVIGPAYIGNNTEIDAYATVGP
FT                   YTVIGNNCRIGQESKVSKSILWNNVKVRRFARLDNAVVTSECIVEVNMEIKNTVFTANR
FT                   LASSTMTT"
FT   gene            115291..116466
FT                   /locus_tag="Tmath_0115"
FT   CDS_pept        115291..116466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0115"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   tpd:Teth39_2178 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59900"
FT                   /db_xref="GOA:D7AQL4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQL4"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADH59900.1"
FT                   /translation="MMNITGRNVAFLSTYPPRECGIATFTQDLVNEIKKIKLINFAGVI
FT                   AINDNKVYEYDSDVKYQLQQFVREDYVRLARKLNNSNIDLLVIEHEYGIFGGKWGEYLL
FT                   DLVDNLNIPFVLTVHTVLSNPDEKQLMILRKLGEKSIRVVTMAKNTIPLLEKIYHIPSC
FT                   KITVIPHGVPSLPVLPKETLKEKYGFQGRKIISTFGLINPGKGIEYGIEAISIVAQKYK
FT                   EVLYLILGQTHPNIKREFGEEYRERLQKLVRELGIEKNVKFVDKYLTKKEILEYLKMSD
FT                   IYMTPYLNKEQAVSGTLAYAAGLGKVIISTPYMYAEEILGEGRGLLANFRDANSLAKHI
FT                   EYVFENPEKRLQIESAIKKLGNAMMWNNVAYRYVIMILSVLDSRSREEIVI"
FT   gene            116487..117536
FT                   /locus_tag="Tmath_0116"
FT   CDS_pept        116487..117536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59901"
FT                   /db_xref="GOA:D7AQL5"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQL5"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2177"
FT                   /protein_id="ADH59901.1"
FT                   /translation="MKVSTKFQHLFNLTDDTGILQHSLYSIPDLTKGYTTDDNTRALIA
FT                   ASMLYEVYKDEKYLELLRRYLSFLIYAQNSKGYFRNFMNYNREFIEEVGSEDCFGRCLW
FT                   SLGYLLNTNLSNGFKNVALALLKKALPNVANLNFLRGNAYSLIGLSLLYNSDVTEFNKE
FT                   KIKNLMISISKKIVQRYRQNKDGEWKWFENVMTYSNAVIPWSLLKVYTVTKDEEVLEVA
FT                   KESMEFLAKVTFKNDYFKPVGCKGWYKKGNEKPAEFDEQPIEACETALMYTEAYKIFKE
FT                   EKYREKAFKSYKWFLGENSKNVSLVDEETGGCYDGLTKDGVNLNEGAESVISLIITEMI
FT                   VNHTDIVFK"
FT   gene            117590..118567
FT                   /locus_tag="Tmath_0117"
FT   CDS_pept        117590..118567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0117"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="manually curated; KEGG: tpd:Teth39_2176
FT                   D-alanine--D-alanine ligase; PFAM: D-alanine--D-alanine
FT                   ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59902"
FT                   /db_xref="GOA:D7AQL6"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQL6"
FT                   /inference="protein motif:PRIAM:6.3.2.4"
FT                   /protein_id="ADH59902.1"
FT                   /translation="MKIGVLWRKFRNVEFQRKLMPDKVYDDAYDEAYHHYMAIKEAGFD
FT                   SVLIEWKEDPLETYETIKKEKVDLIFNASSMKEVAFLEVFNIPYVGSGLDLVATDKRMR
FT                   KDIVAFHGLPTPKYVVAKNSQEIPPVGHLRFPLFVKPISGRGSAGIDEENIVYDKDKLP
FT                   QVVRKITEKIGQAALIEEFIEGKEVTVGIIGYKHPQVLPLLEVGYNNVKTNTYEHKMFD
FT                   NEIIKCPMEVSKEVEEKIKETALNIYKVLNAKDFARIDMILSKDNVPYFLELNTFAGLT
FT                   MSSSKGEKHVHHGYMGYMAKAAGLTRGEFIGKIIESAIERYKLK"
FT   gene            118711..119478
FT                   /locus_tag="Tmath_0118"
FT   CDS_pept        118711..119478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0118"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   tpd:Teth39_2175 3-ketoacyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59903"
FT                   /db_xref="GOA:D7AQL7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQL7"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH59903.1"
FT                   /translation="MDFNDKVVIVTGGGQGIGRCIVQTFADKGAKVVIADIDDEAGIEN
FT                   EEYIKSKGGDSLFVHTDVSLEEDVGNLVDKTIKTYGKIDILINNAGVGARGTIYTRPME
FT                   EWDRVINVNLRGTYMCSKYVAPHMRDNGGGVIINIASTRAFMSEPHTEPYSASKGGIIA
FT                   LTHSLAISLGYDKIRVNSISPGWIEVSEWKKSREAKKPQLTEEDHLQHPAGRVGKPEDV
FT                   ANACLFLCSEEASFITGANLIVDGGMTVKMIYV"
FT   gene            119504..120079
FT                   /locus_tag="Tmath_0119"
FT   CDS_pept        119504..120079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0119"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: tte:TTE0070
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59904"
FT                   /db_xref="GOA:D7AQL8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQL8"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADH59904.1"
FT                   /translation="MNKTKEKIFKAAIKTFSKSGFYKSTMEEIAENAGVAKGTLYYHFK
FT                   SKDDILEFLIEEGIKILKQEAIEEIGKLNNAIEKLQKIIFVQTNFLYRNHDFIIVLLSQ
FT                   IWGHGEVPRKFREKLYTYLELIENIIKEGKEQKLIADCDEKIVAAAFFGMISSILALKV
FT                   VEDSNQKFNPHDITDSVFNFALKGLQLQ"
FT   gene            120214..122430
FT                   /locus_tag="Tmath_0120"
FT   CDS_pept        120214..122430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0120"
FT                   /product="YhgE/Pip N-terminal domain protein"
FT                   /note="KEGG: gym:GYMC10_5356 YhgE/Pip N-terminal domain
FT                   protein; TIGRFAM: YhgE/Pip N-terminal domain protein;
FT                   YhgE/Pip C-terminal domain protein; PFAM: ABC-2 type
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59905"
FT                   /db_xref="GOA:D7AQL9"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQL9"
FT                   /inference="protein motif:TFAM:TIGR03061"
FT                   /protein_id="ADH59905.1"
FT                   /translation="MKAFKVAAKEIEKIIKSRFIRVAVIVVAFMPLLYSFLYLYAFWDP
FT                   YSMLDKLPVAVVNEDRGGVYNGKQENFGNEIVQKLKNNKEFKWDFVDYKKGIDGVKGKK
FT                   YYFMIVIPEDFTQNITSVDSSTPKKATIEYITNDKKNFLATQIGNKAIESLQTEIANSI
FT                   RKGYIDALFKSVDELGSGLKEASEAENKLATGTLELYDGARKLNESMSAALDGSKQIKE
FT                   GVLNLRNGLNQALNGSTALYNGASLLSQKFSDASNTEALLSGMNSLQNGIAGINQGLND
FT                   ASNSAIKLKDGINSLVNGYNQVGQNVSSFADSISQLGSGLSQISTALDSAQVALKDYIA
FT                   KHPEASSDPELQKVLIAIAYSNAGIDSMSQNLNSGLTKVQQLNTALAQLQEASNTINNG
FT                   MDSLASGLSYMSQVSSQLVDGSNKLYSGVAQLSVGINTAGEKLKEISNGLYSLNNGIKS
FT                   LSDGSSKLYNGANSLYNGMALLKDGTRQFADGAKSLYDNQRLLAQKLGDASQKIDSSGI
FT                   TTTKKDMINEPIILDTRRLYPVKNYGIGFAPYFIPLSLWVGSLILFFLIDIFDKEKYEG
FT                   MNNVSIQLGKFMSLALVGILQSVVSSFVLVEGLKLDVHNLFYYYLINAVMSLTFIAIIQ
FT                   LFVMLFGIAGKFFAVVLLMLQLTSSGGTFPMELLPKFFNVINPYLPMTYGVAGLREAIS
FT                   GNNISAILHNISIIAGFGVLFLVFIILLAEKADKMEITQRLKQI"
FT   gene            122700..128204
FT                   /locus_tag="Tmath_0121"
FT   CDS_pept        122700..128204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0121"
FT                   /product="alpha amylase catalytic region"
FT                   /note="KEGG: tex:Teth514_1781 alpha amylase, catalytic
FT                   region; PFAM: alpha amylase catalytic region; glycoside
FT                   hydrolase family 13 domain protein Ig domain protein region
FT                   domain protein; Fibronectin type III domain protein;
FT                   glycoside hydrolase starch-binding; S-layer domain protein;
FT                   SMART: alpha amylase catalytic sub domain; alpha amylase
FT                   all-beta; Fibronectin type III domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59906"
FT                   /db_xref="GOA:D7AQM0"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031319"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQM0"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ADH59906.1"
FT                   /translation="MFNKRILGFLLSFLLIFTAVFGSMPMEFAKAETDTAPATAVVAGN
FT                   FQSKLGDTDWKGDSSITVMTYKGNGFYEYTTHTALPAGDYEYKIVLNGSQWIPDGFGNN
FT                   LKFHLDKDSVVTFYYNYSTSSVTDSTKYTPIPEEKLPRIVGTIQSAIGAGSDWSPETST
FT                   AVMRDYKFNNVYEYTANVPKGNYEFKVTLGPSWDINYGLNGEQNGPNIPLNVAYDTKIT
FT                   FYYDSVSHKIWTDYNPPLTGPDNNIYYDDLRHDTHDPFFRSPFGAIKTGDTVTLRIQAR
FT                   NHDLESAKISYWDDIKKTRIEVPMYKIGQSPDGKYEYWEVKLSFDHPTRIWYYFILKDG
FT                   TKTAYYGDNDEQLGGEGKATDTVNKDFELTVYDKNLDTPDWMKGAVMYQIFPDRFYNGD
FT                   TSNDHARTLSRGSDPVEFHDDWYELPDNPNDKDKPGYKYDGIWNNDFFGGDLKGIDDKL
FT                   DYLKELGISVIYLNPIFDSPSNHKYDTADYSKIDPMFGNLDVFKKLMEDAHAKGIKVIL
FT                   DGVFNHTSDDSIYFDRYGKYLDKGLGAYQAWLQGDQAKSPYGEWYEIKPDGTYEGWWGF
FT                   DSLPVIRQINGSEYNVKSWADFIINNSDAISKYWLNPDGDTNAGADGWRLDVANEVSND
FT                   FWTHFRNSINTVKSNAPMIAEVWEDASSYLLGDSFNSVMNYLFRNAVIDFILDESFDDG
FT                   NVVHNPIDAAKLNQRLMSIYERYPLPVFYSTMNLLGSHDTMRILTVFGYNSADENQNSQ
FT                   AAKDLAVKRLKLAAILQMGYPGMPSIYYGDEAGQSGGKDPDNRRTFPWGREDKDLQDFF
FT                   KKVVNIRNENQVLKTGDLETLYANGDVFAFGRRIINGKDVFGKSYPDSVAIVVINKGDA
FT                   KQVSIDTTKFIRDGVTFTDALSGKTYTVNDGQIVVEVGSMDGAILISDPGQNLTAPQPI
FT                   QDLKAVSGNGKVDLSWSAVDRAVSYNIYRSTVKGGLYEKIASNVTQTSYTDTEVTNGLK
FT                   YVYAVTAVDNYGNESALSNEVEAYPAFPIGWAGNMNQVDTHVIGVNNPVEVYAEVWAEG
FT                   LTDKPGQGENMIAQLGYRYLGDTVGYAVYSDVYNGVEGVAINSDWTWVDAQYVGDSGNN
FT                   DKYMAKFVPDMVGTWEYIMRFSSNQGQDWTQTDVKQFTVVPSNDSVPPTVPVLQQPGIE
FT                   SSRVTLNWSPSADDVAIYGYEIYKSSSETGPFVKIATVSDSVYNYVDTDVVNGNVYYYK
FT                   VVAVDTSYNRRASNTVKATPDIIPIKVTFNVTVPDYTPDDGVNIAGNFPDAFWNPTAQQ
FT                   MIKTGPNTYSITLTLNEGTKIEYKYARGSWDKVEKGEYGEEIDNRKVTVTNQGSNTMVI
FT                   NDTVQRWRDLPIYIYSPKDNTTVDANTSEIEIRGNTYKGAKVTINDESFVQQENGVFTK
FT                   VIPLEYGVNTIKIHVEPSGDKNNELTKDITITVTREKPGHERQPTPTSPTEPSEEVSQG
FT                   RVVVENNTTILKVDENKVAKDIKDTSKQEIQFDLTNIGTTPQKALEIPVTVFNLIVEYN
FT                   KNVVVKSEEVALQFDAKTLTISQEAIDLINKAGTIKLNIHNKGKKEASTFEPVTDAYDI
FT                   TIKAGDKDIKIGSPVKMTFNIEGAKDIRKVGAYYLNETTNQWEYIGGKIDRETNTITFE
FT                   AKHFSTYAAFQYNKQFKDVSKDNWAYDVINVLASRHIIKGIDENTFLPNKKITRAEFAA
FT                   LMTRALGIEEKPYKGQFNDVKEGAWYANAVEAAYKAGIILGDGKNMRPNDPITREEMAA
FT                   VIMRVYGKLVEYREDNIGNTTFSDNNKISEWAKNAVANAVKLGIVKGYKDNTFRPKENA
FT                   TRAEAAAMLYRVLEKTGNI"
FT   gene            complement(128234..128335)
FT                   /pseudo
FT                   /locus_tag="Tmath_0122"
FT   gene            128445..129287
FT                   /locus_tag="Tmath_0123"
FT   CDS_pept        128445..129287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0123"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit"
FT                   /EC_number="4.2.1.2"
FT                   /note="TIGRFAM: hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit; KEGG: tpd:Teth39_2171 fumarate
FT                   hydratase; PFAM: Fe-S type hydro-lyase tartrate/fumarate
FT                   alpha region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59907"
FT                   /db_xref="GOA:D7AQM1"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQM1"
FT                   /inference="protein motif:TFAM:TIGR00722"
FT                   /protein_id="ADH59907.1"
FT                   /translation="MKEIQAKKITEIVKLLCIEANYELPQDIFKNLKERIKEEISPLGR
FT                   EILKDIIANAEVAKTQRMPICQDTGIVIVFVEMGQEVHIVNGSLEEAINEGVRLGYEEG
FT                   YLRKSVVKSPILRINTGDNTPAIIHYHICKGDKFSITVMPKGAGSENMSALKMLKPSEG
FT                   VEGIKSFVIETVEKAGPNACPPLIVGIGIGGDFEYAPYLAKKALLRDIGQRNPDKMLAK
FT                   LEEELLREINMLGIGPQGLGGKNTALDVHIETYPTHIASLPVAVNLGCHVTRHATFIL"
FT   gene            129306..129866
FT                   /locus_tag="Tmath_0124"
FT   CDS_pept        129306..129866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0124"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, beta subunit"
FT                   /note="KEGG: tpd:Teth39_2170 tartrate/fumarate subfamily
FT                   Fe-S type hydro-lyase beta subunit; TIGRFAM: hydro-lyase,
FT                   Fe-S type, tartrate/fumarate subfamily, beta subunit; PFAM:
FT                   Fe-S type hydro-lyase tartrate/fumarate beta region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59908"
FT                   /db_xref="GOA:D7AQM2"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQM2"
FT                   /inference="protein motif:TFAM:TIGR00723"
FT                   /protein_id="ADH59908.1"
FT                   /translation="MYKKVNTPLTEEIIDQLNAGDLVLLSGEIYTARDEAHKRMIESLK
FT                   KGRELPFEIKNSIIYYVGPCPPKPGQVVGSCGPTTSGRMDKYTPVLIELGLKGMIGKGY
FT                   RSKEVIEAMKRYKAVYFTAIGGAGALLAQKVKKAEIVAYEDLGTEAIYKFFVENFPVIV
FT                   TIDIYGNNLYDIERKKYKTNLKR"
FT   gene            129872..130432
FT                   /locus_tag="Tmath_0125"
FT   CDS_pept        129872..130432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0125"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="KEGG: tpd:Teth39_2169 phage SPO1 DNA
FT                   polymerase-related protein; TIGRFAM: phage SPO1 DNA
FT                   polymerase-related protein; PFAM: Uracil-DNA glycosylase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59909"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQM3"
FT                   /inference="protein motif:TFAM:TIGR00758"
FT                   /protein_id="ADH59909.1"
FT                   /translation="MALLPLKELYLECLHCTKCDLSKTKTNMVFGEGNLRAKVIFVGEG
FT                   PGRDEDLQGRPFVGRAGQLLNKMLEEVGLKRGEVYIANIVKCRPPNNRVPLQSEVDACL
FT                   PYLRNQVAIIAPKIIVCLGATAAKAIIDKNFKITVMRGQWFERKGVKIIATYHPAAILR
FT                   DPEKLEPAMEDFKKIKEELDKLL"
FT   gene            complement(130491..131699)
FT                   /locus_tag="Tmath_0126"
FT   CDS_pept        complement(130491..131699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2168 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59910"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQM4"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2168"
FT                   /protein_id="ADH59910.1"
FT                   /translation="MKVTLGIFINGQHGTIIAGSGKYLLYERKFSSQTFLNELQHCLTV
FT                   LGLSKKNVSKIYFTPPFSFSPENKTSSIIHLRLVPEQFSDFSVYPQNLQKSVKILQVAP
FT                   QKLLQKLEENEDQIKKAKVISIITPFGLVYPEKENKAVYTINKFNQGIILKSQNYPHLG
FT                   FHKREKSLLIADNFVVAVSPYVQQLKNFFAPHSPGIYWVENEAVYLTEDFLPQTCGKIY
FT                   EFTPLIQLARGAAVSFGYDYALALFKIGSIFKLFQIQNYVEVSELSSPFSFAATSSVQP
FT                   LFDDIKGKLPKALQDVIPIFNFSSCYFSDSYPYRFYQITFSKSLRYIGLLTAPSILTSI
FT                   TVCKQEDLYYHKKRLLKNLYLVNKNHNLLKKPIAFCQETPIRYLTSNHTILKVELKESN
FT                   SFQ"
FT   gene            complement(131696..132805)
FT                   /locus_tag="Tmath_0127"
FT   CDS_pept        complement(131696..132805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0127"
FT                   /product="protein of unknown function DUF917"
FT                   /note="PFAM: protein of unknown function DUF917; KEGG:
FT                   tpd:Teth39_2167 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59911"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQM5"
FT                   /inference="protein motif:PFAM:PF06032"
FT                   /protein_id="ADH59911.1"
FT                   /translation="MQEITSDWIEPLWYGSIFLGSGGGGKSELLASVLDKALQNRVIPL
FT                   LTLDELSESNFFCGIGLLGSPELCEENLPSGKEASIAIEELEKYTGFQFNGISIVEGAG
FT                   VNIFYPLLAALQTGLPVIDGDAMGRAFPELQMTTYHLENLPVTPLVLVDGSYNVHLFLE
FT                   KQDTFLLELNTRQIVCQQGGVGYFAGFPYSGSVLKKVLLPSTLTFAREIGECFLHADNY
FT                   HELFNLLLEVTSNSFYGPIVEIFQGTIKNISAYETAKWKAATLISPKGEELQLLFQYEN
FT                   LLAFKNGHIAASVPDLISAIDLNKLKPVNNNEIYEGQPLVLLGLPAPLRLRINKALDVV
FT                   GPQCFGYRTIYVPLEKLYWDYYHEKEVFF"
FT   gene            complement(132814..134373)
FT                   /locus_tag="Tmath_0128"
FT   CDS_pept        complement(132814..134373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0128"
FT                   /product="putative sigma54 specific transcriptional
FT                   regulator"
FT                   /note="KEGG: tpd:Teth39_2166 putative sigma54 specific
FT                   transcriptional regulator; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59912"
FT                   /db_xref="GOA:D7AQM6"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQM6"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADH59912.1"
FT                   /translation="MIDSLQETFGFVTELQKECLSFISPSKAGYHVWSPPCTPTCPNIN
FT                   NCPYDLILSFKIEKNNFLVALPKKRSKNLKITPASIIKFLQIVLETSFASEQKTHNILL
FT                   LEQTLQFLAKQSNIEFYLFNNKGQIILSQNSSFVQLSPSDIWEKLGDANDSEGFIKTQW
FT                   GNFYYHLFVKNDKPIGLIIWKIKSFQKNVNFCPSSKDYSFAIIGKNYHFTEIKKLIRQI
FT                   AATEHTILLQGESGTGKELFARYIHHLSPRKDGPFIAINCAAIPENLLESELFGYEDGS
FT                   FTGARRGGKPGKFELANGGTIFLDEIGDMPLPLQAKLLRVLEDRQVERIGATISRPVDI
FT                   RVIAATNKNLKELIDAKLFREDLFFRLSVFPVYIPALRERRDDILLLLDFYLKNICLEQ
FT                   DKPFKIFSPETIEILQNYSWPGNIRELKNVVTYAVSLCKDDIITPQYLPKYLQNGVSFN
FT                   KYQFTNVKSEHSFIEDEQLKNQLEILLAKYGKSTQSKKLIAQELGISLATLYRWLKKYR
FT                   IR"
FT   gene            134751..136013
FT                   /locus_tag="Tmath_0129"
FT   CDS_pept        134751..136013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0129"
FT                   /product="permease for cytosine/purines uracil thiamine
FT                   allantoin"
FT                   /note="PFAM: permease for cytosine/purines uracil thiamine
FT                   allantoin; KEGG: tpd:Teth39_2165 permease for
FT                   cytosine/purines, uracil, thiamine, allantoin"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59913"
FT                   /db_xref="GOA:D7AQM7"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQM7"
FT                   /inference="protein motif:PFAM:PF02133"
FT                   /protein_id="ADH59913.1"
FT                   /translation="MEQHALDPIPESEKRPWYSIALIWAGSMICVSSLMVGGAIVQGMP
FT                   LLEAIIAGAIGYTIIIVYMTFQGMQGADLGVPTVVTSSSAFGREGARFIISAILAISCI
FT                   GWFGVQASVCGAAFSQIMNMWLGIYIPVWLSGLVWGIIMLVTAVYGYKALEYLNYIAIP
FT                   ALVFLSIVGLIQVLTTFGIENLINYVPKDRYSWSYAIGLAVGGFAVGGVIAADFSRYAK
FT                   SRKDALTSGLVGVWPAGMFLLVVGALLTVVAGTYDITIALAQLGLGFVGAVILILATWT
FT                   TNTVNAYSGGLAIVSLFNMENKLRPLMTFIAGAIGTVLAIMGILNYFTSFLTVLTASIP
FT                   PIAGSMIADYWICKKGNRNMWEAGIVDINWIGIASLVIGFIVALFMKTGISAINGIISS
FT                   MVCYLVLYYVLKVSKSATALH"
FT   gene            136152..137255
FT                   /locus_tag="Tmath_0130"
FT   CDS_pept        136152..137255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0130"
FT                   /product="protein of unknown function DUF917"
FT                   /note="PFAM: protein of unknown function DUF917; KEGG:
FT                   tpd:Teth39_2164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59914"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR024071"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQM8"
FT                   /inference="protein motif:PFAM:PF06032"
FT                   /protein_id="ADH59914.1"
FT                   /translation="MKKDIEKLEKIDLQAVEDIAVGAALLGTGGGGDPYVGKLMAIQSI
FT                   QRNGPVELIDVENIPDDALVVPVAMMGAPTVLVEKVPSGKEIFKAFDSLQSFLGKEVYA
FT                   VLPIEAGGVNSMIPIMVAGERKVPLVDVDGMGRAFPELQMVTYHLYGVSATPMVLADEK
FT                   GNSILLHTINNFWTESLARNATVVMGGSVMIAIYPMSGKDVKQAGIRNVVSYSAQIGKA
FT                   IREARKKGENPIEALLEVTGGYMLFKGKISDVQRRTTGGFVRGEAHIDGIDQYKGEAMI
FT                   IDFQNENLIARRNGKVVATVPDLICTVDAHTALPITTEGLRYGQRVFIIGIPCDEKWRT
FT                   EKGIETVGPRYFGYDVDYIPVEELNRG"
FT   gene            137272..138822
FT                   /locus_tag="Tmath_0131"
FT   CDS_pept        137272..138822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0131"
FT                   /product="Hydantoinase/oxoprolinase"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG:
FT                   tpd:Teth39_2163 hydantoinase/oxoprolinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59915"
FT                   /db_xref="GOA:D7AQM9"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQM9"
FT                   /inference="protein motif:PFAM:PF01968"
FT                   /protein_id="ADH59915.1"
FT                   /translation="MEYRIGIDVGGTNTDAVLVDENLELVESVKVPTTKDVSSGIFEAM
FT                   NKVLYKSKIDRKKIKYAMLGTTHATNAVAERKRLCKTAIIRIGKPATAAIAPLVDWPKD
FT                   LVDAVGNHYYLIAGGNEFDGREISPLDENELRKIAKEIKGKVESIAIVSVFSPVNNKHE
FT                   LRAKEILQEVLGEIPISLSHEIGSLGLLERENATVLNAALVEVARTTANSFKDALKREG
FT                   LTEAKIYLCQNDGTLMSIDYAMRYPILTIACGPTNSMRGAAFLSKLENALVLDVGGTTS
FT                   DIGVISQGFPRESSIAVEIGGVRTNFRMPDLISLALGGGTIIREKNGEIKIGPESVGYR
FT                   ITEEALVFGGKTITATDIAVRLGLAEVGSKEKVKDIPLEFAKRVYAKMQEMVNEAIDKM
FT                   KTSKDPQPLVLVGGGSIIVGNEIHGVSEIIRPNNFGVANALGAAIAQVSGEVDRIYSLS
FT                   EMSREAALNDAKQRAINEAIKAGANPDTIEIVYVEDIPLAYLPGNAVKIRVKAAGSLI"
FT   gene            139023..139751
FT                   /locus_tag="Tmath_0132"
FT   CDS_pept        139023..139751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0132"
FT                   /product="Hydantoin racemase"
FT                   /note="KEGG: chy:CHY_1338 hydantoin racemase; PFAM:
FT                   Asp/Glu/hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59916"
FT                   /db_xref="GOA:D7AQN0"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQN0"
FT                   /inference="protein motif:PRIAM:5.1.99.5"
FT                   /protein_id="ADH59916.1"
FT                   /translation="MKLKIIVPITSDEFNEEVKREIKHYVDPDDYVDVENLDYGPASIE
FT                   CEYDEAMAVPDILNKVKKAQEEGFEGIVIDCFGDPGVHAARELVDIPVCGGFEPPMQIV
FT                   LGLGQNIGVITVLPNVVPMLHDLVAKMGIEKRVKSIRYVNIPVLDLGDKQKLEDALFKE
FT                   SLEAIQKENVHVIVLGCTGMMGVARNLMNRLKEKGYDVPVINPAFAAVRMVKTYVRMGL
FT                   KHSRLTYMIPPVKLYTWWEK"
FT   gene            140157..141681
FT                   /locus_tag="Tmath_R0012"
FT   rRNA            140157..141681
FT                   /locus_tag="Tmath_R0012"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            141770..144738
FT                   /locus_tag="Tmath_R0013"
FT   rRNA            141770..144738
FT                   /locus_tag="Tmath_R0013"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            144771..144879
FT                   /locus_tag="Tmath_R0014"
FT   rRNA            144771..144879
FT                   /locus_tag="Tmath_R0014"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 63.93"
FT   gene            complement(144922..145140)
FT                   /locus_tag="Tmath_0133"
FT   CDS_pept        complement(144922..145140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0133"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: tpd:Teth39_2160
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59917"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQN1"
FT                   /inference="protein motif:PFAM:PF01206"
FT                   /protein_id="ADH59917.1"
FT                   /translation="MMHELMTFGEICPLPLLKAIEKYKKMEKGDMLKIVVDHSCSLKNI
FT                   QEYFLKLNCSVEIDEVLNGVWEIYIKK"
FT   gene            complement(145153..146046)
FT                   /locus_tag="Tmath_0134"
FT   CDS_pept        complement(145153..146046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0134"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: tpd:Teth39_2159 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59918"
FT                   /db_xref="GOA:D7AQN2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQN2"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH59918.1"
FT                   /translation="MNINNLRAFYKTVYYKSISSSAKELYLSQPAISQQIKALEKDLKT
FT                   TLLKRSNRGVIPTPAGELVYHYAERILNLYDNMIQDLQCCENDRINRLTISCCPTIGQY
FT                   ALPCALHEFKKKNKNITLHVEHNFSNEVIHHIKEGGTDIGFIEGCYSDENINCIPLGEF
FT                   KMHFVASGNWELKNLPKNKLFYYNFFIIHKNCASRKIIEETLLEYGIDINKLKIEMESP
FT                   SIESIKSSIAAGHGLSILPYISIKKELYTKTLTIVEVDNIEFNYTYSLIYDKKIHKKIK
FT                   SDFIDFIKNSGKTFFC"
FT   gene            146245..146898
FT                   /locus_tag="Tmath_0135"
FT   CDS_pept        146245..146898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0135"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: tex:Teth514_0045 protein of unknown function DUF395,
FT                   YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59919"
FT                   /db_xref="GOA:D7AQN3"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQN3"
FT                   /inference="protein motif:PFAM:PF04143"
FT                   /protein_id="ADH59919.1"
FT                   /translation="MEAVKKSKKKKANQFPYGVALLVVIVIIGIILSKQSTKLAVYWAF
FT                   GIAFGFVLQKARFCFTASLRDPVLTGSTSLTRAVIVAFMIATIGFAAIQYNAYLRGEAI
FT                   PGNIAPVGIHTVIGATMFGIGMVIAGGCASGTLMRVGEGFMMQWLSIIFFIIGSLWGAR
FT                   DFGWWTKVSIAKSPKVFLPDVFGWGVAFFGQLILLGLLFILAEWYEYKRFNAKN"
FT   gene            146919..147146
FT                   /locus_tag="Tmath_0136"
FT   CDS_pept        146919..147146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0136"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: tpd:Teth39_2157
FT                   SirA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59920"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQN4"
FT                   /inference="protein motif:PFAM:PF01206"
FT                   /protein_id="ADH59920.1"
FT                   /translation="MAEYRLDCLGEACPVPLLKTQKEMEKLKVGDVLIVEIDHSCAMKN
FT                   VPEWARNMGYNVEIEEVDDGQWEVYIEKTK"
FT   gene            147163..147696
FT                   /locus_tag="Tmath_0137"
FT   CDS_pept        147163..147696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0137"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: tpd:Teth39_2156 protein of unknown function DUF395,
FT                   YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59921"
FT                   /db_xref="GOA:D7AQN5"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQN5"
FT                   /inference="protein motif:PFAM:PF04143"
FT                   /protein_id="ADH59921.1"
FT                   /translation="MNFQEHPFFKKIIKDAWSYWTGAVLLGLLNIALFAFSGHPWGITT
FT                   TFSYWGAWIFRALGGHPETWTYFQNPSHAKALTQSVFTNTGSVQDIGIILGAFLATLLA
FT                   SQFKIKKIKSHKQVVAAILGGLLMGYGARIAFGCNIGAFFSGVSSMSLHGWVYTVFILI
FT                   GAWIGSKLLVKYFM"
FT   gene            147743..148966
FT                   /locus_tag="Tmath_0138"
FT   CDS_pept        147743..148966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0138"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: tpd:Teth39_2155 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59922"
FT                   /db_xref="GOA:D7AQN6"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQN6"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADH59922.1"
FT                   /translation="MEKKKEYYDVVVIGGGPAGMTAAIYCGRARLKTLLIEKSLVGGLA
FT                   TYTSEIENYPGFPEPIAGLELMKLFEQQTKRFGVQIKLTDVKGLRIEEDYKVVSTFRVD
FT                   YYAKAVIIATGGKPRLTGAKGEENFLYDKGISFCATCDAAYYTDKKVMIIGSGDAAIEE
FT                   GIFLTKFAREVHVSVIHDEGIMDANKVAQEKALKNEKMIFHWNTMVEAFEGNERLERVV
FT                   LKNLKTGELIPVDVDGCFLFIGYVPNTEIFKGLINMTPKGYIITNENMETNIDGVYAVG
FT                   DVRDKFLRQVATAVGDGAIAGVMAEKYIEETDYFTNEILKAKETVLAYVYNAVEAKDRE
FT                   YLMKVEEFHKKYADKLKMCRIDIYKSDRLAKRLYCEKVPCIAVVKEGKVAKHIYDLEDF
FT                   EKELLSCI"
FT   gene            149349..150296
FT                   /locus_tag="Tmath_0139"
FT   CDS_pept        149349..150296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0139"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: tpd:Teth39_2154 ROK
FT                   family glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59923"
FT                   /db_xref="GOA:D7AQN7"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQN7"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADH59923.1"
FT                   /translation="MGRILCGVDLGGTKISTGLVDEKGTIIKSIKIPTMAEKGPEEVIY
FT                   RIERSIYDVLKETGLKLSDLKGVGIGSPGPLDAKRGVVVSPPNLPGWNNVPIVDILSRK
FT                   LELEVKLENDANAAAIGEHLFGAGRGIDNFVYITVSTGIGGGVIIEGKLYSGENSNAAE
FT                   IGHHTINFNGPRCNCGNYGCFEAFASGTAIARFAQQGIQDGENTMIKDLAKDGVVKSEH
FT                   VFEAAKLGDEFAKVLVDKEAFYLGVGISNIMAFYNPKRVAIGGGVSTQWEMLYDKMMET
FT                   IKEKALKPNAAVCEIVKAELGENVGVLGAAALLL"
FT   gene            150307..150879
FT                   /locus_tag="Tmath_0140"
FT   CDS_pept        150307..150879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0140"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="KEGG: tpd:Teth39_2153 DNA-3-methyladenine
FT                   glycosylase I; PFAM: methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59924"
FT                   /db_xref="GOA:D7AQN8"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQN8"
FT                   /inference="protein motif:PRIAM:3.2.2.20"
FT                   /protein_id="ADH59924.1"
FT                   /translation="MNRCPWCLGDDLYIKYHDEEWGVPVHEDKKHFEFLVLESAQAGLS
FT                   WITILKKRENYRKAYADFDPIKVSQYDEKKIEELIKNSGIIKNRKKIEASVHNAKRFIE
FT                   IQQEFGSFDKYIWSFVDYKPIINKWERIEDIPSKTELSDKISRELKKRGFIFIGSTIIY
FT                   SYMQAVGIVNDHLISCFRYKELIETFK"
FT   gene            151015..151239
FT                   /locus_tag="Tmath_0141"
FT   CDS_pept        151015..151239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0141"
FT                   /product="Sigma-G inhibitor, Gin"
FT                   /note="PFAM: Sigma-G inhibitor, Gin; KEGG: tpd:Teth39_2152
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59925"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQN9"
FT                   /inference="protein motif:PFAM:PF10764"
FT                   /protein_id="ADH59925.1"
FT                   /translation="MVLTMESIATRKKCFICEQQSEDGIEVLGKFLCTNCQEKLIDLSP
FT                   FDESYDFYKQKMIDIWEGYMKGIRYENRM"
FT   gene            151306..152730
FT                   /locus_tag="Tmath_0142"
FT   CDS_pept        151306..152730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0142"
FT                   /product="Arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /note="KEGG: tpd:Teth39_2151 Orn/Lys/Arg decarboxylase,
FT                   major region; PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   Orn/Lys/Arg decarboxylase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59926"
FT                   /db_xref="GOA:D7AQP0"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQP0"
FT                   /inference="protein motif:PRIAM:4.1.1.19"
FT                   /protein_id="ADH59926.1"
FT                   /translation="MTAPLYEALMDYVKKQIIPFHMPGHKQGRIFPEEYLVNLTKIDLT
FT                   EVPGLDNLHNPEGPILEAQKLAARAFGAKESFFLVNGTTSGIYAAMYAVLDPDDKVLIM
FT                   RNSHKSVYNGLVLTGAVPFYINPEIDYESGIPMGVNIDKLEECLKKNESIKAVVITYPN
FT                   YYGFCSDIEKISDIVHKYHKILIVDEAHGAHFPFSGNLPLSSLQVGADIVVQSIHKTLS
FT                   SFTQSSILHLNSDRVDTNRLKYFLSLFQSTSPSYLLMSSLDLARDYMEKEGKNRLEKAI
FT                   ILADYARHEINTLGGVRCLGEEILGSFGIVDFDKTKLTISVKNLGITGPEAEGFLRENF
FT                   NIQVEMADTFNILAMITLADNKEEVELLIKGLANMKNLKKDKKLEVEIEDYPDVPEMVL
FT                   KPAEAIRQKTKWVSLEDAEGSICADFIIPYPPGVPLVCPGERIKKDMVKYINVLYNKGI
FT                   KILGLNKNNSLLVCEI"
FT   gene            152727..153341
FT                   /locus_tag="Tmath_0143"
FT   CDS_pept        152727..153341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0143"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="TIGRFAM: thymidylate kinase; KEGG: tpd:Teth39_2150
FT                   dTMP kinase; PFAM: thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59927"
FT                   /db_xref="GOA:D7AQP1"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQP1"
FT                   /inference="protein motif:TFAM:TIGR00041"
FT                   /protein_id="ADH59927.1"
FT                   /translation="MKGKFISFEGIDGCGKTTQIKFLKEYLLKKGYNILVLREPGGTNV
FT                   GEKVRDILLDKYNFISPVTEMLLYASSRAQLVEEKILPAIKEGKIVLLDRFVDSSYVYQ
FT                   GYARGLGIEKVKIVNEIATMGILPDVTIYIDITPEEAMKRRGKREADRLERESWDFHKK
FT                   VREGYIKLVKEYPKRFVFIDGMQEIVKVHQDIIDAVKKYLL"
FT   gene            153354..153683
FT                   /locus_tag="Tmath_0144"
FT   CDS_pept        153354..153683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0144"
FT                   /product="protein of unknown function DUF970"
FT                   /note="PFAM: protein of unknown function DUF970; KEGG:
FT                   tpd:Teth39_2149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59928"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQP2"
FT                   /inference="protein motif:PFAM:PF06153"
FT                   /protein_id="ADH59928.1"
FT                   /translation="MKLVLAIVQDEDVRRLMDGLTEGGFSFTRIASTGGFLRSGNTTLI
FT                   IGVEDEKLEDVISIIEQKCKTRDRIITSPTPMGGATDIFLPQAVEVTIGGATVFVLNVE
FT                   KFLRI"
FT   gene            153694..154131
FT                   /locus_tag="Tmath_0145"
FT   CDS_pept        153694..154131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0145"
FT                   /product="protein of unknown function DUF327"
FT                   /note="PFAM: protein of unknown function DUF327; KEGG:
FT                   tpd:Teth39_2148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59929"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQP3"
FT                   /inference="protein motif:PFAM:PF03885"
FT                   /protein_id="ADH59929.1"
FT                   /translation="MRIQEVKSPKISSDIKSEYNKSRVTKKFIDTFDEELDQFHQDKLS
FT                   EILSEIDSAAQKLKESLTLQDLINYKKLVKKFLQEATNGMLKYTKKEYLDGRGRKKIYS
FT                   LVEKVNGKLEKLTEEFLKDSKHLELLKMIDDIRGLLIDIYS"
FT   gene            154140..155114
FT                   /locus_tag="Tmath_0146"
FT   CDS_pept        154140..155114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0146"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   KEGG: tpd:Teth39_2147 DNA polymerase III, delta prime
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59930"
FT                   /db_xref="GOA:D7AQP4"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQP4"
FT                   /inference="protein motif:TFAM:TIGR00678"
FT                   /protein_id="ADH59930.1"
FT                   /translation="MYRIYGHETVLNIFKNVISQNKISNAYLLVGEKGLGKRFMAEYFA
FT                   IMVNCKKETEKPCFKCSSCLKLMDKNHPDVFFIEPEENSIKVDTIRYITNEINIRPYEA
FT                   NKKIFIIDQADKMTVSAQNAFLKTLEEPPLYGLFILIASQQQKLLPTIISRCNIVRFGK
FT                   ESKNTIKNYLICEQNIPEKEAEVLAHIADGNFDQANKLTDNEYLNFRKETIQEIEKILT
FT                   IRGFEVIEEFEFFDKNKDNIEEILKIMLYYVRDLLIYKVTKDASFIKNIDFLNKIQQME
FT                   SQLTINKLNNIINKIEQFNWQINSNVNYQLAVENLLLDMAGGL"
FT   gene            155117..155995
FT                   /locus_tag="Tmath_0147"
FT   CDS_pept        155117..155995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0147"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: tpd:Teth39_2146
FT                   PSP1 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59931"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQP5"
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /protein_id="ADH59931.1"
FT                   /translation="MVTVVGVRFKKAGKIYYFDPGDLPIEIGDKVIVETIRGIEFGEVV
FT                   VGIKEVAEEEIVAPLKKVIRIATPEDVEHYYENKKKEAKAFEICLEKIQQHGLEMNLID
FT                   VEYTFDNTKVIFYFTAEGRVDFRELVKDLAAVFRMRIELRQIGVRDEAKIIGGLGPCGR
FT                   PLCCTTFLGEFEPVSIKMAKDQNLSLNPTKISGICGRLMCCLKYEQEMYDKIKAELPKV
FT                   GSIIRVGDKEMKIAEVDVIRRKLKVKVKNAEGIEIIKEYDPEEVEVIEEREEEIEENYE
FT                   GELEKIEEIEE"
FT   gene            complement(156116..157339)
FT                   /locus_tag="Tmath_0148"
FT   CDS_pept        complement(156116..157339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0148"
FT                   /product="Arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="KEGG: tpd:Teth39_2145 arginine deiminase; PFAM:
FT                   amidinotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59932"
FT                   /db_xref="GOA:D7AQP6"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQP6"
FT                   /inference="protein motif:PRIAM:3.5.3.6"
FT                   /protein_id="ADH59932.1"
FT                   /translation="MTKVVTAPRVSSEINKLKMAILHRPGKELERLTPQNLSELLFDDI
FT                   PWVRRIQEEHDNFVKVLQQNNVQVLYLQNLLEEILKEENVKEKFIDELLQVNGVTSPKI
FT                   NNYLKEFLKEKSPNNVAEIAIAGLALNEIKIKKSMMGLAEYIYQDNYFYIKPLPNLYFT
FT                   RDPGAMIDGGLMISSMKTAVRRPETLILKYIYKYHEIFRKNNVPWWYDDSYPHSIEGGD
FT                   VLILSEKVIAVGCSERTTPQAIEQLAHNLFEKGSSVEKILVVQIPINRSYMHLDTVFTM
FT                   VDTNRFVFYPGIKNDLRVFSIIKEEKGFSINQEKDLQTALKNALNLYTIDIIPTGGLNA
FT                   ITSAREQWNDSTNTLAIAPGVIVAYSRNEISNKIMEKEGIKVIPIEGSELSRGRGGPRC
FT                   MTMPLLRE"
FT   gene            157478..158224
FT                   /locus_tag="Tmath_0149"
FT   CDS_pept        157478..158224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0149"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: tpd:Teth39_2144
FT                   methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59933"
FT                   /db_xref="GOA:D7AQP7"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7AQP7"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ADH59933.1"
FT                   /translation="MLKDGERLDELNLKNLVIIQHKDKFKFGMDAVLLANFVTAKKGDK
FT                   IVDLGCGTGIIPILIAAKTYDTFIYGVEIQEDMADMATRSVVINNMEKRIKIIQGDVRG
FT                   IEKTLGYEKFDIVTSNPPYMPVKAGFDKKRKSENIARYEIYGGLEEFIKAASKLLKFGG
FT                   KFFMVYRAERLVDILYFLRKYNLEPKKLRFVYPYVDSKPNLLLIESKKGSQPGLNILPS
FT                   LYVYEKNGEYTKEIVEIYSKEKLEEG"
FT   gene            158227..159045
FT                   /locus_tag="Tmath_0150"
FT   CDS_pept        158227..159045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0150"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: tpd:Teth39_2143
FT                   uroporphyrin-III C/tetrapyrrole methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59934"
FT                   /db_xref="GOA:D7AR25"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR25"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ADH59934.1"
FT                   /translation="MDYGILYLCPTPIGNLEDITLRVLKILKEVDIIAAEDTRQTLKLL
FT                   NHFDIKKPLTSYHEHNKKTKGAKLIEELKKGKSIALVTDAGTPAISDPGEDLVKLCIEE
FT                   DIKVVPLPGPTAAITALVASGLDTSSFVFEGFLPTKSKERKIILNRILKEERTIILYEA
FT                   PHRLKETLHELKSYVADRKVVIARELTKIHEEFIRGTVDEVLVKLGDEIKGEIVLIIEG
FT                   AQKQQVEEKPEILVQKYLEGGMNKKEAIKRAAKELGIPKSQMYKLIIGKK"
FT   gene            159182..160051
FT                   /locus_tag="Tmath_0151"
FT   CDS_pept        159182..160051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0151"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="KEGG: tpd:Teth39_2142 cation diffusion facilitator
FT                   family transporter; TIGRFAM: cation diffusion facilitator
FT                   family transporter; PFAM: cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59935"
FT                   /db_xref="GOA:D7AR26"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR26"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ADH59935.1"
FT                   /translation="MDKQKAALLSMISNSALIIMKLVAGVLMHSMVVISAAVDSSIDLI
FT                   ASIIAFFSIRVSVKPADEDHPYGHNKYENISGFIEAILIFFAAVLIIYEAVGRIIAGTY
FT                   VEKLEMGIAVMLFVSFVKGIVSYTLFKVSKKENSIALKADATNLLTDVFTSLGVTTGLV
FT                   IIKVTKLAILDPIISIFVALIIIKTSFDLTKEVLKDLTDSSLPDEEVKEIENIIKANPE
FT                   VTSFHKLRTRKSGTKREVDVHVRVDRNYNIVEAHELSHKVSKQIMDKFPDSHVIIHIEP
FT                   EGKKEEKK"
FT   gene            complement(160087..160338)
FT                   /locus_tag="Tmath_0152"
FT   CDS_pept        complement(160087..160338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0152"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: tpd:Teth39_2141 AbrB family transcriptional
FT                   regulator; TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59936"
FT                   /db_xref="GOA:D7AR27"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR27"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADH59936.1"
FT                   /translation="MLKSTGIVRKVDELGRVVIPIELRRTLNIAERDALEIYVDGEQIV
FT                   LKKYEPACIFCGNAENVINYKGKNICKNCLAELKKSVD"
FT   gene            160517..161101
FT                   /locus_tag="Tmath_0153"
FT   CDS_pept        160517..161101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0153"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   tpd:Teth39_2140 nucleoside recognition domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59937"
FT                   /db_xref="GOA:D7AR28"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR28"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ADH59937.1"
FT                   /translation="MINYIWFFMIAIGILIGIINDRMAEVSKAIVDSAQSAVTISIGLV
FT                   GVMALWLGIMKIADKSGLTDIIAKLLKPIIIKLFSDVPENHPAILAIIMNISANMLGLG
FT                   NAATPFGIKAMEYLQELNKKDSASNAMCRFLVINTSSVQLIPAVMIGIRASLGAQNPAD
FT                   FVIVSVLSTSTALVAGLILNKHLEKMPIFKE"
FT   gene            161107..161628
FT                   /locus_tag="Tmath_0154"
FT   CDS_pept        161107..161628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0154"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   tpd:Teth39_2139 nucleoside recognition domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59938"
FT                   /db_xref="GOA:D7AR29"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR29"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ADH59938.1"
FT                   /translation="MIKIISEWIIPILVFVIPFYGIIKNVKVYEVFVDGAKEGISVVIK
FT                   IFPPLVAMLVAIGVLRASGALDLLGEFLMPFTNKIGMPQELVPLALIRPLSGSGALGIA
FT                   AEIMKTHGVDSLIGKMASAMYGSTETTFYVLAVYYGAVGIKKMRHSVISGIFADIIAIL
FT                   SCVFYSRLFF"
FT   gene            161709..163112
FT                   /locus_tag="Tmath_0155"
FT   CDS_pept        161709..163112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0155"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /note="KEGG: tpd:Teth39_2138 polynucleotide
FT                   adenylyltransferase/metal dependent phosphohydrolase;
FT                   TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   Polynucleotide adenylyltransferase region; metal-dependent
FT                   phosphohydrolase HD sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59939"
FT                   /db_xref="GOA:D7AR30"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR30"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ADH59939.1"
FT                   /translation="MATIPKLIRKLGKEAHNLYIVGGYIRDRILNREAKDYDFVVQENA
FT                   EKIAKLVAEKLGGTFVPFMAEKGTYRVVVRDEILDFTNLKGEDIYIDLAHRDFTMNAMA
FT                   IKLTDYFEFEYIIDPFGGVTDIKNRKIKHVGVMTFKEDPLRALRAVRFAATYKFDIDEA
FT                   TKAKIREEAELIKQVAPERIMNEIFIILKEKNSHKYLRMMEDLKLMENIFEEVAKMKEV
FT                   GKCYYHLTNAWIHSLKTVEEYENIINSMRFPKGVYDVVAEYLNRKLSSDNKVKDIIKLG
FT                   ALFHDIGKPEALYIDTENRVHFYNHEIKGAEIVKKISSRMRMPKKESSLLKKLVLYHMK
FT                   PLMYYVNGGPTNKSLFRFFSELKDDSIAILLLSQADFTATRLNLGKEEEIPKFTDFITR
FT                   LLKRYVEFKETEKPLLSPLDIIINFDVKDGEKLGQILYEIRKNRFYGEIQDKNDAIEFV
FT                   KERMKIEKV"
FT   gene            163447..165345
FT                   /locus_tag="Tmath_0156"
FT   CDS_pept        163447..165345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0156"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="KEGG: tex:Teth514_0066 methionyl-tRNA synthetase;
FT                   TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit; PFAM: tRNA synthetase class I
FT                   (M); t-RNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59940"
FT                   /db_xref="GOA:D7AR31"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR31"
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /protein_id="ADH59940.1"
FT                   /translation="MKKTFYITTPIYYPSDKLHIGHSYTTVAADAMARFKRLTGYDVKF
FT                   LTGTDEHGQKIQRIAKEKGMSPKEYVDGIVEWIKDLWKIMDISYDQFIRTTDKYHEEIV
FT                   QKIFTKLYEKGDIYKSEYEGWYCTPCESFWTESQLVDGKCPDCGRPVERVKEEGYFFKL
FT                   SKYGDRLLQYYDEHPDFIQPESRRNEMINFIKSGLEDLFVSRSSFDWGIKVPFDPKHVI
FT                   YVWIDALSNYITALGYSTDNDDDFKKYWPADVHLVGKEIMRFHTIIWPAMLMALDLPLP
FT                   KKVFGHGWLILEGGKMSKSKGNVVDPKELVSKYGVDAVRYFLLREVPFGADGVFSNEAL
FT                   INRINSDLANDLGNLLSRTVTMIEKYFGGILPKLSQKEEVDDDLITTAQNLPKTVEEYM
FT                   DKLQFSNALIEIWKLVRRANKYIDETMPWVLAKDESKKERLGTVLYNLTEALRFIAVLI
FT                   SPFMPNTPKKIFEQLGVEENLTTWESLKFGLLKEGTKVKRGEIIFPRIDVKKELVAIEE
FT                   KAKEEKKIDYITIEEFAKIQLRVAEILEAERVEGSDKLIKMKLKVGEEIRQIVGGIGRH
FT                   YAPKELVGKKIIIVYNLEPKKLMGIESQGMLLAASIEGKMSLLTVDRDIESGAKIS"
FT   gene            165358..166125
FT                   /locus_tag="Tmath_0157"
FT   CDS_pept        165358..166125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0157"
FT                   /product="hydrolase, TatD family"
FT                   /note="KEGG: tpd:Teth39_2136 TatD family hydrolase;
FT                   TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59941"
FT                   /db_xref="GOA:D7AR32"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR32"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ADH59941.1"
FT                   /translation="MLVDSHAHLEDEKYDKDREEIIEECKKDLTFLINVGSNLLTSKQS
FT                   IELAHNYDFIYASVGIHPHDAQKEFDKVEEIEKLALQQKVVAIGEIGLDYYYDEPSKEF
FT                   QKEVFTKQIRLAKKLNLPIIIHDRDAHEDILDILKKEWTKDLRGVFHSYSGSVEMAFQV
FT                   IEMNFYISLGGPVTFKNAKKPKEVAKAVPIEKLLIETDSPYLTPEPYRGKRNTPVYVKF
FT                   VAGKIAELRGIPYEEASRITAENAIKLFNIPIK"
FT   gene            166313..167344
FT                   /locus_tag="Tmath_0158"
FT   CDS_pept        166313..167344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0158"
FT                   /product="3D domain protein"
FT                   /note="PFAM: 3D domain protein; protein of unknown function
FT                   DUF348; G5 domain protein; KEGG: tpd:Teth39_2135 3D
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59942"
FT                   /db_xref="GOA:D7AR33"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR33"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ADH59942.1"
FT                   /translation="MDTDDFRKRLGEIFKKPVALLTLTVVLLLVVGAITYASLEKEITL
FT                   QDEDKKIVVTTFKSTVKDLLEEKGIKLKKEDVVTPSLDTALKNGMKVTIKRAVPITICV
FT                   GGKAKNIYTAASNVKEVLQQNSITLGPQDKVNMSLDTPVFRYMYIDVTKVTEKIVTQEV
FT                   DIPYQTETVKNDNMERGQVRVVQQGEVGKKQIVMKVIYKNGKEVAKNIIKEKIIKNPVN
FT                   QIVHIGTLGIFTTSRGETFRYREVRTMVATAYDSSEDSTGKKPGDPNYGITATGIKATR
FT                   GVIAVDPRVIPLGTKLYVEGYGFGIAADTGGAIKGNKIDVYFPTREEVMRWGRRYVKVY
FT                   ILK"
FT   gene            167381..168202
FT                   /locus_tag="Tmath_0159"
FT   CDS_pept        167381..168202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0159"
FT                   /product="dimethyladenosine transferase"
FT                   /note="SMART: Ribosomal RNA adenine methylase
FT                   transferase-like; TIGRFAM: dimethyladenosine transferase;
FT                   KEGG: tpd:Teth39_2134 dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59943"
FT                   /db_xref="GOA:D7AR34"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR34"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ADH59943.1"
FT                   /translation="MKIKGVNVKKKWGQNFMFDKNILTKIVTASGVIPEDFVLEIGTGL
FT                   GTLTEELAKRVKKVISFEIDRELYAVAKEKLNIYDNVIIINEDIMKADLNKIANEYFEG
FT                   KPFKVVANLPYYITSPIIMMLLDCKFVKEITVLVQKEVAERICALPGTKDYGILTVFAN
FT                   FKAKPKMLFNLPPTVFVPPPKVDSSLVKLEILDDPLVEVKDEELFSNVVKAAFGQRRKV
FT                   LSNALKTLGFPKEIIDKAFTLSNLSPQRRGETLSIEEFAVLANVIYDLTKQ"
FT   gene            168272..169330
FT                   /locus_tag="Tmath_0160"
FT   CDS_pept        168272..169330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2133 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59944"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR35"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2133"
FT                   /protein_id="ADH59944.1"
FT                   /translation="MPINIYKRFYVVFNQEDRGCSIEGKEVSGYLKVEFRGNRGRITAA
FT                   LQNLNPAYSYNVKLLKSNGEVTVVDFGAIKVDDKGRGGGEWTFNGDDVKDSGISWEEFS
FT                   VAFIEAHDGIKTLVPLASVINKKTTNWKVVYKKYLSKVKEEETPAEKSDKNDREIKQEE
FT                   TETATPQGYESTENETEKGETSQNVLEEVQSETPAFEETSEALTDSSDTQQPETSFNFE
FT                   EEVEEGYIKYLREYVNNIVSFLEEVEPFEKNFEGYRWWKVKTGYREGGFDHYLVGFVND
FT                   EKGELKYIVYGMPGFFTLADQPFGGMTGFVVWKPVKENLRGARDEGYWILHIDAKTGQI
FT                   AVPIEPTPPPLI"
FT   gene            complement(169371..169607)
FT                   /locus_tag="Tmath_0161"
FT   CDS_pept        complement(169371..169607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59945"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR36"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2132"
FT                   /protein_id="ADH59945.1"
FT                   /translation="MKEIKIKLTSIESVKNFVEKTSKYPFDIDVTSGRYVIDAKSIMGL
FT                   FSLNLENVLTVIPHTTDEESLKKLEEDLKEFIV"
FT   gene            complement(169754..171010)
FT                   /locus_tag="Tmath_0162"
FT   CDS_pept        complement(169754..171010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0162"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: tte:TTE0116
FT                   S-layer-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59946"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR025748"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR37"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADH59946.1"
FT                   /translation="MLSKSRLFVSIIIIFSLLFYTTAYAKLQPKYSFDDIKQFTWALKA
FT                   IEKMYAKGFIKGVGNKKFNPSKPVTHLEALVMILRTIGYEEQANKISELPKEYKGPKLS
FT                   WGQGFITLAYQKGILTYDELKRFNPNDKAKRYEIAKYLVRALGLEDQAQQNMNKVLNYK
FT                   DWDKIPKDSIGYMYVAVENGLIKGDGEKLKPNESIKRIEMAVLLERLDKSVQNDLNGRD
FT                   VVGSIYAIDSNTITVKVDDGLKTFNVLKNAPVYNGNEYVGIDYLKPGYQIRLILDSKNN
FT                   IIFVEVLNNKIEEVIPIELKKVTNPPEKVLSAVESIKDKPVVKLVKENGIFYIIATRGM
FT                   MRTGGYIVNIQKAQITKASEEAILEVEVKYIDPSPDTIVIQAITYPYDIKSFTYDGKIT
FT                   QISVKTDKNINVFVDMNLE"
FT   sig_peptide     complement(170933..171010)
FT                   /locus_tag="Tmath_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.990 at
FT                   residue 26"
FT   gene            complement(171011..172165)
FT                   /locus_tag="Tmath_0163"
FT   CDS_pept        complement(171011..172165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59947"
FT                   /db_xref="GOA:D7AR38"
FT                   /db_xref="InterPro:IPR024449"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR38"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2130"
FT                   /protein_id="ADH59947.1"
FT                   /translation="MKAVVVQKEKNKTYVMTEKGEFKCFKNLQNVVVGETIELNENFLA
FT                   FKPTAKILIAASILLVLIFTIINFKSAEVYAYVYVDINPSIEISIDKNGKIINVLPLNE
FT                   DGKKILEKLPYKGLDITTFINQTVEESQKLGFLKDDDTVIITTVPIKNSPFINEQIEKA
FT                   VKNIKKINTNIQIETLKSNEAQREEAKKEKTSPGRLILWKKAKSEGINIPKDKLNSPEF
FT                   FKELKQAYAKIKEKNEQTKATTMPQLSPSPSKSKVITDKILKTIEKDLSKEKTTQTIKN
FT                   VKDKEVKSQNNEVKKDENSDNKSNQQGKGTEKNARSKSDNTNNVLTQKEKNEVKPASDD
FT                   KELDTSDKAINENTYKNVKDTKNYPPKDDKKDEEYNEEIREVKE"
FT   gene            complement(172162..172818)
FT                   /locus_tag="Tmath_0164"
FT   CDS_pept        complement(172162..172818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0164"
FT                   /product="RNA polymerase, sigma 28 subunit, FliA/WhiG
FT                   subfamily"
FT                   /note="KEGG: tpd:Teth39_2129 putative RNA polymerase sigma
FT                   factor SigI; TIGRFAM: RNA polymerase sigma-I factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59948"
FT                   /db_xref="GOA:D7AR39"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014244"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR39"
FT                   /inference="protein motif:TFAM:TIGR02895"
FT                   /protein_id="ADH59948.1"
FT                   /translation="MDIHARVYAAKKDPSEREKLIQEYTPFIIKQLSSFTNRYIDERNS
FT                   DELSIGLIAFNEAIDSFDNTKGSFLSFSSMLIRRRLIDFLRQNQQNTIPLELYVEKVTD
FT                   YEAENRKLEMISFVNLLSIYNITLDDLVKQSPKHSDTRKITTKIAYTICKNNKLLEYLK
FT                   NKKNLPIKDLISILKVSRKTIEKHRKYIIALVIIISEDLPLLKQYISPESEVEKI"
FT   gene            172935..173990
FT                   /locus_tag="Tmath_0165"
FT   CDS_pept        172935..173990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0165"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="PFAM: ATPase-like, ParA/MinD; protein of unknown
FT                   function DUF59; KEGG: tpd:Teth39_2128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59949"
FT                   /db_xref="GOA:D7AR40"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR40"
FT                   /inference="protein motif:PFAM:PF10609"
FT                   /protein_id="ADH59949.1"
FT                   /translation="MLTKEQVLNALRKVYDPEIGRSIVDLDMVKNIQIEGDKVTIDINL
FT                   TVKGCPLQDTIKKDTIEEVSKLGGVSEVIVNLGSMTEEERQNLARKLSGGRKPIFENTR
FT                   VIVVGSGKGGVGKSTVAVNLAVALARLGFKVGLLDADVLGFSVPRLLGIVNERPYALDE
FT                   HTILPLERFGIKVISMGNFIDEDTPLIWRGPLLSGVLDQFFNDVYWGELDYLVLDLPPG
FT                   TGDIPLTVMQKLPESKFVLVTTPQASASHVAGRIGYMAKKVNLEVIGIVENMSYFECPN
FT                   CHQRYNIFGEGETEKLAQDLGTEILVKIPITVKVRELSDVGIPPALDDGPEGVPYIELA
FT                   EKVVEKVRPIK"
FT   gene            complement(174014..174370)
FT                   /locus_tag="Tmath_0166"
FT   CDS_pept        complement(174014..174370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59950"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR41"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2127"
FT                   /protein_id="ADH59950.1"
FT                   /translation="MRIAATITKEDYVEKLPDGPYIIIFDTQKENIEKYENPGYFLKEG
FT                   RRRAIVDFLLDKKTDVVVTVPEAFCSISYGKAKQKGLKFIRLEKSLPYEEVIKNLSKYV
FT                   ENLTDTIPEEELAK"
FT   gene            174663..175181
FT                   /locus_tag="Tmath_0167"
FT   CDS_pept        174663..175181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59951"
FT                   /db_xref="GOA:D7AR42"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR42"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2126"
FT                   /protein_id="ADH59951.1"
FT                   /translation="MFKGIKWQIVLVTFVVVFGFLFASFQLYQNKILPDKISKDVSTVK
FT                   FVKMVTISTDNNGYIMKVRLGEVENLMETYKEIENKVNKYPVKINILLIDNPNEKLNNV
FT                   YYNSQFSIYEGIQKGDYMKMYDTIREISSKNGVKAFVYIDKQNIYLNLRDGSHYLYKII
FT                   PREAYKGES"
FT   gene            175182..176678
FT                   /locus_tag="Tmath_0168"
FT   CDS_pept        175182..176678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0168"
FT                   /product="Vesicle-fusing ATPase"
FT                   /EC_number="3.6.4.6"
FT                   /note="PFAM: AAA ATPase central domain protein; peptidase
FT                   M41; KEGG: tpd:Teth39_2125 microtubule-severing ATPase;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59952"
FT                   /db_xref="GOA:D7AR43"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR43"
FT                   /inference="protein motif:PRIAM:3.6.4.6"
FT                   /protein_id="ADH59952.1"
FT                   /translation="MVKEILLGITIAFTIFAAFLGINVTPLLLLAGIFLLFDYIIENKG
FT                   IISGSKNIIKPESEISFEDIGGQSTAIAELKEALDFVINREKISKMGIRPIKGILLTGP
FT                   PGTGKTLLAKAAAKYTNSSFIATSGSEFIEMYAGVGAQRVRNLFKTAKNIARKEGKNSA
FT                   IIFIDEIDILGVKRGTNESHHEYDQTLNQLLVEMDGIKSDGEVNILVIAATNRPDLLDP
FT                   ALLRPGRFDREVVVDLPDKSGRLQILKIHTKNKPLGEDVNLEAIAENTFGFSGAHLESL
FT                   CNEAAILAMRDNSDVILQKHFVEAVDKVILGEKSDRKPTEEEIFRVSVHEAGHAIISEM
FT                   VNPGSVATVTIVPRGKALGFVRHFDKEDSLIYTKEQLEKDIMIALGGTVAELLILGSRS
FT                   TGSANDFEQAVDIAKKMVYTGLSDLGIVSREDVPKDKVNEEVNKIIKEQEKKVQKMLEE
FT                   KLEYLEKIANILRKEETMSGEKLRELIGHSNFCKNYTFSF"
FT   gene            177119..178453
FT                   /locus_tag="Tmath_0169"
FT   CDS_pept        177119..178453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0169"
FT                   /product="electron transport complex, RnfABCDGE type, C
FT                   subunit"
FT                   /note="KEGG: tex:Teth514_0079 electron transport complex,
FT                   RnfABCDGE type, C subunit; TIGRFAM: electron transport
FT                   complex, RnfABCDGE type, C subunit; PFAM: Respiratory-chain
FT                   NADH dehydrogenase domain 51 kDa subunit; Soluble ligand
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59953"
FT                   /db_xref="GOA:D7AR44"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR44"
FT                   /inference="protein motif:TFAM:TIGR01945"
FT                   /protein_id="ADH59953.1"
FT                   /translation="MKLENLTFKGGVTVPHHKDLTEGLPIERAREPEVVYIPLHQHAGA
FT                   PCEPLVKVGDTVKVGQKIGQSDAFVSAPVHSSVSGIVKDITTMFIPTGQRVKCVIIESD
FT                   GKNELDESVKPKGSLEDLSPKEIIEIIREAGITGMGGAGFPTHVKLSPPSDKKIDTILV
FT                   NGAECEPYLTTDHRLMVEYPEKIVFGLKAIMKAVGVERGIIGVEKNKPDAILALREASK
FT                   NEKNIRIATLKVKYPQGDEKRLINAILRRIVPSGGLPMDVGVIVVNAATTKAVADAILE
FT                   GKPLYERVTTITGRGIKEPKNLLVKIGTPLKDLIEQCGGFTEGSPGKIISGGPMMGIAQ
FT                   HSLDVPIIKGTGGILILTKEEARPQQVLPCIKCGKCVEVCPVNLLPLYISSYSLKKNFE
FT                   KAEEYNALDCVECGSCSYICPAKRPLAESIRLAKREIIARKRNLK"
FT   gene            178468..179427
FT                   /locus_tag="Tmath_0170"
FT   CDS_pept        178468..179427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0170"
FT                   /product="electron transport complex, RnfABCDGE type, D
FT                   subunit"
FT                   /note="KEGG: tpd:Teth39_2123 electron transport complex,
FT                   RnfABCDGE type, D subunit; TIGRFAM: electron transport
FT                   complex, RnfABCDGE type, D subunit; PFAM: NQR2 and RnfD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59954"
FT                   /db_xref="GOA:D7AR45"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR45"
FT                   /inference="protein motif:TFAM:TIGR01946"
FT                   /protein_id="ADH59954.1"
FT                   /translation="MLAKVEEVVLQDKLIVSSSPHIRSNESVKRIMLDVVIALTPAIIG
FT                   SVYLFGLNALKLILISVVSSVLSEALIQKLFKRPITITDFSAAITGILIAFNLPASAPW
FT                   WLPVIGSAFAIIVVKQLFGGLGANFMNPALAARAMLMTSWPVHMTNYTGTRPDVVTSAT
FT                   PLSIMKYGTGAELPTLRDMFIGNIPGVIGETSALLLLIGAAYLIIRKVIDWKIPVFYIG
FT                   TTFIMLLLLGVEPKLLPYHILGGGLILGAFYMATDYSSSPVTPLGRIIFAVGAGVLTAI
FT                   IRIKGAYPEGVSYSILLMNVATPLIEKFTKPRVFGKVK"
FT   gene            179428..180009
FT                   /locus_tag="Tmath_0171"
FT   CDS_pept        179428..180009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0171"
FT                   /product="electron transport complex, RnfABCDGE type, G
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   G subunit; PFAM: FMN-binding domain protein; KEGG:
FT                   tpd:Teth39_2122 electron transport complex, RnfABCDGE type,
FT                   G subunit; SMART: FMN-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59955"
FT                   /db_xref="GOA:D7AR46"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR46"
FT                   /inference="protein motif:TFAM:TIGR01947"
FT                   /protein_id="ADH59955.1"
FT                   /translation="MKEIAKIGLILLLITAAAGVILGVSNAITSKKIAEIEKIANNAAK
FT                   QEVLQEAESFVTLDEKRLKEIAGSNQNVLEVSEGYDGNSSLVGYVFKITSNGYGGEIQF
FT                   MVGISKKGYITGIKILNHKETPGLGANATKSFFTDAFKGKSVADKLVVVKHPPKADNEI
FT                   QALTGATITSNAIVNGVNMVREIYNSKLAN"
FT   sig_peptide     179428..179511
FT                   /locus_tag="Tmath_0171"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.942) with cleavage site probability 0.665 at
FT                   residue 28"
FT   gene            180032..180682
FT                   /locus_tag="Tmath_0172"
FT   CDS_pept        180032..180682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0172"
FT                   /product="electron transport complex, RnfABCDGE type, E
FT                   subunit"
FT                   /note="KEGG: tex:Teth514_0082 electron transport complex,
FT                   RnfABCDGE type, E subunit; TIGRFAM: electron transport
FT                   complex, RnfABCDGE type, E subunit; PFAM: RnfA-Nqr electron
FT                   transport subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59956"
FT                   /db_xref="GOA:D7AR47"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR47"
FT                   /inference="protein motif:TFAM:TIGR01948"
FT                   /protein_id="ADH59956.1"
FT                   /translation="MKLSKIFSNGLVKENPIYVQALGMCSVLAVTTSAINGLAMGLAVT
FT                   AVLVGSNSVVSLLRKVIPDKIRIPAFIVVIATFVTVVEMFMKAYTPALYNALGIFIPLI
FT                   VVNCIILGRAEAFASKNNLLTSVMDGLGMGAGYTLAVLILGSIREILGSGSLFGIQLFG
FT                   ASFEPALIFIMPPGAFIVLGILIGLFNHARRRKEVSETGTKEEVLDEYIYNID"
FT   gene            180657..181229
FT                   /locus_tag="Tmath_0173"
FT   CDS_pept        180657..181229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0173"
FT                   /product="electron transport complex, RnfABCDGE type, A
FT                   subunit"
FT                   /note="KEGG: tpd:Teth39_2120 electron transport complex,
FT                   RnfABCDGE type, A subunit; TIGRFAM: electron transport
FT                   complex, RnfABCDGE type, A subunit; PFAM: RnfA-Nqr electron
FT                   transport subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59957"
FT                   /db_xref="GOA:D7AR48"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR48"
FT                   /inference="protein motif:TFAM:TIGR01943"
FT                   /protein_id="ADH59957.1"
FT                   /translation="MNIFIILINTIFVNNYVFARFLGICPFLGVSNKTETATGMGMAVT
FT                   FVITLSSVITYIIHHAILVPLNLEYLQTIVFILVIASLVQFVEIFLKKTSPNLYGALGI
FT                   YLPLITTNCIVLGVALLNIQEGYTLIETIFNALGASIGFAIALLLMAGIREKLEIIDVP
FT                   KVLEGVPIALITAGLISIAFLGFNGLV"
FT   gene            181241..182056
FT                   /locus_tag="Tmath_0174"
FT   CDS_pept        181241..182056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0174"
FT                   /product="electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /note="KEGG: tpd:Teth39_2119 electron transport complex,
FT                   RnfABCDGE type, B subunit; TIGRFAM: electron transport
FT                   complex, RnfABCDGE type, B subunit; PFAM: Fe-S cluster
FT                   domain protein; 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59958"
FT                   /db_xref="GOA:D7AR49"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR49"
FT                   /inference="protein motif:TFAM:TIGR01944"
FT                   /protein_id="ADH59958.1"
FT                   /translation="MSGILYAIVVLGGLGFLFGSSLSLASKIFALETNPKVKKIREVLP
FT                   GANCGACGYPGCDAYANAIVEGKAPVNACSVGGNSVAKKIAEIMGVDDVEVERKVATVL
FT                   CQGDRSKAKDKYLYNGIRDCRAQNILAGGCKSCPYGCLGCGTCVDVCDYGAIQIINGVA
FT                   VIDKEKCVACKACIEVCPKGIIELVPYNQEVIIKCKSNDPGKVVRGYCSVGCIGCQICV
FT                   RSCPEKAITFENYLAKINYEKCTNCGICAEKCPTGSIFSSLKQVNEKAQ"
FT   sig_peptide     181241..181318
FT                   /locus_tag="Tmath_0174"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.815) with cleavage site probability 0.644 at
FT                   residue 26"
FT   gene            182374..182724
FT                   /locus_tag="Tmath_0175"
FT   CDS_pept        182374..182724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0175"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   tpd:Teth39_2116 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59959"
FT                   /db_xref="GOA:D7AR50"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR50"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH59959.1"
FT                   /translation="MSRILVLDDNKGICSLIEEIFTMDGHEVRSYSDISLFDREIEKFR
FT                   PDIGLFDLHMAKDMLKIIKKVKSIYPNMKGIIMSADEPQEPFTEFPFISKPFDIIALRN
FT                   LVYENLKQEMIV"
FT   gene            182724..182831
FT                   /locus_tag="Tmath_0176"
FT   CDS_pept        182724..182831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59960"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR51"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH59960.1"
FT                   /translation="MFVKGTFVPFYIFLVLALNKCYNEKVMLYNIWAAF"
FT   gene            182861..183712
FT                   /locus_tag="Tmath_0177"
FT   CDS_pept        182861..183712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0177"
FT                   /product="fructose-1,6-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.40"
FT                   /note="TIGRFAM: fructose-1,6-bisphosphate aldolase, class
FT                   II; ketose-bisphosphate aldolase; KEGG: tpd:Teth39_2115
FT                   fructose-1,6-bisphosphate aldolase; PFAM:
FT                   ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59961"
FT                   /db_xref="GOA:D7AR52"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR52"
FT                   /inference="protein motif:TFAM:TIGR01859"
FT                   /protein_id="ADH59961.1"
FT                   /translation="MLVTGIEILKKAHKEGYAVGAFNTSNLEITQAIVEAAEETKSPVI
FT                   IQVSEGGLKYAGIETISSIVRTMAEKASVPVALHLDHGTDFNTVMKCLRNGWTSVMMDA
FT                   SKLPLEENIKVTKTVVEIAHGMGVSVEAEIGKIGGTEDNITVDEREAAMTDPEEALKFA
FT                   KETGIDYLAIAIGTAHGPYKGEPKLDFDRLKKIKEMLNIPLVLHGASGVPEEAIKKAVS
FT                   LGINKINIDTDIRQAFARRLRELIEKDSEVYDPRKILGPCKDAMKEVIKQKMILFGAAG
FT                   KA"
FT   gene            184022..185548
FT                   /locus_tag="Tmath_0178"
FT   CDS_pept        184022..185548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0178"
FT                   /product="transcription termination factor Rho"
FT                   /note="TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; Rho termination factor RNA-binding; Rho termination
FT                   factor domain protein; KEGG: tpd:Teth39_2114 transcription
FT                   termination factor Rho; SMART: Cold shock protein; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59962"
FT                   /db_xref="GOA:D7AR53"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR53"
FT                   /inference="protein motif:TFAM:TIGR00767"
FT                   /protein_id="ADH59962.1"
FT                   /translation="MDFDINTLENLSLMELREIAKELGIKSITKYRKQELKEKILEKAN
FT                   QANEKNLIQKDNKKEEGLNERQTQKSHESAAEKNTDGTLNYDSNVSRNGHVKSISAENA
FT                   ANSLQAQTISAKDILPIVKELSDPLKELIQTQGDVVAEGILDILPDGYGFLRVENFVQG
FT                   PKDIYISQSQIRRFGLKVGDKVRGITRIPREGEKYSAILYVESINGEDPENAKKRIPFD
FT                   ELTPIFPNEKLRLETSPTEFSMRLVDIIAPIGKGQRGMIVAPPKAGKTTLLKQIANSIS
FT                   HNHPEVILIVLLIDERPEEVTDMKRSIKGEVVYSTFDEPPEHHIKVAEMVLEHAKRLVE
FT                   YKKDVVILLDSITRLARAYNLVTPPSGRTLSGGIDPSALHPPKRFFGAARNIEEGGSLT
FT                   ILATALIETGSRMDDVIFEEFKGTGNMELHLDRKLQERRIFPAIDIYKSGTRKEELLLT
FT                   KEELEAMWILRKAMSNLPATEVTEMLIEKLIRTKSNAEFINMIRAQLYKS"
FT   gene            185602..185820
FT                   /locus_tag="Tmath_0179"
FT   CDS_pept        185602..185820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0179"
FT                   /product="ribosomal protein L31"
FT                   /note="manually curated; TIGRFAM: ribosomal protein L31;
FT                   KEGG: tpd:Teth39_2113 50S ribosomal protein L31; PFAM:
FT                   ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59963"
FT                   /db_xref="GOA:D7AR54"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR54"
FT                   /inference="protein motif:TFAM:TIGR00105"
FT                   /protein_id="ADH59963.1"
FT                   /translation="MKAVKPNIHPTYYHDAVVRCACGNTFITGSTKKEIRVEICSKCHP
FT                   FFTGQQKIVDTGGRVERFRKRFNLEEK"
FT   gene            185889..186470
FT                   /locus_tag="Tmath_0180"
FT   CDS_pept        185889..186470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0180"
FT                   /product="Thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /note="KEGG: tpd:Teth39_2112 thymidine kinase; PFAM:
FT                   thymidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59964"
FT                   /db_xref="GOA:D7AR55"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR020633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR55"
FT                   /inference="protein motif:PRIAM:2.7.1.21"
FT                   /protein_id="ADH59964.1"
FT                   /translation="MIYGSLDHGFIEVIVGPMFSGKSEELIRRIKRAQIAKQKVQVFKP
FT                   AIDNRYSIDKVVSHNGTNINAISVVKASEIIEHLEEDTDVIAIDEIQFFDHLLVDVVRE
FT                   IADLGKRVICAGLDMDFRGEPFGPTPDVMAIAESVDKLTAICVKCGNPATRTQRLINGK
FT                   PARYDDPIILVGAYETYEARCRKCHEVPRT"
FT   gene            186486..187412
FT                   /locus_tag="Tmath_0181"
FT   CDS_pept        186486..187412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0181"
FT                   /product="protein of unknown function DUF1385"
FT                   /note="PFAM: protein of unknown function DUF1385; KEGG:
FT                   tpd:Teth39_2111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59965"
FT                   /db_xref="GOA:D7AR56"
FT                   /db_xref="InterPro:IPR010787"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR56"
FT                   /inference="protein motif:PFAM:PF07136"
FT                   /protein_id="ADH59965.1"
FT                   /translation="MKKTDIGGQAVIEGVMMRGHNSVATAVRKGDEIIIKKEYVKPLTK
FT                   RNKFFSLPFIRGTFALFDSLIVGVKSLTYSAELFEEKDEENISKFDLFLQKVFGDKLED
FT                   ILMYFSVVISLILSIIIFFIGPTYVADYIKLFTKNTVVINFVEGLLRVAIFILYLVLIS
FT                   QMKDIKRIFEYHGAEHKAIHCLEHEEELTVENARKYTTLHPRCGTNFLFIVMIVSIIIF
FT                   SFLKWPTFYIRILSRILLLPVVAGISYEIIKLAGRSDNKIIRVFIYPGLLLQKLTTREP
FT                   DDSQLEVAIASLKSVLEDEGGQEFESI"
FT   gene            187399..188238
FT                   /locus_tag="Tmath_0182"
FT   CDS_pept        187399..188238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0182"
FT                   /product="protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /note="KEGG: tpd:Teth39_2110 HemK family modification
FT                   methylase; TIGRFAM: protein-(glutamine-N5)
FT                   methyltransferase, release factor-specific; modification
FT                   methylase, HemK family; PFAM: methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59966"
FT                   /db_xref="GOA:D7AR57"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR57"
FT                   /inference="protein motif:TFAM:TIGR03534"
FT                   /protein_id="ADH59966.1"
FT                   /translation="MKVYEAINWGAKELKGVCDNPRLEAELLLAHCFEINRTALFLRRE
FT                   EEISKEQLERFLEFINMRKSHIPYQYIVKKQYFMGLEFFVDENVLIPRPETEILVEETL
FT                   KRLKRGDVVLDIGTGSGAIAVSIAKYFPDCTVYAVDISKKAIEIAKHNAKKQGVLDRIF
FT                   FIESDLFCNLPPNLKFDFIVSNPPYIKKREIELLQEEVKKEPIVALDGGEDGLFFYKKI
FT                   IREAPFYIKSGGKIGFEIGYSQKEEVTTLLEESGFKDVEIIKDLAGIDRVIIAEHKL"
FT   gene            188287..189357
FT                   /locus_tag="Tmath_0183"
FT   CDS_pept        188287..189357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0183"
FT                   /product="peptide chain release factor 1"
FT                   /note="KEGG: tpd:Teth39_2109 peptide chain release factor
FT                   1; TIGRFAM: peptide chain release factor 1; PFAM: Class I
FT                   peptide chain release factor; PCRF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59967"
FT                   /db_xref="GOA:D7AR58"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR58"
FT                   /inference="protein motif:TFAM:TIGR00019"
FT                   /protein_id="ADH59967.1"
FT                   /translation="MIDKLQAIEDRYVELSQKISDPNIISNVGEWRKYVKEHAAIEEIV
FT                   LKYREYKKVVEDINSTKELLSSDEKELREMAEEELSHLEEKKEELLEEIKILLIPKDPN
FT                   DEKNVIMEIRAGAGGEEAALFAHDLFRMYSMYAEKKGWKVEIMSSNETDIGGFKEVILN
FT                   ISGKGAYSRLKYESGVHRVQRVPTTEAGGRIHTSTATVAVLPEVEEVDVEINPNDIRID
FT                   VFRSGGHGGQSVNTTDSAVRVTHIPTGIVVTCQDERSQLQNRERALKILRAKLYEMALQ
FT                   EQQKEIAEVRKSQVGTGERSERIRTYNFPQGRVTDHRIGLTLYRLQEVLDGDLDEIIDA
FT                   LILNDQAEKLKNVNLN"
FT   gene            189687..190406
FT                   /locus_tag="Tmath_0184"
FT   CDS_pept        189687..190406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0184"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: zinc/iron permease; KEGG: tpd:Teth39_2108
FT                   zinc/iron permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59968"
FT                   /db_xref="GOA:D7AR59"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR59"
FT                   /inference="protein motif:PFAM:PF02535"
FT                   /protein_id="ADH59968.1"
FT                   /translation="MYAFNGMIIGSLVGIIGTGMGGAVTYFLKNPSNRFFSGIMGTAAG
FT                   LMLSIVAFDLLPHAFDIASIPLGTIGILVGAILISFFDMIIENMDIAGSFIKEGVLLAI
FT                   AIALHNFPEGLAVGSGFMVSQSLGVDIALVIALHDFPEGLAMATPFSAGGIPPYKNVIY
FT                   TILAGIPTGIGALIGIVTGGISPYFIGLNLSIAGGAMLYVTCGDVIPEARNVYKGKISV
FT                   LGMILGFIGGIIITKYL"
FT   gene            190434..191498
FT                   /locus_tag="Tmath_0185"
FT   CDS_pept        190434..191498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0185"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="KEGG: tex:Teth514_0096 SUA5/YciO/YrdC/YwlC family
FT                   protein; TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC domain; SUA5 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59969"
FT                   /db_xref="GOA:D7AR60"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR60"
FT                   /inference="protein motif:TFAM:TIGR00057"
FT                   /protein_id="ADH59969.1"
FT                   /translation="MTKIIRVDRNNPEIELIDLAAKVIREGGLVAFPTETVYGIGANSF
FT                   DEEAVKKIFMVKGRPQDNPLIVHIAELEQIYDLVEDIPQKAKILMEKFWPGPLTLIFKK
FT                   SQKVPYVNTAGMDTVAIRMPSDTIAHLLIKRAKVPISAPSANVSGKPSPTDASHVVEDL
FT                   DGKVDIIIDGGKCDFGVESTVLDLTEKMPVVLRPGAVTLEMLKEVIGNVEVDPSLLKKP
FT                   KGNLKPKSPGMKYKHYSPNAEVYIVKGDLEKVVKKIQELTEEQLKYGKKVGIMATVQTS
FT                   TQYKKGEIIVVGDRKRPETIAKNLFAVLRQFDKKGVDVIFAESFEYNNIGLAIMNRLEK
FT                   AAGYKEISAEGELI"
FT   gene            191495..192403
FT                   /locus_tag="Tmath_0186"
FT   CDS_pept        191495..192403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0186"
FT                   /product="sugar-phosphate isomerase, RpiB/LacA/LacB family"
FT                   /note="TIGRFAM: sugar-phosphate isomerase, RpiB/LacA/LacB
FT                   family; ribose 5-phosphate isomerase B; PFAM:
FT                   Ribose/galactose isomerase; Protein-tyrosine phosphatase,
FT                   low molecular weight; KEGG: tte:TTE0146 ribose 5-phosphate
FT                   isomerase RpiB; SMART: Protein-tyrosine phosphatase, low
FT                   molecular weight"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59970"
FT                   /db_xref="GOA:D7AR61"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR61"
FT                   /inference="protein motif:TFAM:TIGR00689"
FT                   /protein_id="ADH59970.1"
FT                   /translation="MKVLFVCTGNTCRSPMAEGLFNAKAKTLGKDFEAQSAGVFASEGF
FT                   PASQQAIEVLKRDYNIDISKHRSKNLRRQDLEEANLILTMSNSHKQSILVQYPEYSYKV
FT                   FTLKEYVGLEGEVEDPYGMPMEVYRQTARELEDLISKVITKISEEREDKKVIALGADHG
FT                   GYDLKEAIKKYLDEKGIAYKDFGTVSTDSVDYTDYALKVAEAVASGEYSEGILVCGTGI
FT                   GMCIAANKVPGIRAAHVEDVFSAKAAKEHNNANILCLGGRITGPGLAVMMVDEWLKATF
FT                   QGGRHQRRIDKIAEIEKKYSK"
FT   gene            192452..193084
FT                   /locus_tag="Tmath_0187"
FT   CDS_pept        192452..193084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0187"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /note="KEGG: tpd:Teth39_2104 uracil
FT                   phosphoribosyltransferase; TIGRFAM: uracil
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59971"
FT                   /db_xref="GOA:D7AR62"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR62"
FT                   /inference="protein motif:TFAM:TIGR01091"
FT                   /protein_id="ADH59971.1"
FT                   /translation="MYKNVFVIDHPLIQHKISLIRDENTGSKEFRELVEEIAMLMAYEV
FT                   TRDLPLEEIEVKTPVAMAKTKVIAGKKLGIIPILRAGLGMVDGMLKLIPAAKVGHIGIY
FT                   RDPKTLKPVEYYCKLPPDIAERDLIVVDPMLATGGSACAAIHFLKERGAQNIKLVNLIA
FT                   APEGIEAVHKEHPEIPIYVASIDQGLNEHGYIVPGLGDAGDRLFGTK"
FT   gene            193116..193559
FT                   /locus_tag="Tmath_0188"
FT   CDS_pept        193116..193559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0188"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   tpd:Teth39_2103 CMP/dCMP deaminase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59972"
FT                   /db_xref="GOA:D7AR63"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR63"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADH59972.1"
FT                   /translation="MRPSWDEYFMQIVDVVKTRSTCLRRQVGAILVVDKHIISTGYNGP
FT                   PTGLAHCEETGCLRDQLGIPSGERPELCRGVHAEQNAIIQAALHGVSTKGATLYVNASP
FT                   CVMCAKMLINTGVKRIVYEEEYPDELAFRLLKEANVDLVKIER"
FT   gene            193617..194657
FT                   /locus_tag="Tmath_0189"
FT   CDS_pept        193617..194657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0189"
FT                   /product="Glycosyl transferase, family 4, conserved region"
FT                   /note="PFAM: Glycosyl transferase, family 4, conserved
FT                   region; KEGG: tte:TTE0154 UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59973"
FT                   /db_xref="GOA:D7AR64"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR64"
FT                   /inference="protein motif:PFAM:PF00953"
FT                   /protein_id="ADH59973.1"
FT                   /translation="MKVYLLSFVMAFVVSLIATPMAKKLAFVIGAIDIPNEERRIHTKP
FT                   VPRLGGVAIFLGTITSILLFLPKTHETIGIVTGATIIAALGLFDDKYSLSAKVKLLGQL
FT                   VAAMVLIISGVRIDWLSNPFGDGMIYLKSWLAIPLTLFWVVGITNTMNLIDGLDGLAAG
FT                   IAVISSGSLFIVSLLNGRFATAVISIAIAGAALGFLPYNFNPAKIFMGDTGAMFLGFVL
FT                   AAISIQGAVKSAAAIAIAVPILALGVPIFDTTFAIVRRLINGKPIMEADKGHLHHRLLE
FT                   KGLTQRQVVLIMYGVSLLLGISAILISSSNETKGLIIFILSILFVMWGADKLGLLEKQK
FT                   KGTQVR"
FT   sig_peptide     193617..193685
FT                   /locus_tag="Tmath_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.623) with cleavage site probability 0.587 at
FT                   residue 23"
FT   gene            194679..195836
FT                   /locus_tag="Tmath_0190"
FT   CDS_pept        194679..195836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0190"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine 2-epimerase; KEGG:
FT                   tte:TTE0155 UDP-N-acetylglucosamine 2-epimerase; PFAM:
FT                   UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59974"
FT                   /db_xref="GOA:D7AR65"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR65"
FT                   /inference="protein motif:TFAM:TIGR00236"
FT                   /protein_id="ADH59974.1"
FT                   /translation="MMTLKIVSVFGTRPEAIKMAPLIKALEREKDFESKVCVTAQHREM
FT                   LDQVLRLFNITPDYDLNIMKEKQTLSEITTSALIGLEKVFNREKPDLVLVHGDTTTTFV
FT                   SALASFYHKIKVGHVEAGLRSFNKWFPYPEEINRRLTGVLTDLHFAPTITAKSNLLKEG
FT                   VDEESIFVTGNTVIDAMVYTVKRDYIFRDERLNQIDYNNKKVIVVTAHRRENWGKPLEN
FT                   ICNALKNIAQNYEDVYIVYPVHKNPVVREPVFRILGELTNVLLLDPLDTDEMHNLMAKC
FT                   YMVMTDSGGLQEEVPSLGKPVLVLRDVTERPEAVKAGTVKVIGTEEQVVYNEGTLLLEN
FT                   KEEYDKMANAVNPYGDGKASLRIIQAIKYAFNLTDKRPEEYKSGE"
FT   gene            complement(195855..196151)
FT                   /locus_tag="Tmath_0191"
FT   CDS_pept        complement(195855..196151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59975"
FT                   /db_xref="GOA:D7AR66"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR66"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2102"
FT                   /protein_id="ADH59975.1"
FT                   /translation="MFWVALIVVGLISSLVFHPLFNYKAGESYGEKLNKIYGTYWAALV
FT                   AHLIGAWVGGAYLGKWGWIVADYNVIGGFIGAIVIGYLWYLIAKSQTKSEANK"
FT   gene            196512..197261
FT                   /locus_tag="Tmath_0192"
FT   CDS_pept        196512..197261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0192"
FT                   /product="Protein of unknown function DUF1779"
FT                   /note="PFAM: Protein of unknown function DUF1779; KEGG:
FT                   tpd:Teth39_2101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59976"
FT                   /db_xref="InterPro:IPR014794"
FT                   /db_xref="InterPro:IPR036209"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR67"
FT                   /inference="protein motif:PFAM:PF08680"
FT                   /protein_id="ADH59976.1"
FT                   /translation="MDKRIIIGIMIFAVLFSLGVQRQAFLSFDDDVELVKRSFLSTGAK
FT                   YEYANINAWSKVNDDFTSFDKINEYVEVTIKNMNLDKQKIKVSRIEENKFRQLVVEYAE
FT                   NTRHINIAVQSLKNGAQSETYMLIDEYLIKGYDNVLKERSLINNSFKLLELKPKVTVCF
FT                   VGTFKGKLNKEKNSSIVKLVLDKLDAQKIEGMEEENIISVSAYSSKLKEYIKLGSEKIN
FT                   LNVAIRYSSFDDKTYLWVATPIIAIEY"
FT   gene            197268..198518
FT                   /locus_tag="Tmath_0193"
FT   CDS_pept        197268..198518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0193"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="KEGG: tpd:Teth39_2100 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59977"
FT                   /db_xref="GOA:D7AR68"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR68"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ADH59977.1"
FT                   /translation="MIRTKFIVEKSPPLKGSVKISGAKNSVLPIIAASLLSSGEIVLDD
FT                   IPTLKDVNVMIELIKHFGAICEFENEKLKIKIDIKDVEAPYELVKKMRASFLVMGPILA
FT                   RLGHAKISMPGGCAIGSRPIDLHLKGFQTLGADITIGHGYVEARAQKLTGKKIYLDFPS
FT                   VGATENIMMAAVFADGITIIENAAEEPEIVDLANFLNKMGAKIKGAGTDTIRIEGVKEL
FT                   KGVEHTVIPDRIEAGTFMVAAAMTGGNVLIENVIVDHVRPIIAKLTECGIEIIEEPKGL
FT                   RVKGTKNYKALDIKTLPYPGFPTDMQAQMMAMMTVAKGTSVIIETVFENRFMHVDELKR
FT                   MGANIKIEGRSAVVTGVDHLTGAEVKATDLRAGAALVLAGLIAEGKTEINDIYHIDRGY
FT                   VKMEEKLKNLGAIIYRI"
FT   gene            198689..199813
FT                   /locus_tag="Tmath_0194"
FT   CDS_pept        198689..199813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0194"
FT                   /product="alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="TIGRFAM: alanine dehydrogenase; KEGG:
FT                   tex:Teth514_0104 alanine dehydrogenase; PFAM: alanine
FT                   dehydrogenase/PNT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59978"
FT                   /db_xref="GOA:D7AR69"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR69"
FT                   /inference="protein motif:TFAM:TIGR00518"
FT                   /protein_id="ADH59978.1"
FT                   /translation="MKIGVPKEIKTAESRVAITPAGVEAFVKNGNEVYIEKDAGIGSGI
FT                   ANEEYVKAGAKILSTAKEVYDVADMIMKVKEPQPSEYDYLKEGQVLFTYLHLAPDKQQT
FT                   EALLKKKVIGIAYETVQLDNGALPLLTPMSEVAGRMSVTIGAYLLTNLNEGRGIVMGGV
FT                   PGVEPAEVVIIGGGTVGTNAAKVAVGMGARVTILDVNPARLAYLDDIFGGRVTTLMSNS
FT                   FNIAQSVKKADLLIGAVLIPGAKAPKLVTEEMVKTMKKGAVIVDVAIDQGGCIETCDRT
FT                   TSHKDPYFIKHGVVHYSVPNIPGVVSRTSTFALTNVTLPYALEIASKGYKKALLENKAL
FT                   LKGLNVYKGMVTYKPVADAQGLEYVDPIDALNIE"
FT   gene            199999..201702
FT                   /locus_tag="Tmath_0195"
FT   CDS_pept        199999..201702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0195"
FT                   /product="pyruvate phosphate dikinase PEP/pyruvate-binding
FT                   protein"
FT                   /note="PFAM: pyruvate phosphate dikinase
FT                   PEP/pyruvate-binding; KEGG: tex:Teth514_0105 pyruvate
FT                   phosphate dikinase, PEP/pyruvate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59979"
FT                   /db_xref="GOA:D7AR70"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR70"
FT                   /inference="protein motif:PFAM:PF01326"
FT                   /protein_id="ADH59979.1"
FT                   /translation="MSETLSYKNYNPRLSKKNEDRIFGKGHIGGKASGLCFAEEVVEKY
FT                   SDVFKQCVKIPESFFIATDYYQMFLDYNDLNDITEDTPYDEAEIRFRETKFPPEYEKIL
FT                   YEILSKMHYPLAIRSSSLLEDNIKYSFAGKYYTTFIPNRGSDRERVKQLEKAIKEIYLS
FT                   VYRPDAVAYRRKHAPGQKDLMGVIVQQLIGSQKGVYFYPEVSGVGFSRNYRRWTDRIKI
FT                   EDGVVRLVFGLGTKCTGRGYARIFSLTNLRLRPEGNNPKEIAKNSQEAFDVLNLITGEV
FT                   ETYNINEVPQFLTYHDKIGDIAQTYSERENAILDINILNRSDEVFDKYIFTFENFPRRH
FT                   KGFFSIISNLFKYLEKEMEMAVDIEFAYNLKKDEFYLLQTRPLSSYESFRKVHIPKDIE
FT                   KKCVLLKGDRMLTNGILKNIRYIVYVDHKVYSQYKDKHEIARIIGRLNKSIGDKYILVG
FT                   PGRWGSSNPYLGVPVIYNEISNAAMIVELGIKNGDFMPELSYGTHFFADLDIDNILYMP
FT                   VFDGYKDNIFNEEWFKKGTYIDTAVKIFEGRFDAYLDGDKMIGYVISHEK"
FT   gene            202306..203355
FT                   /locus_tag="Tmath_0196"
FT   CDS_pept        202306..203355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0196"
FT                   /product="stage II sporulation protein D"
FT                   /note="KEGG: tpd:Teth39_2097 SpoIID/LytB domain-containing
FT                   protein; TIGRFAM: stage II sporulation protein D;
FT                   SpoIID/LytB domain protein; PFAM: Stage II sporulation D
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59980"
FT                   /db_xref="GOA:D7AR71"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR014225"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR71"
FT                   /inference="protein motif:TFAM:TIGR02870"
FT                   /protein_id="ADH59980.1"
FT                   /translation="MKYAIYGVFLIFFSLIILPSIIVFGFNPHRTSSTPENEVKLIDGG
FT                   NLVKVDNLNNKDYHTVNVFITNQNKIQKIDLEEYVKGVVAAEMPAEFEIEALKAQAVTA
FT                   RTYVLSKEIVLGGKGCQLHPGADVCTDSEHCQAWQSEEELRQKWGENFDKYYVKISQAV
FT                   ADTEELVLVYNDALIVPAYHAISGGKTENSEDVWQSKIPYLRSVVSPGEEVASKYKTTV
FT                   VMSKEEFINKLKQKKPSLKLDNSDILNQIKDVERTQAGHIKTLKIGNMTFGGEEIREIF
FT                   DLNSTNFNFEAQGNNIVITVIGYGHGVGMSQYGANALAKQGKKFDEILKYYYTGVEIVK
FT                   IEDLLKIQH"
FT   gene            203423..204235
FT                   /locus_tag="Tmath_0197"
FT   CDS_pept        203423..204235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0197"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: tex:Teth514_0107
FT                   peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59981"
FT                   /db_xref="GOA:D7AR72"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR72"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADH59981.1"
FT                   /translation="MRINREKLIRFFDRKGFYIILFLSIVVIAATSIYVTNNNLKKLEE
FT                   LRKAQQEEINSAIESDWSYEKELAQAQEEKEQQNNSTAVISQQTKENFQPVAENDEVKS
FT                   SGKSDSLENSKVTTVMASNTSTIKKDNDLSSARLVLLKPVNGDIILEFAKDKLVFSKTL
FT                   QEWTTHKGVDIGSKLGEPVLAAMDGIVAKVYKDPKLGNTVVIKNGKWETRYANLEDEIL
FT                   VKQQEKVVKGQQIGKIGESARFEVSEGPHLHFELLENGTPVDPIAYFE"
FT   gene            204365..204625
FT                   /locus_tag="Tmath_0198"
FT   CDS_pept        204365..204625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0198"
FT                   /product="sporulation transcriptional regulator SpoIIID"
FT                   /note="TIGRFAM: sporulation transcriptional regulator
FT                   SpoIIID; KEGG: tex:Teth514_0108 regulatory protein, DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59982"
FT                   /db_xref="GOA:D7AR73"
FT                   /db_xref="InterPro:IPR014208"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR73"
FT                   /inference="protein motif:TFAM:TIGR02844"
FT                   /protein_id="ADH59982.1"
FT                   /translation="MKDYIEERTLEISKYIIEHKATVREAAKVFGVSKSTVHKDVTERL
FT                   PDINFELYKEVREILSKNKAERHIRGGKATKMKYQKMNNKF"
FT   gene            204757..205785
FT                   /locus_tag="Tmath_0199"
FT   CDS_pept        204757..205785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0199"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="KEGG: tpd:Teth39_2094 rod shape-determining protein
FT                   Mbl; TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59983"
FT                   /db_xref="GOA:D7AR74"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR74"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ADH59983.1"
FT                   /translation="MFAFSKDIGIDLGTASVLVYIKGEGIALKEPSVVAMDRNTNKILA
FT                   VGEEAQRMVGRTPGNILAIKPLRAGVISDYDVTEKMLRYFINKACKGRSLVRPKIMICI
FT                   PSGITQVEKRAVIDAAIHAGARKAYLIEEPIAAAIGAGLDISQPSGNMIVDIGGGTTDI
FT                   AVISLGGSVVSKSIKVAGDNFDEAIIRHMRKKHQMIIGERMAEEIKINIGTAYFDGKEE
FT                   KMLVKGRSLISGLPQNVEVTSSEICEALKEPLEEIVAAVHSVLERTPPELAADISDKGI
FT                   VLTGGGALLKGMDRLLRERMNTPVYLSNDPISCVALGTGKALDSLELLEKSETIIDVYK
FT                   IK"
FT   gene            205804..206559
FT                   /locus_tag="Tmath_0200"
FT   CDS_pept        205804..206559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0200"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="KEGG: tpd:Teth39_2093 flagellar basal body rod
FT                   protein; TIGRFAM: flagellar basal-body rod protein FlgF;
FT                   fagellar hook-basal body protein; PFAM: flagellar basal
FT                   body rod protein; protein of unknown function DUF1078
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59984"
FT                   /db_xref="GOA:D7AR75"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR75"
FT                   /inference="protein motif:TFAM:TIGR02490"
FT                   /protein_id="ADH59984.1"
FT                   /translation="MLRGLYAASSGMVTQTKIMDVLTNNLANVNTTGYKRDIVITSSFP
FT                   NFEVTRYGGDNVPPDGKIGKMDYGILIDTFHTNFEEGSFTQTNGKLDFAIDGNGFFVID
FT                   TPNGQRYTRDGSFVLSNDGYLVTQEGYIVQGENGPIELSQGDISVDEMGNIKNNGQLVD
FT                   RLRIVDFDNYDGLRKEGNNLFFIDNSANVQVIPATGRIKQGFLEQSNVNSVKEMVNMIS
FT                   VMRNYESNQKVVIAFDETLGKAVNEVGKV"
FT   gene            206584..207384
FT                   /locus_tag="Tmath_0201"
FT   CDS_pept        206584..207384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0201"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgG;
FT                   flagellar basal-body rod protein FlgF; fagellar hook-basal
FT                   body protein; PFAM: protein of unknown function DUF1078
FT                   domain protein; flagellar basal body rod protein; KEGG:
FT                   tpd:Teth39_2092 hypothetical protein; SMART: PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59985"
FT                   /db_xref="GOA:D7AR76"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR76"
FT                   /inference="protein motif:TFAM:TIGR02488"
FT                   /protein_id="ADH59985.1"
FT                   /translation="MMRALWSAASGMTAQQLNVDVIANNLANVNTTAFKRDRAEFKDLI
FT                   YQTLQRENIYGGQGRPVNMQVGVGVRPSAIVKDFTEGSLQQTDNPLDLALDGEGFFAVL
FT                   GPDGTVYYTRDGSFKLSADGNTLMLVTADGYPVLDDSGNPIVFDSTGKDISVSPMGVIS
FT                   VKNPDGTTQEVATLGIYNFVNPQGLLSVGNNLYEPTEASGQPGTRDDFEGRMGKVMQGF
FT                   LETSNVQVVKEMVDMIAAQRAYEINSKAIQAADEMLGIANNLRR"
FT   gene            207408..207746
FT                   /locus_tag="Tmath_0202"
FT   CDS_pept        207408..207746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0202"
FT                   /product="Flagellar protein FlgJ-like protein"
FT                   /note="PFAM: Flagellar protein FlgJ-like; KEGG:
FT                   tpd:Teth39_2091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59986"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR77"
FT                   /inference="protein motif:PFAM:PF10135"
FT                   /protein_id="ADH59986.1"
FT                   /translation="MEINPVDNINNINKLQIYLQKHSSDFERIIQQAIRDKDQQKLKEA
FT                   CQQLEAVFIGIMLNEMRKTIPEDPLTGDSLANDVFTSMLYDKYAEMLAQNGSFGLAEQM
FT                   YNQLSKKV"
FT   gene            207890..208318
FT                   /locus_tag="Tmath_0203"
FT   CDS_pept        207890..208318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0203"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /note="KEGG: tpd:Teth39_2089 (3R)-hydroxymyristoyl-ACP
FT                   dehydratase; TIGRFAM:
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ;
FT                   PFAM: Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59987"
FT                   /db_xref="GOA:D7AR78"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR78"
FT                   /inference="protein motif:TFAM:TIGR01750"
FT                   /protein_id="ADH59987.1"
FT                   /translation="MENKDIKKILPHRYPFLLVDRIIEIEEGKKAVGIKNVTANEPFFQ
FT                   GHFPDNPIMPGVLIIEALAQVAGIAVMNIEEFRGKLGLFTGINKCRFKKVVRPGDQLVL
FT                   EVLIDSIKMGVVKAKGIAKVGDEIAATTELMFIMTEEG"
FT   gene            208330..209895
FT                   /locus_tag="Tmath_0204"
FT   CDS_pept        208330..209895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0204"
FT                   /product="integral membrane protein MviN"
FT                   /note="KEGG: tex:Teth514_0114 integral membrane protein
FT                   MviN; TIGRFAM: integral membrane protein MviN; PFAM:
FT                   virulence factor MVIN family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59988"
FT                   /db_xref="GOA:D7AR79"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR79"
FT                   /inference="protein motif:TFAM:TIGR01695"
FT                   /protein_id="ADH59988.1"
FT                   /translation="MSTAKKTVKAAGIIMIITLLSKVFGFLRDMTLAFQFGTSVSMDVY
FT                   NMATVIPMILFAAVTAAIATTVVPIFTEYFQKDGKRKAFDFINNLLGIVLLATIILTIL
FT                   GFLFAPYLVKFVAPAFTGEKFELTVKLTTILLPTMVFIAASNIFTGALQSMEHFTIPAM
FT                   IGIPYNIIVITVAILYGDKFGITAVAYSIIIATFLQALMQLPVLYKLGYRFRVKVDFKD
FT                   EGVKRVVLLAMPVLMGTGIQTINVYVDRVIASFLPDGSIAALNYANRLNMFALGIFSTA
FT                   IATVIYPVLSKHSVADDTEGFLKSLNFAVSGILYILIPVSVGAMVLRMPIIKVLFERGA
FT                   FDENSTYLTSIALFYYAIGMTAYGLRDVLSRSFYSMKDTKTPMINGAMAVLLNIALNLI
FT                   LVRYLKLGGLALSTSIAAIFATFLLFYSLKRKVGKIDGKYMFMSFIRAMLASIVMGVLV
FT                   HFMYNNFIVKMPSDKRIYEAIALFITILAGAIIYSVIVLVIDRSAFSYFKKGIRFVNSK
FT                   FVKN"
FT   gene            209916..211034
FT                   /locus_tag="Tmath_0205"
FT   CDS_pept        209916..211034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0205"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: tex:Teth514_0115 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59989"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR80"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADH59989.1"
FT                   /translation="MKSKVYFYNLRANKASSSLSSKVARIFDVAGFKNIIDKNDLVAIK
FT                   IHFGEKGNNAYINPIYVRKVVDKIKSYGGKPFLTDTNTLYKGSRSNAVDHLTTAIENGF
FT                   AYAVVNAPIIIADGILSKDSVEVKIDKKHFDTVKIASNIFFANSMIVMSHFKGHELAGF
FT                   GGAIKNLAMGCAPAAGKQQQHSTVQPVVGKGCTACQMCIRNCPVNAISLVNGSAYIDPS
FT                   ICIGCGECVSICQYGVIKPQWGTDMDAFVERMTEYAYGAYSTKKDKIAFINFIMNVTPL
FT                   CDCTPWSDAPIVPDIGILASFDPVAIDQASYDLVNQQFGHKGTALEEAGYGMNPGEDKF
FT                   KALHPETKGELQLKYGEEIGLGTRDYELVELK"
FT   gene            211140..211301
FT                   /locus_tag="Tmath_0206"
FT   CDS_pept        211140..211301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE0178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59990"
FT                   /db_xref="GOA:D7AR81"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR81"
FT                   /inference="similar to AA sequence:KEGG:TTE0178"
FT                   /protein_id="ADH59990.1"
FT                   /translation="MEKYFVIISIISVVTLILLLLVLIAFVKWTNRIFGIENEKKGKND
FT                   KDKKERNN"
FT   sig_peptide     211140..211223
FT                   /locus_tag="Tmath_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.894) with cleavage site probability 0.870 at
FT                   residue 28"
FT   gene            211333..212145
FT                   /locus_tag="Tmath_0207"
FT   CDS_pept        211333..212145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0207"
FT                   /product="protein of unknown function DUF152"
FT                   /note="PFAM: protein of unknown function DUF152; KEGG:
FT                   tex:Teth514_0117 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59991"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR82"
FT                   /inference="protein motif:PFAM:PF02578"
FT                   /protein_id="ADH59991.1"
FT                   /translation="MEIGFKRNEVKGVIFYTIPSFEKTGLVKHLFTTRIGGVSKGKYAS
FT                   LNLSLKRYDTKEEVYENFKIICDIGGFSYEDMVFSDQVHGDVIRKVTLKDKGKNFGGSD
FT                   ISGVDALMTNERGILLVTFYADCVPLFFLDPVKKVIALAHAGWRGTVAYIGPKTVNAMK
FT                   EEYGSNPKDILVGIGPSIYKCCYEVGDDVANKIKDVIGEWKKVLVKKAEGKWMLDLQLT
FT                   NYLELINTGIPDENITVSQMCTHCNSEFYSYRRDKGMTGSMAAFMELR"
FT   gene            212284..212517
FT                   /locus_tag="Tmath_0208"
FT   CDS_pept        212284..212517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0208"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   tex:Teth514_0118 prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59992"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR83"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ADH59992.1"
FT                   /translation="MKVSATEFKTRVGKYLELVDKEEIIITKNGREVAKLIPAKKEGTP
FT                   NADFLYGILSDYPDKNITAEQIREERIRNKYN"
FT   gene            212573..212989
FT                   /locus_tag="Tmath_0209"
FT   CDS_pept        212573..212989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0209"
FT                   /product="Nucleotide binding protein PINc"
FT                   /note="SMART: Nucleotide binding protein PINc; KEGG:
FT                   tex:Teth514_0119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59993"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR84"
FT                   /inference="protein motif:SMART:SM00670"
FT                   /protein_id="ADH59993.1"
FT                   /translation="MKVLIDTNVILDVLLKRTPFDVDAYNILKLAEEKKINAYLAAFSI
FT                   TDIYYFINKNLSHNESIKALEALLSIVEVVSITKYDIKKAMNLKEFGDLEGALQMQCLR
FT                   KLKGDLIITRDEKFQKITNKAISPKDFLSNKGLT"
FT   gene            213168..216107
FT                   /locus_tag="Tmath_0210"
FT   CDS_pept        213168..216107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0210"
FT                   /product="PTS system transcriptional activator"
FT                   /note="KEGG: tpd:Teth39_2082 PTS system transcriptional
FT                   activator; PFAM: sigma-54 factor interaction
FT                   domain-containing protein; phosphoenolpyruvate-dependent
FT                   sugar phosphotransferase system EIIA 2; PTS system fructose
FT                   subfamily IIA component; PRD domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59994"
FT                   /db_xref="GOA:D7AR85"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR85"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADH59994.1"
FT                   /translation="MIDKIFEIIQKEDRRNPLTDEQIASILNIKREDVTQFRLKNNIPD
FT                   SRERRKPYLLEDAKKIISKDPNISDRNLTKELNNLGYNISRFVAAQIKKEILKSESSET
FT                   LVKSEIFQNAEKQKVDKDHNSNKDTLSFKDIIGSEGSLRVQISLAKAAVLYPPHGLHTL
FT                   IVGPSGSGKSQLAEAMYSFAIESRRFNKNAPFVVFNCADYADNPQLLMSQLFGYVKGAF
FT                   TGADAPKAGLVEKADGGILFLDEVHRLPSEGQEILFSILDKGKFRRLGETESTREVQIM
FT                   LIAATTENPESSLLLTFRRRIPVLIELPSLADRPPQERYEIIYNFFSKESFRINKPIII
FT                   KKEAVRALMLYDCPGNLGQLRSDIQVACAKAFLNSMGSKDSLLTINLLDLPNHVKMGII
FT                   RVSKRSPEIEKYSNEDVLVYPDKENKLYPKEDRYMLPDEIYQFIEERFIDLKNQGLTKE
FT                   EIDKIVGKEIEEELKRFAINVKSNVAISKKDLKGIVGEKIVEAAEKAYEIAKKSFSRLE
FT                   ENLFYSLAIHLSATYERILSGKPIINPQLENIIREYPAEYSTAKIMAKQIEKELGIELP
FT                   EEEIGFITMYLRTFSDEKEIVKGRVGVVVLTHGHVASSMAEVVNKLLGVNHAVGIDMAL
FT                   DESPESVLERTIEVVKRIDEGKGCIILVDMGSLITFGEIITKRTGIPTRVVGRVDTVMV
FT                   LEAVRRAIIPDTNLDEIADALDVDKTYIGRVEDIKSKDKLPKAIVTVCITGEGTALKIK
FT                   KYIEDVLPQLKGNYKIIPVGMLRQEDIEKEISKIREENEVVAFVGTINPGIKSIPFISV
FT                   EEVLNGEGIEKLKKIVNLEKENPLKEVIQEDLILYDLDTSMKSDVIDKLVEILQDKGYV
FT                   DERFLLSVYKRESMGATILKGGIAIPHGYPEHVTKPAIAIAKLKEPIYWEGEFKADLVF
FT                   MIALKEDSKDYMFYLYKVMTDEKIIDALKRAKSPTQIKDIILKNTISAE"
FT   gene            216165..216635
FT                   /locus_tag="Tmath_0211"
FT   CDS_pept        216165..216635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0211"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: tte:TTE0181
FT                   phosphotransferase system mannitol/fructose-specific IIA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59995"
FT                   /db_xref="GOA:D7AR86"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR86"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ADH59995.1"
FT                   /translation="MNFSEFLHEELIIPKMKANSQEEVFKRLYELLLKNGYVKESFLEG
FT                   IKKREQSFPTGLLLNKYNVALPHTDVEHVLKSAVAVATLSKPIVFKNMANPQQDVNVNI
FT                   VFMIALNESGGQVKMLQQIVQLIQNDSLLEELMMAESGKEIIKVIKNISYEN"
FT   gene            216738..217049
FT                   /locus_tag="Tmath_0212"
FT   CDS_pept        216738..217049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0212"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; KEGG:
FT                   tpd:Teth39_2080 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59996"
FT                   /db_xref="GOA:D7AR87"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR87"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ADH59996.1"
FT                   /translation="METTEKNKKVRVLVVCADGVATSTVVFVSLREELEKRGIKAEFVQ
FT                   GRVMDVERMTKDGNFDFVVSTAGTSLDVEIPVISGVPFLTGIGREQVFNQILEIINKN"
FT   gene            217073..218452
FT                   /locus_tag="Tmath_0213"
FT   CDS_pept        217073..218452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0213"
FT                   /product="PTS system Galactitol-specific IIC component"
FT                   /note="PFAM: PTS system Galactitol-specific IIC component;
FT                   KEGG: tex:Teth514_0123 PTS system galactitol-specific IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59997"
FT                   /db_xref="GOA:D7AR88"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR88"
FT                   /inference="protein motif:PFAM:PF03611"
FT                   /protein_id="ADH59997.1"
FT                   /translation="MFAVLVKTFGAAVLLPIFILILELILGVKFSKAIRSALYIGIGLN
FT                   GLISILNPYFLGAVGKAVSDMITTKGVHLPYVDTGWALLAAVGYSTKIGALIIPIGIGV
FT                   NLIMLLLRWTNTLDLDIWNFWHWAFVGSMTYYATNNLWFGILAAVAIEIFLLVIADITA
FT                   PTMQKFFNLPGLSFPHASGQGAVLLAPPFKWLFTKIGLTKLQISSRTVKEKFGILGDSV
FT                   VIGFIISSIIGFLAWGNRLGDIQTWSQILTLGIGTGAYIYLYPKATGALLEGFVPLNER
FT                   VRDILSRKGIQRELNFGMDSALTVGHPDVITTGLLTMITAVPLVFLLPGNKFLMLADLG
FT                   VTPFFLASAVTAVMGGNIIASYITTVVGLIITLYISSAGSPLFFHTVTSLGISLPETGA
FT                   AMVGADIRPLHGLFYFLGKTPIGLIVLYVSIFVILFSFKKNPTAWYRAFGYAEDGTSEN
FT                   R"
FT   gene            218554..219513
FT                   /locus_tag="Tmath_0214"
FT   CDS_pept        218554..219513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0214"
FT                   /product="Phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="KEGG: tex:Teth514_0124 phosphoglycerate
FT                   dehydrogenase; PFAM: D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59998"
FT                   /db_xref="GOA:D7AR89"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR89"
FT                   /inference="protein motif:PRIAM:1.1.1.95"
FT                   /protein_id="ADH59998.1"
FT                   /translation="MKKWKVVSTAVTFGKINKEPVERLEEFGCEVILNPFGRPFTNEEI
FT                   IRYASDADALIVGNDKVPGDVIKKCKKLKIIAKHGVGVDSIDVKTANQLGIIVTNAPGT
FT                   NSEEVADLAFGLLHMLARGLYQANADTKNGKWIKPVGISLSKKTIGIIGVGAIGTAVAK
FT                   RATGYDMNILGYDIKKNPLALELGVKYVGLEELLSEADFISLHLPLTNDTLNILNADKF
FT                   KLIKKGAIMINTARSQLIDNEALYNSLIDGTLKGYATDVYDFEPPRHLPFFDLPNVILT
FT                   PHIGGTTVESNKRMGNTAVDNVIAVLKGETPPNIVLVD"
FT   gene            219546..219842
FT                   /locus_tag="Tmath_0215"
FT   CDS_pept        219546..219842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0215"
FT                   /product="SAF domain protein"
FT                   /note="KEGG: tpd:Teth39_2077 SAF domain-containing protein;
FT                   PFAM: SAF domain protein; SMART: SAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADH59999"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR90"
FT                   /inference="protein motif:PFAM:PF08666"
FT                   /protein_id="ADH59999.1"
FT                   /translation="MPSTKKAILLNKADSVATALSQIQKGDVVDIIYNNETVNKLIALD
FT                   DIEIYHKIAVVPIQSGNNVYKYGEVIGKAIKSIEIGQCVHIDNIESVRIRNEN"
FT   gene            219832..221001
FT                   /locus_tag="Tmath_0216"
FT   CDS_pept        219832..221001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0216"
FT                   /product="Altronate dehydratase"
FT                   /EC_number="4.2.1.7"
FT                   /note="KEGG: tpd:Teth39_2076 altronate dehydratase; PFAM:
FT                   D-galactarate dehydratase/Altronate hydrolase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60000"
FT                   /db_xref="GOA:D7AR91"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR91"
FT                   /inference="protein motif:PRIAM:4.2.1.7"
FT                   /protein_id="ADH60000.1"
FT                   /translation="MKIKAYKRPDGKYGIRNKVLILPSVGCANETVRLISEQVQGTTYI
FT                   TNPKGCGQIGNSVDLMRRTLIGFALNPNVYGTIIVGLGCETIQAYDLYEEIKKRSNKPV
FT                   EVISIQGEGGTLKTIQKGIKLARKMVEEMSKIEREEVDISNITLATNCGGSDATSGIAA
FT                   NPTLGYCSDILIKEGATVFLGETTEFIGAEHILVRRTKNERVRNNLLTIVKNLENEFIR
FT                   LGIDIRGANPSPGNIKGGLSTLEEKSLGSIMKGGTSIINEVVRYGEIPKEKGLIIMDTP
FT                   GYDIESVTGMVAGGAQICVFTTGRGTPIGNPIIPLIKITGNKQTYEKMSDNIDLDVSDI
FT                   IEGKKSIKECGEMLLQEIIDVCNGKLTKAEIYGFSETCIYRNQEIWCSW"
FT   gene            221096..222241
FT                   /locus_tag="Tmath_0217"
FT   CDS_pept        221096..222241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0217"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="KEGG: tpd:Teth39_2075 galactonate dehydratase;
FT                   manually curated; PFAM: Mandelate racemase/muconate
FT                   lactonizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60001"
FT                   /db_xref="GOA:D7AR92"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR023592"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR92"
FT                   /inference="protein motif:PFAM:PF02746"
FT                   /protein_id="ADH60001.1"
FT                   /translation="MKITSLKVYKVKPRWIFLKIDTDEGISGWGELISGTKTETVVAGA
FT                   YEMGEYLIDKDPRQIEDIWQVMYRSFFRGGPINMTILSGIEMALWDIKGKYYNMPVYEF
FT                   LGGQARDKIMVYSWIGGDRPSDVVEAALDRKNKGFKAIKMNATEELHYIDSYKKIEAVI
FT                   ERVASIRDAVGYEMEIGIDFHGRVHKAMAKVLAKELEKYRPMFIEEPVLPENNEALKEI
FT                   ASHTSIPIATGERLYTRWGFKDVLKSGAVDIIQPDVALTGGILETKKISAMAEAFDVAV
FT                   APHAPYGPIALAATLQLDVCTPNVFIQEQSLGIHYNQGFDLLDFVKNKEIFAYKDGFVD
FT                   IPRGPGLGIEIDEELVKKVDMEGLHWTNPKWRNYDGTVAEW"
FT   gene            222330..223292
FT                   /locus_tag="Tmath_0218"
FT   CDS_pept        222330..223292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0218"
FT                   /product="Phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="KEGG: tex:Teth514_0128 D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD-binding; PFAM: D-isomer
FT                   specific 2-hydroxyacid dehydrogenase NAD-binding; D-isomer
FT                   specific 2-hydroxyacid dehydrogenase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60002"
FT                   /db_xref="GOA:D7AR93"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR93"
FT                   /inference="protein motif:PRIAM:1.1.1.95"
FT                   /protein_id="ADH60002.1"
FT                   /translation="MSKYKVVITARSFGESSDEPFNILKGNDCEVVKIPVDRPLSAEEL
FT                   IPLVKDADALIVGNDKVTEDVINAGKKLKVISRYGVGYDNVDLNAAKKKGIVVTNTPNA
FT                   NNNSVADLVIGLMLVLARNLLAVDRIVKSGGWKRIMGTEIYGKTLGIIGLGKIGKGVAK
FT                   RAKGFDMNVLCYDVYPDLKFSEEYGVTYCSFEELLKQSDIVTIHVPLTPETKGLIGERE
FT                   LGMMKPTAFLINTSRGGIVDESALYNALANKKIAGAALDVMEQEPPINSPLLKLDNVVI
FT                   TSHIGGYTSEAITNMGIVAAKNVVLVLNKKQGAHIVNGE"
FT   gene            223312..223959
FT                   /locus_tag="Tmath_0219"
FT   CDS_pept        223312..223959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0219"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="KEGG: tpd:Teth39_2073
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; TIGRFAM:
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60003"
FT                   /db_xref="GOA:D7AR94"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR94"
FT                   /inference="protein motif:TFAM:TIGR01182"
FT                   /protein_id="ADH60003.1"
FT                   /translation="MKSYEVLNKIKEVGICAIVRGTSVDSLYRIADSLIAGGIKAIEVA
FT                   FNTPGAAKMIEKLVEKYSDQLLIGAGTVLDAETARIAILSGASFILSPSLNLEMIRICQ
FT                   RYNVLPVPGISTPTEAVTAWENGAQIVKVFPAGVFGPNYIKQLKGPLSQIEMMAVGAVN
FT                   LDNFKDFIKAGACSVGIGSELVNNKLVEEGKFDEITRRAAAFVNGFKEVNSK"
FT   gene            224031..225182
FT                   /locus_tag="Tmath_0220"
FT   CDS_pept        224031..225182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0220"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   tpd:Teth39_2072 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60004"
FT                   /db_xref="GOA:D7AR95"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR95"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADH60004.1"
FT                   /translation="MNKNTYTIVIIYLLMMLIGIIENVKGPLILSIKTFYSVDYTMMGL
FT                   FLSVGSLGFILSTFFGGFLADKIGRKLVLLSGLLLIILGIIGISMAPNFVLFLLFAFIM
FT                   NMGMGSVEIGINAVAAVVFIMNQAIMMNLLHFFYGVGAIISPNMTVKLLHFNFTWQLVY
FT                   LSVAALAFILMLATLGIKIQEGQRIIKEKINYGEILGNKRMWLFAIMLGFYVASELGVG
FT                   NWAVTFLRTWYKIDNTISSLYLSIFFATFTLGRLFGGFIVEKVGYLKSLSTFSLCAAVF
FT                   IAIGMLSKSLAFLISISGFFYSIIFPTVIATIMKEFKKHVSAIIGITVTIASTINMFAN
FT                   FLIGKLNDLFGVFVGFSAILLFMIVVVFMSSILSQTIKKEVSE"
FT   gene            225283..228030
FT                   /locus_tag="Tmath_0221"
FT   CDS_pept        225283..228030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0221"
FT                   /product="PTS system transcriptional activator"
FT                   /note="KEGG: tpd:Teth39_2071 PTS system transcriptional
FT                   activator; PFAM: sigma-54 factor interaction
FT                   domain-containing protein; PRD domain protein; PTS system
FT                   fructose subfamily IIA component; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60005"
FT                   /db_xref="GOA:D7AR96"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR96"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADH60005.1"
FT                   /translation="MTNKERVFNLIKDLSKDINIKEKKGLTAQEIAKKLNLRRNVASHL
FT                   LNELYKEGKIIKINTRPVYFLDKEVYEKKAKEFKETAKTFDSTVKVSNDDPFTKLIGYN
FT                   GSLKTQVKLCKSAASYPPNGLPILLIGNTGVGKSFIAQLIYEYAKSINAIDENAPYVIF
FT                   NCAEYANNPELLSANLFGYVKGAFTGADKDKPGLLEEADGGYLFLDEVHRLPPEGQEKL
FT                   FLFLDKGIFRRLGETGNWRTAKVRFIFATTEDPEQTLTKTFLRRIPLVVNIPSLYDRPL
FT                   HERLQLIYNFYKNEAKNLGMDILISKQVLNVLLKTKISGNIGQLMNVIKYSCAQAYNHV
FT                   IREKTNILRIHLYDLPREMQADLDIIKSNFHFNGMLISHNRKDEDLTWDKGDDREVYEV
FT                   VNKLFELFERYSSKEISEDTFKKDALIYLNEFTDKIIFKNDNTYIDSIVFNAIKSVVEN
FT                   VLNIIQNMYGIKYYGNSVLVLTHFINYLLSDVTYEKYSENIKMVYRVLKNVFPKEFIIA
FT                   NKMVELIEVNLDVKLNQIAVIYFTLYIKSLNKSDNTNLINSIIIAHGYSTASSIASVAN
FT                   RLLGQFVFEAFDMPIEMSTQEIMLKVQDYLKNIDTSKGIIILVDMGSLEEIYKSLTDIV
FT                   EGDIAIINNITTQLALDVGNKIMQNQPIEQIVTESIQRNSSSYKLIKSQKNKRNAIIAT
FT                   CITGIGTAVKIKELLKECFVNEDIEIIAYDYNRLKGNGVKDEIFKDFNVKLIIGTADPG
FT                   IKEIPYLSLEDLIAGKGDVLLSKVLRGVADAEKIQRINQTIVRLFSLQNVLHHLTILNP
FT                   DKIIAQVEKAISDLERFIGVRFSNDLKISLYIHVSVMIERLVMKEPIVFYSSLEEFEQC
FT                   HRQFINFVKSSFSVIEEMYKIEIPTSEIRLIYDIIKDRVAELNV"
FT   gene            228201..228611
FT                   /locus_tag="Tmath_0222"
FT   CDS_pept        228201..228611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0222"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: tpd:Teth39_2070 PTS system fructose subfamily IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60006"
FT                   /db_xref="GOA:D7AR97"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR97"
FT                   /inference="protein motif:PFAM:PF03610"
FT                   /protein_id="ADH60006.1"
FT                   /translation="MKEKFVLIITHGNFGKGLLNGIEVIMGKQENVLALGLNLGDNIEL
FT                   LRAEVEKIVREKLRENKEVIIAVDLFGGSPFNVALYVMKNYDVKVITGVNMPMLIELLS
FT                   SLNACDTKELINNIYKVGVDGIKVIEKNSLSL"
FT   gene            228840..229619
FT                   /locus_tag="Tmath_0223"
FT   CDS_pept        228840..229619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0223"
FT                   /product="phosphotransferase system PTS sorbose-specific
FT                   IIC subunit"
FT                   /note="PFAM: phosphotransferase system PTS sorbose-specific
FT                   IIC subunit; KEGG: tpd:Teth39_2069 phosphotransferase
FT                   system PTS, sorbose-specific IIC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60007"
FT                   /db_xref="GOA:D7AR98"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR98"
FT                   /inference="protein motif:PFAM:PF03609"
FT                   /protein_id="ADH60007.1"
FT                   /translation="MQMSLSISQAALIALWIAIVEARALGYSTLMLRFSPLMTGLIVGI
FT                   VMHDIPTAMTITAAIQLIYMGLIAPGGAMPSEPAVATAIAVPVAILGGLTPEAAIAIAV
FT                   PVGLLGSYLYSLRFFINTFIIRLTDKYADELNEKGLTLSIIVLPILVSLVLFFPLMFIA
FT                   LYKGTPLIADLVKTLTVGKAFHVLNVVGGGLPALGIALTLTVIGKRKFLVFFLLAYFMA
FT                   VILKPLNVNTVTYAILGGIIAYLYVLVTHSQVEGQEI"
FT   gene            229638..230525
FT                   /locus_tag="Tmath_0224"
FT   CDS_pept        229638..230525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0224"
FT                   /product="PTS system mannose/fructose/sorbose family IID
FT                   component"
FT                   /note="PFAM: PTS system mannose/fructose/sorbose family IID
FT                   component; KEGG: tpd:Teth39_2068 PTS system
FT                   mannose/fructose/sorbose family IID component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60008"
FT                   /db_xref="GOA:D7AR99"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:D7AR99"
FT                   /inference="protein motif:PFAM:PF03613"
FT                   /protein_id="ADH60008.1"
FT                   /translation="MMENIEAKDDLKGTQSNSTDSKITKKDLLLSWIRWWYANEIPHSY
FT                   DRMIAPSLLWGLMPILRKLYKKSEDLKEAYKRHLVFYNTQAIWGGGTILGITASLEEAR
FT                   ARALEENKGEDVVTPDVINSTKVGLMGPLAGIGDAIDSGTVQYILIGMFLPWAKAGSAL
FT                   GALIPWIAFVALTFTYGFYFTQLGYRLGRAAAIEIVSGKGIRSIIDGLSILGTFMMGIL
FT                   AALYVSVSTPLKWSLSGKEFVLQDILDKILPGLLPLLTVLLVYLYFSKKGLKIIQALLW
FT                   LVVIFGVLGVIGIL"
FT   gene            230669..231157
FT                   /locus_tag="Tmath_0225"
FT   CDS_pept        230669..231157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0225"
FT                   /product="PTS system sorbose subfamily IIB component"
FT                   /note="PFAM: PTS system sorbose subfamily IIB component;
FT                   KEGG: tpd:Teth39_2067 PTS system sorbose subfamily IIB
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60009"
FT                   /db_xref="GOA:D7ARA0"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARA0"
FT                   /inference="protein motif:PFAM:PF03830"
FT                   /protein_id="ADH60009.1"
FT                   /translation="MFARVDDRLIHGQVMTKWVKGYNCNSIFIIDNSLANDEFMKQVYM
FT                   MSASAAHVALKILSTEETITLWKKDKFNGFRVILLYKDIISVKETIANGLPIKKLNIGG
FT                   IAKSQDRKFIIPSVSLKKEELEILVELADNFGVEVFFQTVPDSKRVDLEDALKLFGLK"
FT   gene            231281..232243
FT                   /locus_tag="Tmath_0226"
FT   CDS_pept        231281..232243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0226"
FT                   /product="Glyoxylate reductase"
FT                   /EC_number="1.1.1.26"
FT                   /note="KEGG: tpd:Teth39_2066 D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD-binding; PFAM: D-isomer
FT                   specific 2-hydroxyacid dehydrogenase NAD-binding; D-isomer
FT                   specific 2-hydroxyacid dehydrogenase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60010"
FT                   /db_xref="GOA:D7ARA1"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARA1"
FT                   /inference="protein motif:PRIAM:1.1.1.26"
FT                   /protein_id="ADH60010.1"
FT                   /translation="MRKKILITPRSFGKSSNLPFEMLKKYDYEIIKNESGQPYEESQLI
FT                   DLIKDVDGIIVGLDKITSNVLRNAKKLKVITKYGVGVDNIDVDEAERMGIKITYTPDAN
FT                   KESVADLVFALMLGLSREIIKLDNIVRNNRWEKIIGNEIYKKTIGIIGTGAIGRCVAKR
FT                   ATGFDMKILAYDKYPNYEFANSIGMKYVDKKALLEESDFITLHLPLTEETYHFIDEEEL
FT                   EIMKDTAYIINTSRGGIINENALYNALKNKKIAGAALDVFEIEPPIDSKLLKLDNIILT
FT                   PHCGASTKDATDRMGIMAVEGLISVLEGMEPKYLYKRQK"
FT   gene            232273..232905
FT                   /locus_tag="Tmath_0227"
FT   CDS_pept        232273..232905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0227"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="KEGG: tpd:Teth39_2065
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; TIGRFAM:
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60011"
FT                   /db_xref="GOA:D7ARA2"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARA2"
FT                   /inference="protein motif:TFAM:TIGR01182"
FT                   /protein_id="ADH60011.1"
FT                   /translation="MEKQQIIEKLKQLKITAVIRNSDINTMFSLADALKKGGIEALEIT
FT                   VEAPGAIDVIKELSKANKYFVGAGTVLDAETARAAIIAGAKFIFTPVMRLDVIKLCNRY
FT                   GIPVIPGATTPTEILTGYEAGADFIKVFPAGVFGPQYLKEILGPLKHIPIFVTGGINKN
FT                   NIKDFILAGATGVSLGGALVDKELIAKGMFDKITEKAIEFVRLVNQV"
FT   gene            233032..234039
FT                   /locus_tag="Tmath_0228"
FT   CDS_pept        233032..234039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0228"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: tex:Teth514_0138 D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60012"
FT                   /db_xref="GOA:D7ARA3"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARA3"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADH60012.1"
FT                   /translation="MGVKIAIVNSSSFGKHFPEHIERLKALGEVERFELPHDMRGKALA
FT                   EKLMGYSVIIASVKPYYDKEFFEHKDKTLLITRHGIGYDTIDIKSATEKGVIVTKVEGI
FT                   VEREAVAENAIALLLDVMKKVRSASLKVKEGKWGERASFIGYEIKGKVAGIIGIGNIGS
FT                   RVCEILKYGFGAKVVAYDPNLSAEEIEKRGAEPVTLEELLKRADIISLNASLNRDNYHI
FT                   LSHKEFAMMKKGTFIVNTARGELIDTEALIKALKEGIVLGAGLDVIEGEPIDENHPLLA
FT                   FDSVIITPHTSAYTYECLKGMGDKVVSDVEKVLRGEIPEGVINPEVLEGRPWKI"
FT   gene            234234..235643
FT                   /locus_tag="Tmath_0229"
FT   CDS_pept        234234..235643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0229"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="KEGG: tpd:Teth39_2063 6-phosphogluconate
FT                   dehydrogenase; TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   domain protein; 6-phosphogluconate dehydrogenase
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60013"
FT                   /db_xref="GOA:D7ARA4"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARA4"
FT                   /inference="protein motif:TFAM:TIGR00873"
FT                   /protein_id="ADH60013.1"
FT                   /translation="MIKADIGLIGLGVMGQNLALNIARNGYAVSVFNKTEEKTREFIDE
FT                   KVKEEKIYPFYTLKDFVESLKKPRKIILIIKAGTPVDDVINELLSYLEKGDLIVDSGNS
FT                   YFMDTSRRLKVLKEKNILFLGMGISGGEYGALYGPSLMPGGTKEAYELIKDVLLKVAAK
FT                   TEDGPCCTYVGNDSAGHFVKMVHNGIEYAIMQLIAEVYDFMRKILNMTNEEIGDVFERW
FT                   NQEELDSYLMEISYKIMRYKDKETGGFLLDYILDKAEQKGTGKWTAQTSLDLGVPTPTL
FT                   NLAVEARVISHYKEERKTLSKLYSKEKNTISVNKEEMIEHLKKTLLFGVFMSFSQGLWL
FT                   IYEASKQYNYGVDLSEILRIWKGGCIIRAKILDFLRDIIRENEEYANLLHSDKSIEFIK
FT                   DKLNSVYQVLEIGRNYRIPLMIINSAVDYYFALTEENLPANLIQAQRDFFGAHTYERVD
FT                   KEGIFHTEWEK"
FT   gene            235798..237141
FT                   /locus_tag="Tmath_0230"
FT   CDS_pept        235798..237141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0230"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   KEGG: tpd:Teth39_2062 TrkH family potassium uptake protein;
FT                   PFAM: cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60014"
FT                   /db_xref="GOA:D7ARA5"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARA5"
FT                   /inference="protein motif:TFAM:TIGR00933"
FT                   /protein_id="ADH60014.1"
FT                   /translation="MIFIIKIKLTPTQVLALGFATIILIGTLLLMLPVATKSGERTDFL
FT                   TALFTATSATCVTGLVVVDTKTYWSVFGQIVIMLLIQVGGLGIMTMSTLFALILGRKIT
FT                   FKERLVMQEAFNTNSLGGIVKFAKYILMVSFLFESIGAIMLTLRFLPQMGLKKAVYYGL
FT                   FHSISAFNNAGFDLMGNFKSLTGYVSDWVVNLVVMGLIIFGGLGFYVLLDIYEHRHFNK
FT                   FTLHSKIVITITLLLIAIGTLLIFLFEYNNPKTLGPLDFPTKILAALFQAVTPRTAGFN
FT                   TLSLSDMTIASKFLTIILMFIGASPAGTGGGIKTTTFAVILYTVLSVIQGEEETVLYKR
FT                   TISRNIVYKAVAISFISVFIIFSVTMVLSITETSNFLTVLYETTSAFGTVGLSLGLTPE
FT                   LSTVGRIIIIFTMYTGRVGPLTLALALAKRQRRPKPIIKYAEEKIMVG"
FT   gene            237156..237809
FT                   /locus_tag="Tmath_0231"
FT   CDS_pept        237156..237809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0231"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: tpd:Teth39_2061 TrkA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60015"
FT                   /db_xref="GOA:D7ARA6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARA6"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ADH60015.1"
FT                   /translation="MKQFVVIGLGSFGISLAKTLYEMGNDVLVIDEDEELVQAMNGLVT
FT                   HAVRADATDENVLKSLGVKNFDVAIVAIGKNMESSIMVTMLVKELGVKYVIAKAHNELH
FT                   ARVLYKVGADRVVMPEKDMGIRVARNVFSSNLIDLIEFSKEYSIAEILPIEEWFGKTLK
FT                   EINVREKYGLNVVAVKKFNDEIIVSPGPDYEINEGDVLAVCGKNTDIKRFEIKT"
FT   gene            237973..238119
FT                   /locus_tag="Tmath_0232"
FT   CDS_pept        237973..238119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0232"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_0401 xylose isomerase-like TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60016"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARA7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH60016.1"
FT                   /translation="MKRKLKNSVGIWAFGPAATRFDPAGYHTELSNETMEAYIAWHLEQ
FT                   SFK"
FT   gene            238148..239464
FT                   /locus_tag="Tmath_0233"
FT   CDS_pept        238148..239464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0233"
FT                   /product="xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /note="TIGRFAM: xylose isomerase; KEGG: tex:Teth514_0153
FT                   xylose isomerase; PFAM: Xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60017"
FT                   /db_xref="GOA:D7ARA8"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARA8"
FT                   /inference="protein motif:TFAM:TIGR02630"
FT                   /protein_id="ADH60017.1"
FT                   /translation="MEYFKNVPQIKYEGPKSNNPYAFKFYNPDEIIDGKPLKEHLRFSV
FT                   AYWHTFTANGTDPFGAPTMQRPWDHFTDPMDIAKARVEAAFELFEKLDVPFFCFHDRDI
FT                   APEGETLRETNKNLDTIVAMIKDYLKTSKTKVLWGTANLFSNPRFVHGAATSCNADVFA
FT                   YAAAQVKKALEITKELGGQNYVFWGGREGYETLLNTDMELELDNLARFLHMAVEYAQEI
FT                   GFEGQFLIEPKPKEPTKHQYDFDAASVHAFLKKYDLDKYFKLNIEANHATLAGHDFQHE
FT                   LRYARINNILGSIDANMGDMLLGWDTDQYPTDIRMTTLAMYEVIKMGGFNKGGLNFDAK
FT                   VRRASFEPEDLFLGHIAGMDAFAKGFKVAYKLVKDGVFDRFIEERYKSYREGIGAEIVS
FT                   GKANFKTLEEYALNNPKIENKSGKQELLESILNQYLFSE"
FT   gene            239479..240981
FT                   /locus_tag="Tmath_0234"
FT   CDS_pept        239479..240981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0234"
FT                   /product="xylulokinase"
FT                   /note="KEGG: tex:Teth514_0154 xylulokinase; TIGRFAM:
FT                   xylulokinase; PFAM: Carbohydrate kinase, FGGY-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60018"
FT                   /db_xref="GOA:D7ARA9"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARA9"
FT                   /inference="protein motif:TFAM:TIGR01312"
FT                   /protein_id="ADH60018.1"
FT                   /translation="MYFLGIDLGTSAVKIILVEENGNVIGSTSKEYPVYYPQPGWSEQN
FT                   PEDWWNATKDGIRELIIKTGVKNDDIKGIGLSGQMHGLVLLDENNNVLLPAILWNDQRT
FT                   QEECDYITQTLGKERLTKYTGNKALTGFTAPKILWVRKHRPDVYKKIHHILLPKDYIRF
FT                   KLTNEYATDVSDASGTLLFDVENRKWSKDMLDALDIPYNWMPKCYESTEVTGYVTKDVA
FT                   DLTGLKEGTIVVGGGGDQASGAVGTGTVKSGIVSVALGTSGVVFASQDKYVVDEENRLH
FT                   SFCHANGKWHVMGVMLSAAACLKWWIDNIINFNGSSITYEKLLEEAGKVTPASGGLIFL
FT                   PYLMGERTPYSDPYARGSFIGLNMTHNRGHITRAILEGVAFGLRDSLEIIKELNIPVNE
FT                   VRVSGGGAKSVLWRQVLADIFGVRVDMVNATEGPAFGAAIMAAVGYGIFKDVEEATSEL
FT                   IKVNDSVYPIEENKDKYNEVYKIYRNLYYTLKDTFKDVSGIE"
FT   gene            240994..242151
FT                   /locus_tag="Tmath_0235"
FT   CDS_pept        240994..242151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0235"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: gym:GYMC10_3207 oxidoreductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60019"
FT                   /db_xref="GOA:D7ARB0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARB0"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADH60019.1"
FT                   /translation="MIKVAIIGTGNISPQHIQGYLQFSDRCKIVALADIYPEKARDKKE
FT                   RFNLEDADVYDDYKKVLERNDIDLIDICTPPYTHAEIAVNALNTGKHVLVEKPMASSLE
FT                   ECDKMIKASEKNNKLLSVVAQNRFTTQFMKLKHVVDSGLAGDIVHAQVDSLWWRGYSYY
FT                   DLWWRGTWEREGGGCTLNHAIHHIDMLLWLMGMPEEVQAVMNNVAHENAEVEDISIAIL
FT                   KYKNGAVGQITSSVIHHGEEQQIVLQGKKARISAPWKVYASIPSSNGFPAGRDEKLEKE
FT                   LQDFYNKLPDLKYKGHTAQINDVLNAIEMKQDVLVSGKDGRNALELITAIYESASTEQP
FT                   VKLPLSERDPFYTVLGIRANVPYFYKKKTFIENFDDENITFGRII"
FT   gene            242199..243269
FT                   /locus_tag="Tmath_0236"
FT   CDS_pept        242199..243269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0236"
FT                   /product="Oxidoreductase domain protein"
FT                   /note="PFAM: Oxidoreductase domain; oxidoreductase domain
FT                   protein; KEGG: pjd:Pjdr2_5203 oxidoreductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60020"
FT                   /db_xref="GOA:D7ARB1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARB1"
FT                   /inference="protein motif:PFAM:PF02894"
FT                   /protein_id="ADH60020.1"
FT                   /translation="MSKESGMYYMPESQARKVCNEGDFIFAAIGLDHGHIYGMTKGLIE
FT                   AGAQLKWVYDLDTVKVEAFCRAYPQVKKARSEDEILEDDSVHLVASAAIPSERCSLGLR
FT                   VMEAGKDYFADKPPLTTMEQLERAKKKVKETKRKYAVYYGERLHNEGAVFAGQLVKQGA
FT                   IGRVLQVIGMGPHREGKGRPDWFYDKEKYGGILCDIGSHQIEQFLYYTGAKDAEVQIAR
FT                   VANYNHKQYSNFEDFGDVLLVGDNGATGYFRVDWFTPDGLGTWGDGRLFILGTEGYVEV
FT                   RKYIDVAREGTGDHVYIANKDGERYFHVKGKVGFPFFGELILDCLNRTENAMSQAHIFR
FT                   TIELALKAQNSAIKIE"
FT   gene            243292..244695
FT                   /locus_tag="Tmath_0237"
FT   CDS_pept        243292..244695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0237"
FT                   /product="Glucuronate isomerase"
FT                   /EC_number="5.3.1.12"
FT                   /note="KEGG: tte:TTE1939 glucuronate isomerase; PFAM:
FT                   Glucuronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60021"
FT                   /db_xref="GOA:D7ARB2"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARB2"
FT                   /inference="protein motif:PRIAM:5.3.1.12"
FT                   /protein_id="ADH60021.1"
FT                   /translation="MKNFMDENFLLTNDIAVTLYHQYARNMPIYDFHCHLSPKEIYENK
FT                   RFKNITEIWLYGDHYKWRLMRANGIDEKYITGNADDYDKFMAYAKTIPMAIGNPVYHWT
FT                   HLELQRYFGIYDLLNEKTAKSIWERANEVINHDDFNVRNIIKKSNVKIIITTDDPTDSL
FT                   EYHIKLKEQNEFDVKVLPAFRPDKGLGIEKEDFIPWLKKLEEVTGKEINNYEDFLQALE
FT                   KRIEFFHTVGCRISDHALDYVFYQKSSKQEVEKIFKKALIRQHLTKEEIDSFKTYTLIF
FT                   LGKKYAELKWVMQLHIGAMRNNNTKMYKVLGPDTGYDSISDFAIAYPLARLLDALEVED
FT                   SLPKTILYTLNPAANYVIATMIGNFQGGKIAGKMQFGTAWWFNDNKDGMIEQMKALANT
FT                   GLLSRFIGMVTDSRSFLSYTRHEYFRRILCNLLGEWVENGEVPNDIELLGKIVQDISFN
FT                   NAKEYVGII"
FT   gene            244744..245403
FT                   /locus_tag="Tmath_0238"
FT   CDS_pept        244744..245403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0238"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="KEGG: cbe:Cbei_1836
FT                   keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate
FT                   aldolase; TIGRFAM: 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60022"
FT                   /db_xref="GOA:D7ARB3"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARB3"
FT                   /inference="protein motif:TFAM:TIGR01182"
FT                   /protein_id="ADH60022.1"
FT                   /translation="MSMNKWEVLETIMQEGIIAVIRSETKEKAIKVAEALKKGGIKILE
FT                   ITMTVPGSIDIIKELSEKYKSQDIIIGAGTVLDRETSRLSILSGARFIVSPHLDIEIIK
FT                   LCNIYKIPVIPGISSVKDIIKALEYGVDIMKLFPGEIMGLQAIKAFKGPIPQADFIPTG
FT                   GVNLNNLKDWIKAGAVAVGVGSNLTKGQEEENYELIEKTAEEYVKEVKRVKAQMKI"
FT   gene            245530..247146
FT                   /locus_tag="Tmath_0239"
FT   CDS_pept        245530..247146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0239"
FT                   /product="Mannitol dehydrogenase domain protein"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: tte:TTE1940
FT                   mannitol-1-phosphate/altronate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60023"
FT                   /db_xref="GOA:D7ARB4"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARB4"
FT                   /inference="protein motif:PFAM:PF08125"
FT                   /protein_id="ADH60023.1"
FT                   /translation="MLLTRDGIKDIDRWRHAGIKLPNYDVEKIAEKTKQNPTWLHFGAG
FT                   NIFRGFIALLQQDLLDKGLTETGIIAIESYDYEIIEKVYIPYDNLSLLVIMHADGTLET
FT                   EVIGSISDKILADPWSQDWTKLKNIFTNPSLQIASFTITEKAYNLKDFSGEYIKEVKED
FT                   IQKGPEKPRNIISKITSLVYERYLKGKYPIALVSLDNFSGNGERLFGSVKTITEEWIKK
FT                   GMIEEKFLDYLTNPSKVSFPLTMIDKIVPRPSEEVKKKLEGLGLEKMDIIKTNKNTVIA
FT                   PFVNAEKIHYLVIEDKFPNGRPPLEEAGVIFTDKETVEKVERMKVTTCLNPLHTTLAIF
FT                   GCLLNYSTIAEEMEDPCLKKLVEKIGYDEGLPVVVHPGVLDPKEFLREVIEIRFPNPYM
FT                   PDTPQRIATDTSQKMAIRFGETIKSYEQREDLNVTDLKYIPLVIAGWCRYLMGVDDEGR
FT                   PMTLSPDPLLEDLKSHVSNIKLGDIESVKDNLRPVLSNKHIFGLNLYEVGLGEKIENYF
FT                   KELIAGPGAVRKTLRKYLECE"
FT   gene            247177..248124
FT                   /locus_tag="Tmath_0240"
FT   CDS_pept        247177..248124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0240"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: tpd:Teth39_1972
FT                   ribokinase-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60024"
FT                   /db_xref="GOA:D7ARB5"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARB5"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADH60024.1"
FT                   /translation="MPTVVTLGEAMVVFTAEEYIPLEYATSFKKGLGGAEANFAIGVRR
FT                   LGFDVGWISRVGKDPFGNFIIKNLKSEGVDVSGVKIDEDHPTGIYFKEKRNSIITNVYY
FT                   YRKGSAASFMVPEDLDEGYIASAKILHITGITPALSDTCRATVYKAIEIAKSHNITISF
FT                   DPNIRLKLWKDNEYKKVLLDIAQYADIVLPGLEEGKMLFGITEPESIAKKFLDMGAKIV
FT                   ALKLGDKGAMLVTQEQTIYQSSSKVKEVDPVGAGDGFDAGFIVGLLRGWELKECLRLAN
FT                   DVGAIVVSTKGDMEGLPTMEEVEIFRGNMVHIER"
FT   gene            248159..249232
FT                   /locus_tag="Tmath_0241"
FT   CDS_pept        248159..249232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0241"
FT                   /product="mannonate dehydratase"
FT                   /EC_number="4.2.1.8"
FT                   /note="TIGRFAM: mannonate dehydratase; KEGG: ate:Athe_0856
FT                   mannonate dehydratase; PFAM: Mannonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60025"
FT                   /db_xref="GOA:D7ARB6"
FT                   /db_xref="InterPro:IPR004628"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARB6"
FT                   /inference="protein motif:TFAM:TIGR00695"
FT                   /protein_id="ADH60025.1"
FT                   /translation="MKMVFRWFGENDDSVTLEQIRQIPGVTGVVGALFDIPVGEVWPLE
FT                   RILDLKRKVEAFGLELEVIESVNVHEDIKLGLPSRDRYIENYKETIKNLGLAGIKVLCY
FT                   NFMPVFDWIRTDLSKKLTDGSEVMAYDDRIIKDLDPIKLVQEMESGSRGYSLPGWEPYR
FT                   LKELKRLFELYQDMDEEKLFDNLKYFLENVIPVCEKYDVKMAIHPDDPPWSAFGLPRIV
FT                   TNKENLEKIINLVDSPYNGLTLCSGSLGANPENNIPELIRYFGKKGRIHFAHVRNIKIV
FT                   SERAFHETSHLSSDGSFDMFKIMKAYYDIGFDGYMRPDHGRMIWGEKARPGYGLYDRAL
FT                   GIAYLNGLWEAINKMRG"
FT   gene            249441..250409
FT                   /locus_tag="Tmath_0242"
FT   CDS_pept        249441..250409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0242"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcl:ABC0556 sugar ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60026"
FT                   /db_xref="GOA:D7ARB7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARB7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH60026.1"
FT                   /translation="MNVEVTNKEFIELPSMNEKSNFKKTLKAIRKDWQLYSLLILPLAH
FT                   YLIFRYIPMYGNIIAFRKYYPGGPVYGSEWVGLRYFKMFLTDPTFWKVLKNTIILNVEY
FT                   LVISFPFPIIFALLLNELRNQLFKRFVQTVSYLPHFISVVIVAGMIMELLSPSTGVVNI
FT                   ILKHFTGKTINFLAEAAWFRTIYIVSGIWQGMGWGAIIYLAALSNINPELYEAAIIDGA
FT                   NKWQQIRYITIPGIMPTIMILLILNIGNLMNSAFEKILLLYNPLTYETADVISTYLYRM
FT                   GLEMNNFSYAAAIGMFESIIGLILLGTANYISKRLTETSLW"
FT   gene            250423..251295
FT                   /locus_tag="Tmath_0243"
FT   CDS_pept        250423..251295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0243"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcl:ABC0557 sugar ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60027"
FT                   /db_xref="GOA:D7ARB8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARB8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH60027.1"
FT                   /translation="MKVSRGEKIFNIMNIIIMIIVIIATLYPFLYLTAISFSSEKYVYA
FT                   GEITLLPKGFTMKTYQVLLSEKLFWISYKNTIVYTLVGTFISLFLSTLLAYPLSKKHLK
FT                   GRGIILGLVVFTMFFSGGLIPTYLLVNALGMRNTIWAVVIPGAINTYYVIVMKTFFEGL
FT                   PVELEEAAAIDGMNTYGILLHIVLPLSMPMMAAMTLFYAVGMWNNWFGPFIYLDKRELF
FT                   PAALYLRNIIAGAQQTAVSSGSNIGDLEQIEATVKSAAMILTALPIIMVYPFLQKYFVK
FT                   GVMIGSLKG"
FT   gene            251403..253058
FT                   /locus_tag="Tmath_0244"
FT   CDS_pept        251403..253058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0244"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bcl:ABC0558 sugar ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60028"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARB9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH60028.1"
FT                   /translation="MSRKFKILIVTILVLSLLTTLFAGCSSKNSSETQQKETQQAAQNT
FT                   NSSDPENKHFYSEKPLEFTMLYSEHPAYPYKEDWLLWKAIKDMTNVSLKLTVVPMSDYD
FT                   QKRSLLISTGEAPEIIPKTYPGQEVPFIPSGAILPISDYIDEMPNFSRQIKEWNLQDDL
FT                   NTLKQKDGKFYVLPGLHEIFVQDYSLAIRLDIFEKNNIPVPNSWDELYDALKKLKEIYP
FT                   NIIPFSDRWQGKSLLNVAAPTFGVQAGWGAGNGMYYYRDKDEFGFYPITDDYKNMLSYF
FT                   NKLVKEGLMDPESFTQNDDQAIQKFVTGKSFVISTNSQELVNLRNKMKETMGEDAFKVV
FT                   KILPPAGPKGAVVAGGRLENGIMISKNALKNPNFHEMLKFIDWLWYSEEGQTLTKWGVE
FT                   GVTYKKVDGKFELMPDVTAGFLGLNPNGTKDLRKDFGFGNGVFILMYGGPKELAYSYMS
FT                   DEDRKFAEELDKTRELLPPAPPVLFDEVQREQANMISQPLMDYVEQMTLKFILGQASLE
FT                   KDWDNYVQQCRAKGADKLTQLTNEVYKSTKDMLK"
FT   sig_peptide     251403..251489
FT                   /locus_tag="Tmath_0244"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.916) with cleavage site probability 0.404 at
FT                   residue 29"
FT   gene            253205..253304
FT                   /pseudo
FT                   /locus_tag="Tmath_0245"
FT   gene            253380..256865
FT                   /locus_tag="Tmath_0246"
FT   CDS_pept        253380..256865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0246"
FT                   /product="glycoside hydrolase family 2 sugar binding
FT                   protein"
FT                   /note="PFAM: glycoside hydrolase family 2 sugar binding;
FT                   glycoside hydrolase family 2 immunoglobulin domain protein
FT                   beta-sandwich; glycoside hydrolase family 2 TIM barrel;
FT                   KEGG: gym:GYMC10_2667 glycoside hydrolase family 2 sugar
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60029"
FT                   /db_xref="GOA:D7ARC0"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR032311"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="InterPro:IPR040605"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARC0"
FT                   /inference="protein motif:PFAM:PF02837"
FT                   /protein_id="ADH60029.1"
FT                   /translation="MAAAAKDLGGGCRKMNKKILFNDGWEFAKSSLEADSTTLKFEPID
FT                   IPHDWLIYNTLNLYENSIGWYRKKFTCAKEEGKQILLCFDGVYMDSSIYVNKQFVGEWK
FT                   YGYSSFEYNITDSLVDGENEILVKVVYQNPNSRWYTGAGIYRNVWLKIRDENQHIVTNG
FT                   IYVTTKQEDDRWLVEIDTELVSYEDSLLTHTITYEGQVFAASKSVVKASNYVTHNVQTI
FT                   FVKNPLLWSPEEPNLYKLITELYLVKSDKDSKESIEKIEYIAQNIGFRKIILDPQQGLL
FT                   VNGRKMKLKGVCEHHDLGALGAAFNKTALKRRFKILKEMGVNAIRTAHNMPAPEFMDLA
FT                   DEMGFFVVSEAFDVWEIPKTRYDYSRFFKNWAHIDVRSWVMRDRNHPSLLMWSIGNEIY
FT                   DTHANERGQELTKMLVDLVRKYDPKENGKVTIASNYMPWENAQKCADIVKVVGYNYGEK
FT                   YYKRHHEEHHDWVIYGSETGAVVQSRGIYHFPREKSILADDDEQCSALGNSPTSWGAKS
FT                   AESCILAERDTPFSLGQFIWTGFDYIGEPTPYHTKNSYFGQIDTATFKKDSYYIYQAAW
FT                   TDYKTKPMVHIIPSYWDFNKGQMIDVGVCSNAPKIELQLNGITIGTHEFDHEHGTQLVA
FT                   WWKIPYEKGELKAIAYDETGKIIATDVRKSFKDARKIRLHADKESLIANGTDLIFVEIT
FT                   VEDENGNIVENANNRIHVNVTGAGRLIGLDNGDSTDYDQYKGLSRRLFNGKLMAIIGST
FT                   LEPGKIYMEVTSKGLEGQTAEFEALPAKGENLEGISALMKNRDMPCVMGSNDEIPVRKI
FT                   EIISTSGQELNELKREILVRAKLYPENTTYREVEWSVVTDGGFPSNIAKVEAFGHEAKI
FT                   IALSDGKFRVRCTSKNGTEKTKLISELEFKAVGFGKAYKDPYEFIYAGLYDYSKGEVTS
FT                   GNEKGIATSRDGETQVGFRNIDFGTYGSDTITISIFALTREEYPIQIWEGMPDEEGSTL
FT                   LAEVIYQKPVKWNVYQEETYRLPKRLRGVTSICFVLHQKVHIKGFYFKKKYRPFELNKA
FT                   SECDHIYGDMFSIKGDSVEGIGNNVSLVFEDMDFTNEGATKIVVYGRSPIEKNTILIRF
FT                   TSPNSESEQIIEFTKSDKYEERIFELEKITGKQKVTFIFLPGSNFDFGWFRFER"
FT   gene            257019..258044
FT                   /locus_tag="Tmath_0247"
FT   CDS_pept        257019..258044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0247"
FT                   /product="Endo-1,4-beta-xylanase"
FT                   /EC_number="3.2.1.8"
FT                   /note="PFAM: glycoside hydrolase family 10; KEGG:
FT                   csc:Csac_2408 endo-1,4-beta-xylanase; SMART: glycoside
FT                   hydrolase family 10"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60030"
FT                   /db_xref="GOA:D7ARC1"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031158"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARC1"
FT                   /inference="protein motif:PRIAM:3.2.1.8"
FT                   /protein_id="ADH60030.1"
FT                   /translation="MFIENKNGINGTISLKEVYKDYFLIGAAVEVEDLEDGLHRQLLLK
FT                   HFNSLTAENAMKFERIHPKEDEFNFKDADKIVEFAMENNLKVRGHTFVWHNQTPEWVFK
FT                   DKTGNEVSKELLLERLKFHINTVCNHYKNKIYAWDVVNEAIEDKEDYVLRKSPWYRIIG
FT                   KEYVELAFKFVREADPEVELYYNDYNNEKPYKLYKTYDFLKSLLDKGIPIDGIGIQGHW
FT                   DIYDEGLFDNLKRAIELYASLGLKIQITELDISMFEFENKTREVLIPTAEMLELQALTY
FT                   KKLFEIFRSYKGIITSVTFWGISDKHTWKDNFPVKGRKDWPLLFDEKQNPKKAFFEIVD
FT                   F"
FT   gene            258084..260156
FT                   /locus_tag="Tmath_0248"
FT   CDS_pept        258084..260156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0248"
FT                   /product="Alpha-glucuronidase"
FT                   /EC_number="3.2.1.139"
FT                   /note="KEGG: gtn:GTNG_1770 alpha-glucuronidase; PFAM:
FT                   Glycosyl hydrolase 67 middle domain protein; glycosyl
FT                   hydrolase 67 C-teriminal domain protein; glycoside
FT                   hydrolase family 67"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60031"
FT                   /db_xref="GOA:D7ARC2"
FT                   /db_xref="InterPro:IPR005154"
FT                   /db_xref="InterPro:IPR011099"
FT                   /db_xref="InterPro:IPR011100"
FT                   /db_xref="InterPro:IPR011395"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="InterPro:IPR037054"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARC2"
FT                   /inference="protein motif:PRIAM:3.2.1.139"
FT                   /protein_id="ADH60031.1"
FT                   /translation="MLKISDIDKKSKVYNCWLNYENCSVGEYQDFCNYIKVKSTHPIIN
FT                   TAIEELKFGLNKLMKKEPLILNYSPKSSYIFVGTLEDLKNEKLDVQIRNEILKEDGFAV
FT                   KIIKEGDTDVLAIIGQNEKGVLYGVFYLLMAICSSNSLNEIEIEDGPYNLLRIINHWDN
FT                   LNGEIERGYAGQSVFFKDNKVVEDLSRVKDYARLLASVGINGVVLNNVNVHKYETELIT
FT                   DKFLPDVSRIADVFRLYGIKIYLSINFAAPVEIGGLPTADPLDERVKKWWKEIVENIYR
FT                   YIPDFGGFLVKADSEFRPGPFTYGRNHAEGANMLAEALKPHGGLVFWRAFVYNCMVDWR
FT                   DRTQDRAKAAYENFKPLDGQFMDNVVLQIKYGPMDFQIREPVSPLFGAMEKTNVALELQ
FT                   ITQEYTGQQKDLCYLPTMWKEILDFDTYAKGKGSTVAKVVNGSLFGMKYGGIVGVSNIG
FT                   DSKSWTGHPLAQANLYGFGRLAWNPELSPKEIAEEWTKLTFGHDEQVINTIVSMLMASR
FT                   DIYEKYTAPLGVGWMVNPGHHYGPNLEGYEYSHWGTYHYADYKGIGVDRTVATGTGYTA
FT                   QYKEPIASMYENIETCPDELLLFFHHVPYTHKLKSGKTVIQHIYDTHFEGAEEAKGLKE
FT                   KWLTLRGKIDEEIFEMVLERLEMQIKNAIEWRDVVNTYFYRKTGIRDVHNRKIYE"
FT   gene            260211..262256
FT                   /locus_tag="Tmath_0249"
FT   CDS_pept        260211..262256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0249"
FT                   /product="Xylan 1,4-beta-xylosidase"
FT                   /EC_number="3.2.1.37"
FT                   /note="KEGG: dge:Dgeo_2690 glycoside hydrolase family
FT                   protein; PFAM: glycoside hydrolase family 52"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60032"
FT                   /db_xref="GOA:D7ARC3"
FT                   /db_xref="InterPro:IPR000852"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARC3"
FT                   /inference="protein motif:PRIAM:3.2.1.37"
FT                   /protein_id="ADH60032.1"
FT                   /translation="MESISFYAHHSAFGAFSSFIVGKLGKGGGVVLNDVHPPNNNVYVG
FT                   YKQGKKIKLLPFLKVNSIKPEEAFTGEKVKNNAKYDIEFFSEKEIDREMGWASDTWLTD
FT                   KFKFSIITPFGYVKFPESMEEEEKKLAFAPVIFIQLTMDNRQSKLDAEMMFGLEGTKRL
FT                   LSDTMDSKYLGIAFDRKYGFATWNSEDVKEYLRLGLLDSWANDIYQNHRLGKEGALLFK
FT                   VPAGEMRTYTIALATYQDGIITTGIETEFYYTTLFKSLEDVLEFGLKNANYYLDMAEQR
FT                   DKELRESGLNEYRQFLIAYATHAYYANSQLMTRKDGVPLWIVNEGEYLMINTFDLTIDH
FT                   LFWELKFHPWTIKNTLDLYVEKYSYFDQAGRSFTHDMGVANNFSPQGYSSYELPNLHGV
FT                   FSYMTHEELLNWIITGAVYAFKTNDKEWLEQNLNVFVDCFNSLVARDKNNDGIMDVDTS
FT                   RCENGSEITTYDSLDVSLGQARNNLYLGVKTWAAYVLLNKIFKEYNLDDYADASLKKAQ
FT                   QAASTIVSKFDEQNRYIPAVFEQGNTSRIIPAIEALIYPYYIGDVDTVSETGPFKELII
FT                   ALKHHIVTVLKPGCCIDPISGGWKLSSTSKNTWNSKIFLSQHIVKKILGLDFGDKEIEW
FT                   DRVHTRWQQISCSEEGPVDQVNSDNGTARGSRLYPRLVTSILWMEE"
FT   gene            262313..263269
FT                   /locus_tag="Tmath_0250"
FT   CDS_pept        262313..263269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0250"
FT                   /product="Cephalosporin-C deacetylase"
FT                   /EC_number="3.1.1.41"
FT                   /note="KEGG: cce:Ccel_0210 acetyl xylan esterase; PFAM:
FT                   Acetyl xylan esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60033"
FT                   /db_xref="GOA:D7ARC4"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR039069"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARC4"
FT                   /inference="protein motif:PRIAM:3.1.1.41"
FT                   /protein_id="ADH60033.1"
FT                   /translation="MPFYDMPLEELKKYMGKNPCPPDIDEYWDNAIKEAEKIDLNIELK
FT                   KIDYPDNSVEAYDLYFTSTNNARIYALYVKPKKASKEKSPCILEFHGYGMNSKTIDTKL
FT                   KWANAGFHVLSMDCRGQGGKSTDPGGVIGNTLRGHIIRGIEDRDTLMFKHIFIDTYLLS
FT                   KIAESFEDIDKDNIMTTGASQGGGLALACAALNPNIKKVAACYPFLCDYKRAWELNCDS
FT                   AYTEIREWFRLFDPLHEREEEIFTRLGYIDLQHLGKRIKGKVLVSVGLEDHICPPSTIF
FT                   AMYNKLNTDKQMLIYPDYGHEYIPDWDDKAFRFLVNK"
FT   gene            263405..267772
FT                   /locus_tag="Tmath_0251"
FT   CDS_pept        263405..267772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0251"
FT                   /product="Cellulose 1,4-beta-cellobiosidase"
FT                   /EC_number="3.2.1.91"
FT                   /note="PFAM: glycoside hydrolase family 10;
FT                   Carbohydrate-binding family 9; Carbohydrate-binding CenC
FT                   domain protein; S-layer domain protein; KEGG:
FT                   pjd:Pjdr2_4255 endo-1,4-beta-xylanase; SMART: glycoside
FT                   hydrolase family 10"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60034"
FT                   /db_xref="GOA:D7ARC5"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010502"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="InterPro:IPR031158"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARC5"
FT                   /inference="protein motif:PRIAM:3.2.1.91"
FT                   /protein_id="ADH60034.1"
FT                   /translation="MSQKKKALKILSLIVVFAMICGIIGDYPIKVLAGGNSSINLVANG
FT                   DFENGTLDEWTKHGDPTLEVTTEQAIGNYSMKVAGRTNSYEGPAYSFLGKMENGATYNV
FT                   SLKVRVVDGQIAAGHHDPKITVTMRRVYTPSVEGDTGSYYDTIVWQKPVSEDAWATLTG
FT                   SYTLTYNGTLKELFMYIESPDPTLEYYIDDVIVTPVNTPQVGNIIENGTFESGDTTGWV
FT                   GTGQAVISAVKEEAHSGNYSLETAGRTADWMGPSYNLTGKIVPGKQYSVDFWVKYNNGN
FT                   DTEQFKATVKATPTTGSPQYIQVNNPVSVKKGEWTEIKGSFTVPDGDYSSISIYVETPG
FT                   STIDFYIDDFEVIGEIAAAPIKIQEDIPDLYSVFLDCFPIGVAVEPGRLVNTDPHSQLT
FT                   AKHFNMLVAENAMKPESLQPQEGIFTFSNADKIVDFAIAHNMKMRGHTLLWHNQVPDWF
FT                   FQDPSDPTKTAPRELLLERLKTHIFTVLGHFKEKYGSNNPIIAWDVVNEVLDDNGQLRN
FT                   SKWLQIIGPDYIEKAFEYAHEADPNVKLFINDYNIENNGAKTQAMYELVKSLKEKGVPI
FT                   DGIGMQMHININSNVESIKASIEKFKSLGVEIHITELDMNMLGDVSQDALLKQARLYKQ
FT                   IFDLLKQEKDHITAVVFWGVSDDVTWLKQPNAPLLFDTKLQAKPAYWAIVDPSKVAVDR
FT                   QVISVSQGSPVIGTNIDKIWSTEKWFYANNFVKNLNGATAKFKLLWDAKNLYVLVQVDD
FT                   TTPSKNDSIEIFVDKNQGSMSQTEIKHYTIRRDNSGNTDILNYVQEETNGYVVQMAIPI
FT                   DDLNPQIGTKIGFDIKVNDDKGGGQIDNIAVWNDYSNSGKTEYYGLLLLSKTSQITEAV
FT                   YGTPIIDGKIDDIWDKANTIYTNVWVQGTSGPTAKARTMWDENYLYVLAEVTGAKLNKS
FT                   SPNPWEQDSVEFFVDENNYKSPYYQSGIGQYRVNFDNEQSFGDSTNSEGFKSATSITSS
FT                   SSYIVEVAIPFKTIKPTDGHILGFDVQVNGADESGNRTSIVLWNDPSGNSWKDASGFGN
FT                   LILVDTRLILPTPRPQPAPTPTEPTEASHEVSQGKVVVENNTTIMVVDETKISKDIKDT
FT                   SKKEMQFDLTNIGKTDAKALEIPVSVINLVVENNKNITIKLNDVTLKFDPNSLVVSKNT
FT                   IDLINQVGAVRLTIQEKGRQTPPPLTPVSNAYDVKIKAGDKEIKVDSPVKVTFEIKDAK
FT                   DIRKVGVYYLNETTGKWEYVGGKIDKKTNTVTAEVIHFSTYGAFEYDKQFKDVSKDFWA
FT                   YDVVNVLASRHIIRGVDDDTFAPNAKITRAEFAAFMIRALGIPEEPYKGEFEDVKEGAW
FT                   YANAIEAAYRAGIMLGDGKNMRPKAPITREEMTAVIMRVYSKLTGYKEENIGNTTFTDN
FT                   GKISEWARNAVANVMKLGIVRGYEDNTFKPKDNATRAEAAAMLYRVLEISSTI"
FT   gene            267919..268623
FT                   /locus_tag="Tmath_0252"
FT   CDS_pept        267919..268623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0252"
FT                   /product="protein of unknown function DUF624"
FT                   /note="PFAM: protein of unknown function DUF624; KEGG:
FT                   csc:Csac_1811 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60035"
FT                   /db_xref="GOA:D7ARC6"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARC6"
FT                   /inference="protein motif:PFAM:PF04854"
FT                   /protein_id="ADH60035.1"
FT                   /translation="MFGNFFNQMYFGNPRKPDLKPEDIPKKGIPLFIDIFCSNFWQLIS
FT                   LNLLLIIFSIPIITIGPAFAGFNHVLRNYVFRKNVWLWNDFKDGAFKNLKQSLIITLIN
FT                   MLVAFVLINNYKIYSIMNNDFIKKSGIIITGLIGLMYLLMNIYIFPMMVTYDLKTKHIF
FT                   KNAFIFSVIEFPRTLGILLICLFVLFVSIILAFIPLVLISFSLMGLIINVFDRMIFEKY
FT                   IDNKNQVTGNDN"
FT   gene            268812..268989
FT                   /pseudo
FT                   /locus_tag="Tmath_0253"
FT   gene            269128..270549
FT                   /locus_tag="Tmath_0254"
FT   CDS_pept        269128..270549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0254"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: tpd:Teth39_2058 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60036"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARC7"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH60036.1"
FT                   /translation="MITIVIMVVGLLSGCGQNSQTGQSESTQPKEKVLKIWSFTNEAKV
FT                   FATAFKEKHPDVKIEFTMIPMTEGEYQLKLKSALQSGEGPDVVALESDFVREFVESDYL
FT                   VDLSDLLPFAEEVKTYQFTIDIGTDENGVVKAFSYQATPGLMYYRRSLAKEYFGTDDPV
FT                   KIQELVADLSKFEEAAKIVKEKSNGNTYMIASTADLGRVIIENRDKPWIVDSKLVIDPK
FT                   VEELFDIAKNFRQNGYEAQATQWQESWFAGMNDSLVDAKGNPKQIFAYFLPTWGLSYVL
FT                   QPNSAPAKGESDGGKTAGKDTSGDWAAIPGPMPYRWGGTWFGVTKDSENVELAKEFIKF
FT                   VTLNEETLKNWALGVYTNEYLKKIDPSVGDELQQPAGDFVSSQKVVEEIASQFGDTSAA
FT                   KFLGGQNPYEVFAEAARRIDLGGRTKNIQATDFVVQDALWDPLDAYASGEISKDEALKR
FT                   FKEAVKNALPDVDVD"
FT   gene            270627..271553
FT                   /locus_tag="Tmath_0255"
FT   CDS_pept        270627..271553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0255"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tpd:Teth39_2057
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60037"
FT                   /db_xref="GOA:D7ARC8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARC8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH60037.1"
FT                   /translation="MVLVESGIKVRKSNSKINKNYYGYIFTAPFIIVFLLFSFYPLIYT
FT                   FYLSLTDMTIMSKTYNFVGLNNFKQLFSDDFFIKSVLNTWKIWLMNFIPQLGIAMLLAV
FT                   WFMNNRLKIKFVGFWRTVYYLPNLLMPVAIAALFYNLFSRYGPVNQIAVRAGILEEAFD
FT                   FFRSPGWTQSIVAFIQWWMWFGVTILYLMAGMSSISPSYYEAALVDGASSWDMFTKITL
FT                   PLLKPVLIYVLVTSLAGGMQMFDIPYLLTDGRGSPNGSIMTMSVLMYMKFSSGKGFIGA
FT                   GASVAVMIFIITAISASIIIRLLREKE"
FT   gene            271582..272424
FT                   /locus_tag="Tmath_0256"
FT   CDS_pept        271582..272424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0256"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tpd:Teth39_2056
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60038"
FT                   /db_xref="GOA:D7ARC9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARC9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH60038.1"
FT                   /translation="MSYTIKTKLTKTFIYIFLVILFLITIVPVWILLINATRSTPEIQQ
FT                   GVSLLPSNNLLNNWKYLTGKGANIWRGFINSALISIPATLLTVYFSMMTAYAIQVYDFA
FT                   YKKILYNIIILLTIIPTQMASIIGFYKYMSMLNLLNSYIPLIIPAIAAPPMVFFASQYL
FT                   ESTLVKDLIESARIEGASEIGIFHRIILPIAKPGAFTMGILSFVASWNNFFTPFMLISK
FT                   VEKYTLPMMVKLLRGDMYRTEYGAIYLGLAITVIPIIIVYAMFSKYIISGISLGSVKD"
FT   gene            272448..274811
FT                   /locus_tag="Tmath_0257"
FT   CDS_pept        272448..274811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0257"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: tpd:Teth39_2055 glycoside hydrolase family 3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60039"
FT                   /db_xref="GOA:D7ARD0"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARD0"
FT                   /inference="protein motif:PFAM:PF01915"
FT                   /protein_id="ADH60039.1"
FT                   /translation="MMKASYLDPKQPVEKKVENLLAQMTIEEKIAQLSGIWVYEILDDM
FT                   MKFSYKKANRLMTHGIGQITRLGGASNLSPQETVKIANQIQKYLVENTRLGIPALIHEE
FT                   SCSGYMAKGATIFPQTIGVASTWNPKLVEKMASVIREQMKAVGARQALAPLLDVTRDPR
FT                   WGRTEETFGEDPYLVMHMGVSYIRGLQTENLKEGVIATGKHFVGYGNSEGGMNWAPAHI
FT                   PMRELYEIFLYPFEAAVKEAKLGSIMPGYHELDGIPCHKSKQLLTDILRKNWGFDGIVV
FT                   SDYFAINQLYEYHRLASNKKEAAKLALEAGVDVELPSTDCYGLPIKELIEQGDIDIDFV
FT                   NDAVRRILKAKFLLGLFENPYVDEKRVVEIFDTQEQRQLAYKIAQESIVLLKNESNLLP
FT                   LKKDLQSIAVIGPNADNIRNMIGDYAYPCHIESLLEMREKDNVFNTPLPEGLEAKDIYV
FT                   PIVSVLQGIKEKVSPKTKVIYAKGCDVISDDTAGFNKAVEIAKQADVAIVVVGDRAGLT
FT                   DGCTSGESRDRADLNLPGVQEQLVKAIYETGTPVVVVLINGRPMSISRLAEKIPAIIEA
FT                   WLPGEEGGRAIADVIFGDYNPGGKLPISIPCSVGQLPVYYYHKPSGGRTNWKGDYVESS
FT                   TKPLYPFGYGLSYTEFLYSNLNISNPKVSTQEGIIEISVDVKNIGKVKGDEVVQLYIHR
FT                   EFLSVTRPVKELKGFKRITLDVGEQKTVIFQLSSEQLGFYNEEMEYVVEPGRVEVMIGS
FT                   SSEDIRLFGSFEIVGEVKKTDKKFMTQVRVENKL"
FT   gene            274924..276126
FT                   /locus_tag="Tmath_0258"
FT   CDS_pept        274924..276126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0258"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: tex:Teth514_0159 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60040"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARD1"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADH60040.1"
FT                   /translation="MITADQLLVKQINKSIVLNTIRKKGNVSRADIAHITGLNKSTVSF
FT                   LVDELINEGFVREEGPGESKGGRKPIILSINNKAGCIIGIDLDVNYILIVLTDLMANVI
FT                   WEKKVDVKIGESQQAIIKRLIELIDEAILNAPETIRGILGIGIGVPGIVDYKKGTVLMA
FT                   PNLKWENVPLKQIIENKFKIKVHIDNEANVGAIGEKWFGAGIKYNNLVYVSAGIGIGTG
FT                   IIINGELYRGTVGLAGEMGHMTINILDHQCSCGNTGCWENYASEKALFDYIHTQLIMGK
FT                   SDNYINKDNFNTLSALDIINYAQKGSEIAVEALKEIGRKLGVGIVNVINTFNPELVIIG
FT                   NTLSLARGLILDEILKEVEKKCLVYRYHKVKIKTSKLQFHAGAIGAVSLVISELFAYPG
FT                   L"
FT   gene            complement(276228..276803)
FT                   /locus_tag="Tmath_0259"
FT   CDS_pept        complement(276228..276803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0259"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   tpd:Teth39_2031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60041"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARD2"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ADH60041.1"
FT                   /translation="MPLPKREDIYTYEDYLNWPNNQRIELINGQIYLMTPPSTVHQRIS
FT                   REIFTSFAVYLRGKQCEVFSAPFGVRFPSGNEKSDKEIKTVVEPDIVVVCDKSKLDDEG
FT                   CKGAPDLIVEITSPSTASRDKIEKFNLYEKHGIKEYWIVEPDDKVVSVFILQENSRYGR
FT                   PDVYTVGNKIKVSIFEDLEIDLKDVFAY"
FT   gene            277035..278045
FT                   /locus_tag="Tmath_0260"
FT   CDS_pept        277035..278045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0260"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: tex:Teth514_0161 periplasmic binding
FT                   protein/LacI transcriptional regulator; PFAM: periplasmic
FT                   binding protein/LacI transcriptional regulator; regulatory
FT                   protein LacI; SMART: regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60042"
FT                   /db_xref="GOA:D7ARD3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARD3"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADH60042.1"
FT                   /translation="MAVTIKDIAKLANVSITTVSRVINNKSEGVSEETRNRILQLVKEL
FT                   GYQPNAIARGLVTKKTKTIGLIIPDISNPFFPDLARGVEDSAHIYGYNVFLCNTDDNLE
FT                   KESEYINALKEKYVDGIIFTSSSIPKHEHIMELVKSGIPIVIMDRRVDSEDIYGVFLDN
FT                   YEGGYIATKHLIDLGHKKIACITGPLYTKSAKERLEGYKKALIENGMDVDERLIFEGDY
FT                   KINSGIIGTEKLLGNNENVTAIFACNDLMAYGAYKTIRSYGYKIPDDISIVGFDDIQLS
FT                   QILEPQLTTIKQPAYDMGLTAARMLIKLVEGKKLKKKIINFKPQLIIRQSTKNIG"
FT   gene            278059..278988
FT                   /locus_tag="Tmath_0261"
FT   CDS_pept        278059..278988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0261"
FT                   /product="ribokinase"
FT                   /note="KEGG: tpd:Teth39_2042 ribokinase; TIGRFAM:
FT                   ribokinase; PFAM: PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60043"
FT                   /db_xref="GOA:D7ARD4"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARD4"
FT                   /inference="protein motif:TFAM:TIGR02152"
FT                   /protein_id="ADH60043.1"
FT                   /translation="MEKIVVVGSINMDVVIRVPHIPVVGETVIAYDLKNYGGGKGANQA
FT                   VSIARLGGTVFMIGRVGNDEYGKKLYEGLKIDSIDVKGIEFDYEIPTGTAYINVSERGE
FT                   NNIVVYQGANKRLNIEQIEKHEDIFDEAKMCVIQLEIPVETVEFVVDLCYRKGIKVILN
FT                   PAPACKLPDTLLEKVYILTPNETELAFLSKSKIETIADIKKASKYLLDKGVQNVITTIG
FT                   EKGSFFINKDTEKLFDAIKVTAVDTTAAGDSFTGALAVALSEGKNIESAIEFATYVAAL
FT                   TVTKEGAQSSLPYRDEVEKFIKERSYNK"
FT   gene            278985..279377
FT                   /locus_tag="Tmath_0262"
FT   CDS_pept        278985..279377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0262"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport; KEGG: tpd:Teth39_2041
FT                   D-ribose pyranase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60044"
FT                   /db_xref="GOA:D7ARD5"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARD5"
FT                   /inference="protein motif:PFAM:PF05025"
FT                   /protein_id="ADH60044.1"
FT                   /translation="MKKTYLLNSEISEVVARLGHTDLLVIADSGLPIPDGVKRIDIALT
FT                   KGIPSFKDTLNTVLTELGVEKAYIAKEMIDKNNDLYLYLLELFGEKLIIISHEDLKAMS
FT                   KNAKAIIRTGEYKPYANIILESGVEF"
FT   gene            279400..280890
FT                   /locus_tag="Tmath_0263"
FT   CDS_pept        279400..280890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0263"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_2040 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60045"
FT                   /db_xref="GOA:D7ARD6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARD6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH60045.1"
FT                   /translation="MEPVLEMRNITKKFGNVKVLDNVSLTLYKGHVLALLGENGAGKST
FT                   LMKILCGIYEKDEGSIYIKGKEVNIRNVKDAEKYGIVMIHQELNLIPSLSVAENIFLGR
FT                   EYLKSFNAIDWKKIKQEAAKKLSELGMNINVNRLVKYLSVGEQQMVEIARSLLMDAEIL
FT                   VMDEPTAALTEAETKKLFEVIRSLKSEGRTIIYISHRMNEIFEICDDYIVLRDGRFISQ
FT                   GKINEVTRDELVTMMVGRELKEQYPRESVPLGEEILRVENLSVKGLFENINFTVRKGEV
FT                   VGFAGLIGAGRTEVAKTIFGFYKKTSGKIYLENEELKINNPKDAIDNGIIYLSEDRKND
FT                   GLILKHTLKENMTLSALKSISDYIGTIYHSKEKYLVNQMIEKLNIKTSSINQKISKLSG
FT                   GNQQKIAIAKCLLTNPKLIILDEPTRGIDVGAKNEIYKLINNLKKQGIGIILISSELPE
FT                   VLNISDRIIVMHEGRITGEILHEEATEEKVMLKAVGGE"
FT   gene            280892..281848
FT                   /locus_tag="Tmath_0264"
FT   CDS_pept        280892..281848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0264"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   tpd:Teth39_2039 monosaccharide-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60046"
FT                   /db_xref="GOA:D7ARD7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARD7"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADH60046.1"
FT                   /translation="MNLPGEKVTKINISEFLLKAKSLIGLVGLIVVFSILSPRFLDYYN
FT                   LTNVLRQTSLNAIMAVGMTFVILTGGIDLSVGSILAFSSAITAGMLKDGSPLIIAVLAG
FT                   LIIGTGLGFFNGFVIIRWNIPPFIATFAMMTVARGLTLVYTNGQPITGLGAAFGYIGNG
FT                   YIGPIPVPIILTVLIFAIGYYILKNNRLGRYVYATGGNIQAAKLAGINTNNIILFVYSL
FT                   SGFLAAISGLIITSRLNSAAPTAGQGAELDAIAAVVLGGTSLSGGEGGVIGTLIGALII
FT                   GILNNGLNLLNVSPFYQLIAKGAVILLAIALDKKESR"
FT   gene            281930..282853
FT                   /locus_tag="Tmath_0265"
FT   CDS_pept        281930..282853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0265"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: tpd:Teth39_2038
FT                   monosaccharide-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60047"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARD8"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADH60047.1"
FT                   /translation="MRKSKILFLLLTFILTVALIAGCSTGNTTNTSNAKGEKTIGLVIS
FT                   TLNNPFFVTLKDGAETKAKELGYKLIVADSQNDSSKELSNVEDLIQQKVDVLLINPVDS
FT                   DAVVNAIKEANSKNIPVITLDRSANGGDVICHIASDNVKGGEMAAEFIAKALHGKGNVV
FT                   ELEGIPGTSAARDRGKGFDEAIAKYPDIKIIAKQAADFDRSKGLSVMENILQAQPKIDA
FT                   VFAQNDEMALGAIKAIESANRQGILVVGFDGTDDALKAIKDGKMAATIAQQPALIGSLG
FT                   VEMADKYLKGEKVEKFIPAELKLITK"
FT   sig_peptide     281930..282010
FT                   /locus_tag="Tmath_0265"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.749 at
FT                   residue 27"
FT   gene            283008..283856
FT                   /locus_tag="Tmath_0266"
FT   CDS_pept        283008..283856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0266"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: tte:TTE0211 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60048"
FT                   /db_xref="GOA:D7ARD9"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARD9"
FT                   /inference="protein motif:PFAM:PF01418"
FT                   /protein_id="ADH60048.1"
FT                   /translation="MTDILTVIKELEATFKPSEAKIAKYILDNADVVTELSINELARAC
FT                   DTSEASIVRFCRTIGLKGFQELKIKIAVSLSKQTKKLDGGITDDDDVSDVIQKIANFNK
FT                   QAIDNTISLLDVKSIIKAVDALSNANKIDFYGVAASGTVAYDAMLKFARINIPCTAYQD
FT                   THLQLTSAANLKKGDVAFGISYSGCTREIVEALEVAKEAGATTISLTKFGQFPLVKVAD
FT                   INLFVSSEEPLFRSGATASRIAQLTVIDILFILVAKRKYNDVVKFLENTTEALSIRKIY
FT                   K"
FT   gene            283891..284799
FT                   /locus_tag="Tmath_0267"
FT   CDS_pept        283891..284799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0267"
FT                   /product="glucokinase regulatory-like protein"
FT                   /note="TIGRFAM: glucokinase regulatory-like protein; KEGG:
FT                   tte:TTE0212 N-acetylmuramic acid-6-phosphate etherase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60049"
FT                   /db_xref="GOA:D7ARE0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARE0"
FT                   /inference="protein motif:TFAM:TIGR00274"
FT                   /protein_id="ADH60049.1"
FT                   /translation="MILDELITEGRNPETMDIDRLDTIEMLKKINNEDKKVAVAVEKVI
FT                   PSIAKAVDSIAEKMKKGGRLIYIGAGTSGRIGILDASECPPTFGTDPGLVIGIIAGGDK
FT                   AIRNAMENVEDDVEAGRQDLINVNLTVNDSVIGISASGRTPYVIGALQYAKQVGALTIG
FT                   LFCNPNENLSNIIDILITPVVGPEVIMGSTRMKAGTAQKLVLNMISTSVMIKMGKVYSN
FT                   LMVDLQANNEKLMERAKRIVKLATGAEERIIESILNETNYNVKLTILMIVTNLDKDRAK
FT                   QLLDVAGGYIAEAIKLKEDRN"
FT   gene            284854..286251
FT                   /locus_tag="Tmath_0268"
FT   CDS_pept        284854..286251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0268"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: gym:GYMC10_5639 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60050"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARE1"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH60050.1"
FT                   /translation="MKAKKLISILLTIIFITSMLSGCSKTTNQPNGEASSAKKDIVKVW
FT                   TFPVEKDYEQNFAKIKEDFESKNPNIEIQVEVLSWAEGVKKFDTAINAGDPPDLMFIVP
FT                   SAKYVQTGLAVPIEDYIDKETLSDYYPVALEYMKVGGKLYGLPLYMKIHTIAGNKKLME
FT                   DAGIDWKKIQENGWTWDEFKELTKKGTKINAEGKQQYGFVFHGAGVDITELLNHMLMNN
FT                   GLPYMVDEKGKFTYTDPKFLETLKFIRSLIDEGIMPKESNQITPQKRMELFYTEQAMII
FT                   GKAMPYYEVVIGDNNKKVQEKTAPPDQKVVDFVLLPEPHAAGQKAITPGGVDGYSMFKQ
FT                   KNYNGPVSQEEHLRNVGKVLVALTSGYAGISAKILLLPQVTKSGDQMWKDKYTMKPENK
FT                   EEVDRLFKNVLPPVQLDPAISQKAQKLYDEIIKAEYPALLGGDITPEKMYEDVKKAARE
FT                   IFGDNIY"
FT   sig_peptide     284854..284928
FT                   /locus_tag="Tmath_0268"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.809) with cleavage site probability 0.330 at
FT                   residue 25"
FT   gene            286301..287215
FT                   /locus_tag="Tmath_0269"
FT   CDS_pept        286301..287215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0269"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gym:GYMC10_5638
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60051"
FT                   /db_xref="GOA:D7ARE2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARE2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH60051.1"
FT                   /translation="MQEMMIYNRKSEKIKQFLRDYGWSYIFIALPVIIFLSFTLYPLIK
FT                   AFMMSFQEYQVMGSRWVGIENYSYIFRRKLFWKALYTTLVYTIGTVPVNILISLGLALL
FT                   IFQLDKKSQTFFKATFYLPAVASGVTLSLVWFIMYDPTPDGLLNKFLSLFGFPNINWLG
FT                   RMDTALFSLMLMTYIGGHGSGIILYLASLGGIPKTIYEAAEIDAAGTWSKFRNITWPLL
FT                   KPITLYMLITGIIGSSQAFMTAYLMTSGGPNHATTTIAYLIWQDAFEYFDFGVAAAESF
FT                   VLALIIVGLSVLQFKYLGSDVEY"
FT   gene            287228..288118
FT                   /locus_tag="Tmath_0270"
FT   CDS_pept        287228..288118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0270"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gym:GYMC10_5637
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60052"
FT                   /db_xref="GOA:D7ARE3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARE3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH60052.1"
FT                   /translation="MNTTIEAVREEEIPVYREKKGVTFYVKRILIYSLLILWSIFTIFP
FT                   LYWMLTTSFTDPNLSATMHFNLIPREFTFASYRFFFTFNKYVLRWLINSLFIATVITLS
FT                   NVLFASMAGYAFAKLKFPGGNTIFWILISTIMIPGQVTLIPLYVLVINVFNLADTYFAI
FT                   ILPQLVSVYNIFLMKQYMTSIPSTLIDAARIDACSEFGIFWKVIFPLAKPGIAVMAIFT
FT                   FVSQWNDFFWPFLVTKTSAMRTIQVGLASFKFADSTLYGPMMAGAVIASIPMFILFFSL
FT                   QKYFLQGITIGAIKG"
FT   gene            288134..289249
FT                   /locus_tag="Tmath_0271"
FT   CDS_pept        288134..289249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0271"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bcl:ABC3122 sugar ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60053"
FT                   /db_xref="GOA:D7ARE4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARE4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH60053.1"
FT                   /translation="MAKIVFEHVTKEFIDEKRGKVIAVNDANFTIEDKEFVVLVGPSGC
FT                   GKTTTLRMIAGLERQTKGNIYIGEKLVNYLPPKDRDIAMVFQDYALYPHMTVYENLSFG
FT                   LRNLKVPRTEIEQKVKRAAEILGISELLDRKPRELSGGQRQRVAVGRAIVRNPKVFLFD
FT                   EPLSNLDAKLRVQMRVELAELHKKLETTIVYVTHDQVEAMTLGQRIIVMNHGIIQQIAT
FT                   PDELYNRPVNMFVAGFIGAPSMNFINCKVERNKIILSDGNSNTMFDIPQKFKKVIANIN
FT                   GKEMVMGIRPEDIYDAVFSQNIENKLYVDVYVKVVEKLGSENLIYFDKYGTTITARVNS
FT                   QSRIVSGEYAKVAFNIDKIYLFDKETGIAIY"
FT   gene            289267..289938
FT                   /locus_tag="Tmath_0272"
FT   CDS_pept        289267..289938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcl:ABC3121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60054"
FT                   /db_xref="GOA:D7ARE5"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARE5"
FT                   /inference="similar to AA sequence:KEGG:ABC3121"
FT                   /protein_id="ADH60054.1"
FT                   /translation="MNSLSKVLIKSGHDIYENIVYVVIISIIWFIFIFPAIFVLTPYAG
FT                   VIYFIFISIPVFTAILYLTRQRIDRKSFSYKLFFTGLKKFYIRTFIYSMLFSIFVMIPV
FT                   SSWWYYFQTKTMFTFIIAVIQTYLFIFIILSQVYFLPFLISENKNLISSINASIKLFLD
FT                   NGLYTFGALIQIASVSILLLITIVGVPLLWAGMVSIFLINLYDNLLLKYMDRKAINSTK
FT                   I"
FT   gene            290011..291078
FT                   /locus_tag="Tmath_0273"
FT   CDS_pept        290011..291078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0273"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: tte:TTE0213
FT                   beta-lactamase class C and other penicillin binding
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60055"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARE6"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ADH60055.1"
FT                   /translation="MVFDNNRLDEAFNLIDKGIEDGAFPCAAVAVGNKSDFLKIAVKGN
FT                   KRIVPYKEMLNRTSLFDLASLTKVVATTTLLMLMIEKGFISVYDKVCEYISSFNEKSKD
FT                   RITIFQLLTHTSGLPAYIPFYKICRDYDDAIDYICKEVELRETKEVEYSDLNFILLGKI
FT                   LETVGGDKLDKLCKKEIFDPLDMRNTLFNPGNRDVVPTEIDKESGEVICGVCHDENARF
FT                   FGGISGHAGLFSTIDDLVKFAKMLVNYGEIKNEIFLFYPLFKRMITNYTESLSENRGWG
FT                   WVIKGNTAAGGDLFSKKAFGHTGFTGTSLWVDPEYGVYIILLTNRVHPTRENVKIIRFR
FT                   RLFHNAVLASLDGRS"
FT   gene            291081..292223
FT                   /locus_tag="Tmath_0274"
FT   CDS_pept        291081..292223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   tte:TTE0214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60056"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARE7"
FT                   /inference="protein motif:PFAM:PF07075"
FT                   /protein_id="ADH60056.1"
FT                   /translation="MVKCGIDVIEKYEKLFKNKRIGLITAPSGVTRNLESTIDVLYKNF
FT                   NLVALYSPEHGIRGEFQAGEKVKGYVDERTGVKVYSLYGDTKKPTPEMLEEINVLVIDV
FT                   QDVGSRYYTYLYTMAYAMEACKENGKEFVVLDRPNPIGGLKVEGNILDTKFRSFVGWYP
FT                   IPQRYGLTIGEIAHLFNKEFGINCDLHVVKLEGWKRDMYYDETGLLWVNPSPNISSLDA
FT                   AVLYSGTCLFEGTNISEGRGTTRPFEIIGAPWIDPYKLADSMNKKGLKGVVFRPVYFIP
FT                   SFSKHKGQLCKGVQIHVKDRKAVDSVEVGIKLLYEIIRQSGENFKWLPPYGESNVYFID
FT                   LLAGTDELRLMKYDEDQLLDKWKRESEEFKRLKESYHFYE"
FT   gene            292238..293818
FT                   /locus_tag="Tmath_0275"
FT   CDS_pept        292238..293818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0275"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: tte:TTE0215 beta-glucosidase-related glycosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60057"
FT                   /db_xref="GOA:D7ARE8"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARE8"
FT                   /inference="protein motif:PFAM:PF01915"
FT                   /protein_id="ADH60057.1"
FT                   /translation="MKKIEEMTLEEKIGQMLMIGFPSTFYDDHIRELVTSYKIRNVILF
FT                   SRNVQDARQVMDLCTDIQKETIENTGIPAFISIDQEGGMVTRIYRGATYLPGNMAIGAT
FT                   KDPENAYKVGEIAGRELRTIGININFAPVMDVNNNPLNPVIGVRSYGENPEDVANFGIN
FT                   YIKGLQKEGVIATAKHFPGHGDTTVDSHLDLPKVSHGKGRLYEVELYPFLKAIENGVDA
FT                   IMTAHILFPALEDSKVPATLSYNILTRILREEFKFDGLIITDCMEMNAIAKYFGTRKAA
FT                   SMAIKAGADIVLVSHTKDLQIKAFENIKEAVERGEIPVERIDKSVRRILKMKEKYGLFD
FT                   NPYPEKDKFDTTAEIEKHRKIAKAISLKSITVVKDEKKLIPLKTKNVLAISPETVPASF
FT                   VDDALMDRLSFARQFTSTFGGVEETISVNPNDREISVILEKAKDKEVVVVGTYNANLNE
FT                   GQVKLVNTLLQVNKDVIVVALRNPYDLQKFENVPTYVCAYEYTPLSVESVIGVLTGKYP
FT                   AEGKLPVTI"
FT   gene            293837..294757
FT                   /locus_tag="Tmath_0276"
FT   CDS_pept        293837..294757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0276"
FT                   /product="ATPase BadF/BadG/BcrA/BcrD type"
FT                   /note="PFAM: ATPase BadF/BadG/BcrA/BcrD type; KEGG:
FT                   tte:TTE0216 N-acetylglucosamine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60058"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARE9"
FT                   /inference="protein motif:PFAM:PF01869"
FT                   /protein_id="ADH60058.1"
FT                   /translation="MEYVIGIDGGGTKSAISILDLQGNVLFTGRGGPTNIRSEGREEAC
FT                   ENLKNLIVKSVEKMHLKLGDCRAICVGTAGAGREEEKEIVTNCLKEIGVKGNMVVTHDA
FT                   EIILSEAIEKREGIVVIAGTGSLAYGRKDGIEKRAGGWGHLLGDEGSAYYIAVEGIKAA
FT                   LRYYDGRGNYTKLLDMMMKRLNVKRPEEFIGFVYKDGITKADIAELAKVVDEAYKEGDK
FT                   EARKILKKSAEELFNLTKAVVKAFKWENDEISIVVTGSVFINNESVFKEFSRLIKKYYP
FT                   KANIKKLDKDASYGAAILALSFLKD"
FT   gene            294757..295965
FT                   /locus_tag="Tmath_0277"
FT   CDS_pept        294757..295965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0277"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   tte:TTE0217 anhydro-N-acetylmuramic acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60059"
FT                   /db_xref="GOA:D7ARF0"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARF0"
FT                   /inference="protein motif:PFAM:PF03702"
FT                   /protein_id="ADH60059.1"
FT                   /translation="MREESAMDRLLRIYNKEERLVVGLMSGTSADGIDAALVKVKGRGL
FT                   DTKVELLEFEKFPYEEEVQKKIFELFDPHTGTVEKICHMNFLLGELFAEATLKLIKKAG
FT                   LAPKDIDLIGSHGQTIYHIPNFIEDMGYKVRSTLQIGEPAVIAERTGIVTVADFRVRDV
FT                   AAGGQGAPLVPYTEYILYRSPNETIALQNIGGIGNVTVLPKEGSVEDVIAFDTGPGNMV
FT                   IDEVVKRITHGEMKFDKDGELASRGKVNEEFLAELLKDEFFEIKPPKTTGREHFGKNYV
FT                   DNLMKRASYLEINKYDLVATVTALTAYSVVRSYERFIFPYYKVDKVVIGGGGSFNKTLV
FT                   QMIKKQLPQVRVITQEDIGFNSDAKEAVAFAILASETINGNFNNIPKATGAKHPVVMGK
FT                   ISL"
FT   gene            295980..296939
FT                   /locus_tag="Tmath_0278"
FT   CDS_pept        295980..296939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0278"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   tte:TTE0218 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60060"
FT                   /db_xref="GOA:D7ARF1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARF1"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH60060.1"
FT                   /translation="MGIDYLPLARDKGEEIVRLWNKELGKEFPLRKELFYQNSLEDENV
FT                   LLEGSWIALEREKLVGFIISKIWKEDLECVKNKKDTGYIQVILVDSDYRNKGIGSELLR
FT                   KAEEALKANGVKTVVLGQDPWHYFPGIPSEYIDTVEWFKKKGYVEFGEEYDLYCRLNGE
FT                   GQVTLPVFPEVEFKILDKWQKNSFLEFLNRGFPGRWEYEAVKYFEKGGEGREFVVAEKK
FT                   GKIIGFCRINDSRSSFIAQNVYWVPLFEEELGGIGPLGIDPEERGKGYGLAIVQAGMYF
FT                   LNQRGIRNIVIDWTNLVDFYGKLGCKVWKKYVKCKKQF"
FT   gene            297038..297754
FT                   /locus_tag="Tmath_0279"
FT   CDS_pept        297038..297754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0279"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: tte:TTE0219
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60061"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARF2"
FT                   /inference="protein motif:PFAM:PF02585"
FT                   /protein_id="ADH60061.1"
FT                   /translation="MSKKLHIMAVGAHCGDMELVAGGVIAKYTRAGHEASIVHLTSGEK
FT                   GHPHLKPEEYAKQKIEEAKKAAEILGAEPIFLPYRDAELPVNDEVKFKLAEVIREKKPD
FT                   VIITHWKNSMHPDHANTYLIVEGALLIAALPAFELKYPAHGVRDLFYGENWEDPYGFEP
FT                   DVYVDITSTYDVWVEAIKQYEFVRGGVSTFRYLDYYTHLTVVRGCLMGVKYAQAFMMPE
FT                   GANKRRGASLPGFNLE"
FT   gene            297768..298721
FT                   /locus_tag="Tmath_0280"
FT   CDS_pept        297768..298721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0280"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   tte:TTE0220 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60062"
FT                   /db_xref="GOA:D7ARF3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARF3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH60062.1"
FT                   /translation="MRYIVRTYRGGDEKGIVEAWQQSLPFDPINQHLFRAKVLLDPNFD
FT                   PEGAIVAEDEKGQIIGFTLTLVRKLPMYKDDLEPENSWITVFFVHPAYRGQGIGSKMFE
FT                   KAKEFVQEKGRKYIFFSSYAPNYFLPGIDEKTYPEGYRFLLKQGFTKLYSPVAMDRSLL
FT                   DFTIPEKVKKLKEEREKEGFKFGYAEDRHLYELIEFANVVFNPDWGRAIREGILQGLPL
FT                   EQIVVAEKDDKIVGFCLYGAYEGIRERFGPFGVDPSMHGLGLGKILLNYCLFEMRCKGL
FT                   HNVWFLWTGEESAAGYLYKKTGFKVTRKFHVMRFSF"
FT   gene            298758..302516
FT                   /locus_tag="Tmath_0281"
FT   CDS_pept        298758..302516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0281"
FT                   /product="protein of unknown function DUF187"
FT                   /note="KEGG: gym:GYMC10_1278 protein of unknown function
FT                   DUF187; PFAM: protein of unknown function DUF187; Ig domain
FT                   protein group 2 domain protein; SMART: Ig domain protein
FT                   group 2 domain protein; Fibronectin type III domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60063"
FT                   /db_xref="GOA:D7ARF4"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR003790"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARF4"
FT                   /inference="protein motif:PFAM:PF02638"
FT                   /protein_id="ADH60063.1"
FT                   /translation="MLRRSFAIFLVFMFVFTMSPGVSLKVFSQDSSLSLPIVNCALIEI
FT                   VPNPVRLLPGEEKQFSIKAYNEKGEEVAVPLKQVIWRAERDIGTISNDGVLMVPQVVEG
FT                   LKYGYVEAEYNGMVAKGLVIVGNKIAEVIEDFENIELNGKVILSTGTITQAGSLPATAT
FT                   VQLAKRPEPVLYGEHSAKFMYDMRGTTGTTATYLSLRDISTGSLDRPIPGVPKKIGVWV
FT                   YGNQNNHWLRARLKNSDGKMFPVDLTATANFNWTGWKYVTANIPSDQKGPFKFMDLYIV
FT                   ETKDTNKDSGFVYYDRLSVFYTDTDVFGVDIIGLTPMQVGETKQAKVAITLKNSTSPEI
FT                   VNNGITYLSSNPNVASIDNEGNVIALRPGKTTIVALYGNTEAAFFELLITENEPIVDIL
FT                   EIYGPEKIEAGMTGNLQVFAKFNGYDNKIEVTKEVNFISQNPKIATVSKEGIIQALSEG
FT                   ETTIIAKYKNKEALYSLKVTKPTPVLSKIELTGLKSMTVQSELQAKVIGVYTVFGKEYE
FT                   RIEIKEGVTFKSSRPEVAEINQQGLVKAKSVGVTVITANYLNKTASYVLVVNKEPITPK
FT                   REFRAAWIATVDNIDWPKKGVYDPEQQKQDFIEILDKLKDIGMNAIIVQIRPTADSFYP
FT                   SKYFPWSHWLTGIQGKDPGYDPLAFMIEGAHKRNLEFHAWINPYRVSMGDDLNALVDNH
FT                   PAKQHPEWVVSYGGKLWFNPGNPEVKEYIINSIIEVVKNYDIDAIHFDDYFYPYPVTGV
FT                   DFPDEELYQKYGVGFESKEAWRRNNVDTLISELSQKIKATKPYVKFGISPFGIWRNKST
FT                   DPNGSETNGFQSYDSLYADTRKWVQNEWIDYIVPQIYWYFNYSPAAYEKLVDWWRQQTA
FT                   GKNVHLYIGHAAYRVGADDVNWLDPDQLPNQVLYNRNFENVYGSVFFATNNLLKNPLGV
FT                   TDRLKELFKYPALVPLMEWLTADLPSQPIKVKINAKEAGIELKWEDMTPENTGYYVIYR
FT                   VEGEEVPSINDAKNILALVRKSNGFQQTYLDLNVLPDKTYSYAITGVNRINEEGVPIYI
FT                   TVKEASQGKVIVVGNTTTYLLEKNKLEEEINDKHKKELKFDLTDIGITSQKELEIPLEV
FT                   LRLLEKGNKRIIIKSDEITLEFNSKTVVAPKNIFKLIEEEGSLTIAINNKGKIEVDSFN
FT                   SLTNAYEVILKARDKVLKIKEPLFKISFNLPDKNDFKKVGVYFWEEKNGRWKYIGGKVD
FT                   RKINTITVEAKQMTIYTVFEHEKNFIP"
FT   gene            302538..302952
FT                   /pseudo
FT                   /locus_tag="Tmath_0282"
FT   gene            302953..303536
FT                   /pseudo
FT                   /locus_tag="Tmath_0283"
FT   gene            303537..303829
FT                   /pseudo
FT                   /locus_tag="Tmath_0284"
FT   gene            303889..305328
FT                   /locus_tag="Tmath_0285"
FT   CDS_pept        303889..305328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0285"
FT                   /product="protein of unknown function UPF0236"
FT                   /note="PFAM: protein of unknown function UPF0236; KEGG:
FT                   tte:TTE2708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60064"
FT                   /db_xref="InterPro:IPR009620"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARS0"
FT                   /inference="protein motif:PFAM:PF06782"
FT                   /protein_id="ADH60064.1"
FT                   /translation="MENKTTQKGVSLVKKNIFEDIILQNALNFTREVVDIFSDLLNKGM
FT                   NITELAARIKELTDKLGREAIEAIIEELDKIIKEDKRRKEKWVVERKDKKRLTTILGDI
FT                   EYERTYYKSREDGRYTYLVDDALEIGRHDRIEKGVKIKLVENAIEESYERSSKKACPEE
FT                   LSKQTVLNAIREIGEVEVKREIKEKKEVRVLYIEADEDHVPLQDGSNETPRLIYIHEGK
FT                   EERNGRDVLRNVHYKAYVGEKAEDIWIDVANYIEENYKEEKIEKIYIAGDGAPWIKEGL
FT                   EWIAKSRFVLDRYHLNKYVLKATSKEPKYREKIWRAINEGDKEGVKKIFDELIKAAEEE
FT                   REKEKIKEARKYILNNWEGIEIYNKDKDVIGCSAEGHISHVFSVRLSRNPLGWSREGLK
FT                   LMAKLRVFSKNGGDLREVEWGKRKNINEGSYKLTKKQIKEAVRRVKTSTNEKINNITVL
FT                   NIGKVTPIYRVLRAIKYAQVI"
FT   gene            305387..306551
FT                   /pseudo
FT                   /locus_tag="Tmath_0286"
FT   gene            306611..307759
FT                   /locus_tag="Tmath_0287"
FT   CDS_pept        306611..307759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0287"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="TIGRFAM: N-acetylglucosamine-6-phosphate
FT                   deacetylase; KEGG: tpd:Teth39_2028
FT                   N-acetylglucosamine-6-phosphate deacetylase; PFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60065"
FT                   /db_xref="GOA:D7ARS1"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARS1"
FT                   /inference="protein motif:TFAM:TIGR00221"
FT                   /protein_id="ADH60065.1"
FT                   /translation="MGNLLLRHGEIYTDEEIIYDGDVYIKEGKIAEIGRNLKKEDAEVI
FT                   DVEGKKIVPGFIDIHIHGGVGHDTMDATYEALNAISIHLAKHGVTSFCPTTMTMDIPYI
FT                   LNALKNINETMKKKTAGAQILGAYVEGPFISKEHKGAQDEKYIIPPDKNLFDEFLEIAG
FT                   GNIKVIALAPEKDPDGSFVEHVTKKGVKVSLGHTNATYEEMKNGVEHGATIAVHTYNGM
FT                   KGLHHREPGALGEVFLDDRIYSEVIVDFIHTHPASVKLLIKIKGTDKVILISDAMSACG
FT                   LGDGEYKLGGQKVFVKNGEARLESGSLAGSTLTLDKAVKNITSLGVPLFEACKMASLNP
FT                   AKAIGVDDRKGSIEVGKDADIVVLNNDLTVYMTIIEGKVFME"
FT   gene            complement(308177..309343)
FT                   /locus_tag="Tmath_0288"
FT   CDS_pept        complement(308177..309343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0288"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   tpd:Teth39_2027 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60066"
FT                   /db_xref="GOA:D7ARS2"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARS2"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADH60066.1"
FT                   /translation="MNTDKYISNVVKSIPPSGIRKFFDLVTNSKDIISLGVGEPDFVTP
FT                   WEIRKEGIDALDRGSTTYTSNLGLPELRIAISYFLKTHYNLTYDPEKEIMVTIGASEAI
FT                   DLALRALLNDGDEVLVPEPSYVSYAPCVTLTRGIPVFVPTDEKNNFILTPDDLKSKITS
FT                   KTKALILPYPNNPTGAIMKKEELEEIVDIIIEHDLIVISDEIYSELTYEGKHVSIASLP
FT                   GMRERTILINGFSKAFAMTGWRLGYIAAEHGFIEAMNKIHQYTTICAPITAQYAAIRGI
FT                   YECEEDIVKMRETYDKRRKFIVNGFREMGLDCFEPKGAFYIFPSIKKTGMTSQEFCEKL
FT                   LKEEKVAVVPGDAFGPSGEGFIRVSYAYSIDKIARALERIENFVKRIL"
FT   gene            complement(309340..309828)
FT                   /locus_tag="Tmath_0289"
FT   CDS_pept        complement(309340..309828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0289"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="KEGG: tpd:Teth39_2026 AsnC family transcriptional
FT                   regulator; PFAM: Transcription regulator, AsnC-type-like;
FT                   SMART: Transcription regulator, AsnC-type"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60067"
FT                   /db_xref="GOA:D7ARS3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARS3"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADH60067.1"
FT                   /translation="MDKSMEILDLLCENSRLTEKQMAAITGLSEEEVKNTIKSLEDKKV
FT                   LLKYTALVDWEKAGREVVTALIDVKVAPQQGLGFNAIAERICQYEEVKSVSLISGTYDL
FT                   SVEVEGKTMKEIALFVAERLAPIDGVLSTTTHFILKRYKKDGVFYEEGQDDKRLVITP"
FT   gene            310038..310301
FT                   /locus_tag="Tmath_0290"
FT   CDS_pept        310038..310301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0290"
FT                   /product="FeoA family protein"
FT                   /note="KEGG: tpd:Teth39_2025 FeoA family protein; PFAM:
FT                   FeoA family protein; SMART: FeoA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60068"
FT                   /db_xref="GOA:D7ARS4"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARS4"
FT                   /inference="protein motif:PFAM:PF04023"
FT                   /protein_id="ADH60068.1"
FT                   /translation="MAENTILNLIQLRENHEGEIVLIKAGRAATQRLNEMGLVPGTKVK
FT                   VVRKGLLRGPVELEVRNSHLVIGYGLASKIYVKTLDGKGDMR"
FT   gene            310298..312268
FT                   /locus_tag="Tmath_0291"
FT   CDS_pept        310298..312268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0291"
FT                   /product="ferrous iron transport protein B"
FT                   /note="KEGG: tex:Teth514_0188 ferrous iron transport
FT                   protein B; TIGRFAM: ferrous iron transport protein B; small
FT                   GTP-binding protein; PFAM: GTP-binding protein
FT                   HSR1-related; Ferrous iron transport protein B domain
FT                   protein; nucleoside recognition domain protein; Ferrous
FT                   iron transport B domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60069"
FT                   /db_xref="GOA:D7ARS5"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARS5"
FT                   /inference="protein motif:TFAM:TIGR00437"
FT                   /protein_id="ADH60069.1"
FT                   /translation="MKKEIVIALAGNANVGKSVIFNQLTGLTQIIGNWPGKTVERAEGV
FT                   LRFKGRTIKIVDLPGIYSLSAYSQEEIVSREFIAFEKPDVVINVVDASNLERNLFFTVQ
FT                   LLELHVPMVMALNQVDYAIKKGIDINVKKLEELLGIPVVKTIATKGKGLEKLIDKVLEV
FT                   VDSNKETTVNDYDIKQEKILKYGNEISEYVMRIYNILLKHNVVNIINLFHPLWISLKLI
FT                   EEDSDIIEKLKREPDGKKAYEEIQKELEGLKAKTDGPLVTLVTAARYDIASFIARQTVS
FT                   EIHHRITWTDLIDNVALHKIFGYISMFAIVFISFYGIFKFGEYFSGVLEGFFDVLRPLV
FT                   YNLHIPNMYKDVLWNGLVEGLISAITIVLPYILPFYVFLSILENTGYLARIAFLMDEIM
FT                   HKVGLHGKALIPILMGFGCNVPAVLGTKILETDREIFVASFMSTLVPCSARIVIILGTI
FT                   GVFMGPQYALAVFALDVLVIYIAAYFADKIAHGKPYDLIMELPGYRVPALKPTLKQIWI
FT                   RIKDFLYVALPIIVVGSLVLEILKYTGIFKYVTYVTDPIVVKWLGLPSIVGIVLIFGVL
FT                   RKELTLIMLLALSGTSHISQILTPKQMIVFGVVTMLYIPCIATIAALKRTIGWRKTWWV
FT                   VFVDIFVAILVGGILHSVKLS"
FT   gene            312355..313758
FT                   /locus_tag="Tmath_0292"
FT   CDS_pept        312355..313758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0292"
FT                   /product="protein of unknown function UPF0236"
FT                   /note="PFAM: protein of unknown function UPF0236; KEGG:
FT                   tte:TTE2708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60070"
FT                   /db_xref="InterPro:IPR009620"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARS6"
FT                   /inference="protein motif:PFAM:PF06782"
FT                   /protein_id="ADH60070.1"
FT                   /translation="MNKHIFEDIILQNALNFTREVIEIFSDLLNKGMNITELAARIKEL
FT                   TDKLGREAIEAIIEELDKIIKEDKRRKEKWVVERKDKKRLTTILGDIEYERTYYKSRED
FT                   GRYTYLVDDALEIGRHDRIEKGVKIKLVENAIEESYERSSKKACPEELSKQTVLNAIRE
FT                   IGEVEVKREIKEKKEVRVLYIEADEDHVPLQDGSNETPRLIYIHEGKEERNGRDVLRNV
FT                   HYKAYVGEKAEDIWIDVANYIEKNLQGKEIEKIYIAGDGAPWIKEGLEWIAKSRFVLDR
FT                   YHLNKYVLKATSKEPKYREKIWRAINEGDKEGVKKIFDELIKAAEEEREKEKIKEARKY
FT                   ILNNWEGIEIYNKDKDVIGCSAEGHISHVFSVRLSRNPLGWSREGLKLMAKLRVFSKNG
FT                   GDLREVEWGKRKNINEGSYKLTKKQIKEAVRRVKTSTNEKINNITVLNIGKVTPIYRVL
FT                   RAIKYAQVI"
FT   gene            313890..314252
FT                   /locus_tag="Tmath_0293"
FT   CDS_pept        313890..314252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0293"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: tte:TTE0244 nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60071"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARS7"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADH60071.1"
FT                   /translation="MGDKIMPYIMPQKEKRLKVLRDELEKAIDSIISLNPEKVVLFGSL
FT                   EREDVHLRSDIDLLIIWKTDLPFLERLQVFYDAIKPNVAMDILVYTPEEIEKLYRKNKF
FT                   IAKVLDKGRVLYEKKQ"
FT   gene            complement(314348..315076)
FT                   /locus_tag="Tmath_0294"
FT   CDS_pept        complement(314348..315076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0294"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_2023 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60072"
FT                   /db_xref="GOA:D7ARS8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARS8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH60072.1"
FT                   /translation="MSTVFELKNVYYSYNKSVPALVDITFEVKKGEKLILLGANGSGKS
FT                   TLLKLMDNLISPDSGEIWAFGKLLGDKKTFDEYEFRKKVGFVFQDSDVQLFSTTVFDEI
FT                   SFAPLQMGLERNKVQKTVEETLNSFGIEKLKDRPPHRLSGGEKKKVALASVMVINPEVL
FT                   LLDEPTNGLDPRSKKWLLEKLQKLNKNGTTIVIATHDLDIAAMLSDRIIVLNENHSIEA
FT                   IGKPDEILKDKELLLKVNLI"
FT   gene            complement(315088..315903)
FT                   /locus_tag="Tmath_0295"
FT   CDS_pept        complement(315088..315903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0295"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="KEGG: tpd:Teth39_2022 cobalt ABC transporter, inner
FT                   membrane subunit CbiQ; TIGRFAM: cobalt ABC transporter,
FT                   inner membrane subunit CbiQ; PFAM: cobalt transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60073"
FT                   /db_xref="GOA:D7ARS9"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARS9"
FT                   /inference="protein motif:TFAM:TIGR02454"
FT                   /protein_id="ADH60073.1"
FT                   /translation="MDNFLQKTILSIQNAFEDMFYSDTISAKKGIMQSLDTRIKLVSVF
FT                   ILIIIVNFGKTISFMTIFLIYTLLLAYFSKIPLKAYVMRVSAVSIFFTGIVLIPSLFNV
FT                   VKEGHPLVYFTKNFYITKEGLYSAIIFMMRSFISLSFVYILALSTKWVEILKGLRSFKL
FT                   PRIFTATLEMALRYIFLLLEIATNMFLARKSRNVGKSNSSEGRKFVASAMANVLIRSQQ
FT                   LSDEVYNAMISRGYNGDYKALTTLKMAFYDYIWIGFNITFLFILWYIHP"
FT   gene            complement(315896..316213)
FT                   /locus_tag="Tmath_0296"
FT   CDS_pept        complement(315896..316213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60074"
FT                   /db_xref="GOA:D7ART0"
FT                   /db_xref="InterPro:IPR025937"
FT                   /db_xref="UniProtKB/TrEMBL:D7ART0"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2021"
FT                   /protein_id="ADH60074.1"
FT                   /translation="MKKFYIAAIVIILLTPLGLLAPGSAWGEWGLDEIKNMIGYVPEGM
FT                   SRFSEVIKAILPDYSIPGFDANFFQQALGYIFSAVVGIAAIVLIFAILGRIMGKPQKKN
FT                   G"
FT   sig_peptide     complement(316130..316213)
FT                   /locus_tag="Tmath_0296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 28"
FT   gene            complement(316210..316902)
FT                   /locus_tag="Tmath_0297"
FT   CDS_pept        complement(316210..316902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0297"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein; KEGG: tex:Teth514_0192 cobalt transport protein
FT                   CbiM"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60075"
FT                   /db_xref="GOA:D7ART1"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:D7ART1"
FT                   /inference="protein motif:PFAM:PF01891"
FT                   /protein_id="ADH60075.1"
FT                   /translation="MHIPEGYISPQTCAVMGAAMVPVISVAAKKVNESFDKKDISTLAI
FT                   GSAFAFTIMMFNVPIPGGTTSHAIGATLLAITLGPWAASISLTIALFIQALLFGDGGIL
FT                   ALGANSFNIAFIAPFVGYGIYKLMLALKLNKVISSAIGGYVGINAAALATAIELGLQPL
FT                   LFHTANGTPLYFPYGLNVAIPAMMFAHLTVAGIVEAIITGLVVYYLQKADEENILYKFS
FT                   SKLRGDNR"
FT   gene            complement(316916..317347)
FT                   /locus_tag="Tmath_0298"
FT   CDS_pept        complement(316916..317347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0298"
FT                   /product="transcriptional regulator NikR, CopG family"
FT                   /note="PFAM: NikR nickel binding; CopG domain protein
FT                   DNA-binding domain protein; KEGG: tpd:Teth39_2019 nickel
FT                   responsive regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60076"
FT                   /db_xref="GOA:D7ART2"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:D7ART2"
FT                   /inference="protein motif:PFAM:PF08753"
FT                   /protein_id="ADH60076.1"
FT                   /translation="MGVISLEEITRFGVSMESKLLYQFDELIKKKSYNNRSEAIRDLIR
FT                   DFIIENQLEAENTETIGTITYVFNHEVREINDKLTNIQHKHYQNIISTMHVHLDKHNCL
FT                   EIMVLKGTAKEITKIADEIISTKGVKHGKLVMTTTGKNL"
FT   gene            317515..317985
FT                   /locus_tag="Tmath_0299"
FT   CDS_pept        317515..317985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0299"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   tpd:Teth39_2018 tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60077"
FT                   /db_xref="GOA:D7ART3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D7ART3"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ADH60077.1"
FT                   /translation="MPLNVVLVEPEIPQNTGNIARTCVLTGSRLHLVKPLGFSIDEKYV
FT                   KRAGLDYWPLLDLTVYDNLERFLEQNKGKKFYLATTKAKKYYHEVKYEDNSYILFGKET
FT                   AGLPKWLIEKYYEDCIRIPMHEVISTRSLNLSNSVAIVLYEALRQLGFPNMK"
FT   gene            318003..319172
FT                   /locus_tag="Tmath_0300"
FT   CDS_pept        318003..319172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0300"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: tpd:Teth39_2017 DNA polymerase IV; PFAM: UMUC
FT                   domain protein DNA-repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60078"
FT                   /db_xref="GOA:D7ART4"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:D7ART4"
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /protein_id="ADH60078.1"
FT                   /translation="MKRKIIHVDMDAFFASVEQHDNPKYKGKPVIVGGLSGRGVVSTCS
FT                   YEARKYGIHSAMPMYMARKLCPHGIFLSVRRKRYEEVSKQIFDILYSITPLVEPVSIDE
FT                   AYLDVTDIDKNPEVIAKEIKKKVKETTGLTISAGVSYNKFLAKLASDWNKPDGFTVITE
FT                   DMIPDILKPLPVSKVYGIGEKSEERLKSMGINTIGDLLKLSQENLVEIFGKVGVEIYLR
FT                   IRGIDERPVETMREIKSIGKEKTLEKDTKDKKLLLHYAKLFSDIISEELFRAGLYARTV
FT                   TVKIKTSDFAIHTKSKTLNKYIRLSEDIYNVAYEIIENIKLDQYIRLIGLSVSNLSAVK
FT                   YEQLSFLDKSVVKSIKAENIAREINKKIGQEIVKKASELLNNKTKQWRD"
FT   gene            319173..320543
FT                   /locus_tag="Tmath_0301"
FT   CDS_pept        319173..320543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0301"
FT                   /product="MATE efflux family protein"
FT                   /note="KEGG: tpd:Teth39_2016 MATE efflux family protein;
FT                   TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60079"
FT                   /db_xref="GOA:D7ART5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D7ART5"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ADH60079.1"
FT                   /translation="MEAKERHKRNIAKEIIELAWPSITEQMLIMTVGMVSTIFVGRVGT
FT                   NAIAAVGMINSLIFFFQAIFAGLATGSTVIVARLIGEEDEGSARVAVMQSLIMSIAVSI
FT                   GFTVLGYIFAVPLIKIFFGSVSPDVFKLALIYYKIVILGIPFMIVEIVIAGALRGAGDT
FT                   KTPMYITAIVNVINLLLNSILVFGVHFHSGYVVPPLGVKGSALSATISRTIGGFLQLYI
FT                   LYFGKRRINLDIKEKIRLNFDMMMRIIRVGIPASLEQVIMQGGFLVVQIIVSTMGTVSM
FT                   AVYQIGMNANSLAFMPIFGFSLAATSLVGRSLGAKRLMLAEIYAKVSRNIAVVVISIIG
FT                   FFMFIFSRQLAALYTTDPVVIKISSDIIKIFAVVEPLLAILNVMAGVLRAAGDIPYIVL
FT                   STFIGLWLFRVTIGYTLGKVFGIGIYGIWIGICIDFVVRSVMYSYRFKAGRWKYIKV"
FT   gene            320636..322402
FT                   /locus_tag="Tmath_0302"
FT   CDS_pept        320636..322402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0302"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: tex:Teth514_0198 RND family efflux transporter
FT                   MFP subunit; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60080"
FT                   /db_xref="GOA:D7ART6"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:D7ART6"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADH60080.1"
FT                   /translation="MKKKYLYVIIAVLISGIVTFYFVNRAKSSQPRQFSYATVTRGNIS
FT                   MKVTGTGNITNDVRVITLKGNGTVKKVYFKEGDTVKKGDLLYEIENESLKQQIEEAKLN
FT                   VDLAAQQLKSDLESYNKSIANLKITSPSDGIVDSILVQKGQNVSAGTQVATIADYSHVT
FT                   VRVPFNSVQIKNIKVGQKADIFLYDSLTTITGTVEYVSHQAVPHNTMEYYYVTVGLDNP
FT                   GALSDGMKVQVSIHTDNGVEKALEDSTLTVKNTVTVIAKTSGTVEKINVTEGENVKKGT
FT                   LLVELSSDNISDTQIQNDKLALTQAQNNYNELLEQLENLKIYSPIDGKIVSQNIKEGDV
FT                   LGSSTSDSTTNGSQSSQLTFVPISDVSELSNYESEAETAVIVGNGNYTVNLSVDEADIK
FT                   NIKVGQKAEITTDDLPDKTFTGTVTAISQLPTVENGVSSYTVTVELDSNGDLMLGMSVN
FT                   ISIIVAEKENVLLLPLQAVQTNDDKKYVILYTDDLKNQKSKNSTTKTSLENNIKFIETG
FT                   IYNDNYIEITSGLKEGDKVLIPTTSSSTNTNSQRAGFGIMGGPGAGPVPGANPPGNKPS
FT                   QSGSRSSGTSSK"
FT   gene            322421..323110
FT                   /locus_tag="Tmath_0303"
FT   CDS_pept        322421..323110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0303"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_2014 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60081"
FT                   /db_xref="GOA:D7ART7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7ART7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH60081.1"
FT                   /translation="MSNVLIKVRNLTKIYKMGENEVKVLDGISFDIEKGEFVSIVGQSG
FT                   SGKTTLMNILGCLDVKTSGEYFLNGIDTSKLSDNELADLRCREIGFVFQNFNLLQKMTA
FT                   LENVELPMIYKGVPAKERRERAEMLLEMVGLKERMHHRPNQLSGGQQQRVAIARALAND
FT                   PPLILADEPTGNLDSKNGSEIMKIIKELNENGNTVVLITHDPNIAAQAKRIIRIKDGHI
FT                   LENEVLP"
FT   gene            323110..324285
FT                   /locus_tag="Tmath_0304"
FT   CDS_pept        323110..324285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0304"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   tpd:Teth39_2013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60082"
FT                   /db_xref="GOA:D7ART8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D7ART8"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADH60082.1"
FT                   /translation="MRYVQVVKIALRSVLSNKMRSFLTMLGIVIGVTAVIALVSIGQGS
FT                   TRSVTSQIQSMGSNLIMVNIRGRGRESSLTYDQAIALGDSNHIAAISPVISTSVTAMYG
FT                   DNSVDNTTVNGVNGDYQSIRNIEVAVGRFILPMDDEGRNKVAVLGSNVASELFGFTDPL
FT                   GKTIKLNGQNFTVVGILSQKGSSIAGSDDDSIFIPLKTMFYFAKNKDITQIYIEATSPN
FT                   TVELAKNEITSKLLTIFKGDTDAFRIMDQSEILSTVNSVTNTLSLLLGGIAGISLLVGG
FT                   IGIMNIMLVSVTERTREIGIRKALGAKKKDILLQFIVESLTLSGLGGIVGIIGGYVLSM
FT                   ILGSAMNINAKPSLSTVLISFSFSVIVGLFFGVYPANKAANLNPIEALRYE"
FT   gene            324399..324809
FT                   /locus_tag="Tmath_0305"
FT   CDS_pept        324399..324809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0305"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="KEGG: tte:TTE0259 hemerythrin; TIGRFAM:
FT                   hemerythrin-like metal-binding protein; PFAM: Hemerythrin
FT                   HHE cation binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60083"
FT                   /db_xref="GOA:D7ART9"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:D7ART9"
FT                   /inference="protein motif:TFAM:TIGR02481"
FT                   /protein_id="ADH60083.1"
FT                   /translation="MLKWTESLSVGNELIDSQHKELIKKVNDVLEACNQKKGKEKIEEV
FT                   MKFLKDYTIEHFSAEEDLMKKYQYPSYEDHKKIHEDFIKKVEELDEKIKKEGINLSIIM
FT                   LVNKTLVDWLINHISKEDKKVGEHIKKLKGDF"
FT   gene            324811..325167
FT                   /locus_tag="Tmath_0306"
FT   CDS_pept        324811..325167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0306"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="KEGG: tte:TTE0259 hemerythrin; TIGRFAM:
FT                   hemerythrin-like metal-binding protein; PFAM: Hemerythrin
FT                   HHE cation binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60084"
FT                   /db_xref="GOA:D7ARU0"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARU0"
FT                   /inference="protein motif:TFAM:TIGR02481"
FT                   /protein_id="ADH60084.1"
FT                   /translation="MKWTESLSVGNDYIDEQHKEWIRRINDLLEAYNQKRGKEKVREAM
FT                   EFVKEYTVTHFGAEQELMKKYKYPEYEIHKRIHDNFIKEVNELDEKIKKEGPTLTNLMT
FT                   VNRTLVDWVLNHIS"
FT   gene            325294..326022
FT                   /locus_tag="Tmath_0307"
FT   CDS_pept        325294..326022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0307"
FT                   /product="5-carboxymethyl-2-hydroxymuconate
FT                   Delta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="KEGG: tpd:Teth39_2012
FT                   5-carboxymethyl-2-hydroxymuconate delta-isomerase; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60085"
FT                   /db_xref="GOA:D7ARU1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARU1"
FT                   /inference="protein motif:PRIAM:5.3.3.10"
FT                   /protein_id="ADH60085.1"
FT                   /translation="MRLVRIDKVPNKYGIIKGDKVITFESEGFDSYNLEEVKLLPPCLP
FT                   TKAICVGLNYRDHIEEMGDKEPAEPTLFIKPSTAVIGSDDFIVLPEMSERVDYEGELAV
FT                   VIGKKAKNVSEKDALDYVLGYTIANDVTARDLQAKDGQWTRAKSFDTFLPIGPWIETDL
FT                   DPSSLDITTYVNGEVKQKSNTKHLIFNVPKLISFISHIMTLNPGDVILTGTPSGVGPLK
FT                   SGDIVTIEIEGIGKLTNRVK"
FT   gene            326170..329631
FT                   /locus_tag="Tmath_0308"
FT   CDS_pept        326170..329631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0308"
FT                   /product="ATP-dependent nuclease subunit B"
FT                   /note="TIGRFAM: ATP-dependent nuclease subunit B; KEGG:
FT                   tpd:Teth39_2011 ATP-dependent nuclease subunit B-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60086"
FT                   /db_xref="GOA:D7ARU2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014140"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARU2"
FT                   /inference="protein motif:TFAM:TIGR02773"
FT                   /protein_id="ADH60086.1"
FT                   /translation="MSIRFIYGRAGTGKTSFCLNDIKRKLSDGKSHPLILFVPEQFTFE
FT                   AEKYLLDTIEKDEKIRAQVLSFKTLANRVFTEVGGLTHQHLKSCGRSMLIYKIMEDAQK
FT                   DLKIYSQASKQQGFIKKISETITELKRFEVSPDKLLEIAETIDYLGLREKLRDISLIYS
FT                   KFEENLHQNYIDQEDELALLAEKLEYSSQFEGAEFWIDGFTGFTPKQYRVIEKLLKKAS
FT                   RVNVTLCMDTSCNFSEIDTTDLFYTTKKTEDKLLEICQRNNISYEKPVDLNGGTPKRFR
FT                   ESEELSFLEKHFFSYPYKVYPSETKDISLFKAVNVYSEVEETARDIIRLVRDKGLRYSE
FT                   IVVAARDLNRYHKLVKAIFSQYGIPYFIDLKIEIKNNPIIVFITSLFDIHLKRWSYESV
FT                   FRYLKTGFANLEIEDISLIENYVLANGIKGDKWKEEAWNYRLDYRFDRLTMEEEEKEII
FT                   EKVNEIKEKITIPLQGFYKKFSKSKNVREACGTLYDFLVEMGLPQKIQKLIEKFKEEKE
FT                   YDTANQYAQVWDIVVDVLDQLVEVIGGEKVTVEQFAKILSIGFDEYQIGTIPPALDEVL
FT                   VTSVDRMKSHNAKALYIIGVNDGIFPASHFDERILTDEDREILTSHDVELDNDTKTKVF
FT                   EEQFLVYTALTSTSKFLRISYPIADHEGKSMRPSIIISRLKKIFPKIKQFNNVVEMDTA
FT                   EENLNRVSTPSPTFNEMITAIKKWDVTDKIHPLWLDVYKWYAKNDRWKPGLTRALEGIY
FT                   YTNQVEKVPAHKMKKLYGDKLRFSVSRLEKYAACPFAYFVQYGLKARERKIYSFEPPDL
FT                   GIFMHNILDRFSKALEEEELTWQEVDKEWCDEAVSIIVDDMIQKIPGYILNSSPRYKFL
FT                   AERLKRILSNAVWIVSEHIKRSSFKPVDHEVAFGDNQKYPPIKIGLSNGEEINLIGRID
FT                   RIDIFKKEDEAYIRIIDYKSGNKTLDLSDVFYGLELQLLIYLDAILESAIKEGTTLNPA
FT                   GVFYFKIDYPIIKADKDMSDEDLQKEIFKRLRLEGLVLKDEQIIKEMDKSIEGTSYIIP
FT                   ATINKDGSIGKNTKGATKEQFELLRKHVKKTIQRLTEEMLEGNISISPYKKDKETPCKY
FT                   CPYSSICQFEKNFKDNDYRVIKTKDVEEIWSMLEQEVKTDGDYVDS"
FT   gene            329609..333301
FT                   /locus_tag="Tmath_0309"
FT   CDS_pept        329609..333301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0309"
FT                   /product="recombination helicase AddA"
FT                   /note="KEGG: tpd:Teth39_2010 UvrD-like DNA helicase, C
FT                   terminal; TIGRFAM: recombination helicase AddA; PFAM:
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60087"
FT                   /db_xref="GOA:D7ARU3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARU3"
FT                   /inference="protein motif:TFAM:TIGR02785"
FT                   /protein_id="ADH60087.1"
FT                   /translation="METTWTHEQQLAINTRGNNLLVAAGAGSGKTAVLVERIIRLITDK
FT                   ENPVDIDRLLVVTFTNAAASEMRERIADALISKLDQNPEDRRLSNQLTLLNKATITTIH
FT                   SFCLEVVRNNFFLVDLDPNFRIGDDTETLLLKLEAAEELFEELYQKEDNQDFLMLIESY
FT                   GGTRDDKPLVDVLLRLYNFVKSLPWPEKWLMEMLLNFEVKEDFNFEKSQWAQVILDSLK
FT                   VEISGLLNGMYVAIDKLHAEIGLQSYLDNFEIEAGNLEKLLDCENWEEFRKQINAIKFD
FT                   RLPRAGKDADPKVKEEVTKIRNEVKAKIKEIRNKFFSDDIEKIEEEIKVLYPIMKALVD
FT                   LILLFDKKYADKKREKGIIDFNDIEHFALKILTEVDEKGKMKPSEVALMYREKFQEIFV
FT                   DEYQDSNLIQEVILSTIAREDTPNRFMVGDVKQSIYRFRQANPYIFFEKYNTYSSKEED
FT                   KNKKILLYKNFRSRSQIIDAVNFIFKKIMSKNVGEIDYTDEEKLNYGADFGTPPLGAIV
FT                   GGPVEIHLIEKNDEIPEEEEVEVYEEEEEEVIDNIQGEARVVSQRIKELVNQSERGIFM
FT                   VYDKNLKNYRPVEYRDIVILLRATERWAPVFLEELINAGIPAFADTGTGYFETTEIKTI
FT                   ISLLQVIDNPMQDIPLLAVLRSPIFSFTPEELIDIRLEEPNKTIYEALKKAAQRQDELG
FT                   QKIVFFLKSLKKWQEKAIYMPVDEFLWYLYQDTGYYAYVGAMPQGVQRQANLRILFERA
FT                   KQYEETSFKGLFNFINFVTRLKVSSGDMGSAKIVGENENVVRIMSIHKSKGLEFPVVIV
FT                   AGLGKQFNLKDLSQSVLYHHLLGLGPEFVDFKRRISYPSIVKEAIKNKIKLESLSEEMR
FT                   VLYVALTRAKEKLILVGSVKDIKEKVKKWCNIAMLGNKVPEYEVLKGKSYIDWIGPAVI
FT                   KHPDLKPLRDFAHVQCAALEEDRSQWQVRIWDKKDVIIDKEKAEEETSFLEKLKDINLN
FT                   SPSSEFYDEVARRLNYVYPYEKACHLPAKLSVTEIKRILNEEVIDEDTTSIFEKTVLKT
FT                   PAFLEERKGLTAVEKGVVMHLVMQKLDLNGDLTAEGIKKQIKNMVDREILTEAQAKEVD
FT                   VKKIEAFFKTPLGMRMLNSQNVRREVPFHIKFKSTEVYKDLPEDYENEFIAVQGIVDCF
FT                   FEEEGEIVLVDYKTDYVTEETLEATKEKYKVQIELYGKALEKITGKKVKEKYIYLFFNG
FT                   KILKY"
FT   gene            333312..334529
FT                   /locus_tag="Tmath_0310"
FT   CDS_pept        333312..334529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0310"
FT                   /product="nuclease SbcCD, D subunit"
FT                   /note="KEGG: tpd:Teth39_2009 nuclease SbcCD, D subunit;
FT                   TIGRFAM: nuclease SbcCD, D subunit; PFAM:
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60088"
FT                   /db_xref="GOA:D7ARU4"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARU4"
FT                   /inference="protein motif:TFAM:TIGR00619"
FT                   /protein_id="ADH60088.1"
FT                   /translation="MRILHTSDWHLGKSLENFSRMEEQEKFLEDFVQIVEENNVDLVII
FT                   AGDVYDSSNPPAKAEMLFYSTLKRLSSGERVILVIAGNHDNPERLSAASPLAYEHGVIL
FT                   LGTPKSIVHKGDFGKFKILDSGEGYLEIEIKGEKAVIIALPYPSEKRLNEIFTEEMEEG
FT                   KRQKSYSERIGEIFKRLSEKYRDDTINIAVSHIFVSGGEEAGSERPIQLGGSFAVEIRH
FT                   LPQKAQYIALGHLHRPQKVSSTLNAYYSGSALQYSKSEINHSKCAYLVDIKAGTSPIVK
FT                   EVYFKNYKPIEIFKCDNIDEAIEICKEYQDKNIWAYFEIKTDSPLPPSKIKEMKQILPN
FT                   IVEIKPILPEDEAQVEDYEITEKSMLELFEEFYLKERGVTPSQDLIDLFVSIVKEEDEE
FT                   DETFEA"
FT   gene            334510..338043
FT                   /locus_tag="Tmath_0311"
FT   CDS_pept        334510..338043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0311"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; KEGG: tex:Teth514_0205 SMC
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60089"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARU5"
FT                   /inference="protein motif:PFAM:PF02463"
FT                   /protein_id="ADH60089.1"
FT                   /translation="MRPLKLRISGLNSFAEEQVIDFERLTERGLFGIFGPTGSGKSTII
FT                   DAITLSMYGKIPRNSREFINTNSISTSVSYEFEIGIGAERKRYIVERNIKKDLKTGGYK
FT                   TTLARIREMGEKGEKVLCEGDREVQKKIAEILGLTAEDFTRSVVLPQGKFSDFLKLTGK
FT                   DRRDMLERIFGLEKYGNNLLKKIREVKNEKNLILNRVSGELSRYEGVSSEALQEMTKKL
FT                   EILKGQEEKLAAEKNRLDLEKEKLKAIWEKQQELNQYLQKKELLEGKIEEIERKKVKIK
FT                   KAEKALSVKPYIDAVNETNSKIAQNKEEVEKYTKELTVIEENLKKIEKEYDIALQKKEE
FT                   KIPLLIEKEEKLKRALQIQKEVKTINEEREKLLKTYRAVEKEIEKLKKELEILSNDIEI
FT                   TKKVLEDKDKKIEELKISSGQREKIFSALEVQKEFERIEKDKREKEVKIFELEEAIKRQ
FT                   QKEHERLKNLIKQKEEEIQALEEKIRNLEGHMPPTSDELLIMQQQLEEQKSKFLEAKEN
FT                   DELRQNIKGILDEISDLKGKLKEQIKKLEDDIKTKSKQLENLTKEIEEIQRQNIAGELA
FT                   KDLEEGMPCPVCGSVHHVKLAQKIDEELINEKRAFEEIFKREIEEFQNQLLKLKGELVA
FT                   LEAKEELHKKEYDRVEEKLKGIDIKAFEQNVGQLQLRFEKAKLKTERWNKEKEEINALL
FT                   KKLGEEKAQLDLEEARLKESLGKDVKALKELKVSVEELSRAYSCILDQLESLRTELEIR
FT                   DFKQKVVEINEKDREVEKLQKESELLEKKLEELVNKKEILSNKINELLIKKAQIVEIGK
FT                   EKSKYLQERQKEIDILSEGKEIENYLKEVQRERENILKEEKILKEQFENEKKKRQETEN
FT                   KKVSALENQILLNNMLKDQFEKLNASISKNGFKDEKEVMECFLDEGTIKSLEEEIKNFE
FT                   NEYISICSNIERLDSTLNGQRIEEEVWRNLEEKIKETEQALSEKRKEIGATQKTLEDIQ
FT                   NNLQKVEELTEQKKELEQLLDMLEDLDKLFQGNHFVEFVATRQLKLITFSASKRLKEIT
FT                   RGRYALELDSDNNFVMRDDFNGGTRRSVDTLSGGETFLTSLSLALALSSHIQLKGRAPL
FT                   EFFFLDEGFGSLDSELLDVVMTSLERLRNDKMVVGIISHVEELKNRVPVKLIVIPPSTA
FT                   GEGSKVRIEYS"
FT   gene            complement(338268..338930)
FT                   /locus_tag="Tmath_0312"
FT   CDS_pept        complement(338268..338930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0312"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Peroxiredoxin-like; KEGG:
FT                   tpd:Teth39_2006 putative peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60090"
FT                   /db_xref="GOA:D7ARU6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARU6"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADH60090.1"
FT                   /translation="MEEIRMKLLGEKFPSMEVVTTQGVKRLPEDYAGKWFVLFSHPADF
FT                   TPVCTTEFVEFARKANDFKELNTELIGLSVDQVFSHIKWVEWIKDNTNIAIPFPVIADD
FT                   LGKVSNQLGMIHPGKGTNTVRAVFIVDDKGTIRLIMYYPQEVGRNVDEILRALKALQTA
FT                   DQYGVALPEKWPNNYLIKDHVIVPPSTDEASANERKEKIKSKEIEAFDWWFVHKPLK"
FT   gene            complement(338934..339368)
FT                   /locus_tag="Tmath_0313"
FT   CDS_pept        complement(338934..339368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0313"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: tpd:Teth39_2005
FT                   ferric uptake regulator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60091"
FT                   /db_xref="GOA:D7ARU7"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARU7"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADH60091.1"
FT                   /translation="MKMTYTIEQLKDYLKRHDIKPSTIRIKVLEYLLNNRIHPTADDIY
FT                   QYLINEIPTLSKTSIYNTLELFMEKGVVNALSLKEKELRYDINVYFHGHFKCEICGKVY
FT                   DFPVSEEIINVEELKGFVIKNVDINVYGICKKCNEKNKEA"
FT   gene            complement(339385..339561)
FT                   /locus_tag="Tmath_0314"
FT   CDS_pept        complement(339385..339561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60092"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARU8"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2004"
FT                   /protein_id="ADH60092.1"
FT                   /translation="MEVKELVLKILKESSEPLRPGDIAQKANLDKKEVDKAIKELKKED
FT                   LIISPKRCYYAAK"
FT   gene            339892..340857
FT                   /locus_tag="Tmath_0315"
FT   CDS_pept        339892..340857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0315"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="TIGRFAM: galactose-1-phosphate uridylyltransferase;
FT                   KEGG: tpd:Teth39_2003 galactose-1-phosphate
FT                   uridylyltransferase; PFAM: galactose-1-phosphate uridyl
FT                   transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60093"
FT                   /db_xref="GOA:D7ARU9"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARU9"
FT                   /inference="protein motif:TFAM:TIGR00209"
FT                   /protein_id="ADH60093.1"
FT                   /translation="MSEIRYDLITGKRVIIATERGKRPHDFNVNYEEKKNNTCPFCPGN
FT                   EEMTPPTLVEIKDKKGNWLVRGFENKFAAVNTDLKSFEAPSLYKAEYGYGVAEVIVESP
FT                   EHDVTFGSLSLEQMQKVFMAIIERYKKIAQDDKIKYIQVFKNFGARGGASLEHGHWQII
FT                   ATSFIPDVVEKEVAGTQEYIKKKGKCPYCEIVKYEKEEGKRIISENENFIVIAPYASQY
FT                   PYECWIIPKEHQERFEELKEENVASLTKILKTLIVKYEREFNFPPYNIVVHTLPIYDTR
FT                   NYHWHFEIAPRLTVAAGFELGTGVYINPVPPELAASVLRI"
FT   gene            340883..342451
FT                   /locus_tag="Tmath_0316"
FT   CDS_pept        340883..342451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2002 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60094"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARV0"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2002"
FT                   /protein_id="ADH60094.1"
FT                   /translation="MYISKTFNFEDIPTKLKDILKNINKDNFKKFRWFQEKAYDILDIF
FT                   LFDYAILSKKEAEVIIAAIIAFVVKASTSNKEIMLLYYVPLIITPYFRNNDLIDIIESP
FT                   NLKAFIYDGIDDINYVKFLNKALNEETVIKFESGAKLIPYNLKKDDIYSARRLSNKSSN
FT                   SLTFLQKNEIIKTYRKFVKGVNPDLEMTFELKNAGFGNVQDIRGYFLYEDSSGERYTVA
FT                   IIVEHIKNMGDMWQYTQEYLSSVISTLSDYDKIEESYVEGYLSDYLEEVREIARIIADM
FT                   HIKLSYIDKEDFAKRNVEISDVEEIVKSIKNNFTKLLNFVKLSTFDEQITSMIEEIIKQ
FT                   QEFLMSKLEEFKNSAVLGKYIRCHGDLHLEQILKTEEGYVIIDFEGEPTKPIEMRRKKI
FT                   SPLKDVAGMVRSFSYAAYFNYLNAKGKFQDEKIEKALLWWERAVTETFVENYLELVTRE
FT                   APDIIPDGENFDKALAIFKLDKALFEGIYEVNNRPSWFRIPLKGILECIEDLKLEKHGS
FT                   EVNYG"
FT   gene            342444..343610
FT                   /locus_tag="Tmath_0317"
FT   CDS_pept        342444..343610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0317"
FT                   /product="glycogen synthase"
FT                   /note="KEGG: tpd:Teth39_2001 glycogen synthase; TIGRFAM:
FT                   glycogen synthase; PFAM: glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60095"
FT                   /db_xref="GOA:D7ARV1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011875"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARV1"
FT                   /inference="protein motif:TFAM:TIGR02149"
FT                   /protein_id="ADH60095.1"
FT                   /translation="MDKLKVTMFTNEYPPNIYGGAGVHVDYLVRELSKLMKVDVRCFGD
FT                   QDYTADNLKVRGYKEWDKLKENSDPRYQKVLGPFSIDLAMVKDEIDSDILHCHTWYTFM
FT                   AGFLAKKLYDKPLVVTIHSLEPLRPWKEEQLGNGYKLSSWMERTGIEAADRVIAVSQGS
FT                   KEDILKYYNIPEEKVEVIYNGIDLNQYQKTDRNIARKKYGIEGKYILFVGRISRQKGIT
FT                   HLIDAVKYLPKDIKVVLCASSPDTQEVLEEVEQKVKLYDNIIWINKMVEKEEIIELYSN
FT                   AEVFACPSIYEPFGIINLEAMACKTPVVASATGGIKEVVVHEETGFLVEPGNSEELAKY
FT                   INILLNNKDLAIKFGENGRKRVEEMFSWESIARKTYEMYKDVIEKYKK"
FT   gene            343692..344312
FT                   /locus_tag="Tmath_0318"
FT   CDS_pept        343692..344312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0318"
FT                   /product="SNARE associated Golgi protein-associated
FT                   protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   tpd:Teth39_2000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60096"
FT                   /db_xref="GOA:D7ARV2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARV2"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADH60096.1"
FT                   /translation="MEGQSFLYNAIINYGYIALFIGLLIEGTGAPGPVQILFFAAAYLA
FT                   TKGEMNLFYVIVIATLGNITGNVIAYLVGYYKGRPVVEKYGKYLKITVKDLEAMDKWFA
FT                   KYGGFTVLLGRLIGLPRTPAIWASGITRMNFTAYVIFSAIADFIWSTFWTVVSYLAAVQ
FT                   LIKINFFVKSYSAWVYFASTIGFIIFLYMVWRILLWMKERYLT"
FT   gene            complement(344410..345147)
FT                   /locus_tag="Tmath_0319"
FT   CDS_pept        complement(344410..345147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0319"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   tpd:Teth39_1999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60097"
FT                   /db_xref="GOA:D7ARV3"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARV3"
FT                   /inference="protein motif:PFAM:PF05949"
FT                   /protein_id="ADH60097.1"
FT                   /translation="MKGKVLQTLSFMLVFIAMGLMISIQFKTVQGSNRTSTPTVATNYA
FT                   RSEELTQQLKKVQEEKANLEQQLEELTKRFKEYEDAASKNDAALKNLQQDIEKYKSLAG
FT                   LTDMEGPGVIVTVNDSDLQPRDGEDPNLYLVHDEDLLNIVNELKAGGAEAIAINDQRLI
FT                   ATSEIRCVGPTININSTRYAPPYVIKAIGDPETLKAALNIKGGIIDTLKFYGIKVDIQT
FT                   SDRIVIPKYSEPIKFFYAKPVTN"
FT   gene            345450..346385
FT                   /locus_tag="Tmath_0320"
FT   CDS_pept        345450..346385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0320"
FT                   /product="L-lactate dehydrogenase"
FT                   /note="KEGG: tpd:Teth39_1997 L-lactate dehydrogenase;
FT                   TIGRFAM: L-lactate dehydrogenase; PFAM: Lactate/malate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60098"
FT                   /db_xref="GOA:D7ARV4"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARV4"
FT                   /inference="protein motif:TFAM:TIGR01771"
FT                   /protein_id="ADH60098.1"
FT                   /translation="MNKISIIGSGFVGATTAYTLALSGFVKTIVLIDINKDKAEGDALD
FT                   ISHGVPFISPVEVYAGDYGDAAGSDIIIITAGAAQKPGETRLDLVKRNTMIFKDIVAKL
FT                   IKVNDTAIYLIVTNPVDILTYVTYKISGLPYGRVLGSGTVLDSARFRYLLSKHCNIDPR
FT                   NIHGYIIGEHGDSELAAWSITNIAGIPIDDYCNLCGKACEKDFRDEIFNDVVRAAYTII
FT                   EKKGATYYAVALAVKRIVEAILKDEHSILTVSSPLTGQYGVTNVALSLPSVVGRNGIVN
FT                   ILELPLSQEEIDAFRRSAEIIKGVIQELDI"
FT   gene            346470..346928
FT                   /locus_tag="Tmath_0321"
FT   CDS_pept        346470..346928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0321"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tex:Teth514_0217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60099"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARV5"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0217"
FT                   /protein_id="ADH60099.1"
FT                   /translation="MQKITQQEIILSSFVEAQNLEKILLDKVREYGKESVDNQIKGLLK
FT                   QIEIMIKNHKEDIQKAQKTMHISSLVKKNMSQEPLDMLQDLLKNLVNIQAFYNETVVNV
FT                   TNPYVRQLFTQMRDDVMRFISILQIEIESLESKPSIPNNTVLNTPEMS"
FT   gene            346930..348030
FT                   /locus_tag="Tmath_0322"
FT   CDS_pept        346930..348030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0322"
FT                   /product="dehydrogenase (flavoprotein)-like protein"
FT                   /note="KEGG: tex:Teth514_0218 dehydrogenase
FT                   (flavoprotein)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60100"
FT                   /db_xref="GOA:D7ARV6"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARV6"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0218"
FT                   /protein_id="ADH60100.1"
FT                   /translation="MKVAIIGAGVSGLAAAITFQRYGIIPDIFEKKCKIGDLYNHVAGL
FT                   LKVINRPIKDPLHYLKNVYGIEIKPINTIDKIVMKGPTVTASVNGNNLGYMILKGQDAN
FT                   SLENQLYNKLEIPVNFNIEADYKKLKDNYDYLIIATGSSQIPKELGCWQELVTTWVRVA
FT                   SVLGNFDTKTLIMWINTLYTKSGYVYLIPYNEKRAVLAMVVPYISKEELQYYWDTFLKV
FT                   EKMNVDIVNMVDLEHISGNCFPHQYENLLFVGNAGGAIEPFLGFGTFNSIVSGAIAAKS
FT                   IVQGADFEKEIRFLSEANIKMLEFRKALDLIDNDKLDKLIKILTFPPVKKIVYHTNFNV
FT                   IKYGSIFMRYTMNKMNNKPYEHRKKV"
FT   gene            348033..349100
FT                   /locus_tag="Tmath_0323"
FT   CDS_pept        348033..349100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0323"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   tex:Teth514_0219 dehydrogenase (flavoprotein)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60101"
FT                   /db_xref="GOA:D7ARV7"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARV7"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADH60101.1"
FT                   /translation="MRVAIIGAGVAGLCCAYTLGKLGISCDIYERKHTIGSLYSYGELL
FT                   LHIAHRPCKDPLKFIAKEFGILIEPLNEVRKIVIKSPKREAFIEGKQLGYIVKRGQEQE
FT                   SIENQLAKKINAKINFNINADYRELAKSYDYVVVATGSSMIAKQLTEVKNVVSTRIKGG
FT                   IALGDFEPNTVYLWLNTMYARSGFGYLVPLSKSNASIILVATYTQKEEIENMWHTFLYQ
FT                   EKLDYEMIETFETELDISITDKHQIDNMFLIGNAGGFLDPFLGFGLLNAVESAVYAAES
FT                   IKHGGDYEKKVKRITDRVDKLIGFRKMMDSIKNEDYDRIVKVIENPIVKRVMYRTNLDV
FT                   IKYLHYFIKHQRPSN"
FT   gene            complement(349109..349537)
FT                   /locus_tag="Tmath_0324"
FT   CDS_pept        complement(349109..349537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0324"
FT                   /product="protein of unknown function DUF296"
FT                   /note="PFAM: protein of unknown function DUF296; KEGG:
FT                   tex:Teth514_0220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60102"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="InterPro:IPR025707"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARV8"
FT                   /inference="protein motif:PFAM:PF03479"
FT                   /protein_id="ADH60102.1"
FT                   /translation="MGYKSVSIERRFIGRFQYGKDLLEEINKIITSENIRSGEIRIIGA
FT                   VSKAVFSYYDAQSKNYIYISKDEHMEILNATGNISVKDGKPFAHVHITLADKNGNAFGG
FT                   HLMEGTIIFAAEFVISDYGENKLERIYDETTGLQLWNI"
FT   gene            349787..350794
FT                   /locus_tag="Tmath_0325"
FT   CDS_pept        349787..350794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0325"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: tex:Teth514_0222
FT                   periplasmic binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60103"
FT                   /db_xref="GOA:D7ARV9"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARV9"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADH60103.1"
FT                   /translation="MKTLNENFFRLIDKVILILVILIAALSIFLYKLEKVEEPIFAKTS
FT                   QYHFYMVAQNSVDPFWKEVKMGAMDAAKRYNVAIEFNAPKFNNIQEELQYLDIAILSKV
FT                   DGIITHVSNSKEFVDLIEEAYKEGIPVITIENDAKDSKRQAFIGTNSFQLGEEAGKLMI
FT                   KATKGKANIAIIVSNDYQLDTVNQNLKINGFLDAIKDYPQMKVVKVYTSKLGTLSAEEI
FT                   TQSIISSKQNINAIYTTDSVDTIGTAQVIVDFNKVGEIAVVGYGDTADILRYIDKGIIY
FT                   GTVMSDPYRIGYESVKSMVEIKEKNNVSTFVDIGVNVITKHNVKEYFKRIQLME"
FT   gene            350804..352312
FT                   /locus_tag="Tmath_0326"
FT   CDS_pept        350804..352312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0326"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="KEGG: tex:Teth514_0223 integral membrane sensor
FT                   signal transduction histidine kinase; PFAM: histidine
FT                   kinase internal region; histidine kinase HAMP region domain
FT                   protein; ATP-binding region ATPase domain protein; SMART:
FT                   histidine kinase HAMP region domain protein; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60104"
FT                   /db_xref="GOA:D7ARW0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARW0"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADH60104.1"
FT                   /translation="MKKDVWRFTGIRRKLIVYYLLITVLMGITSFYSYYNTKSVINRLK
FT                   SIFVDYIYLNNLNADVNTLETEVEKYLSTKSSDALLNYYTLYNKLQEQASAILNEKNYD
FT                   QDGLMLKDIGNMIESLLNETDAAINAKRGRISSEYIAHFTRSIRISEYIKLYINNLLNS
FT                   KLQEGSLKYASISKNMEFISYLNVFLIIGSILFNIFLAIFFTYRITKPLMDLSYLAVRV
FT                   SKGDFDVRPVEIETNDEISILAEAFNKMVVSIRNYIGEIKNQAEVEKKLKEQEMQNLKM
FT                   RNILKEAELKALQSQINPHFLFNTLNAAAQLAMMEGADKSSEFIENVAKLFRYNLKKLD
FT                   TTVTLQDEINNVKTYMYILKTRFGDRVDFKVEVDEKVLDVEMPCTIIQPVVENAFIHGL
FT                   EDVEEGGFIKLTVKRDDDKVLIEVVDNGRGMSKEKVKAILSADYEDLSKKHVTGIGLHN
FT                   IINRLRLFYNISAIQDVIEIDSKIGEGTKVTLKIPLMKGDKEND"
FT   gene            352305..353918
FT                   /locus_tag="Tmath_0327"
FT   CDS_pept        352305..353918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0327"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: tex:Teth514_0224 response regulator receiver
FT                   protein; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60105"
FT                   /db_xref="GOA:D7ARW1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARW1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH60105.1"
FT                   /translation="MIRLFIADDEQIVIDSIKFIIEKNDVKADIIGFAKSGREAIEKVE
FT                   ILKPDVVFMDIKMPGIDGIEAIKQIKERHKDIIFVIITAYEYFNYAKEAIDLGVLDYLL
FT                   KPLNRNKVVEAIKKAIEVIEKRREAMLKELELKEKLNKIIPYLEGQFLYTTLFSGITYD
FT                   DLSFYEEIFGIKLQRGYAMIVTVDDVDNNLKGQTLKLSIDKQNFYDHFKTIVKNIKKCL
FT                   VGYFFIDKVFVYFPVVEEDSFEIKNDSIETAQKIIEAINQKVKIPYRIGIGRAYNFENI
FT                   LKSYYEAEMALKMEKNELIAHFDDIAMPQNRFKPYPINKERLFIDRLMAGDLQGSFTIF
FT                   NEIYEWMVLEYQEDVDKIKSKLIEIIGVIKRNLSYYVEEEKFIENRELEEILKINDVDK
FT                   IKFIFINTLKNLFDSIKTINKEKMDTLMTKIIRFIENNFNKDITLDDVAKEVNMSYHYF
FT                   SKFFKDQTGKNFVDYLTNLRVTKARELLEDESVSIKEVCYKVGYSDPNYFSKIFKKATG
FT                   MTPTEYRLAIYKKGGVVGGE"
FT   gene            353908..354987
FT                   /locus_tag="Tmath_0328"
FT   CDS_pept        353908..354987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0328"
FT                   /product="monosaccharide-transporting ATPase"
FT                   /note="KEGG: tex:Teth514_0225 monosaccharide-transporting
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60106"
FT                   /db_xref="GOA:D7ARW2"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARW2"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0225"
FT                   /protein_id="ADH60106.1"
FT                   /translation="MESKNVIKVIVAIVLMIIFGVLVFLTVKHVVAYREVKSVNSNLDK
FT                   KGHKIKIGFSLGTLKEERWIKDRDIVMAKLRELGAEVLVQNANNDDQDQLKQVRYLLDQ
FT                   KIDVLIIVPNDLEKASYAVSLAQKEGVKVISYDRLVTKSNVDLYISFNNIKVGKLMAEY
FT                   LVKRVPRGNYLIINGATTDNNTKMIKEGYDSVLKPRIESGDIKIVKEDWAPNWMTEYAF
FT                   NSTDELLQKGVKIDAVIAGDDALAGGIIEALSEHRLAGKVLVAAQDADLAACQRIVEGT
FT                   QAMTVYKPIDKLAEATAKMAMKLARGEKLDVKNTIYDGKYYVPYYVLEPIAVDKTNIDD
FT                   TVIKDGFHNRDEVYRNVFK"
FT   gene            355163..356248
FT                   /locus_tag="Tmath_0329"
FT   CDS_pept        355163..356248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0329"
FT                   /product="D-xylose ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /note="KEGG: ate:Athe_0105 D-xylose ABC transporter,
FT                   periplasmic substrate-binding protein; TIGRFAM: D-xylose
FT                   ABC transporter, periplasmic substrate-binding protein;
FT                   PFAM: periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60107"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARW3"
FT                   /inference="protein motif:TFAM:TIGR02634"
FT                   /protein_id="ADH60107.1"
FT                   /translation="MVKSKKLLAFFLVMILTLSVVLAGCTSSKTNETTNTTSSNGSSST
FT                   ETKKIKIGFSLPTMREERYQRDRDAFVEEAEKLGAEVLVQGANNDENLQNSQVENLITQ
FT                   GIDVLVLDPQNAASAATLVEKAHQAGIKVISYDRLILNSEPDVYISFDNERVGELQGEF
FT                   LTKLVPKGTYFIFAGAPTDNNATLFKKGAMKYIQPLVDKGDIKIAFDQAIKDWDPNEAL
FT                   KLAENALTANKNKVDAILAPNDGTAGGIIQALAEQKLAGKVPITGQDAELAAVKRIVEG
FT                   TQSMTVFKDVRVLARKAAQIAVMLAQGKEVKDIPEINKTVNNQKIDVPSLLLTPVVITK
FT                   DNIDKELIDSGWFTREQVYGK"
FT   sig_peptide     355163..355255
FT                   /locus_tag="Tmath_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.386 at
FT                   residue 31"
FT   gene            356308..357825
FT                   /locus_tag="Tmath_0330"
FT   CDS_pept        356308..357825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0330"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_0106 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60108"
FT                   /db_xref="GOA:D7ARW4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013455"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARW4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH60108.1"
FT                   /translation="MSEYILEMRNITKEFPGVKALDNVNFKVKRGEIHALVGENGAGKS
FT                   TLMKILSGVYPYGTYKGDIIIDGEVKQFRNIKDSEKSGIAIIYQELTLVKYMTVGENIF
FT                   LGEEPVKGGIIDWMKVYSETYRLLKELQINVNPYTKVMNLGIGHQQMVEIAKALSKKAR
FT                   ILILDEPTSALTESETEHLLNILKDLKKNGVTCIYISHKLNEVFEIADSITVLRDGKTI
FT                   MTDKKENFTENKVISLMVGRELTQRFPRAKHTPGEVVFEVKNYTVYDHEIPGKKIIDNV
FT                   SFKARRGEILGIAGLMGAGRTELAASIFGAFKGRKEGEIYLNGKKIEINTPSDAIKHGI
FT                   AYLSEDRKRFGLVTLMDVQENIALPNYDRLSKFSIINNNAKIKHAEKYVKELKIKTPTI
FT                   RQRVANLSGGNQQKVVIAKWLMSDPKVLILDEPTRGIDVGAKFEIYNLMNKLVDMGVCV
FT                   IMISSELPEILGMSDRILVIHEGKINGEFPIEEADQEKIMYCATGGK"
FT   gene            357828..358994
FT                   /locus_tag="Tmath_0331"
FT   CDS_pept        357828..358994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0331"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ate:Athe_0107 monosaccharide-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60109"
FT                   /db_xref="GOA:D7ARW5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARW5"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADH60109.1"
FT                   /translation="MMESKVSKTTEKRILNHFKIDIRSYTMILALLGIWIIFSILTHGD
FT                   FLSPRNLSMLARQMSITAILASGMVLVIVAGHIDLSVGSVAGFTGAIAAILQVIYHWDT
FT                   VPTIIVTLMAGLAIGVWQGFWIAYRKVPAFIVTLSSMLVFRGGILLITKGVTISPLKQD
FT                   FTVVGQGYIPPLFSVILAVVAGVLYVIMDLKNRNSRIKYGLSVSSWGIELAKIAGVLIF
FT                   IALFTSVMISYEGIPVPVLLVLVIVILLTFVAQNTTFGRYVYAIGGNKEAAAYSGINIA
FT                   KTNMTIFLIMGVLSAIAGIVLTSRLNAATTSAGNLFELDAIASAIIGGTSTLGGEGTVP
FT                   GAILGALIMASIDNGMSLMNIDYSILTIVKGLVLVLAVWVDISTKKRG"
FT   gene            complement(359046..360500)
FT                   /locus_tag="Tmath_0332"
FT   CDS_pept        complement(359046..360500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0332"
FT                   /product="Glycine cleavage system P-protein-like protein"
FT                   /note="PFAM: Glycine cleavage system P-protein-like; KEGG:
FT                   tex:Teth514_0229 glycine dehydrogenase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60110"
FT                   /db_xref="GOA:D7ARW6"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023012"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARW6"
FT                   /inference="protein motif:PFAM:PF02347"
FT                   /protein_id="ADH60110.1"
FT                   /translation="MKEYNKLIFELSKKERKAYTFPKLDVEEKTLEEILPEQMIRKEEI
FT                   ELPEVSEVDIIRHYTLLSNKNYGVDTGFYPLGSCTMKYNPKINEDMASLTGFTALHPYQ
FT                   PVETVQGALKLMYELENMLSEITGMDKFTLQPAAGAHGELTGLMIIKAYHEHRNDKKRK
FT                   KIIVPDSAHGTNPASATVAGFDVIEIKSNKEGAIDLEALKTVLNEEVAGLMLTNPSTLG
FT                   LFEENIVEIARLVHEAGGLLYYDGANMNAIMGITRPGDMGFDVVHLNLHKTFSTPHGGG
FT                   GPGSGPVGVKKELADFLPVPVIEFKDGMYTLNYDRPLSIGKVRSFYGNFNVLVKAYSYI
FT                   LTMGAEGLKRASEMAVLNANYLKEKLKNHYKVAVDKVCMHEFVLAGLLEKVNDIRTLDV
FT                   AKRLIDYGFHPPTIYFPLIVEEAIMIEPTETENKETLDAFIEAMIKIAEEAKENPQLLK
FT                   EAPHNTPVRRVDEVLAARNPVLKCSK"
FT   gene            complement(360501..361841)
FT                   /locus_tag="Tmath_0333"
FT   CDS_pept        complement(360501..361841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0333"
FT                   /product="Glycine dehydrogenase (decarboxylating)"
FT                   /EC_number="1.4.4.2"
FT                   /note="KEGG: tpd:Teth39_1990 glycine dehydrogenase subunit
FT                   1; PFAM: Glycine cleavage system P-protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60111"
FT                   /db_xref="GOA:D7ARW7"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARW7"
FT                   /inference="protein motif:PRIAM:1.4.4.2"
FT                   /protein_id="ADH60111.1"
FT                   /translation="MFPYLPISSHDEKEMLTSIGKSSVEELFENIPKEVRLNRSLNLAK
FT                   PMSEIELKRHIKRYAEQNRNLEELISFLGAGVYDHYIPSIVKHIISRSEFYTAYTPYQP
FT                   EISQGTLQAIFEYQTMICNLTEMEVTNASMYDGATACAEAAIMACENTKRKTILVSKTV
FT                   NPETRKVLKTYMHFRDIQVIEIEDTEGVTDIENLKNKIGSNAAAVIVQYPNFFGIIEDL
FT                   QQIEKITHENKAMLITYVHPIPLGILKSPGEIGADIAVGDGQSLGNGLNFGGPYLGFLA
FT                   TTQKLVRKMPGRIVGQTKDVDGKRAFVLTLQAREQHIRREKATSNICSNHSLNALTAAV
FT                   YLATMGKKGIKEVAYQCTQKAHYAFSVLTASGKYKPAFTKPFFMEFAIKSEIDIDIINQ
FT                   KLLENGILGGYNLHRDYDKYKNTMLLAFTEKRTKEEIDRLKALLEVI"
FT   gene            complement(361846..362226)
FT                   /locus_tag="Tmath_0334"
FT   CDS_pept        complement(361846..362226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0334"
FT                   /product="glycine cleavage system H protein"
FT                   /note="KEGG: tex:Teth514_0231 glycine cleavage system
FT                   protein H; TIGRFAM: glycine cleavage system H protein;
FT                   PFAM: glycine cleavage H-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60112"
FT                   /db_xref="GOA:D7ARW8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARW8"
FT                   /inference="protein motif:TFAM:TIGR00527"
FT                   /protein_id="ADH60112.1"
FT                   /translation="MEVLEGLYYSKDHEWVKVEGDKAYIGITDYAQHSLGNIVYIELPE
FT                   VGAELNAGDVLGVVESVKAASDVYTPVDGKVLEVNNAIVDDPSLVNNDPYGSWMILVEL
FT                   KDRSQLENLMTAEEYKKFLDEE"
FT   gene            complement(362242..363348)
FT                   /locus_tag="Tmath_0335"
FT   CDS_pept        complement(362242..363348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0335"
FT                   /product="glycine cleavage system T protein"
FT                   /EC_number="2.1.2.10"
FT                   /note="TIGRFAM: glycine cleavage system T protein; KEGG:
FT                   tpd:Teth39_1988 glycine cleavage system
FT                   aminomethyltransferase T; PFAM: glycine cleavage T protein
FT                   (aminomethyl transferase); Glycine cleavage T-protein
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60113"
FT                   /db_xref="GOA:D7ARW9"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARW9"
FT                   /inference="protein motif:TFAM:TIGR00528"
FT                   /protein_id="ADH60113.1"
FT                   /translation="MDSLKKTPLFDLYKKYNGKIIDFAGWALPVQFESIISEHEAVRNA
FT                   AGLFDVSHMGEIIVKGREAFAFLQNLITNDLSKLKENQVLYTFMCNYNGGVVDDLLIYK
FT                   YSDEHFLLVVNAANIEKDYKWMNDNKGVYAVEINNISDEISELAIQGPKAEEVLEKLTD
FT                   TDLSQIKFFYFKDNVKIAGINSLISRTGYTGEDGFEIYIPNKYAVELWEKIIEVGKEYG
FT                   LKPAGLGARDTLRFEAGLPLYGNELSEEITPLEAGFEFFVKFDKGNFIGKDALLKQKEE
FT                   GLKRKIVGFEMIDNGIPRHGYEVRAHNQKIGYVTTGYFSPTLKKNIGLALIDVKYAKLG
FT                   NQIEIVVRNKPLKASIISKNFYKKNYKK"
FT   misc_binding    complement(363423..363493)
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score
FT                   42.31"
FT   misc_binding    complement(363496..363601)
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score
FT                   55.38"
FT   gene            363704..364684
FT                   /locus_tag="Tmath_0336"
FT   CDS_pept        363704..364684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0336"
FT                   /product="lipoyltransferase and lipoate-protein ligase"
FT                   /note="KEGG: tex:Teth514_0233 lipoyltransferase and
FT                   lipoate-protein ligase; TIGRFAM: lipoyltransferase and
FT                   lipoate-protein ligase; PFAM: Lipoate protein ligase-like;
FT                   biotin/lipoate A/B protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60114"
FT                   /db_xref="GOA:D7ARX0"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARX0"
FT                   /inference="protein motif:TFAM:TIGR00545"
FT                   /protein_id="ADH60114.1"
FT                   /translation="MLYIYNKNTNPYFNLAAEEYILKEFQEECFMLWRNEPSIIIGKNQ
FT                   NTLAEINLDYVRQHKIPVVRRLSGGGAVFHDLGNLNFTFIVNEDVSSFSDFKRFTQPII
FT                   DVLRKLSINAEFSGRNDITIDGKKISGNAQYYYKNRILHHGTLLFSSSITDLSAALKVR
FT                   PVKFEDKGVKSVSKRVTNISEHLKEPITIEQFIDLIMNHIREQTGGSEMYEFTQEDIKK
FT                   IEKLVREKYSTWEWNFGTSPDYKFKNEKKFAGGTVEVNLNVEKGIIKDVKICGDFFGKY
FT                   DVSEVENLLKGVKHSEEEIKKVLSNIDINDYLANITVDNLIEVMF"
FT   gene            364844..366499
FT                   /locus_tag="Tmath_0337"
FT   CDS_pept        364844..366499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0337"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="KEGG: tex:Teth514_0234 dihydrolipoamide
FT                   dehydrogenase; TIGRFAM: dihydrolipoamide dehydrogenase;
FT                   PFAM: pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; biotin/lipoyl
FT                   attachment domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60115"
FT                   /db_xref="GOA:D7ARX1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARX1"
FT                   /inference="protein motif:TFAM:TIGR01350"
FT                   /protein_id="ADH60115.1"
FT                   /translation="MDIEIKVPAFSDTMKSGRITKWYVEEGQYVEKGACLCDIAVNKVN
FT                   FEVYSDYEGIISKIVCHPGSTVEPGDVIAIVTQSEEVKPSVTQKEIKYEYKEYDLAVIG
FT                   AGPGGYVAAIKAAKKGAKVALFEKDKLGGTCLNRGCIPTKAYARIAEVYDILKRAGEFG
FT                   FDVKVNSFDYTQVVKRKDGIVGELVEGINALLKANGVDLFYAEAKVDKEKNVLFGENKI
FT                   KAKNIIIATGSSPAELPIEGINSKNVMNSDTILEMTSLPQSLCIIGGGVIGMEFAFIMN
FT                   QFGIKVSVVEMMPDILPTLDKEVSSFIRAIAQKRGIRIYTSSTVERIDEEENGGSIVTV
FT                   KNGENIKRIYADKVFVSIGRKLNTDIGPITELLEFEGRAIKVDKHMRTNVEGVYAIGDV
FT                   TGKMMLAHVASAQGEVAVDNIFGESSTLDYMKIPAAVFTEPEIGYFGYTEEEARNKFQE
FT                   VKVGRFNFEHNGRAKTYGETEGFAKVISNEKGEVVGAWVVGSGASELIHILSTACQEGV
FT                   NAEALKKVVYAHPTRSETIMEAVKDIFGESIHKV"
FT   gene            366588..367031
FT                   /locus_tag="Tmath_0338"
FT   CDS_pept        366588..367031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0338"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: tpd:Teth39_1985
FT                   OsmC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60116"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARX2"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ADH60116.1"
FT                   /translation="MAIETFKAVSRKLPEGLAVESEVRGFKIILDEPKELGGTNKGMNP
FT                   VEALLCALGSCQTIVASVFAKAKGINLQDFWVELEGDLDTDGFMGKAGVRPGFQEIRFK
FT                   MHIKTDAPKEKVEEFAKFIEKTCPVGDSLANPVKLVLSDVIVE"
FT   gene            complement(367132..368001)
FT                   /locus_tag="Tmath_0339"
FT   CDS_pept        complement(367132..368001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0339"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1950 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60117"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARX3"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1950"
FT                   /protein_id="ADH60117.1"
FT                   /translation="MKGRNQMSQKYDIAMKNIFSDMADDIMSYFLGLTSVKIDELNIEF
FT                   AKIEKRESDMIFKCTTDTGDIAVHIEFQSSNDNKMPYRMLRYAIEVIEKYNLMPYQVVI
FT                   YLGRHELKMVDSINFNFSKENLLNYRYKIIDIGNIKFSEITQTNYYDLYSLLPLIDKKR
FT                   REEEGEKYLEKCVKAIKNMQVDIDKKRNIAFKAEILAGIVYKKEVIERVFREVEKMFRL
FT                   EESETYKMIIEKGIEKGIEKGIEKGIEKGKKEGKIAVAKKLLEKGMDIDEIAEITELSK
FT                   EEIKKLLN"
FT   gene            368161..369327
FT                   /locus_tag="Tmath_0340"
FT   CDS_pept        368161..369327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0340"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   tpd:Teth39_1984 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60118"
FT                   /db_xref="GOA:D7ARX4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARX4"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADH60118.1"
FT                   /translation="MNFEDRVAKRAKSIEISTIRYFFNMAKEVPGAISLAIGEPDFVTP
FT                   EHIREAAKKALDEGKTGYTVNPGLIELRQEISNYLKKRYNLSYNPETEILVTIGATEAI
FT                   YVALNTLAEEGDEVLIPEPSFVAYNPCTILAGAKSVFVPTYEEDDFVLRADVLEKYITD
FT                   KSKVLILPYPNNPTGAVMPKEAMEKIAEVVKKHDLIVVTDEIYSELIYSGFEHVSFASL
FT                   KDMWERTVTINGFSKSYAMTGWRLGYIAAPEYFVKHMTKVHQYSVTAAATMCQYAGIEA
FT                   IKNGDEDILKMREEYDRRRKYLLQSVREMGLDCFEPKGAFYIFPSIKKTGLTSEEFAKR
FT                   LLFEAKVAVVPGNAFGENGEGYVRMAYATSMENLEEAVKRMKEFMSKF"
FT   gene            369471..371579
FT                   /locus_tag="Tmath_0341"
FT   CDS_pept        369471..371579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0341"
FT                   /product="PTS modulated transcriptional regulator, MtlR
FT                   family"
FT                   /EC_number="2.7.1.69"
FT                   /note="KEGG: tex:Teth514_0237 transcriptional
FT                   antiterminator, BglG; PFAM: phosphoenolpyruvate-dependent
FT                   sugar phosphotransferase system EIIA 2; PRD domain protein;
FT                   Helix-turn-helix type 11 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60119"
FT                   /db_xref="GOA:D7ARX5"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARX5"
FT                   /inference="protein motif:PRIAM:2.7.1.69"
FT                   /protein_id="ADH60119.1"
FT                   /translation="MIIITLNERCTQILVKLINSNAPIKISDLAKIFNVSSRTIRYDLD
FT                   TIDEFLKYNNLPQLMRKPNVGVKFSELLEHRNKVLSLLDNLNIYYYNLSQKERVNIILS
FT                   ELIQQKDYITINSIADKLMVSRSTIIKDLKDVREWLTRHGLQLKSVPKYGIKVVGDEKR
FT                   LRRAAIELLTEVIDVNKALDIVKSPIYTRSSVGIDKQITKLFEDIDIPYIEECIQIAER
FT                   ELETVFSDAAFSGLVIHIAIAIKRIQLGKDIIMPKEELKALEITKEFAVASNIAKMLED
FT                   HFKVSIPHDEIGYITVHLLGSNVTKTRPYANENWVEYQLLTEKIIRNVSSKINQDLSGD
FT                   RQLFEGLLDHLRPTVYRLRHGLKLKNPILDEIKANYKKLFEIVKESLKPLEDYTGKELN
FT                   DEEIGYFTIHFGAAIEKLNIAKAPKLNILVVCGTGIGTAKLLSSRLQSVFDVNIVDTVA
FT                   CHQVKEILKEKDIDLIVSTVPIPYEGIKAIEVNPLLTEKDIELLKSLIIKPKVQHTVID
FT                   DLIKIIEKHCVINNREKLMEDLSKFLNKASYENARGVVQPVLKDLLTKETIKLNVEAKD
FT                   WEEAVRIGGELLEKSGAIEPRYIDAMINTVKEIGPYIVIAPGIAMPHARPEAGAKKIGM
FT                   SLITLKNPVNFGNKENDPVKIVVSLCAIDHSSHLKALSELVELLGDENTVKTICEASDV
FT                   EEVVNLIK"
FT   gene            371845..373260
FT                   /locus_tag="Tmath_0342"
FT   CDS_pept        371845..373260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0342"
FT                   /product="putative sugar-specific permease SgaT/UlaA"
FT                   /note="PFAM: putative sugar-specific permease SgaT/UlaA;
FT                   KEGG: str:Sterm_0142 putative sugar-specific permease
FT                   SgaT/UlaA"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60120"
FT                   /db_xref="GOA:D7ARX6"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARX6"
FT                   /inference="protein motif:PFAM:PF04215"
FT                   /protein_id="ADH60120.1"
FT                   /translation="MQIIIHGFELFSNNILTKPEFFVGLIVMIGYLLLRKPFYEAFGGF
FT                   IKATVGYMLLNVGAGGLVVTFRPILAGLNERFNLNAAVIDPYFGLNAVNEGLKSIGLTS
FT                   SWTLISLLIGFVWNIILVLFRKHTKIRTLFITGHIMVQQATTATWLVFLALPAMRNVQG
FT                   AILVGLLVGTYWAVFSNLTVEATRDLTGNAGFAVGHQQMLGVWLSDKIAGKIGDKEKSV
FT                   ENLKLPGWLSMFNDNVVASGTLMLVFFGTIMIILGEPFMREIDSSFTPTLAFPTYIVSK
FT                   SLMFAVYLVILMSGVRMFVAELVNSFQGIADRVLPGSLPAVDCAATYAFSSPNAVLWGF
FT                   IFGAIGQFLAVAALFIFKSPIMIIPGFVPVFFDNATLAVFANKKGGFKAAAILTFLSGI
FT                   IQVLGGAFAAMYFGLYQYGGWHGNFDWDTLWPVIGLIIGKLHVLGIIAVIILMLLIPQF
FT                   QYTKSKDHYFEVG"
FT   gene            373399..373689
FT                   /locus_tag="Tmath_0343"
FT   CDS_pept        373399..373689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0343"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; KEGG:
FT                   cbk:CLL_A3264 PTS system enzyme IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60121"
FT                   /db_xref="GOA:D7ARX7"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARX7"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ADH60121.1"
FT                   /translation="MLRVIAACGNGMGSSQLIKMKIEKTLKKLNISAKVDHMSVGEAKS
FT                   VGENYDVIFCPKHLMSNFSCIDNNRTKIIGLINLMSEKEIEEKIKEYLMRL"
FT   gene            373703..374350
FT                   /locus_tag="Tmath_0344"
FT   CDS_pept        373703..374350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0344"
FT                   /product="Orotidine 5'-phosphate decarboxylase"
FT                   /note="PFAM: Orotidine 5'-phosphate decarboxylase; KEGG:
FT                   cro:ROD_32501 3-keto-L-gulonate-6-phosphate decarboxylase
FT                   (L-ascorbate utilization protein D)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60122"
FT                   /db_xref="GOA:D7ARX8"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARX8"
FT                   /inference="protein motif:PFAM:PF00215"
FT                   /protein_id="ADH60122.1"
FT                   /translation="MFPKLQIALDNASFSEAITDIKDVVNEIDIIEVGTILLCSEGKRV
FT                   VKYLKTLYPNKIIVADAKIADAGKIITSMMFDVGADWTTVICSADISTVKGALEIARQA
FT                   EKDIQIELIGHWSFDQAQQWRSVGVKQVVYHRSRDAQASGVKWGPEDLNKIEKLCSMGF
FT                   NVTVTGGITAEDIKLFKDLPIYVFIAGRAIREAKYPNQAANQFKQEIMKYWK"
FT   gene            374352..375203
FT                   /locus_tag="Tmath_0345"
FT   CDS_pept        374352..375203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0345"
FT                   /product="hexulose-6-phosphate isomerase"
FT                   /EC_number="5.1.3.22"
FT                   /note="TIGRFAM: hexulose-6-phosphate isomerase; KEGG:
FT                   hdu:HD1864 putative L-xylulose 5-phosphate 3-epimerase;
FT                   PFAM: Xylose isomerase domain protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60123"
FT                   /db_xref="GOA:D7ARX9"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARX9"
FT                   /inference="protein motif:TFAM:TIGR00542"
FT                   /protein_id="ADH60123.1"
FT                   /translation="MENLIGIYEKALPKNLDWFCRLKLARELGFDFVEISIDESDERLE
FT                   RLYWPKEQKIRLVQDIFASGVPIMTMCFSGHRRYPLGSNSKQIRDKAMELMHKAILFAK
FT                   DTGIRVIQMAGYDVYYEKSTPKTRRWFFEGLERSIELAEKYQVMLAMEVMDTPFINSIT
FT                   KYLEIEEMFNSPWFAVYPDLGNLSAWNNDVVKEIEKGFHKIVAVHVKDTLAVTDTCKGK
FT                   FRDVPFGSGCVDFVTAFSILKKLGYKGPFVIEMWSEKSQDPVAEVISAKEWVIARLKEG
FT                   GF"
FT   gene            375203..375898
FT                   /locus_tag="Tmath_0346"
FT   CDS_pept        375203..375898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0346"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: smf:Smon_1319 L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60124"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARY0"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ADH60124.1"
FT                   /translation="MLEILKKEVLEANLEIKNKGMVIYTWGNVSGIDRRQGLVVIKASG
FT                   VSYEEMTEDHMVVLDLEGNVIEGRYRPSSDTPTHLALYKAFPEIGGITHTHSPWATAWA
FT                   QASRDIPVYGTTHADYFYGTIPCTRAMKEEEIKNDYEVQTGNLIIRTIKEKGLDPLKVP
FT                   GVLVSGHGPFVWGKNPGEAVYNAVVLEEVAKIAFMTENINSHASPICKALLDRHYFRKH
FT                   GSNAYYGQK"
FT   gene            376314..377378
FT                   /locus_tag="Tmath_0347"
FT   CDS_pept        376314..377378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0347"
FT                   /product="putative L-ascorbate 6-phosphate lactonase"
FT                   /note="KEGG: cpf:CPF_0643 putative L-ascorbate 6-phosphate
FT                   lactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60125"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARY1"
FT                   /inference="similar to AA sequence:KEGG:CPF_0643"
FT                   /protein_id="ADH60125.1"
FT                   /translation="MTKIEEITRETWILNTFPEWGTWLNEEIEEEVVQPNTFAMWWLGC
FT                   AGIWIKTENGTNICIDFWVGSGKRTKTKQYMDAHHQMARMTGGRKLQPNLRNVPVVLDP
FT                   FAIRKIDAVLATHDHSDHIDINVAAAIIKNCDDSVPFIGPKTCADLWISWGVPKERCII
FT                   VKPGDAIKIKDVEILALESFDRTAAITAPKGITLKGRLLDDLNKKAVNYLVKTPGGNIY
FT                   HSGDSHYSNYYAKHGNDHQIDVALASFGENPRGVTDKMTACDVLRMAEALNTKVIIPVH
FT                   YDIWTNFQADPKEISVLYEMKKNRLQYKFKPFIWQVGGKFVYPDDKDKIEYHYPRGFDD
FT                   CFTNEPDLPYIFYL"
FT   gene            377630..377875
FT                   /pseudo
FT                   /locus_tag="Tmath_0348"
FT   gene            378326..378520
FT                   /locus_tag="Tmath_0349"
FT   CDS_pept        378326..378520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tad:TRIADDRAFT_54508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60126"
FT                   /db_xref="GOA:D7ARY2"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARY2"
FT                   /inference="similar to AA sequence:KEGG:TRIADDRAFT_54508"
FT                   /protein_id="ADH60126.1"
FT                   /translation="MELRKRLLKIVGIIFTIIGLFSIIVIIKSIISMDMKFFANIVNIL
FT                   DIFVSLLFLYIGYIILRYS"
FT   gene            379026..380195
FT                   /locus_tag="Tmath_0350"
FT   CDS_pept        379026..380195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0350"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   tex:Teth514_0241 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60127"
FT                   /db_xref="GOA:D7ARY3"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARY3"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ADH60127.1"
FT                   /translation="MENFVFSSPTKIIFGKGTEHQVGEEVKNYSSKVLLCYGGGSIKKT
FT                   GLYDKVVDSLKEAGIEFIELSGVKPNPRLGLVQEGIKLCRENNIDFILAVGGGSVIDTA
FT                   KAIAMGVPYDGNVWDFFVGKAKLERALPVGVILTIPATGSEASDATVITNENGWYKRGF
FT                   HHDLIRPKFAIMNPELTYTLPNYQTACGVADIMAHVMERYFTNVKNVDLTDRLCEATLK
FT                   TVINNVRIVLKDPTNYNARAEIMWAGTIAHNDLLSTGRIGDWASHKIEHELSAIYDIAH
FT                   GAGLAIVFPAWMKYVYKHNINRFVQFAVRVWDVDLPYENLEDIALEGIKRMTEFFKEIG
FT                   LPVTLKEAGISDDRFEEMANKCTDNGNKKIGNFVKLGKEDVINIYKLAK"
FT   gene            380363..382888
FT                   /locus_tag="Tmath_0351"
FT   CDS_pept        380363..382888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0351"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="KEGG: tte:TTE0314 membrane carboxypeptidase
FT                   (penicillin-binding protein); TIGRFAM: penicillin-binding
FT                   protein, 1A family; PFAM: glycosyl transferase family 51;
FT                   penicillin-binding protein transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60128"
FT                   /db_xref="GOA:D7ARY4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARY4"
FT                   /inference="protein motif:TFAM:TIGR02074"
FT                   /protein_id="ADH60128.1"
FT                   /translation="MNNNANLKRSERKKHKVKGKNKSTAVVILKFIIYAVIILIFAGIG
FT                   AIGGKVLAIIKNTPPISQEALTAQRQSSIVYAKDSNGQWQRVAILHGADNRLWVPIEKI
FT                   PKDLQNAFVAIEDQRFYKNNLGIDPKRIIGALIADIKAGGKPVQGASTITQQLVKNTML
FT                   SSEKTLTRKIQEAILAWQLEQKYSKQQILEAYLNTIYLGGPDVNAYGVQAAALAYFGKD
FT                   VSQLSLAECAMIAGITNNPSLYSPYANLEAATKRQHLVLQKMLEQGYITKEQYDEAIAE
FT                   KLEFKKTDFTTYDHKYFIDQVINDVAEELSKKLSISHDEAINKIYNGGLRIYSTMDLKI
FT                   QSYIEEAFKNPELFPVNSKIKEEVQGAMVVMDWKTGEVKGIVGGRDSSNIVRGFNRATQ
FT                   AYRQPGSSIKPLTVYGPALESGLTAATVVDDVPTSFGNWTPHNYESSTYRGLVTLREAL
FT                   TDSLNVPAVKVVDRIGIATSANYGKKFGLTITDNDMYLPALALGGLYKGITPLQEAAAY
FT                   GAIANGGVYTTPITFTKVTDSEGNLILENKPLRHVVLSEQSAYILTSMMQDVVKYGTGS
FT                   RAKLPNMPVAGKTGTTDKYTNAWFSGFTPYYVATVWMGYDNNSISLYDSRTGRNVVGGT
FT                   YPAQLWKTVMLQIHKDLPYKDFVRPPGIISATVCKDSGELPTDLCHLDPRGGRAYTEIF
FT                   AQGTQPTTYCSVHVAVKINSQNGKLATDLTPPDLVKDAVFIDPPGRTPEQNAVARDGKY
FT                   VVPTEYDDTTSILPENNEPTNETVPPDNSQQPSSDNNNNNAQPPDEQLPNTPPNNNGNT
FT                   QTNPDNTQDTNSNSNILQKLFPNRGNGRP"
FT   gene            383107..384270
FT                   /locus_tag="Tmath_0352"
FT   CDS_pept        383107..384270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0352"
FT                   /product="aminopeptidase-like protein"
FT                   /note="KEGG: tex:Teth514_0244 aminopeptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60129"
FT                   /db_xref="GOA:D7ARY5"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARY5"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0244"
FT                   /protein_id="ADH60129.1"
FT                   /translation="MKSIYYLKELTKFGHRGSATKNEKQAADYILNELKKMGYKVEIQT
FT                   FKTTRDNLYMLPLQVGVLLFICGLFSLMYGRPLEIAAFLLSLFAISLLLLEVSGKPIET
FT                   SIMPRHLSQNVFTTFDESRSKRIIVSAHYDTQRGSLMFHPKIVDKLSIIYNICYVGFGL
FT                   VPIGILLKALKLNVIAYISLYLGLFIVFVTVIFMAICEVTGRYTQGANDNGTGTALTLA
FT                   LANCYINNKDKFPDNVDVIFLFTGSEEAGERGMKNFIKKYGKKLPKDTQFIILDNLGSG
FT                   KITYLEGEGIVFYKRASELLFDVAEDMAKGHADKVQKMKNLLLPTDALPAMAAGFDAIA
FT                   FLAKDEKGRLGNYHWYTDTIENVDTELLDYEEEFFKEYLLKVAQRLN"
FT   gene            384598..385182
FT                   /locus_tag="Tmath_0353"
FT   CDS_pept        384598..385182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0353"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: tpd:Teth39_1964
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60130"
FT                   /db_xref="GOA:D7ARY6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARY6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADH60130.1"
FT                   /translation="MGDSVKEKIVMSTLKLISEKGYKSTTTKNIAEEAGVNEVTIFRCF
FT                   GSKKDIVLYALKELELLKPVNEKILDKCIWNLKEDLIMLAHEYHKNFTEEKAKIMMGLR
FT                   SPEIFEEVKEYLMKIPKGFKEVLIKYFEKMYEKGLLNTDNFELLAFAFMSLNFGFILMN
FT                   VSYGNKLIGFGDSEFVKKTIEIFVRGVEKSD"
FT   gene            385232..386230
FT                   /locus_tag="Tmath_0354"
FT   CDS_pept        385232..386230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0354"
FT                   /product="Protein of unknown function DUF2229, CoA enzyme
FT                   activase"
FT                   /note="PFAM: Protein of unknown function DUF2229, CoA
FT                   enzyme activase; KEGG: tpd:Teth39_1963 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60131"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARY7"
FT                   /inference="protein motif:PFAM:PF09989"
FT                   /protein_id="ADH60131.1"
FT                   /translation="MKIGIPKALMYYFYYPFWKTLFESLGFEVVTSGDTSKSVLDAGVK
FT                   EAVAEICVPMKVYTGHILNLLDKNVDYIYIPRFVSLRRGIFMCPKFMGLPDMIKGLFDG
FT                   IEDKILTHSIVAKSTDIAEFHNYTVFIDKLGVSRRDLKNALKKARSKWLEFRVLNKQGY
FT                   DLNELLTNEEPKKYDGDITIGLIGYVYNVYDRFVNMDLLNVFRKLNIKVVTFDMMEEKV
FT                   IQRQLKKFKKNMFWEFTNMLLGTAYEFMERDDIDGIVHITAFGCGPDSILEPFLIIDSE
FT                   KYKKPFMTLRIDEQTGESHIITRVEAFTDLIKLKKHKDSVIAEEKSKEGVI"
FT   gene            386231..387328
FT                   /locus_tag="Tmath_0355"
FT   CDS_pept        386231..387328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tex:Teth514_0250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60132"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARY8"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0250"
FT                   /protein_id="ADH60132.1"
FT                   /translation="MKITFPYMGSPYIYEKLFSLLGHEVVTPPRPSQKTINYGVKYSPE
FT                   FACFPLKVILGTYLEAIELGADTIVTSGGNGPCRAGYYGEAQKKILKNMGYDIEFIIFD
FT                   EPKRDLKGFMDNVKKIKGNNSWGKVLKTVKTVYDMAKSMDKVEKIVEVKRAYECNKGEF
FT                   TKAWHEIAEEYRKIKTSEDVKVIEEKAIKRLNSIKTCEVPEEERIRIGIVGEIYVVMEP
FT                   SVNGNIEEVLNSYGAEVERSHYISEWIDFNLIPLPSYKEKEHEILKKAEKYIEIIIGGH
FT                   AKQSVGAIIDFMERGFDGVIHLKPFGCLPELISQSVIDKIMREYDYPILSLSVDEQMAI
FT                   ANVLTRIEAFLDVIKLKKHRKRIAR"
FT   gene            387335..388297
FT                   /locus_tag="Tmath_0356"
FT   CDS_pept        387335..388297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0356"
FT                   /product="CoA-substrate-specific enzyme activase"
FT                   /note="KEGG: tpd:Teth39_1960 putative
FT                   CoA-substrate-specific enzyme activase; TIGRFAM:
FT                   CoA-substrate-specific enzyme activase; PFAM: ATPase
FT                   BadF/BadG/BcrA/BcrD type"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60133"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARY9"
FT                   /inference="protein motif:TFAM:TIGR00241"
FT                   /protein_id="ADH60133.1"
FT                   /translation="MEKIYIGVDVGSVSINVVAIDENNEVLFKSYVRNVGQPIDTVKDE
FT                   LAKLHNELANKEIGGVGVTGSGRQLLGYVLGADVVKNEITAHATATLHFHPDVSTIFEI
FT                   GGQDSKLIIINDGTIADFAMNTVCAAGTGSFLDHQAQRLGIKIEEFGEIALTAKREVRI
FT                   AGRCTVFAESDMISKQQYGFSKAEILRGLSKALVRNYMNNLVRGRKLRPVFVFQGGVAA
FT                   NIAIKKAFEEEVGHEVIVPKYYNVMGAIGIAMLAKDEMKRTGNHTRFKGFGVSEEKFET
FT                   TSFICKACPNECEIIQIKANGKVIAMTGDRCGRWSNSVI"
FT   gene            complement(388520..389008)
FT                   /locus_tag="Tmath_0357"
FT   CDS_pept        complement(388520..389008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1959 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60134"
FT                   /db_xref="GOA:D7ARZ0"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARZ0"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1959"
FT                   /protein_id="ADH60134.1"
FT                   /translation="MNVKFLTRTAVLLAITLIFQFLKMPQLITGSIVNAMLLIAAGTVG
FT                   MWSGVIIGLLTPVIAFLVGIMGFPLMIPFIMIGNGVYVILFSTQKNKVIGMIVGAVVKF
FT                   IWLALSVKYIMQLFNVKVPLKIVQAFTTPQLITPLIGGILGIIVIALLENYFKKAKEQ"
FT   gene            389241..389963
FT                   /locus_tag="Tmath_0358"
FT   CDS_pept        389241..389963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0358"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tex:Teth514_0253 ABC transporter related;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60135"
FT                   /db_xref="GOA:D7ARZ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARZ1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH60135.1"
FT                   /translation="MNKIEFKEVSYGSFGKEILKDISVKFEGGAIHTIVGPSGAGKSTL
FT                   IKLINRLIDPTHGSILIDDVDIKTIDVIDLRRRIGMVFQQPHLFEGTVKDNIEYGPMLK
FT                   GEKNVNVEYYLSIVGLNNEYATRDVKNLSGGEQQRVSIARTLANNPEALLLDEPTSALD
FT                   PTSTEIIEELIVKLKEEMNLTVIWITHNMEQAKRIGDYTALLNKGILVEYAKTYDFFTN
FT                   PQNEITKLFIQSKLKEEG"
FT   gene            389964..390719
FT                   /locus_tag="Tmath_0359"
FT   CDS_pept        389964..390719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0359"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   tex:Teth514_0254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60136"
FT                   /db_xref="GOA:D7ARZ2"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARZ2"
FT                   /inference="protein motif:PFAM:PF03649"
FT                   /protein_id="ADH60136.1"
FT                   /translation="MSVLSLTLASSLVLISIFVSYYQKLGIEKEIVIGTIRAVVQLTIV
FT                   GYILHYIFAADNALFTLAMVSLMIVVAGNNASKRGKGIPNVFYFITFSIALSAAITISL
FT                   LILFGNIHFRPQEVIPVSGMIIGNSMVASGLVVSRLKDEIKNKSEEIEAYLSLGATSRQ
FT                   AAQKVIKTAIKTGMIPTVDSMKTLGIVQLPGMMTGLILGGVDPIEAVKYQIMVTFMLAS
FT                   TVAISCFSVTFLTYRNFFTKYHQLVSDLQ"
FT   gene            391055..393505
FT                   /locus_tag="Tmath_0360"
FT   CDS_pept        391055..393505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0360"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="KEGG: tex:Teth514_0255 leucyl-tRNA synthetase;
FT                   TIGRFAM: leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60137"
FT                   /db_xref="GOA:D7ARZ3"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARZ3"
FT                   /inference="protein motif:TFAM:TIGR00396"
FT                   /protein_id="ADH60137.1"
FT                   /translation="MAYSVDVDRKWQKKWEETKLYKFNPENADKKLYCLEMFSYPSGAK
FT                   LHVGHWYNYGPTDSWARMKRMQGYEVFHPMGFDAFGLPAENYAIKTGIHPYDSTMENIR
FT                   TMEKQLKEMGATFDWDYEVITCLPEYYKWTQWIFLKLFEAGLAYRKKAPVNWCPSCQTV
FT                   LANEQVIDGKCERCGTEVTKKDLTQWFFKITAYAEELLEKLDELDWPEKTKIMQINWIG
FT                   KSDGAEIEFKVAGKDLTFKVFTTRADTLYGATYVVIAPEHEIVDLITTEEYKQAVEEYK
FT                   EYARKQSEIERLSTEKEKTGVFTGAYAIHPLTGEKLPIWIADYVLATYGTGCVMAVPAH
FT                   DERDYEFATKYNLPIKRVIKGIGDIDDSLPFVEYGELVDSGEFTGLKSEKARIKIVEKL
FT                   KQEGRAEFKVNYRLRDWLVSRQRYWGAPIPVIHCERCGIVPVPEEDLPVLLPYDVEFAP
FT                   TGESPLKKHEGFMNVTCPKCGGKALRDPDTLDTFVDSSWYFLRYPDNKNDKEPFNKEWI
FT                   NKMLPVDKYVGGAEHATMHLLYARFVTKALRDLGYLDFDEPFKSLVHQGTILGPDGSRM
FT                   SKSKGNVISPDEYIKEYGSDVFRLYLMFGFAYSEGGPWNDDGIKAISRFVNRVERFIDK
FT                   FIETRNNPGKTKDEMGKDENELNYVRHYAIKSVTEDAERFQFNTAIARIMELVNALYKY
FT                   DTDVEVKNIEFYEDVVADLIRLLAPFAPHFSEEMWEKLGYEYSVFNQKWPKWDEKALQR
FT                   DVVEIAVQVNGKVRGRLEVPSNAPDEEVQRIALSDDKIKSYLDGKEIKKVIVVKGRLVN
FT                   IVVK"
FT   gene            393571..394272
FT                   /locus_tag="Tmath_0361"
FT   CDS_pept        393571..394272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0361"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: tex:Teth514_0256
FT                   AzlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60138"
FT                   /db_xref="GOA:D7ARZ4"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARZ4"
FT                   /inference="protein motif:PFAM:PF03591"
FT                   /protein_id="ADH60138.1"
FT                   /translation="MIVDSDVKKSINGVKSALPIVLGYLPIGFAYGLVGVKSGFTISQV
FT                   VALSLFVYAGSAQFIAISLLSAGTSIVTLVSTIFIVNLRHFLYSTSLSQYMKYIPRKHI
FT                   PILSFFITDETYAVAITDLQNDSKYTEGYFYQLFLTSYTAWVFASFLGAVSATLIGGSI
FT                   NVGLDFALPAMYIALLFMQISGYKKVFISVFSGLLSITLMFVLPGNTNVIVAALIGAGM
FT                   GVLLDKWVRNL"
FT   gene            394254..394577
FT                   /locus_tag="Tmath_0362"
FT   CDS_pept        394254..394577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0362"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport; KEGG:
FT                   tpd:Teth39_1954 branched-chain amino acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60139"
FT                   /db_xref="GOA:D7ARZ5"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARZ5"
FT                   /inference="protein motif:PFAM:PF05437"
FT                   /protein_id="ADH60139.1"
FT                   /translation="MGTKFIISVIGMFLVTYIPRFMPVYGLTKIELPQAVKSFLEYVPV
FT                   AVLSALLFPVIFIKDGKSFLDLSNIYLLSAIPTFIAAYFTRKLFTPVVVGIVSYVILSF
FT                   IIK"
FT   gene            394709..395812
FT                   /locus_tag="Tmath_0363"
FT   CDS_pept        394709..395812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0363"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: PfkB domain protein; regulatory protein MarR;
FT                   KEGG: tpd:Teth39_1953 ribokinase-like domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60140"
FT                   /db_xref="GOA:D7ARZ6"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARZ6"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADH60140.1"
FT                   /translation="MALTQREKEILRLIKKNPMISQEELAKLMGISRSAVAGHIANLMK
FT                   KGFILGRGYVVRDFKGITVIGGANIDIKGKPYSELKQHTSNPGHINIAPGGVGRNIAHN
FT                   LAQLSLPVTLLSVVGNDDEGRRLLEETRQAGVNVEQIVISNTRRTGIYLAILNAIGDMD
FT                   VALSGMDILEELNIQYLESKIEVIKNSEIVVFDTNIPEDSIKYIVELCYNNNIPVVAEP
FT                   VSIDKAKKLIGVLDKIDYVTPNKEELESISGVKIANDEDMKKAVKYLRQKGIKNVIVTL
FT                   GERGVYISSEEVEKFIEPYQAEIVDATGAGDALTAGLVYGIFNGYPLDVSAKFGLAAAS
FT                   LTISSPYTVNPFLNENQLKNIVKETVK"
FT   gene            395809..396732
FT                   /locus_tag="Tmath_0364"
FT   CDS_pept        395809..396732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0364"
FT                   /product="Indigoidine synthase A family protein"
FT                   /note="PFAM: Indigoidine synthase A family protein; KEGG:
FT                   tpd:Teth39_1952 indigoidine synthase A family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60141"
FT                   /db_xref="GOA:D7ARZ7"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARZ7"
FT                   /inference="protein motif:PFAM:PF04227"
FT                   /protein_id="ADH60141.1"
FT                   /translation="MNKFINLSQEVKKAMEEGKPVVALESTIISHGMPYPENIETAKTL
FT                   ENIIREHGAIPATIAIINGRIKIGLSKEELEFMATSKEILKASRRDLPAVLAKGFSAAT
FT                   TVSATMICANLASIKVFVTGGIGGVHRGAEQTFDISADLQELANTDVAVVCAGAKAILD
FT                   LPRTLEYLETFGVPVVGFKTWEFPAFYTRESGLKVDYKVDDEIEAAKIIKTKWDLGLKG
FT                   GVLIANPIPEEYALDKAYIDKAIEDALYEAEKRNIKGKEITPFLLDKIKDLTQGESLKA
FT                   NIELVKNNAFVGAKIAIELNKLYKEA"
FT   gene            complement(396742..397005)
FT                   /locus_tag="Tmath_0365"
FT   CDS_pept        complement(396742..397005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0365"
FT                   /product="small, acid-soluble spore protein tlp"
FT                   /note="TIGRFAM: small, acid-soluble spore protein tlp;
FT                   KEGG: tpd:Teth39_1951 small acid-soluble spore protein Tlp"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60142"
FT                   /db_xref="InterPro:IPR017524"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARZ8"
FT                   /inference="protein motif:TFAM:TIGR03090"
FT                   /protein_id="ADH60142.1"
FT                   /translation="MAKENDKYTKPPKPDDRSDNVEKLQQMIHDTIENYREAEDYLKLH
FT                   AEELSTEEIERIKQKNKNRLTSIQNMREEIIDEVHDNDKKQV"
FT   gene            397225..398223
FT                   /locus_tag="Tmath_0366"
FT   CDS_pept        397225..398223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0366"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: tte:TTE0329
FT                   phosphate/sulphate permeases"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60143"
FT                   /db_xref="GOA:D7ARZ9"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D7ARZ9"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ADH60143.1"
FT                   /translation="MDFYFIAVIVIFFYIFVTGFHDEGNLVATIIFSRSIDAKKAFILA
FT                   AVAQFLGTAIISTNVSKTVAKDIVKYEYLFKSGYNISLLILCGLIGAMIWNFITWYFGI
FT                   PSSSSHALIGGMLGPFVLEYGFNSINVQGILFRAILPLFLSPIIGFITGYLITFFLSEI
FT                   LKNQTPAVNNILKKLQYFTLFFLNAGQGSNDAQKGMGLIVILMMIKGQTHNFEVPFDVK
FT                   YISALMISFGLILGGFRIIKNVGAGIYRVRPFHSFNAQLSSLLVVSIAAIIGAPISGTQ
FT                   LINSSILGIGAKERPTAVRWQFARGIIMAWFITIPVSFIISYLIYGLSKLL"
FT   gene            398238..398852
FT                   /locus_tag="Tmath_0367"
FT   CDS_pept        398238..398852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0367"
FT                   /product="Putitive phosphate transport regulator"
FT                   /note="PFAM: Putitive phosphate transport regulator; KEGG:
FT                   tte:TTE0330 phosphate transport regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60144"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS00"
FT                   /inference="protein motif:PFAM:PF01865"
FT                   /protein_id="ADH60144.1"
FT                   /translation="MNVFKWLFSKETDFYKLLEEQSRLTLQGVCALEKYMMTGNIEDGH
FT                   EVNRLEKIADRKREELIDELDKTFITPFDREDIFNLSKAIDDILDYSNTTVKEMEAYNL
FT                   QPTGELQEIVTVIKYSTDLIYKSVCNLNRDKKEGMEQALKAKKYENEVENLYRKNLAKL
FT                   FEEDDIKYILKMREIFRHLSNCADKIDLAGDILGHIYVKMM"
FT   gene            399069..401774
FT                   /locus_tag="Tmath_0368"
FT   CDS_pept        399069..401774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0368"
FT                   /product="PTS system transcriptional activator"
FT                   /note="KEGG: tpd:Teth39_1949 PTS system transcriptional
FT                   activator; PFAM: sigma-54 factor interaction
FT                   domain-containing protein; PRD domain protein; PTS system
FT                   fructose subfamily IIA component; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60145"
FT                   /db_xref="GOA:D7AS01"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS01"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADH60145.1"
FT                   /translation="MKRIDKVYNCVKELCSKQFAERGEIIGVSAMEIAHALNIQRTNAS
FT                   SDLNTLFREGKVIKVEGKPVLYKVKELDMVSDESDMVVKDVFDSIIGANLSLKNAVQQA
FT                   KAAIIYPPNGLHTLLLGETGTGKSMFAEVMYSFAKEIGRIKRNAPFVTFNCADYANNPQ
FT                   LLMSQLFGVKKGAYTGADKDRMGLVEKADGGILFLDEVHRLPPEGQEMLFYLIDKGLYR
FT                   RLGESETQHKANVLIICATTENIESTLLRTFIRRIPMVIKLPALAERTYEERFELIKNF
FT                   FREEAAIINTDIMITSNALKALLLYECPNNIGQLKSDIKLSIAKAYLGYMMKRDKGVCV
FT                   HTEDLPEYVRRGLFKYKESKDEIDRFITGDIIKFSVDNATPVIQQNNQIFNFYEALEEK
FT                   RKALEQKGLNESDIRLIMSIDIETYLKKYLLNLDKNNLEELYKVVDKKIVDIVNDFLNY
FT                   ASKKLKRSFSEKTLYGLSMHVASSVERILSGKDIVNHQLENIKKVYEKEFEVANALRER
FT                   VQKEFNIKVPDDEVGFVTMFLCLDEETKEKDERVGIIVAMHGEAAATSIAEVSNRLLGD
FT                   NYVIGYNMPLDQKPEVALNNLTNIVKRVDKGRGVLLLVDMGSLVLFGDMIYERTGIPVK
FT                   TIEMVSTPMVLEAARKAILNASLDEVYDAVVNFSPYVGRIYKDSVKFEDSLKKNVIITA
FT                   CITGEGTAVKLKSILEKNLDLKEQDIDIIPIEIESTREFRRKLLNIKEEKNILAVVSAI
FT                   NPQDDSILYISTSDVFDNDKLSVLKNKIEALSQIEIIDNMKEVIRENIKIDSEKYISSF
FT                   KRFYAALIRDGVNLNEDITIGLILHLACVIERILQGKQLIHIKDTQEYIKNYPKEFDII
FT                   KKAIRIIEEGCNVKISDEECVNMMKIIYSL"
FT   gene            401942..403204
FT                   /locus_tag="Tmath_0369"
FT   CDS_pept        401942..403204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0369"
FT                   /product="PTS system, lactose/cellobiose family IIC
FT                   subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="TIGRFAM: PTS system, lactose/cellobiose family IIC
FT                   subunit; KEGG: tpd:Teth39_1948 PTS system
FT                   lactose/cellobiose family IIC subunit; PFAM:
FT                   phosphotransferase system EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60146"
FT                   /db_xref="GOA:D7AS02"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS02"
FT                   /inference="protein motif:TFAM:TIGR00410"
FT                   /protein_id="ADH60146.1"
FT                   /translation="MDALINFLDRYFMPVAGRIAEQRHLKAIRDGIVATMPLLLIGSFF
FT                   LIIAFPPIPALEALVKPYVNDLLKIVNATFDIIAMVASFTIAYSLAGTYKIDPLASGVL
FT                   SLSTFMLSVPLTQDGNIPLKWMGSQGLFVAMILAIFTVEVQRKFVEKNLIIRMPEGVPP
FT                   SVGRAFAALIPGAVTITFIWIIHMILIKTIHLTIPEAINKLIAIPLLKLGSTLPAVILA
FT                   ILAIQFLWSVGIHGAALVGGILGPIWLTFTQENSAAKIAGEKILPHIVTQQFFDIFIYI
FT                   GGSGTTLALALLLIFATKSAQLKAVGKAAIWPGIFNINEPITFGMPIVMNPVMIIPFIL
FT                   APIAAGLITYFAMALNLVARPYALIPWTTPVLISGFLTTGDWKAIILQIINFLVAGAIY
FT                   YPFLKLWDNKKYEEEQQFKKE"
FT   gene            403292..404041
FT                   /locus_tag="Tmath_0370"
FT   CDS_pept        403292..404041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0370"
FT                   /product="YdjC family protein"
FT                   /note="PFAM: YdjC family protein; KEGG: tpd:Teth39_1947
FT                   YdjC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60147"
FT                   /db_xref="GOA:D7AS03"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR022948"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS03"
FT                   /inference="protein motif:PFAM:PF04794"
FT                   /protein_id="ADH60147.1"
FT                   /translation="MKYLIVNADDFGLTKGVNKGVVECYKNGILRSTSIMCNMPYANEA
FT                   LQVKELCPDLGFGIHITLDAGKPLSSPEKVNTLVDERGYFKRGFPHSLDDADVDQIRIE
FT                   IEEQIKKAFSLGVTITHMDSHHHAQSHSKVIDAFIEMAHKYNLPVRSTPLDKEKIIKAG
FT                   LKTVDNFIYTFYDDGVKKENLLSILGSLEEGTTEIMSHPAYVDDELVNISSYHAKREVE
FT                   RKILTDKDVLQFIRDNNILLTNYSILK"
FT   gene            404072..404383
FT                   /locus_tag="Tmath_0371"
FT   CDS_pept        404072..404383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0371"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; KEGG:
FT                   tpd:Teth39_1946 phosphotransferase system,
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60148"
FT                   /db_xref="GOA:D7AS04"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS04"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ADH60148.1"
FT                   /translation="MRILLICGAGMSTSLLVEKMKKEGEKRGMKDLYIFAEAADNLEKV
FT                   IDDYDVVLLGPQIRYKEKYVAELTKEKNKVYRVIPPNVYGMIDGAKTLDLAIEALKNK"
FT   gene            404403..404735
FT                   /locus_tag="Tmath_0372"
FT   CDS_pept        404403..404735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0372"
FT                   /product="phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit"
FT                   /note="PFAM: phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit; KEGG:
FT                   tpd:Teth39_1945 phosphotransferase system PTS,
FT                   lactose/cellobiose-specific IIA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60149"
FT                   /db_xref="GOA:D7AS05"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS05"
FT                   /inference="protein motif:PFAM:PF02255"
FT                   /protein_id="ADH60149.1"
FT                   /translation="MNLEQIVFTIISHAGNARSICFDALKHAKEGNFVEAENCLNKASE
FT                   ELLEAHHVQTDMIHKEAQGEKQEVTLLLIHAEDHLMNAILAKELITEMIELYKIIYQTK
FT                   GATYNV"
FT   gene            404728..406038
FT                   /locus_tag="Tmath_0373"
FT   CDS_pept        404728..406038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0373"
FT                   /product="glycoside hydrolase family 4"
FT                   /note="PFAM: glycoside hydrolase family 4; KEGG:
FT                   tpd:Teth39_1944 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60150"
FT                   /db_xref="GOA:D7AS06"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS06"
FT                   /inference="protein motif:PFAM:PF02056"
FT                   /protein_id="ADH60150.1"
FT                   /translation="MSKKDLKIAVIGGGSSYTPELIEGFIKRYEELPVRDIYLMDIEEG
FT                   KEKLEIVGGLAKRMVEKAGIGINIHLTLDRREAIKDADFVVTQFRVGGIDARIRDEKIP
FT                   LKYDVIGQETTGPGGFAKAQRTIPVILDICRDIEELAPNAWLINFTNPSGVITETVLKH
FT                   TNVKAIGLCNVPIGMVYGIAEILGVDPKRVNIDFAGLNHLVWGTHIYLDGEDVTEKLID
FT                   SFAGAKSLSMKNIPEFPWDPEFIKSLGMYPCPYHRYYYLTDKMLDEQKKEAATVGTRGE
FT                   VVKKVEQELFELYKDPNLNIKPPQLEKRGGAHYSDAACSLISSIYNDKKDIHVVNVRNN
FT                   GTIADLPDDVVIETNAIIDRNGAHPINIGHVPAKIRGLMQAVKAYEELTIEAGVKGNYY
FT                   TALQALTIHPLVPSATVAKKILDDILEQNKEYLPQYK"
FT   gene            406136..407530
FT                   /locus_tag="Tmath_0374"
FT   CDS_pept        406136..407530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0374"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /EC_number="3.2.1.86"
FT                   /note="KEGG: tpd:Teth39_1943 beta-glucosidase; PFAM:
FT                   glycoside hydrolase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60151"
FT                   /db_xref="GOA:D7AS07"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS07"
FT                   /inference="protein motif:PRIAM:3.2.1.86"
FT                   /protein_id="ADH60151.1"
FT                   /translation="MAKEYKFPEGFWWGSATSAVQIEGAANEDGKGMNVWDYWYKNEPN
FT                   RFFDRVGPQVTSDFYHRYKDDIKLMKELGHNSFRFSISWSRLIPGGVGEVNKKAVEFYN
FT                   SVIDELIKNDIEPFVTLFHFDMPIEMQNMGGFENRKVVEYFAEYAKTCFELFGDRVKRW
FT                   ITFNEPIVPVLGGYLYNFHYPDIVDFKRAVQFAYGTVLASARAIEEFKKLQIERAKIGI
FT                   VLNLSPVYPRSNHPADLKAAEIADLFYNRSFLDPTVKGEYPKELVELLKTYNHLPEYSD
FT                   SDLELIKNNTVEYLGVNYYQPIRVKAKENMPNPYGVFTPNWFYDEYIMPGRRMNPYRGW
FT                   EIYERGIYDIMINLRDNYGNIGSFISENGMGVEGEERFIKDGIIQDDYRIEFIKEHLKW
FT                   LHKAIEEGCNVKGYHLWTFMDNWSFLNAYKNRYGLVSVDLKTQKRTIKKSGYWYKELSE
FT                   NNGFVD"
FT   gene            407681..409117
FT                   /locus_tag="Tmath_0375"
FT   CDS_pept        407681..409117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0375"
FT                   /product="PTS system, mannitol-specific IIC subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="TIGRFAM: PTS system, mannitol-specific IIC subunit;
FT                   KEGG: tpd:Teth39_1942 PTS system, mannitol-specific IIC
FT                   subunit; PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; phosphotransferase
FT                   system EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60152"
FT                   /db_xref="GOA:D7AS08"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS08"
FT                   /inference="protein motif:TFAM:TIGR00851"
FT                   /protein_id="ADH60152.1"
FT                   /translation="MQNTNVLITGGGSVKAKLQRLGGFLAGMVIPNIGAFIAWGLITAF
FT                   FIPTGWIPNEHLAKLVGPMITYLLPILIGYTGGKLVYDVRGGVVGAIATAGIIIGSSIP
FT                   MFLGAMLMGPLGGYVIKKFDELVEGKIPAGFEMLVNNFSAGILGGLLAILAFLFIEPVV
FT                   NGISVGLGAAAQWVTNKGLLPLIAIFIEPGKILFLNNAINHGILAPLGVAEVKEFGKSI
FT                   FFLLETNPGPGLGVLLAYWLFGKGDAKQSAPGAIIIHFFGGIHEIYFPYVLMNPLLLLA
FT                   VIGGGMAADATFVLTKAGLVATPSPGSIFAEIAMAPKGGLLPVLAGITVGAVVSFLIAS
FT                   VIVKRASEESMSAESMTFARSVVSGLKAQSKGQKVEEVKPSVQKIESMPKLIVFACDAG
FT                   MGSSAMGETILKKKLKEAGLDIAVKHSAVNQIPKEADVVFTQENLAERASQVVPNAKIV
FT                   TVKNFLDNTIYDEFVKNLKK"
FT   gene            409140..411182
FT                   /locus_tag="Tmath_0376"
FT   CDS_pept        409140..411182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0376"
FT                   /product="transcriptional antiterminator, BglG"
FT                   /EC_number="2.7.1.69"
FT                   /note="KEGG: tpd:Teth39_1941 transcriptional
FT                   antiterminator, BglG; PFAM: PRD domain protein;
FT                   phosphotransferase system lactose/cellobiose-specific IIB
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60153"
FT                   /db_xref="GOA:D7AS09"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS09"
FT                   /inference="protein motif:PRIAM:2.7.1.69"
FT                   /protein_id="ADH60153.1"
FT                   /translation="MEDLTVRQKFILKTLLEKGPSNIEDLSKLMDVSGRTIMREIASIN
FT                   NNLKKYKAVIVEDNGQIILKGEEEALDKIHASLGAIPLQWLLTPEQRQILMTIQLLLSE
FT                   EPIKAAYFSYQFNVVEGTISLYLDKIEEWLKMRNLSLIRRRGYGIKVEGSELDKRSAIV
FT                   ELFYNYKPIEELLAFVYNNEKDNYVYTFFNTVFDNELVQLVKRIAQQIKNVIHGYLSDL
FT                   NYFGMFVHLLVSIYRTKIDKPIQLNDEFVKDILLSKEFIFMKDVEKILKENEIYLPDAE
FT                   LAYLAIHLSPKKYVYKQNRFEELGISLQDLSKEVVEEVSRLLNIKINCDEQLIVGLSQH
FT                   FEPALYRLTMGLQTTNPLVEEIKNYYGDLFKAVNKACKLIFSKYNLMIPEEEIGYITMH
FT                   IGAAIERQQALSKKLRVFVICPNGMGTARILSAKLKALFREIDTIDIGSIWEYKKKGDN
FT                   YDLIISTVKLEDLKDNVIVVSPFLTEEDIKKIKEFIEKYVVKKEKELPRNLPMVERRGN
FT                   FEIADEILRNLQLKYVEAKTIEDLIKFIAKDLYDLMLTEDAKEIEELIFKREAMGNVVI
FT                   PNTHIALIHTRSDKMAIPFVGIYKLKTPLKMKSAGFTYEEVDTFLVMLARKTESSEILE
FT                   MLGKISISLIEDKAFNEILRFGDIKDIRNSLVKILNDTQEALEDE"
FT   gene            411175..411615
FT                   /locus_tag="Tmath_0377"
FT   CDS_pept        411175..411615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0377"
FT                   /product="phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: tpd:Teth39_1940
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60154"
FT                   /db_xref="GOA:D7AS10"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS10"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ADH60154.1"
FT                   /translation="MNKEILNENNIVLNVPSESKIQAIERVGNLLFKNGYVEKEYIEGM
FT                   KKREEDVTTYIGNGIAIPHGVSEYVKYIKKSGIVIAQYPEGVNFGDGNIAYIVIGIAGK
FT                   GDEHLEILSKIALTCQYEENVEKLKKARTKQEIIEILQKGDE"
FT   gene            411617..412783
FT                   /locus_tag="Tmath_0378"
FT   CDS_pept        411617..412783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0378"
FT                   /product="Mannitol dehydrogenase domain protein"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: tex:Teth514_0271
FT                   mannitol-1-phosphate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60155"
FT                   /db_xref="GOA:D7AS11"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS11"
FT                   /inference="protein motif:PFAM:PF08125"
FT                   /protein_id="ADH60155.1"
FT                   /translation="MLKAVHFGAGNIGRGFIGYLLSKSGYEITFVDISKELVESINNYK
FT                   RYNVIILKDNVEKEVVKNIKAIHIDDKEKLSKAILDADIITTSVGANNLKSIGEKLINY
FT                   LKIRKANTDKPLNIMACENALFATNILKNSILEKGDKDFVDYVNQKIGFPNTAVDRIVP
FT                   NVEIKKELPIDVAVEDFYEWDIEKKAIIGDLNIKGAELVDDLEPYIERKLFLLNGAHAT
FT                   TAYLGYLKGYKYIHEAIEDGFIRNIVSRMQEEASLALSRKHNIKKDDLEGYASKVIKRF
FT                   KNPYLKDEVVRVGREPTRKLAGNDRLMMPAKFCYEIGVMPQFILYGIAAGFLFDYKEDP
FT                   KAYEIQDGIKNFGLEKTISKVTGLEENNDLLQEIVKKYKELKETFRKR"
FT   gene            413156..416824
FT                   /locus_tag="Tmath_0379"
FT   CDS_pept        413156..416824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0379"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="KEGG: tpd:Teth39_1938 5'-nucleotidase,
FT                   2',3'-cyclic-nucleotide 2'-phosphodiesterase; PFAM:
FT                   5'-Nucleotidase domain protein; SH3 type 3 domain protein;
FT                   metallophosphoesterase; SMART: SH3 domain protein; Capsule
FT                   synthesis protein, CapA"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60156"
FT                   /db_xref="GOA:D7AS12"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS12"
FT                   /inference="protein motif:PFAM:PF02872"
FT                   /protein_id="ADH60156.1"
FT                   /translation="MFRSRSGILAILVAAIMVLSMFFSAIPQIAFAATSKTFDFIEVTD
FT                   FHGYLQNDGKLSDGTIYKQQIAGVLAKQIKDIKAQNPDRTVILSGGDMFQGTSLSNVLK
FT                   GQPVIDMMKNIGFDAITLGNHEYDWGIDSVIDTQNATLKNSTIPVLGANVYDKTTGKPV
FT                   SYTKPYVIIERDGVKIGIIGIVDNKEFPNIIMPAYIQNVEFKDPVPIVNDLAQQLRQQG
FT                   AQIVVVLAHMGAYQDKSGNATGNLIDFAKQVKGVDAIFGGHTHTIVTTRVNGIPVGVAA
FT                   NYGKGFINLKITLNDDGTVTTGDMQYIDITGLYSTQNPAVDPEVQAIVDKSSEDVGPIF
FT                   NEVIGQAAIDLTRTQSAEPYGDSLLGNWAAQVTKDAVGADFGFANNGGLRIDIPKGDIT
FT                   VGMMYQLMPFDNTIVTMKMTGAQIKTILEQAVQDGGKGIQVAGLSFKYDPTKPSMHRVF
FT                   DMKKSDGTPVVMDKTYLVATNNFMGTGGDGFKGFTDPDVAKTYVDTYKLVRDAFIEAVK
FT                   AQKVVTSTIDNRIAPGTNNSILVTVLATSDMHGNIFPWDYNNAKAANRGLAKVATYIKQ
FT                   VRTQYPYVVLVDNGDTIQGTPLSYYYNKIDTETEYPLAKVMGAMKYDTWTLGNHEYNYG
FT                   LDVLNRVIKDMRSEGIHVLSANTYKDDGTNFVDPYYIKTFDTPEGPVKVGILGLTTKTI
FT                   PSWEDKDHYAGLYFNDHVEEANKWVSKLREAGADIVVVTMHSGEEKPTDTIPENQVIAV
FT                   ATQVNGIDAIVAGHTHANIPQHTYTNPAGNTVIITQPGKWGEYVSQIYFDIVKNAEGKW
FT                   VVGDKWSTTVKMDDSIQADPDIIKLAQPYQDATLKYIGTKIGIAAGDFLGTEQTVKETA
FT                   IMDLINKVQKYYAKTDLSIAAPLSSSAKILKGDITIQDIMGVYVYENYLYGIKMTGKQL
FT                   KDWMEWSARYYKQVSSPNDPITKDPTLNIPDYNLDQLYGASYVIDLTQPAGHRIKNLKV
FT                   NGKLVKDDEVFTVAINNYRFNGGGGFMQAAGITNPEIVFDSAKAYGDDGQVRNLMIRYI
FT                   QEHGTITPTVENYWYVSTTPVVEETPVPQPQPTPQPQPVPQPVYNYGIVTASALNVRAG
FT                   ANTSSKIIGVLPAGKVVTLLEKVNGWYKIDYNGKTGYLYGKYVAATPNPSNVTVLKAVK
FT                   VTAKSGLNVRVGNSITAKKIGAVPYGTELKVVGEYNGWYQIEYNGGFGYVYAKYTK"
FT   sig_peptide     413156..413254
FT                   /locus_tag="Tmath_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.917) with cleavage site probability 0.915 at
FT                   residue 33"
FT   gene            416971..417936
FT                   /locus_tag="Tmath_0380"
FT   CDS_pept        416971..417936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0380"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="KEGG: tpd:Teth39_1937 nifR3 family TIM-barrel
FT                   protein; TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60157"
FT                   /db_xref="GOA:D7AS13"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS13"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ADH60157.1"
FT                   /translation="MKIGNIILKNNVFLSPMAGVTDKPFRLICQEMGCGLAYTEMVSAK
FT                   GLYYGSENTKMLTDIDEEEKVALQVFGSDPDIMGEIARKLNDSKALILDINMGCPTPKI
FT                   VKNGDGAALMLKPELAEKVMESVVKASNKPVTVKIRKGWDDNHVNAVEIAQIAEKAGIK
FT                   AVAVHGRTREQFYSGKADWSIIKKVKESVKIPVIGNGDIFTPQDAKRMLEETGCDAILI
FT                   GRGAQGNPWIFKRTVHFLNTGELLPEPTIQEKIEVIIRHLEMMIEYKGERTGILEMRKH
FT                   IAWYLKGLYGSAKLREAVFKMEKYEEIKEFLLNVAKTYAN"
FT   gene            418214..418975
FT                   /locus_tag="Tmath_0381"
FT   CDS_pept        418214..418975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0381"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   tex:Teth514_0274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60158"
FT                   /db_xref="GOA:D7AS14"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS14"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ADH60158.1"
FT                   /translation="MSIEYIVALCGIGFAAAFIDSIAGGGGIISLPGLLVLGVPPAFAL
FT                   GTNKFAASCASFTSSLTFIKYRVYDGDLLKYLVFGTLLGAILGVKTVLLLDSSQLRIII
FT                   IILMIFVAIYTLFAKNIGNENKVKGVNKKTIAIGLIISIILGFYDGFFGPGTGSFYIFL
FT                   FLTLLNYDFKMSAGNGKILNFVSNITSLIMFALHGKILYSIAIPMALAMILGARLGTKL
FT                   AIKNGARLIRPILISVTLLYAVKMIFDVTNH"
FT   gene            419037..419783
FT                   /locus_tag="Tmath_0382"
FT   CDS_pept        419037..419783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1935 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60159"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS15"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1935"
FT                   /protein_id="ADH60159.1"
FT                   /translation="MWEENRGKKYKGIDIIEFYQKEATKRKNTIPKKTFYNRFLKIEDC
FT                   IMISKPYEEKFEEKRYKISLYELLKNVYYEEAFGINISSKRKKESYRNNLSFKNFTIGD
FT                   IVLATSPGFHIQGAIRHAAIFDSRRYHGSVDDECLLTAEPNKGVIYESIRFYHENFGEA
FT                   WGLYVPNTTLQQRIAVVDELAKHIGERYYWSAHKNDSRTWYCSLVPWRGYYKITGIDID
FT                   YNDGYWVLPIDIFMSEYTEVFEYSRG"
FT   gene            420161..421246
FT                   /locus_tag="Tmath_0383"
FT   CDS_pept        420161..421246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0383"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: tpd:Teth39_1934 LacI family transcription
FT                   regulator; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60160"
FT                   /db_xref="GOA:D7AS16"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS16"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADH60160.1"
FT                   /translation="MNSKDIARIAGVSRSTVSRVINNYPNVPPETKEKVLKVIKEYNYV
FT                   PHASARMLRGKSSRTIGLVIVDIKKNNDIHKVHDNVYFGPFTTAVIDFANQLGYNVLVI
FT                   TVYKARDYKKVREVFYNKTINGAIFIGVKNDDPDIKNLIEDGLKTAIIDQEIREDEDDT
FT                   FNKSIIVNMDNVNGAYEATKYLINLGHTEIAHITGDMEKLSGFARLEGYKKALKEAGIP
FT                   FKNNLIIKGDFVEESGYKAAYKLFKKAKPTAIFASNDQMAIGAMHALEEMGYKVPEDVS
FT                   IIGFDDITISRYLKPALTTMSASLLQMAELAVENLIKSIEEEMAITAKFVVPVKLVERE
FT                   SCKRIEMQRVKMNDEYALSMK"
FT   gene            421812..423569
FT                   /locus_tag="Tmath_0384"
FT   CDS_pept        421812..423569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0384"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   Entericidin EcnAB; KEGG: tpd:Teth39_1933 extracellular
FT                   solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60161"
FT                   /db_xref="GOA:D7AS17"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS17"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADH60161.1"
FT                   /translation="MRRLLSLLLVLMLIMGALAGCGQKSQETSDKSNQQNANTQQVAQE
FT                   TTYQRNETVYFGGGLWSPPSNWNPLTPWNAVTGTVGLIYETLFNYDPLKNEFIPWLAEK
FT                   GEWTSDNTYQITLRDGLTWQDGKPLTSEDVKFTFEIAKQYSEIYYSPMWQWLQSIETPD
FT                   NKTVIFRFSTANYHEWAYNLYQIPIIPKHIWADKSKDDILNGANEKAIGSGAYLFDTYS
FT                   NDRMVYKRNDNWWGIKAMNMTPAPKRIVYLIVPSNNVALGMLMKGELDLSNFFLPGIKT
FT                   LKANYGVTTFYDNPPYMIPDNTVFMFINTTKPPLNNVELRRAMAYAINPKVIAEKVYEN
FT                   QVEPANPLGFVPAKSWQEYYDQNVVDKYGYTYNPEKAKSILDAAGFKLGSDGVRTTPDG
FT                   KKFKLEISVPYGWTDWMEAAKIVADQLKAVGIDAEAKFPDYSKYYEDLTKGTFDLSFNN
FT                   FGSQVTSTPWTLYNWLFNKVQENGPQNNGNFGRFDVPGLQDLIAKFNQTKLGSPEAKQA
FT                   AAQLEEIFLKNMPAIPLWYNGLWMQASNAAWENWPTEHDPYAYPVTWGGRWQTGGTMML
FT                   TKIKPKASQ"
FT   sig_peptide     421812..421871
FT                   /locus_tag="Tmath_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.444 at
FT                   residue 20"
FT   gene            423587..424579
FT                   /locus_tag="Tmath_0385"
FT   CDS_pept        423587..424579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0385"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tpd:Teth39_1932
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60162"
FT                   /db_xref="GOA:D7AS18"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS18"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH60162.1"
FT                   /translation="MLRYLIKKLYIYILTFFFAVSIDWLIPRFMPGDPILVLVSRFSGL
FT                   PESARVMYGYLTKAFGLDLPLWKQYLNFWIAVFKGDLGVSIYMYPKPVLDVIAQAIPYT
FT                   LVVLLPSIVLSWIVGNYIGAVAARHRSLDSRMLPIFYILTSIPYMWLGILLAWALGVVF
FT                   GIFPIAGAYSFSMRPNWSWQFVTDFLRHWILPFLSLFIVQIGGWAIGMRNLIIYELDAN
FT                   YSRYLEALGASEGLIRKYAFRNAILPQITGLALQLGTIVAGSIATEVVFSYPGVGYLLL
FT                   QGILNQDYFLVQGTFLFIIIGVLLANFIVDILYMVFDPRIRLGYGGENS"
FT   gene            424576..425418
FT                   /locus_tag="Tmath_0386"
FT   CDS_pept        424576..425418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0386"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tpd:Teth39_1931
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60163"
FT                   /db_xref="GOA:D7AS19"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS19"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH60163.1"
FT                   /translation="MKEFTHFALSNTKFKIGIGILLFFIVLAIIGPYITPYKDPLEYVS
FT                   MSNLPPNRENWLGTTTFGQDVFTQFVYGLRSSLFIGLIGGGIATIMGLFIGFIAGYKGG
FT                   LVDDLLMMLTNILIVIPTLALLIIIAAYLPYRGIGIQSIIIGLTAWPWTARAVRAQTLS
FT                   LKSREFVNLAKITALRPLKIVFEEIAPNMMSYVVMVFILQFAGAILAAVGLDFIGLGPT
FT                   RGISLGLMMQYSVLWNAIQLGIWWWFIPPGLAITMIVSSLYLLNIGLDEIFNPRLREE"
FT   gene            425424..426377
FT                   /locus_tag="Tmath_0387"
FT   CDS_pept        425424..426377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0387"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: tpd:Teth39_1930 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60164"
FT                   /db_xref="GOA:D7AS20"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS20"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADH60164.1"
FT                   /translation="MIQIEKLKIYYRTLHGDAKALDDVSFTINDKEIVGIAGESGCGKS
FT                   TLGNSLILLKPPMKYVGGEVKINGDRLPIDNTKEMRKYRYKTVSLIPQYAMDALNPTRK
FT                   IGGIIKDLIGQHRIKYEEIEGRLYERLNMVKLSKEVLNMYPFELSGGMKQRVVLVISTL
FT                   LNPDLLIADEVTSALDVSSQKAVSLMFKDFRDKGIVNSIIFITHDIAVLHQIADKIVIM
FT                   YAGKVAEIGNTEEIIKEPLHPYTKALIKSLPNAGIRHTKEKLEGIPGHPPNLINPPEGC
FT                   RFKDRCPLADESCVEEPPLQEIKEGRFVACWKVKDL"
FT   gene            426353..427312
FT                   /locus_tag="Tmath_0388"
FT   CDS_pept        426353..427312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0388"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: tpd:Teth39_1929 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60165"
FT                   /db_xref="GOA:D7AS21"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS21"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADH60165.1"
FT                   /translation="MLEGERLMIKAKNLTKIFNSGFLFTKNVVAAVDDVNFEIGKGEIL
FT                   ALVGESGSGKSTIGKMMLKLLKPSGGQILLDDKDIWNLSNNKEFYSRVQGIFQDPFSSF
FT                   NPIFKVNRVFKLVRQSFKKEVPASEWNDRVENVLKKVGLNAGEVLNKYIHQLSGGQLQR
FT                   LLIARALLMDVEVLVADEITSMLDASTRVDVLEALLSLKEIGAAIMFITHDLSQAYYIS
FT                   DKIVVLYRGSVVEMGSIEKVFSNPRHPYTQMLLDAIPQLDSKWETDRIDIEDSDKTHAT
FT                   WKEGLCKYIDRCPITDTSCVKPILKLIEEDHYVACAKL"
FT   gene            427342..429813
FT                   /locus_tag="Tmath_0389"
FT   CDS_pept        427342..429813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0389"
FT                   /product="glycoside hydrolase family 2 sugar binding
FT                   protein"
FT                   /note="PFAM: glycoside hydrolase family 2 sugar binding;
FT                   KEGG: tpd:Teth39_1928 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60166"
FT                   /db_xref="GOA:D7AS22"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="InterPro:IPR041447"
FT                   /db_xref="InterPro:IPR041625"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS22"
FT                   /inference="protein motif:PFAM:PF02837"
FT                   /protein_id="ADH60166.1"
FT                   /translation="MEKRISLNGTWHFKEAYSSEWYEGEVPGCVQLDLMRLGEIDDPYY
FT                   RMNEVKFHKLEEKEWVYRKEFDFDEKDKDEFDAIKLIFEGIDTFADIYLNDMHLGKAQN
FT                   MFMLYEFDVKNIIKHGKNVLEVHFDSITKTIKAMEQTSPVNLAWSGERGRPYVRKAQYS
FT                   FGWDWGPRIVQVGLWRGVYLSLVKYAEIKNPYFYTEKIEQNKAYVVLSAEIEKYIKKDL
FT                   EAEIEIIHNDTSYGKKREKVQKNKIKTTMLIKNPKLWYPNGIGEQPLYDIRIRLLAGEE
FT                   IIDERNFRSGIRTVKLIREKDEEGETFIFEINGIKVFAKGANWIPADNLLPRLTKEDYY
FT                   EYIRLAKDANMNMLRIWGGGIYEDPAFYDACDEMGIMVWQDFMYACAQYPDQFEWFQEL
FT                   AKEEAEKVILTLRNHPSIVLWCGNNENNWGFHSWWNNKDPKYLGNYIYKEILPKVCARL
FT                   DPSRPYWVSSPYGGEDPNSESEGDRHQWNVWSGWVDYEEYTRDRGRFLSEFGFQSMPDW
FT                   KTVLSYTAPEDRTILSPVVISHNKMVEGMERLIRFMVGHLGFPKDLKSFVYLSQFNQAE
FT                   AIKTGVEHWRSRKFKTGGTLYWQFNDCWPVASWSCIDYYKRKKALYHYSKKFYAEILPY
FT                   IKKEDGGITIYGISDLTCDEEVDVAIKVFKLNGEKIAEKHLKTKLIANDVTKIAHYQIE
FT                   ELNIGYRAKEMPIAIPGCTLPIEENGELLNSVIYLEIIANRKTYENYKVFDRFRNLNLL
FT                   QPRISYEIAEKKIVLETDIPAFGVFIETDNDVELSDNCLNMMPNKKYEIKCSQNPENVK
FT                   VFDITQLIANI"
FT   gene            429863..431206
FT                   /locus_tag="Tmath_0390"
FT   CDS_pept        429863..431206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0390"
FT                   /product="beta-galactosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="TIGRFAM: beta-galactosidase; KEGG: tpd:Teth39_1927
FT                   beta-glucosidase; PFAM: glycoside hydrolase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60167"
FT                   /db_xref="GOA:D7AS23"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017736"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS23"
FT                   /inference="protein motif:TFAM:TIGR03356"
FT                   /protein_id="ADH60167.1"
FT                   /translation="MIKFPKDFVWGVATSSYQIEGAVNEDGRTPSIWDTFSKTEGKTYQ
FT                   GHTGDVACDHYHRYKEDVEIMKEIGVKAYRFSIAWPRIFPEEGKYNSKGIDFYKRLVDE
FT                   LLKKDIMPVVTIYHWDLPQWAYEKGGGWLNRDSVKWFAEYATKLYEELGDVIPLWITHN
FT                   EPWCASILSYGIGEHAPGHKDYREALIAAHHILLSHGEAVKAFREMNIKGSKVGITLNL
FT                   TPVYPASEKEEDKLAAQYADGFSNRWFLDPIFKGNYPQDMMELYSKIIGEFDFIKEGDL
FT                   ETISVPIDFLGVNYYTRSIVKYDEESMLKAENVPGPGKRTEMGWEISPESLYDLLKRLD
FT                   REYTKLPIYITENGAAFKDEVTEDGRVHDDERIEYIKEHLKAAAKFIEEGGNLKGYFVW
FT                   SLMDNFEWAHGYSKRFGIVYVDYKTQKRILKDSALWYKGVIQRSVIEE"
FT   gene            complement(431263..432057)
FT                   /locus_tag="Tmath_0391"
FT   CDS_pept        complement(431263..432057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0391"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: tex:Teth514_0276 ABC-3
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60168"
FT                   /db_xref="GOA:D7AS24"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS24"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ADH60168.1"
FT                   /translation="MIDIFSYEFMRRAFIAGSIISIIAPLTGSFLVLRRLSQIGDTLSH
FT                   VALAGVAAGILLGINPTLGSIIVVLLASFGIERLRKTYLRYSEISIAIVMSAGMSIAII
FT                   LLSLSRGGAANIMNYLFGSIVSVTNTEVFLILTLGIIVVASIVLLYKELLYITFDEEAA
FT                   KISGIPVGYINFFFTILVALTVALAMRIVGALLVSSLMVIPAAASLRIAQNFKQTIFYA
FT                   ILFSFISVFSGIAISFYLNLSPGGSIVLVSLLIMGLVSLKKR"
FT   gene            complement(432050..432814)
FT                   /locus_tag="Tmath_0392"
FT   CDS_pept        complement(432050..432814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0392"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_1925 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60169"
FT                   /db_xref="GOA:D7AS25"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS25"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH60169.1"
FT                   /translation="MNFVELKNVSFAYDTKKVLNNVSLKINKGEFVAIIGPNGSGKSTL
FT                   VNIMVGNLIPTSGEVLYDGVKLTNIKNRSFISYVPQKSYSFNASFPASVEEVVSMGLYA
FT                   KKGIFKKLSKKDWEEVYEALRIVDMLDYKHSLIGKLSGGQLQRVFIARSLVVKPEILFL
FT                   DEPTTGIDAKSEKALYAILEKLNKEKGITIVMVTHDVWAITDKVSRIICMSEGKINEKC
FT                   EAVDLDEGDLAELYGYPVKITKHHHNGSVNND"
FT   gene            complement(432821..433702)
FT                   /locus_tag="Tmath_0393"
FT   CDS_pept        complement(432821..433702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0393"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   tex:Teth514_0278 periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60170"
FT                   /db_xref="GOA:D7AS26"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS26"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ADH60170.1"
FT                   /translation="MKKFLMAILLIIAVIVGITSCSTKTEESSKPVIYASFYPIYDLAS
FT                   KIGGDKITVKTIIPPGVEPHDWEPTTKDVASMTKAKTILYLGLGMDSWIDKIKANAPNV
FT                   AFYEVSKGVTPIVEGSITNPHIWLSPKESLIMTKNINEALQKSFPAYKDYFEKNYQNLK
FT                   TTLEALDKEYTDALSQTKHKIFIVYHSAFDYLARDYGLKQEALVGMNEEAEVSPARMTE
FT                   IINLIKNENIKYIFTEPLASPKPIQTIAKETGAQVLPLSTIEGLTKEDIKKKEDYISLM
FT                   KQNLENLKKALE"
FT   sig_peptide     complement(433631..433702)
FT                   /locus_tag="Tmath_0393"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.633 at
FT                   residue 24"
FT   gene            complement(433708..434136)
FT                   /locus_tag="Tmath_0394"
FT   CDS_pept        complement(433708..434136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0394"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG:
FT                   tex:Teth514_0279 ferric uptake regulator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60171"
FT                   /db_xref="GOA:D7AS27"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS27"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADH60171.1"
FT                   /translation="MRKQEAVKKLKEHNYKLTPQRELILDIMLNQQGYLSVREIYEKVK
FT                   EVFPQVSIDTVYRNLSLLKDINILNETTIGNNIMYVMRKEIHNHTMKCLNCGQIFELDI
FT                   CPLELWINQIKDFEIVDHKIEIVGYCKNCRADKTHFRR"
FT   gene            434459..435031
FT                   /locus_tag="Tmath_0395"
FT   CDS_pept        434459..435031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0395"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: tpd:Teth39_1919
FT                   LemA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60172"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS28"
FT                   /inference="protein motif:PFAM:PF04011"
FT                   /protein_id="ADH60172.1"
FT                   /translation="MKNPLIITLIVLAVIAVLVFGTIYGIYNQLVALDENVNSKWSQID
FT                   NQLQRRADLIPNLVETVKGYAAHEKEIFDSVNKAREKLLSANTVAEKAASNDELNTALG
FT                   RLLAIAENYPNLKADANFRQLSDELAGTENRIAVARMDYNNAVQAYNTKIRSFPASIIA
FT                   NMFGFKEREYFKADEAAKTVPKVDFSK"
FT   sig_peptide     434459..434524
FT                   /locus_tag="Tmath_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.826) with cleavage site probability 0.703 at
FT                   residue 22"
FT   gene            complement(435174..436058)
FT                   /locus_tag="Tmath_0396"
FT   CDS_pept        complement(435174..436058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0396"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: tex:Teth514_0284 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60173"
FT                   /db_xref="GOA:D7AS29"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS29"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH60173.1"
FT                   /translation="MTLRDIEIFVTVCELKSMSAAAKKLYMSQPAISQAISQMEGELQV
FT                   RLFDRIGRKLSLTYAGEILYSYGKRILNLVKEAESTLDDVRNMRMGRLRVGTSTTVGIY
FT                   LLPEIIGEFRKKFNIDVYFTIGNTAEIEKLILDNSIDLGIVEGPVHSRDIVVTPYIDDE
FT                   LYLVCSKSHRWAKKKNISPAEIENEDIIMREKGSGTREVFEEAMARNNVKYRIKYVLNN
FT                   TEAIKKAVEANIGVSVISRLAVKKEIRGGRLLKVDIENIRFKRKFSIIYHKDKFKSNLF
FT                   EEFIKHLYNCSIR"
FT   gene            436383..437426
FT                   /locus_tag="Tmath_0397"
FT   CDS_pept        436383..437426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0397"
FT                   /product="sulfite reductase, subunit A"
FT                   /note="TIGRFAM: sulfite reductase, subunit A; KEGG:
FT                   tex:Teth514_0285 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60174"
FT                   /db_xref="GOA:D7AS30"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR014259"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS30"
FT                   /inference="protein motif:TFAM:TIGR02910"
FT                   /protein_id="ADH60174.1"
FT                   /translation="MSYCVSIKRMNEILKALQKEYKIYAPVRFEKRGRYSDTDLIRYAE
FT                   INSIEDVVYDEKSDFSPKEVIYPITQALFYFTEYEYMESKIDDKKILIFARPCDINGFR
FT                   RLDTIFLKNGGTEDIYYKRLREKVKFILMECKEGGWDSCFCVSMGSNKTDDYSLAVRFS
FT                   NDNILVEIKDDEFTNLFADEREVEFTPEFVTSNPTKVNIPEIDSHELLEKIYDLDMWKS
FT                   YNSRCISCGACTAVCITCSCFTTLDVTYTENGKVGERRRVQASCMHEDFTTMAGGLSFR
FT                   KTAGERMRFRTLHKIYDYKLRFKDEHMCVGCGRCDERCPELISFPATINRLYDEVEKLK
FT                   KAETTKE"
FT   gene            437458..438249
FT                   /locus_tag="Tmath_0398"
FT   CDS_pept        437458..438249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0398"
FT                   /product="sulfite reductase, subunit B"
FT                   /note="KEGG: tpd:Teth39_1916 anaerobic sulfite reductase
FT                   subunit B; TIGRFAM: sulfite reductase, subunit B; PFAM:
FT                   oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   Dihydroorotate dehydrogenase, electron transfer subunit,
FT                   iron-sulphur cluster binding domain; Oxidoreductase
FT                   FAD-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60175"
FT                   /db_xref="GOA:D7AS31"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR014260"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS31"
FT                   /inference="protein motif:TFAM:TIGR02911"
FT                   /protein_id="ADH60175.1"
FT                   /translation="MSENIMRPTPHKIIDIIRETGNEYTFRIETNAKVKHGQFFQVSLP
FT                   KVGEAPISVSAMGDGWVELTIRKVGKVTNEIFNLKPGDKIFMRGPYGNSFPVDDFKGKD
FT                   LVVIAGGTGVSPVRSLLKYFYEHPDEIHSLYFIAGFKDEESILFKEDLNNFRSRFNTIY
FT                   TLDKDKIEGFEVGFVTEHIKKIPFDSFENYNVVIVGPPVMMHFAALECLKNGVTEEKIW
FT                   VSFERRMSCGVGKCGHCKINETYVCLEGPVFNYAKAKNLLD"
FT   gene            438266..439279
FT                   /locus_tag="Tmath_0399"
FT   CDS_pept        438266..439279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0399"
FT                   /product="sulfite reductase, subunit C"
FT                   /note="KEGG: tpd:Teth39_1915 nitrite and sulphite reductase
FT                   4Fe-4S region; TIGRFAM: sulfite reductase, subunit C; PFAM:
FT                   nitrite and sulphite reductase 4Fe-4S region; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein;
FT                   nitrite/sulfite reductase hemoprotein beta-component
FT                   ferrodoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60176"
FT                   /db_xref="GOA:D7AS32"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR014261"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS32"
FT                   /inference="protein motif:TFAM:TIGR02912"
FT                   /protein_id="ADH60176.1"
FT                   /translation="MSYDIDIKKVRRNCYRQSKVRGEFMLQIRVPGGVIDAKYLSFFQH
FT                   IAETWGNGEFHLGVRQTISIPGIKYEYIDEVNKYIRPYIEEIEVNLCGVDMVVDDNGYP
FT                   TIGARNIMACIGNRHCIKANIDTTDLARKIEKIIFPSDYHIKLNIAGCPNDCAKAHVSD
FT                   IGIIGITKTEYDYERCIGCKKCVEACARHATRVLSVEKGKIVKDTCCCVGCGECVLVCP
FT                   TGAWTRNPKKFYRVLIGGRTGKQTPRMGKIFLNWVTEDVVLGVLKNWETFSAYVMNNKP
FT                   EYIHGGHLIDRVGYNKFKEMILKDVKLNPEAMVAERVLWTETEYRSNFNVKPVTQR"
FT   gene            439576..440337
FT                   /locus_tag="Tmath_0400"
FT   CDS_pept        439576..440337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0400"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="PFAM: TatD-related deoxyribonuclease; KEGG:
FT                   csc:Csac_1647 TatD-related deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60177"
FT                   /db_xref="GOA:D7AS33"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR012022"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS33"
FT                   /inference="protein motif:PFAM:PF01026"
FT                   /protein_id="ADH60177.1"
FT                   /translation="MKEIVDSHVHVSLLPFEGWESMALAGVKKIIGCSLFFGAKHAETL
FT                   FDHFHQMLTLSMSNAAKNGIKLYVTIGIHPMGIPDDWSRVINALPSYLKMSGVIGLGEI
FT                   GLHEENKREEEVFREQLKIAKEYKVPVIIHTPPQNRVEITEKIIEIATNVGMEPGKMII
FT                   DHANLDIIDLIEDFGAVPGLTIHQEGFTSQLLLNHLERFQRGVLNSDYSNLKPNDPLSV
FT                   PKTVRYLELNGASPELIARIARYNAEKVFGI"
FT   gene            440425..440751
FT                   /locus_tag="Tmath_0401"
FT   CDS_pept        440425..440751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0401"
FT                   /product="Protein of unknown function DUF2250"
FT                   /note="PFAM: Protein of unknown function DUF2250; KEGG:
FT                   csc:Csac_1648 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60178"
FT                   /db_xref="InterPro:IPR019254"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS34"
FT                   /inference="protein motif:PFAM:PF10007"
FT                   /protein_id="ADH60178.1"
FT                   /translation="MPVNNDQEEFLDLTILAYLKKLGPEYAKFLARRLGLSLEESRKRL
FT                   QSLEERGLIKRVERRIVKYYHRQRKSVKHRNHTYYELTREGELFLRQARKKIDINLDIK
FT                   YPNR"
FT   gene            440824..442072
FT                   /pseudo
FT                   /locus_tag="Tmath_0402"
FT   gene            442069..442482
FT                   /locus_tag="Tmath_0403"
FT   CDS_pept        442069..442482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0403"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /note="KEGG: tpd:Teth39_1910 NifU family SUF system FeS
FT                   assembly protein; TIGRFAM: SUF system FeS assembly protein,
FT                   NifU family; PFAM: nitrogen-fixing NifU domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60179"
FT                   /db_xref="GOA:D7AS35"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS35"
FT                   /inference="protein motif:TFAM:TIGR01994"
FT                   /protein_id="ADH60179.1"
FT                   /translation="MSDLNQLYSEVIMEHYENSPHQKELKDATHKERGYNPLCGDNITL
FT                   YLKMNGDIIEDASFTGHGCAISQASTSMMIDLIKGKDKKEALRLVQEFIDMIHKKDVNL
FT                   DELGDAQVLQGVSDFPARVKCALLAWKTLQEIL"
FT   gene            complement(442486..442681)
FT                   /pseudo
FT                   /locus_tag="Tmath_0404"
FT   gene            442988..443788
FT                   /locus_tag="Tmath_0405"
FT   CDS_pept        442988..443788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0405"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   tpd:Teth39_1909 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60180"
FT                   /db_xref="GOA:D7AS36"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS36"
FT                   /inference="protein motif:PFAM:PF04536"
FT                   /protein_id="ADH60180.1"
FT                   /translation="MKGRIFLIAIAFLLLFFNSIAFSAPDVPPKPIQFRYVYDYAGLMS
FT                   QNDIEEIERVGKALDDATKAQIIVVTVDTIGDYPIEEYSLALFRNWGIGDKEKNNGVLF
FT                   LVVKDRLLKGQAGKVRIEVGYGLEGAIPDSVAGRILDDFVLTSWAKGEYSKGIYAGYMA
FT                   VASRVAKEYNIDLQGLDVSEYSVNTSSNDSSISWEDIAAVIILILIFIIFGRGGRNIRR
FT                   NWWGPGSFGSGGFGDFRGGSFGGGGFGGGGGFGGGSAGGGGASR"
FT   sig_peptide     442988..443059
FT                   /locus_tag="Tmath_0405"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.962 at
FT                   residue 24"
FT   gene            complement(443841..444413)
FT                   /locus_tag="Tmath_0406"
FT   CDS_pept        complement(443841..444413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0406"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   tex:Teth514_0292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60181"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS37"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ADH60181.1"
FT                   /translation="MPLPEKNKKYTYADYLTWSEEERWEIINGVPYLQAAPTWQHQAVL
FT                   LELARQFANYLQDKSCRVFTAPFDLRIPEANEKDEETTNVVQPDIIIICDNSGLKKTGY
FT                   YGVPELIIEVVSPSTGQKDKIEKFNLYEKAGVKEYWIVEPDEKVVMVFTLEEGRYGRPQ
FT                   MYSEEDKVKVSIFDNLVIELKPVFERI"
FT   gene            444571..445021
FT                   /pseudo
FT                   /locus_tag="Tmath_0407"
FT   gene            445047..445258
FT                   /pseudo
FT                   /locus_tag="Tmath_0408"
FT   misc_binding    445321..445514
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 124.91"
FT   gene            445629..446576
FT                   /locus_tag="Tmath_0409"
FT   CDS_pept        445629..446576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0409"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   tpd:Teth39_1904 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60182"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS38"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADH60182.1"
FT                   /translation="MRNFKGLLALLLVFVLAFYLAACSTNTVTKPENTSQTATETVKTQ
FT                   FPLKVTDFLGKEVTIEKEPQRIVSLAPSITELIYALGAGNKVVGVTDFDNYPPEVKDVP
FT                   KVGGFKGPNVEAITAQKPDIIFASTLSGKEQMESLEKMGIPVVMLEAKNIDQIYQSIRI
FT                   IGQITGTEKKGEEIIKQMQDKIKEINDKVKELPKVSVFYLVSLDGNWTAGKGTFIDELI
FT                   NLAGGKNVAEDVNGWAQYSVEELVKKNPDVIITSPHAGNVKDIKNMAGYKDTNAVKNDK
FT                   IFVISNDDIISRASNRIVLGLEEIAKFLHPEAFK"
FT   sig_peptide     445629..445697
FT                   /locus_tag="Tmath_0409"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.824 at
FT                   residue 23"
FT   gene            446578..447570
FT                   /locus_tag="Tmath_0410"
FT   CDS_pept        446578..447570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0410"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   tex:Teth514_0297 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60183"
FT                   /db_xref="GOA:D7AS39"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS39"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADH60183.1"
FT                   /translation="MKFKRGIYFGTAFSLLVFTMILSISAGAVKIPLREILNIFFGGGS
FT                   ETSRTIILNLRLTRVIESAVVGMGLSVVGAFFQGLLRNPMADPYVLGISSGAAFGATIA
FT                   IILGFGIFGLSFMAFVTSLMTVFFVYTISRTSTRVSMTTMLLAGIAISAFMSAIISLMM
FT                   LLNHDEFSRIVFWTMGGFSLITWNSVVFSTPIIVIGSFVMYVFSRDVNAILTGEEVAEH
FT                   LGVNTELVKKIILVTGSLVTATAVSVGGIIGFVGLIVPHISRLIVGPDNRVLVPFSAIS
FT                   GAIFLTFADLLARIILKPMEIPIGIITAAFGGPFFLYLLIKSKQKSEGM"
FT   sig_peptide     446578..446664
FT                   /locus_tag="Tmath_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.649 at
FT                   residue 29"
FT   gene            447575..448375
FT                   /locus_tag="Tmath_0411"
FT   CDS_pept        447575..448375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0411"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_1902 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60184"
FT                   /db_xref="GOA:D7AS40"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS40"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH60184.1"
FT                   /translation="MAILKVDKLHFSYGERKVLRGIDFTINKSIVIGIIGANGSGKTTL
FT                   LKNISGYLTPTYGNVFVLGKNIKDFTIKEKAKYIGYVPQDIVYDFEFSCYDVVMMGRIP
FT                   YLKRFQSERKEDRDIVRECMEITNTWQFKDKSIKELSGGERQRVYIARALAQKARILLM
FT                   DEPVSHLDIKYQVEILSLVKDLSLKGILVIVVLHDINLASQFCDEIFIMKEGKIIASGS
FT                   PRNVLTLNNIKSAFSIDVEVFENPIIHTPYVIPSLNGKEQLKVV"
FT   gene            448368..449750
FT                   /locus_tag="Tmath_0412"
FT   CDS_pept        448368..449750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0412"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="KEGG: tex:Teth514_0299 cobyrinic acid a,c-diamide
FT                   synthase; TIGRFAM: cobyrinic acid a,c-diamide synthase;
FT                   PFAM: Cobyrinic acid ac-diamide synthase; CobB/CobQ domain
FT                   protein glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60185"
FT                   /db_xref="GOA:D7AS41"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS41"
FT                   /inference="protein motif:TFAM:TIGR00379"
FT                   /protein_id="ADH60185.1"
FT                   /translation="MCKAVMIAGTHSGAGKTTVSLGLMGVLSKRYKVQPFKVGPDYIDA
FT                   AYHRYVTGNFSCNLDLYMLGEQNLKSLFYKNACNADISIIEGVMGMYDGIDTTKKGSSA
FT                   HIAKILDIPVILVVDASSMATSVSALIMGYMHYDREVKIKGVILNKVGSEKHYALLKEC
FT                   ITRDLGIEVFGYLPKDPKLDLPERHLGLVPIYEMPEIKHKFDTLYDYIEKYIDIEKILN
FT                   VSVIDCSNTFRNTIGEGHDLKRVKIGYAFDEAFNFYYKESLELFEEMGAELVPFSPLKA
FT                   YKLPDGISGLYIGGGFPEVFAEKLSKNKKMLKSVKDAIDSGMPAYAECGGFMYLTKSIT
FT                   DLQGDTFEMAGIYDFETVMTKRLQRFGYVEAEVIEDNVLFRKGDKIKGHEFHHSIIKGF
FT                   SQKASYVVHKPGKENAWECGFVHKNCLATYVHINLYTYKEAVKRFVDKCVQYRNSNAFQ
FT                   ED"
FT   gene            449752..451275
FT                   /locus_tag="Tmath_0413"
FT   CDS_pept        449752..451275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0413"
FT                   /product="cobyric acid synthase CobQ"
FT                   /note="KEGG: tex:Teth514_0300 cobyric acid synthase;
FT                   TIGRFAM: cobyric acid synthase CobQ; PFAM: CobB/CobQ domain
FT                   protein glutamine amidotransferase; Cobyrinic acid
FT                   ac-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60186"
FT                   /db_xref="GOA:D7AS42"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS42"
FT                   /inference="protein motif:TFAM:TIGR00313"
FT                   /protein_id="ADH60186.1"
FT                   /translation="MALKLMIQGTASSVGKSLLVAAFCRIFKQDGYRVAPFKSQNMALN
FT                   SYITDEGLEIGRAQAMQAEAAGVKPSYHMNPILLKPSSDKKSQVVLRGKVYKNMSAAEY
FT                   HQFKPQLLKFIKEDFDFLASQNDIVVIEGAGSPAEINLRDRDVVNMGMAEMVNAPVLLV
FT                   GDIDKGGVFASIAGTLLLLKENERNRIEGVLINKFRGDIEILKPGLEMLENIVHKKVLG
FT                   VVPYMDVHIDEEDGATERFYRRSTEGDIEIAVINLPHISNFTDFEPLAKVPGIKLRYVN
FT                   KGERIGDCDVVIIPGTKNTIGDLQALKKYGLDKEIFEMRKKGKFIVGICGGYQILGKVI
FT                   KDPGRIESTTSEIEGLGLLDVETVIENEKTTTQIKAVIRNNLPSILSPLRNIAVEGYEI
FT                   HMGKSRILGDCQPFSVITHRNGEKIEVYDGCISDDGKVFGTYIHGIFENREFVREFINI
FT                   VRKSKGLSPIEEIIDYKEFKEREYDKLADIVRKSIDMKEVYEIMERYRD"
FT   gene            451275..452213
FT                   /locus_tag="Tmath_0414"
FT   CDS_pept        451275..452213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0414"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="KEGG: tpd:Teth39_1899 cobalamin biosynthesis protein
FT                   CobD; TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   cobalamin biosynthesis protein CbiB"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60187"
FT                   /db_xref="GOA:D7AS43"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS43"
FT                   /inference="protein motif:TFAM:TIGR00380"
FT                   /protein_id="ADH60187.1"
FT                   /translation="MEVVLAYLLDLLIGDPEGYPHPVRIIGRVVSHLESILRRYAKSNR
FT                   ALKIAGFILCGLTVTLAFAATYALLYIAGLIHPYLKYAFDVLIIYTCLATKDLGKAAGK
FT                   VYEALTKGDIVEARRRLSYIVSRDTDRLDVENISRGAIETVAENISDGIIAPMFYAFIG
FT                   GAPLAIFYKAASTLDSMVGYKNEKYIDLGFASAKLDDILNFIPARITGFLIVMAAFLLG
FT                   YDYKNSWRIFLRDRLKHQSPNSAHGEAAVAGALNIQLGGLNYYFGKPEIKPTLGDGKEK
FT                   IDPQHIKDSIKIMYMTSFLGLVVFYIGRRLM"
FT   gene            452210..452695
FT                   /locus_tag="Tmath_0415"
FT   CDS_pept        452210..452695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tex:Teth514_1930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60188"
FT                   /db_xref="GOA:D7AS44"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS44"
FT                   /inference="similar to AA sequence:KEGG:Teth514_1930"
FT                   /protein_id="ADH60188.1"
FT                   /translation="MKEKANTLKNVKTLTLVAMLIALSAIGALIKVFNTVAFDSMPGYF
FT                   AALYLGGWYGALVISLGHMLTAITSGFPLGLTNHIYIAVQMALYAYLFRFFYRKFNIYI
FT                   AVIVATILNGPVATLLFVPIFGWGFFAAWVLPLTIASFANVFLAALIYKAIPKRSRE"
FT   sig_peptide     452210..452293
FT                   /locus_tag="Tmath_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.890 at
FT                   residue 28"
FT   gene            452699..453430
FT                   /locus_tag="Tmath_0416"
FT   CDS_pept        452699..453430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1897 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60189"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS45"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1897"
FT                   /protein_id="ADH60189.1"
FT                   /translation="MIERYRDLVVIYENDVAYVISCDSLGAIGNKENDVLKVDEEIVGR
FT                   TTVKVALSEVLCVGAKPLVISDTLSVEMNPTGEKILKGIKNELEDNGLLDVVFTGSTEE
FT                   NFPTSMTGIGITVIAKANVCDLKIKKVKAGMHVSLLGYPRVGSEVLNSKDVLTLKDYIK
FT                   ISNSKEIIEAIPVGSKGIKYEIGILEKISGLKVEANFPQYLDVLKSGGPSTCCLVVHSE
FT                   EDTVSIKGLTDKPLTYIGVLI"
FT   gene            453454..454539
FT                   /locus_tag="Tmath_0417"
FT   CDS_pept        453454..454539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0417"
FT                   /product="L-threonine-O-3-phosphate decarboxylase"
FT                   /note="KEGG: tex:Teth514_0304 putative
FT                   L-threonine-O-3-phosphate decarboxylase; TIGRFAM:
FT                   L-threonine-O-3-phosphate decarboxylase; PFAM:
FT                   aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60190"
FT                   /db_xref="GOA:D7AS46"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005860"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7AS46"
FT                   /inference="protein motif:TFAM:TIGR01140"
FT                   /protein_id="ADH60190.1"
FT                   /translation="MKPYEHGGNVYDYEGEIIDFSSNINPLGVPEWIFDIIKKVDLTKY
FT                   PDIKYRKLKEAVSQYVGYSQENIIVGNGATELIHLFVRAFKVKRPLIPSPAFLEYERAV
FT                   HINGGEPIYFRLEEDYGFKMNLAKLLSQMEEADSLIIGNPNNPTGQAIIREEIGILLKK
FT                   AEILNIPVMIDEAFIEFMKDYKNYEALPLINKHDKLFVVRAATKFFGMPGLRLGYGIGS
FT                   SSLIQKLEEHKEPWTVNAFADAVGREIFKDEAYIEKTREYVNKEIDYMLYALREIDYLV
FT                   AFDTKVNFILLKLRTGRVNDLKQILLKKGILIRDASNFRYLDKSFFRVAIKRHEDNEKL
FT                   IQALKEIDIKDLVEDKERVVI"
FT   gene            454540..455094
FT                   /locus_tag="Tmath_0418"
FT   CDS_pept        454540..455094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0418"
FT                   /product="Adenosylcobinamide-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.62"
FT                   /note="KEGG: tex:Teth514_0305 adenosylcobinamide
FT                   kinase/adenosylcobinamide-phosphate guanylyltransferase;
FT                   PFAM: cobalbumin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60191"
FT                   /db_xref="GOA:D7ASG7"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASG7"
FT                   /inference="protein motif:PRIAM:2.7.7.62"
FT                   /protein_id="ADH60191.1"
FT                   /translation="MSLVMITGGARSGKSEFAEQLALEKGGNSVLYIATSIPFDEEMKE
FT                   RVRRHKERRPPFWQTKEVYKNLYDVISKSNAKVALIDCLTVMITNLLMEVDLTWENAGI
FT                   EEIDNIENQIADEVDEILTAKKDFKGDIILVTNEVGMGLVPEYKLGRIFRDIAGRMNKK
FT                   VADAADEVYLMVSGIPLKIKG"
FT   gene            455117..455869
FT                   /locus_tag="Tmath_0419"
FT   CDS_pept        455117..455869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0419"
FT                   /product="cobalamin 5'-phosphate synthase"
FT                   /note="KEGG: tex:Teth514_0306 cobalamin synthase; TIGRFAM:
FT                   cobalamin 5'-phosphate synthase; PFAM:
FT                   cobalamin-5-phosphate synthase CobS"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60192"
FT                   /db_xref="GOA:D7ASG8"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASG8"
FT                   /inference="protein motif:TFAM:TIGR00317"
FT                   /protein_id="ADH60192.1"
FT                   /translation="MEEIKRLVLAMQFMTRLPIPIEIDAEKSEFYKIASYFPIVGIVIG
FT                   GILSLLYIALKNFFSREIVMTFIVAFSYVLTGAMHIDGLADTFDGLFSNKDKERILEIM
FT                   RDSRLGTNGVLALVFMVVLKILFLTNIHENITLTALLITPIIGRLSIVFSMMITKSARG
FT                   GKGLGGLMLGKVGIREFVIAFVISIATSYFILPLAVFVKILTISLFVTYIVSKYISLRI
FT                   GGMTGDTLGAVNELAELTALICFVSVSL"
FT   gene            455885..456250
FT                   /locus_tag="Tmath_0420"
FT   CDS_pept        455885..456250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0420"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein; KEGG: tex:Teth514_0307 cobalamin (vitamin B12)
FT                   biosynthesis CbiX protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60193"
FT                   /db_xref="GOA:D7ASG9"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASG9"
FT                   /inference="protein motif:PFAM:PF01903"
FT                   /protein_id="ADH60193.1"
FT                   /translation="MGKGLLIIAHGSRVEETKDVVTKVVEKIKNLKNTKNVKAGFMEFN
FT                   EPDISTSIREFVEEGIYDIIAVPMFLFEGNHVLHDIPEVFGEEKEKYPGLKIKFAKSIG
FT                   YDDRIVDIILERAKEVE"
FT   gene            456282..456905
FT                   /locus_tag="Tmath_0421"
FT   CDS_pept        456282..456905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0421"
FT                   /product="Precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /note="KEGG: tex:Teth514_0308 precorrin-8X methylmutase
FT                   CbiC/CobH; PFAM: Precorrin-8X methylmutase CbiC/CobH"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60194"
FT                   /db_xref="GOA:D7ASH0"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASH0"
FT                   /inference="protein motif:PRIAM:5.4.1.2"
FT                   /protein_id="ADH60194.1"
FT                   /translation="MNYITDPKEIEKRSFEIISKNIDEMKFEKRELMIVKRVIHATADF
FT                   DFAHIIKISDGAIDAGLKALKEGCTIVTDTKMAEAGINKKALKSIGASVKCYIDMPQVE
FT                   ELSKTYAITRSMASMVIASKDGRNKIFAIGNAPTALFKLCELVNSGEVMPYLIIGVPVG
FT                   FVGAQEAKEEVKKLGVPYIITEGRKGGSTIAAAIVNALLYMMGD"
FT   gene            456938..458038
FT                   /locus_tag="Tmath_0422"
FT   CDS_pept        456938..458038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0422"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /note="KEGG: tex:Teth514_0309 cobalamin biosynthesis
FT                   protein CbiD; TIGRFAM: cobalamin biosynthesis protein CbiD;
FT                   PFAM: cobalamin (vitamin B12) biosynthesis CbiD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60195"
FT                   /db_xref="GOA:D7ASH1"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASH1"
FT                   /inference="protein motif:TFAM:TIGR00312"
FT                   /protein_id="ADH60195.1"
FT                   /translation="MEVYTIKEGKKLRYGYTTGSCAAAASKAATYMLFTGEKIDTVEID
FT                   TPKGWHLILDVLDVTSGNGWVKCGIRKDGGDDPDATHGLIIYSKVELKEGEGIDVYGGE
FT                   GVGVVTKPGLPVNPGKPAINPVPMSMILNEVKKVLPEGKGVKITISVPGGEKVALKTFN
FT                   PRLGIVGGISILGTSGIVEPMSEEALKSSLELELSILSAEGHKKVVFAPGNYGKDYAMK
FT                   EGLEERLIISYGNFLGFMLEKAVEYGFAHVVLAGHIGKLVKVAAGIFDTHSHVADARAE
FT                   IMAAYAAHFGADKKTVDKVLDSNTTEEALDIIEKAGVNIKDFSQFIADRVYMKCKQYVY
FT                   DKLNIEVHLISLKRGIIAKAGEKVEW"
FT   gene            458032..458643
FT                   /locus_tag="Tmath_0423"
FT   CDS_pept        458032..458643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0423"
FT                   /product="precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /note="KEGG: tex:Teth514_0310 precorrin-6y
FT                   C5,15-methyltransferase (decarboxylating), CbiE subunit;
FT                   TIGRFAM: precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60196"
FT                   /db_xref="GOA:D7ASH2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASH2"
FT                   /inference="protein motif:TFAM:TIGR02467"
FT                   /protein_id="ADH60196.1"
FT                   /translation="MVTIVGIGPGNKKFITPYALEKIKKADVLVGGRRHLEEFEDIDCE
FT                   KIVINASTDYQSILSREGNIVILASGEPSLYGITEVILKYVDKSQLEIIPGISSIQYMC
FT                   AKLKITMNDLTVVSLHGRSEDLVKKVKENKKVAVFTDNTHTPQFIAALLKEGNLHDRKI
FT                   HVGENLSYDIERIYSFTVEELLNCNKKFDLNVVVITCGNT"
FT   gene            458640..459212
FT                   /locus_tag="Tmath_0424"
FT   CDS_pept        458640..459212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0424"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit"
FT                   /note="TIGRFAM: precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit; KEGG: tex:Teth514_0311
FT                   precorrin-6Y C5,15-methyltransferase (decarboxylating),
FT                   CbiT subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60197"
FT                   /db_xref="GOA:D7ASH3"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR023475"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASH3"
FT                   /inference="protein motif:TFAM:TIGR02469"
FT                   /protein_id="ADH60197.1"
FT                   /translation="MTPGIPDEYFVRGNVPMTKEEIRALSISKLRLKEDSIIWDIGAGT
FT                   GSISIEAALISKKGVVYSIEKEEEGIKLINENIKRFNVENIVVVAGEAPDALLDLPSPD
FT                   RIFIGGTGDKMYQIFDIATTKLKEEGVVVVNGITLDTAYSANHYFKQKGYSVETICVNI
FT                   SVSKEAGNKTMMIARNPVYIITAKREG"
FT   gene            459214..459888
FT                   /locus_tag="Tmath_0425"
FT   CDS_pept        459214..459888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0425"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /note="KEGG: tex:Teth514_0312 precorrin-2
FT                   C20-methyltransferase; TIGRFAM: precorrin-2
FT                   C20-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60198"
FT                   /db_xref="GOA:D7ASH4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASH4"
FT                   /inference="protein motif:TFAM:TIGR01467"
FT                   /protein_id="ADH60198.1"
FT                   /translation="MAKLYGIGVGPGEESLITLKAVKILQKVDVVIAPTSKGEGSIAYE
FT                   IAKPYIKGDVIFMEFPMTYSKEDLKTKWEENVKKIKELLDEGKDVAFITIGDPMIYSTY
FT                   IYILKGIKDYEVETIPGITSYSAAASRLNIPIAEGNETFAVISSGDVTEISKALDMFDN
FT                   VVLMKISRRYEEIVNLLKEKRFKGYLVIKCGHQDEKISCDLDRYIGKKIDYLSLIIAKK
FT                   VK"
FT   gene            459891..460646
FT                   /locus_tag="Tmath_0426"
FT   CDS_pept        459891..460646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0426"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="TIGRFAM: precorrin-4 C11-methyltransferase; KEGG:
FT                   tex:Teth514_0313 precorrin-4 C11-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60199"
FT                   /db_xref="GOA:D7ASH5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASH5"
FT                   /inference="protein motif:TFAM:TIGR01465"
FT                   /protein_id="ADH60199.1"
FT                   /translation="MIYFIGAGPGDPELITLKGMKIIQACDVIIYAGSLVNKEILKYAK
FT                   PEAEIYNSALMNLDEIIELMVKSHKEGKDVARIHTGDPAIYGAIHEQIVRLEEENIDYE
FT                   VIPGVSSFLAAAAVLKKELTVPEITQTVIITRIGGRTKVPPEQELKELSRHRATMAIFL
FT                   SVQEIDRVVSELKEGYQETTPVAVVYKATWEDQVIVTGTLNDISQKVKSKGINKTAMIL
FT                   VGDFLKDVKSYSKLYDREFSHSFRKKENL"
FT   gene            460643..461692
FT                   /locus_tag="Tmath_0427"
FT   CDS_pept        460643..461692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0427"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein; KEGG: tex:Teth514_0314 cobalamin biosynthesis
FT                   protein CbiG"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60200"
FT                   /db_xref="GOA:D7ASH6"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR021745"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASH6"
FT                   /inference="protein motif:PFAM:PF01890"
FT                   /protein_id="ADH60200.1"
FT                   /translation="MKVAIIALTKNASKLANEIGQKLKGDVYVKEKYSTPEGYAIEEDF
FT                   IDFVHKIFRKYQGLVFVMATGIVVRAIAGVVKDKFTDPAVVVVDEKGKFAISLLSGHVG
FT                   GANRLALKVASIIGAQPVITTATDVEGVISLDVIAKDYGYQIENKEDLKKVSAAFVNGE
FT                   NVRFILDEDAEKIPLLKDYLKNRDDRQVDAFVYITDKEIKKPLEKPYVILRPKNIVIGL
FT                   GCKKGIAFEDLFLFVSETFKKLNLSLKSIKSIATIDIKKEEKGIQHLAKFLKVPLVFYT
FT                   KEDLKKVEDKFPISDFVFHTVGVGSVARPSAYLASSGGKEIAYLKKNGMTLAIYKKEGL
FT                   TWDGLKSWE"
FT   gene            461665..462396
FT                   /locus_tag="Tmath_0428"
FT   CDS_pept        461665..462396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0428"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /note="KEGG: tex:Teth514_0315 precorrin-3B
FT                   C17-methyltransferase; TIGRFAM: precorrin-3B
FT                   C17-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60201"
FT                   /db_xref="GOA:D7ASH7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASH7"
FT                   /inference="protein motif:TFAM:TIGR01466"
FT                   /protein_id="ADH60201.1"
FT                   /translation="MGWIKVVGIGPGDINDMTLKAYNVLKECNVVVGYTTYINLIKPLI
FT                   EDKEVISLGMRKEIDRAKKAVELALQGKNVCIVSSGDAGIYGMAGLMYEVVHKENIDLK
FT                   IEVIPGVTALNAAAAILGAPVMQDFAVISLSDHLVPWQVIEKRLALSAQADFVIVLYNP
FT                   KSKERPENLMKAQKIIMKYKKEDIPVGIVKNASREGQQVIITTLKEMANYEIDMRTIVI
FT                   IGNESTYVENGKMVTPRGYVL"
FT   gene            462393..463142
FT                   /locus_tag="Tmath_0429"
FT   CDS_pept        462393..463142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0429"
FT                   /product="precorrin-6x reductase"
FT                   /note="KEGG: tex:Teth514_0316 precorrin-6x reductase;
FT                   TIGRFAM: precorrin-6x reductase; PFAM: Precorrin-6x
FT                   reductase CbiJ/CobK"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60202"
FT                   /db_xref="GOA:D7ASH8"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASH8"
FT                   /inference="protein motif:TFAM:TIGR00715"
FT                   /protein_id="ADH60202.1"
FT                   /translation="MILVLAGTKDGREIAERLKLKGFGVIASTVTDYGASLFSEGIKVH
FT                   KGAMDELSLVNFIYKNNIDIVVDATHPFAKDVSINAINACNKTGIKYIRYERESLYYYK
FT                   AIVVKSFEEAAEECKKYDSIFLTVGSKNLEKFRVLWEIGKKVTARVLPLSSVIKKCENL
FT                   GLKPKNIIAMEGPFTKELNYQMFKERNAEVIVTKESGIVGGVLEKFEAAKMLGIPVILI
FT                   KRPDVNYPVVVTDVDSLINEVTKSGHK"
FT   gene            463129..464316
FT                   /locus_tag="Tmath_0430"
FT   CDS_pept        463129..464316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0430"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="TIGRFAM: glutamyl-tRNA reductase; KEGG:
FT                   tex:Teth514_0317 glutamyl-tRNA reductase; PFAM:
FT                   Tetrapyrrole biosynthesis, glutamyl-tRNA reductase-like;
FT                   Shikimate/quinate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60203"
FT                   /db_xref="GOA:D7ASH9"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASH9"
FT                   /inference="protein motif:TFAM:TIGR01035"
FT                   /protein_id="ADH60203.1"
FT                   /translation="MDINNIKMVGVDKDTPLELREKVSFKDIGEALIKLKELGLEEVVI
FT                   LSTCHRSEIYFYSQKISTDEVKDFFINYFGLKEDFIKYLRQIYGLDAVEHIFRVACGLE
FT                   SMVVGEDQILSQVREAIDTAQTFNSSGKIFFKLFRDAVTLGKKARTDTGIKDLALSISY
FT                   IAVKFVQEVFEDIKGKKAFVIGLGEMGQNAMKNLIDKGADVFVTNRTFSKAIQLKEQIP
FT                   EIHVVPYEQKYLYIASSDIVISATNAPHYTISYEKFKEVYNGRKICMVDIALPRDIDPR
FT                   IGQIEGVSLYTIDDLKKTAEENKKERLSLIPVIEKMVKEEVDKFEKWYKTLEIEPYIKE
FT                   VSRYANEVYNTEFQRIVNKLTDVSEKDKENIKIALKRVANKMANKMITYLKENAY"
FT   gene            464332..465231
FT                   /locus_tag="Tmath_0431"
FT   CDS_pept        464332..465231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0431"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="TIGRFAM: porphobilinogen deaminase; KEGG:
FT                   tex:Teth514_0318 porphobilinogen deaminase; PFAM:
FT                   Porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60204"
FT                   /db_xref="GOA:D7ASI0"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASI0"
FT                   /inference="protein motif:TFAM:TIGR00212"
FT                   /protein_id="ADH60204.1"
FT                   /translation="MKKVIKVGTRSSELALVQTQMVINEIKKFRQDFEFEIVKITTQGD
FT                   ALIDKPVSEIGGKGVFVKEIESALLKGEIDMAVHSMKDMPYEIPKGLKLMAVLKREDPK
FT                   DVFVSRDGTQFMDLKEGAKIGTSSLRRQVQLKALKPDIQIVPIRGNVRTRLKKMEELNL
FT                   DGIVLSAAGLHRLGLESIITEYFPPDVVVPAPCQGILAVEIAESFDNIFQEFYPYIVDR
FT                   RTFFEASVERELLKVFGVNCRQPFGAYAQYRKERDEEKINIKVVYQKEDKLLKSEVTGL
FT                   IEETDKMIEKLIEEFGGI"
FT   gene            465231..466724
FT                   /locus_tag="Tmath_0432"
FT   CDS_pept        465231..466724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0432"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="KEGG: tpd:Teth39_1890 uroporphyrin-III
FT                   C-methyltransferase; TIGRFAM: uroporphyrin-III
FT                   C-methyltransferase; PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; Uroporphyrinogen III
FT                   synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60205"
FT                   /db_xref="GOA:D7ASI1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASI1"
FT                   /inference="protein motif:TFAM:TIGR01469"
FT                   /protein_id="ADH60205.1"
FT                   /translation="MSGIVYLIGAGPGDIGLLTLRAVELIKNADVLVYDRLINEDILKM
FT                   AKKDAELIDVGKFPDNHKVPQSKINEIIAKKALSGKKVARIKGGDPFVFGRGGEEAEYL
FT                   SQKRIPYEVVPGITSAVAVLSYAGIPVTHRDLSSSFHVITGHEREGKDKNLDWEVISKL
FT                   EGTLVFLMGIKNIEKIVQKLLNYGKDPHTPAAVVMEGTTPKQKVVTGKLIDIPSLVRKE
FT                   GIKNPGVFAVGDVVALRDRLKWYENKKLFGKRILLTRTYEQSQQMKKILSEEGADVVVC
FT                   PTIKITPFLDNIVKFLEEIHKFDYAVFTSVNGVWSFIEASREKRFDLRNLSIKVVAIGS
FT                   KTAEALENIFIYPDIIPEEYTSYSLANALKKHVEGKNIALLTSQIGGDILMESLGNCAN
FT                   VQKIVAYKNEPNYEIKEKLISELRKGIDIAVFTSSSTFNYMHQLIGDEINLLKNSKIAA
FT                   IGPVTKKAIEDKGFNVDIMPSEYTTEKLIEEILKNHQNL"
FT   gene            466742..467716
FT                   /locus_tag="Tmath_0433"
FT   CDS_pept        466742..467716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0433"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="KEGG: tpd:Teth39_1889 delta-aminolevulinic acid
FT                   dehydratase; PFAM: delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60206"
FT                   /db_xref="GOA:D7ASI2"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASI2"
FT                   /inference="protein motif:PRIAM:4.2.1.24"
FT                   /protein_id="ADH60206.1"
FT                   /translation="MDLVKRPRRLRMNSILREMIRETSLDVSDLIYPLFVVPGDNIKEE
FT                   IDSMPGVYHFSIDLLVEEVKEVRDLGIPAILLFGVPSYKDELGSEAYSEEGIVQKAVRE
FT                   IKEKVPEIVVITDVCMCGYTIHGHCGIVENGQVLNDKTVDYIAKIALSHVEAGADIVAP
FT                   SDMMDGRVAAIRKLLDSKGFVNTPIMAYSAKYASSFYGPFREAANSFPQFGDRKSYQMD
FT                   YGNSNEALREIALDIEEGADIVMVKPALSYLDIIRRVKDNFNIPIAAYNVSGEYSMVKA
FT                   AAKMGWIDEKSVVLEILTSIKRAGADMIITYFAKDVAKWLITL"
FT   gene            467698..468270
FT                   /locus_tag="Tmath_0434"
FT   CDS_pept        467698..468270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0434"
FT                   /product="siroheme synthase"
FT                   /note="TIGRFAM: siroheme synthase; KEGG: tpd:Teth39_1888
FT                   glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60207"
FT                   /db_xref="GOA:D7ASI3"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042518"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASI3"
FT                   /inference="protein motif:TFAM:TIGR01470"
FT                   /protein_id="ADH60207.1"
FT                   /translation="MAYYPVMLNIKNKKCLVVGGGKVAFRKILSLVEGEALVTAISPSF
FT                   DEGIIELAAKGKVELIKREYQQGDVRGFFVVIAATNDEKVNKLVASDGEKYNVLVNVVD
FT                   DKDLSSFIVPAIVKRGDLIISISTSGKSPLLSRMIKEKLESIFNDDYEKLLQKLYQKRI
FT                   ELKEKDFAEEEKMAIYRKIIEKSGLLK"
FT   gene            complement(468262..468663)
FT                   /locus_tag="Tmath_0435"
FT   CDS_pept        complement(468262..468663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0435"
FT                   /product="PilT protein domain protein"
FT                   /note="KEGG: ate:Athe_1987 PilT protein domain protein;
FT                   PFAM: PilT protein domain protein; SMART: Nucleotide
FT                   binding protein PINc"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60208"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASI4"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADH60208.1"
FT                   /translation="MEKIWIDANVILRYLLKDNEEFYAKAYEIMKKADSGELKLLVSPL
FT                   TIAEVVWTLESFYKISKDQISDTLIAFICSEAVEAEERDTLILSLNSYRENNVDFIDAY
FT                   IAAHAINSGNKKVFTFDKKHFSRLNVELF"
FT   gene            complement(468644..468928)
FT                   /locus_tag="Tmath_0436"
FT   CDS_pept        complement(468644..468928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0436"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: ate:Athe_2482 transcriptional regulator, AbrB
FT                   family; TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60209"
FT                   /db_xref="GOA:D7ASI5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASI5"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADH60209.1"
FT                   /translation="MIHATSTITGKGQIQLPAEIRKAIGADIGDNVIFIVQDNKEVVLK
FT                   LIKKKKLSQLGGTLKSQVKFKSIDEETENTKEIWVNKRVRRNNNGENMD"
FT   gene            469051..470352
FT                   /locus_tag="Tmath_0437"
FT   CDS_pept        469051..470352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0437"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /note="KEGG: tex:Teth514_0321
FT                   glutamate-1-semialdehyde-2,1-aminomutase; TIGRFAM:
FT                   glutamate-1-semialdehyde-2,1-aminomutase; PFAM:
FT                   aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60210"
FT                   /db_xref="GOA:D7ASI6"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASI6"
FT                   /inference="protein motif:TFAM:TIGR00713"
FT                   /protein_id="ADH60210.1"
FT                   /translation="MKTDKSQKLFEKAKKLMPGGVNSPVRAFKSVGATPVFIKKGEGSH
FT                   IWDEDGNEYIDYVLSWGPLILGHSHPRVVEAIKKQAQLGTSFGACTELEVKMAEKVVEA
FT                   VPSVEVVRMVNSGTEATMSAIRLARGYTGRDIIVKFEGCYHGHSDSLLIKAGSGALTFG
FT                   APDSKGVTKEVAKDTIIARYNDINMVENIFKAYGENIAAVIVEPVAGNMGTVLPEENFL
FT                   KGLREITTKYGALLIFDEVMTGFRVSYSGAQGFYNVMPDITTLGKIIGGGLPVGAYGGR
FT                   EEIMRMVSPDGPVYQAGTLSGNPLAMAAGFETLKILSEDPTLYEELDKKAEKLCNGLKE
FT                   SMVQNGIDVTINRIGSMMCMFFNKESVHDYDSALKSNTTLYAKYFREMLKRGIYMPPSQ
FT                   FETFFLSTAHTDDDIEKTIETSFEVAKIISQQLE"
FT   misc_binding    470480..470731
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 126.57"
FT   gene            470854..471597
FT                   /locus_tag="Tmath_0438"
FT   CDS_pept        470854..471597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0438"
FT                   /product="cobalamin biosynthesis protein CbiM"
FT                   /note="KEGG: tpd:Teth39_1886 cobalt transport protein CbiM;
FT                   TIGRFAM: cobalamin biosynthesis protein CbiM; PFAM:
FT                   cobalamin (vitamin B12) biosynthesis CbiM protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60211"
FT                   /db_xref="GOA:D7ASI7"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASI7"
FT                   /inference="protein motif:TFAM:TIGR00123"
FT                   /protein_id="ADH60211.1"
FT                   /translation="MKRCMLLVAFALFLIAPQIAYSMHIMEGFLPLKWCIIWNIVSLPF
FT                   VVIGLIAINKKVKENPKLKMLLGFAGAFAFVLSALKIPSVTGSCSHPTGVGLGAILFGP
FT                   FAMSVLGLIVLLFQALLLAHGGITTLGANTFSMAIVGPIASYYIFKGVKKAGSPNWLAV
FT                   FLAASIGDLLTYVTTSFQLAIAFPAEVGGFTASFLKFMGIFAVTQVPLAISEGLLTVLV
FT                   INMLTAYSKEELIELKVLEKEGKAI"
FT   sig_peptide     470854..470922
FT                   /locus_tag="Tmath_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.481 at
FT                   residue 23"
FT   gene            471594..471887
FT                   /locus_tag="Tmath_0439"
FT   CDS_pept        471594..471887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0439"
FT                   /product="cobalt transport protein"
FT                   /note="KEGG: tpd:Teth39_1885 cobalt transport protein;
FT                   TIGRFAM: cobalt transport protein; PFAM: Cobalt transport
FT                   protein CbiN"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60212"
FT                   /db_xref="GOA:D7ASI8"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASI8"
FT                   /inference="protein motif:TFAM:TIGR01165"
FT                   /protein_id="ADH60212.1"
FT                   /translation="MKDKKFLMKNLILGLLVILLVVFPLVSIKNAEFAGADDRATEAIA
FT                   QVDKNYKPWFKPIWEPPSGEIESLLFALQAATGAGFLGYYIGVAKGRKNANR"
FT   sig_peptide     471594..471683
FT                   /locus_tag="Tmath_0439"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.562 at
FT                   residue 30"
FT   gene            471874..472641
FT                   /locus_tag="Tmath_0440"
FT   CDS_pept        471874..472641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0440"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="KEGG: tpd:Teth39_1884 cobalt ABC transporter, inner
FT                   membrane subunit CbiQ; TIGRFAM: cobalt ABC transporter,
FT                   inner membrane subunit CbiQ; PFAM: cobalt transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60213"
FT                   /db_xref="GOA:D7ASI9"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASI9"
FT                   /inference="protein motif:TFAM:TIGR02454"
FT                   /protein_id="ADH60213.1"
FT                   /translation="MLIDSYAYTNRMYNVHPVEKLLFAFLTMILCFEFDAYTNIAVIIL
FT                   IFVITVFKAKIPAKVYIKLMLIPFSFLIISIITLIINVIGNKSAALISFNIFGVTLGIT
FT                   AQGINTAVILFFRALAIVSCLYFLVLTTPVVDIINILKKLKIPSLFLELLQLIYRFIFV
FT                   LMQAADEIYISQDSRLGYATLKNGYRSLGLLISSLFIKSYKNSEDLYVALEARGYNGEI
FT                   KVLSKDYKFCYKNIIFIVLIELILISASMLLRR"
FT   gene            472645..473475
FT                   /locus_tag="Tmath_0441"
FT   CDS_pept        472645..473475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0441"
FT                   /product="cobalt ABC transporter, ATPase subunit"
FT                   /note="TIGRFAM: cobalt ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; KEGG: tpd:Teth39_1883 cobalt
FT                   ABC transporter, ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60214"
FT                   /db_xref="GOA:D7ASJ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASJ0"
FT                   /inference="protein motif:TFAM:TIGR01166"
FT                   /protein_id="ADH60214.1"
FT                   /translation="MKEQFILEAIDITFEYSDGTKALDEVNMSIEEGKKIAVLGPNGAG
FT                   KTTLFLHFNGILKPKSGKILYKGEEINYRHSELVKLRKNVGIVFQNPDIQLFSASVYQE
FT                   ISFGPMNLGYPENIVKEKVENAMKETRIIGLKDKPTHFLSYGQKKSVSIADIIVMEPEV
FT                   IILDEPTVYLDPKHVQEIMGLFDKLVEKGKTIILSTHDVDFAYSWADYIYVMKNGKVVA
FT                   KGEPTVVFANAKELDRSDLKKPMLLEIYEILKEKGIISGSNIPKNIEELKKYIK"
FT   gene            complement(473553..473671)
FT                   /pseudo
FT                   /locus_tag="Tmath_0442"
FT   gene            complement(473696..474907)
FT                   /locus_tag="Tmath_0443"
FT   CDS_pept        complement(473696..474907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0443"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /note="KEGG: tpd:Teth39_1882 isocitrate dehydrogenase;
FT                   TIGRFAM: isocitrate dehydrogenase, NADP-dependent; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60215"
FT                   /db_xref="GOA:D7ASJ1"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASJ1"
FT                   /inference="protein motif:TFAM:TIGR00127"
FT                   /protein_id="ADH60215.1"
FT                   /translation="MIGKIQMKVPLVEMDGDEMTRIIWKLIKEILLEPYIDLKTEYYDL
FT                   GIKNRDETEDQVTIDAAYAIKKYGVGVKCATITPNAQRVEEYHLKKMWKSPNGTIRAIL
FT                   DGTVFRAPIIVSSIKPLVKTWKKPITIARHAYGDIYKDVEYRIENRGKAELVFTSETGE
FT                   VSRQTIHEFEGPGVILGMHNTDESIKSFARACFNYALDTKQDLWFATKDTISKTYDHRF
FT                   KDIFQEIYENEYKEKFEEAGIEYFYTLIDDAVARIIRSEGGMIWACKNYDGDVMSDMVA
FT                   TAFGSLAMMTSVLVSPDGKYEFEAAHGTVTRHYYKYLKGEETSTNSIATIFAWTGALKK
FT                   RGELDGIDSLVDFADKLEKASLQTIEKGIMTKDLAALSDLPNKIVVNTESFLLEIKKNL
FT                   EEII"
FT   gene            475217..475759
FT                   /pseudo
FT                   /locus_tag="Tmath_0444"
FT   gene            475845..476051
FT                   /locus_tag="Tmath_0445"
FT   CDS_pept        475845..476051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0445"
FT                   /product="abortive infection protein"
FT                   /note="KEGG: amt:Amet_3349 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60216"
FT                   /db_xref="GOA:D7ASJ2"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASJ2"
FT                   /inference="similar to AA sequence:KEGG:Amet_3349"
FT                   /protein_id="ADH60216.1"
FT                   /translation="MSQEYYFNIIGNAIQFLDSHLSRKLDYLSSHITRIGEILTMTNWL
FT                   LFLLFIVLCINTFINWKRYKNGK"
FT   gene            476450..476788
FT                   /locus_tag="Tmath_0446"
FT   CDS_pept        476450..476788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tex:Teth514_0334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60217"
FT                   /db_xref="GOA:D7ASJ3"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASJ3"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0334"
FT                   /protein_id="ADH60217.1"
FT                   /translation="MHLKKIFYNYLFKFGWLLPILTLAINISVYKYLPDNIALQKDAFG
FT                   NINYWINKLEFIFFIPVLQLFAYIAVKYPQAKRKKQIFHGVFDIGGGIILLFLDIFLIY
FT                   LFIKQSSV"
FT   gene            477164..477787
FT                   /locus_tag="Tmath_0447"
FT   CDS_pept        477164..477787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0447"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="KEGG: tpd:Teth39_0419 transcriptional activator of
FT                   acetoin/glycerol metabolism-like protein; PFAM: regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60218"
FT                   /db_xref="GOA:D7ASJ4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASJ4"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADH60218.1"
FT                   /translation="MSVEEDWVKGEYLFLLTDIEGYLLDVKCNTKEKKCIKDSGFEPGV
FT                   SFREESCGTNAISMAMRLKRIVYVRPQEHYCDIFKKWHCIASPIIVENGEIVGYVDIST
FT                   IDKKIADEISMVIKLLVEKIAIEYEKTLKEKELNEIKIKLNDSQIKILALEAKGYRGLD
FT                   IAEALGIEVVTVKYHKRKIVEKLEVKNIKEAVAKAIKLNLIDMD"
FT   gene            complement(477942..478378)
FT                   /pseudo
FT                   /locus_tag="Tmath_0448"
FT   gene            478621..479052
FT                   /pseudo
FT                   /locus_tag="Tmath_0449"
FT   gene            479061..479827
FT                   /pseudo
FT                   /locus_tag="Tmath_0450"
FT   gene            480309..480467
FT                   /locus_tag="Tmath_0451"
FT   CDS_pept        480309..480467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bta:510381 structural maintenance of
FT                   chromosomes 6"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60219"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASJ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH60219.1"
FT                   /translation="MKVKRQDEGVKTRIKKQDLDVKTWLDLTEEELKIISDVCNCMYGR
FT                   KNTIGDG"
FT   gene            480625..481986
FT                   /locus_tag="Tmath_0452"
FT   CDS_pept        480625..481986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0452"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   kol:Kole_0769 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60220"
FT                   /db_xref="GOA:D7ASJ6"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASJ6"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADH60220.1"
FT                   /translation="MFKSKYIHECFINSKLLLFHTLTFSYEILTGEDIVLWEKNKFDFI
FT                   SNKKLGKLISKLFIVEDKGSDEALLNKAITLLGNKGRLKPQFFIYVTTECNLNCPYCYQ
FT                   RDYKSKNITISKKHVDSVVTTIDLLSKKENKHLVIFGGEPLLPQNKQIIEYMFDRFKTI
FT                   DATVEIVTNGIYLKQYDDVLSSNKQMIKILRFTLNGPKKIHNFIRDNSNFDTFSIITDN
FT                   IRYVLNKYDHIQVIINFLLDKLNCDSISDLFNELEINDILGKQNCRIEFGRIQSRKHPE
FT                   NNFYKNELPYTEYYPVLLRTKLKDKRITDEMLIGSEVSILGKIYRQFLKKEIAIPNLKG
FT                   CKAIYPGVFAFYPDGKIYPCDEIAGDVSYAIGQYYPYFMFYKEKENWSSYSVLDNEKCL
FT                   KCKFIGMCNGGCLVSNLAVNGDINSPYCLDIENSLNNFLVELELEGFFNGQDYS"
FT   gene            481967..483250
FT                   /locus_tag="Tmath_0453"
FT   CDS_pept        481967..483250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0453"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   kol:Kole_0769 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60221"
FT                   /db_xref="GOA:D7ASJ7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASJ7"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADH60221.1"
FT                   /translation="MDKIILNQYQSYYDISEKKGAVVDFLVGKINYISKTSANLEIYEE
FT                   FSHLYEEKSNILQKKLQRIISNRINFTIIPTYLCNMNCEYCYEGDLKRIKKIVDIDYAE
FT                   AIVKLLKEILKDERNKDIEFNILGGEPIMQRNMKFYDYLFKNIQNLSVSYKLNFITNGL
FT                   EIKKYIKNLKKYGITTCQITLDGSVETHNKRRIPIDTTINSFERVCESIDCLLENNIYT
FT                   YVRVNIDEQNINDLPELSEVVISKKWNNFKNFHIYLYPISFSGHNPNKIYLEECEILNK
FT                   VLSIFKSMPQKNRLFGLDFHGISFIDALRGNETPPLKFVFCDACRNQYVFDALGYIYSC
FT                   WWGAGRDEFKIGEKFGNEYVLDDNRINKWRNRNITTISNCIKCKFKYICGGGCSYKAIL
FT                   RKGDLFKGNCYSFDKIIESYLRYLNDYQ"
FT   gene            483651..484682
FT                   /locus_tag="Tmath_0454"
FT   CDS_pept        483651..484682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0454"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gwc:GWCH70_0486 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60222"
FT                   /db_xref="GOA:D7ASJ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASJ8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH60222.1"
FT                   /translation="MRVIEVKNLTKVYCAYEGKSLGRIFKRLWSREGVKEVKALDNVSF
FT                   SIDLGESVGLIGVNGAGKSTTIKILTGILEPTEGVVRVFGNIPSKHRMKNNYRIGAVFG
FT                   QRTQLRWDLPAYESYGLLKEIYNVDDKVFKERLDYFSEVLDIKKIMHRPVRTLSLGEKM
FT                   RAELCAAFLHGPEVVFLDEPTIGLDIFSKEALLHFLKEIKEEKKVTIILTTHDLSDIEE
FT                   VSDRIIILDRGKILFDASKDEVLNTLEVGSQIIFTLKNKEAVIPQSVKSLPFSISKNFL
FT                   KVDNVSKDLVPQVLTDVFSYNTVLGVEINYPDFKDIVKQIYLQNKDRGRKNGDNLYKGK
FT                   IGF"
FT   gene            484645..485451
FT                   /locus_tag="Tmath_0455"
FT   CDS_pept        484645..485451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0455"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; KEGG:
FT                   smf:Smon_0137 protein of unknown function DUF990"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60223"
FT                   /db_xref="GOA:D7ASJ9"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASJ9"
FT                   /inference="protein motif:PFAM:PF06182"
FT                   /protein_id="ADH60223.1"
FT                   /translation="METISTKARLGFKLIKIGFESQYIYRLGTFFSFLSGLLYLIMQYF
FT                   LWQAIYHSGDIKQYSFNDIIFYIFLAQIISYVFPTDVSSKIAFHVRTGDIIHLLLKPVK
FT                   IETQLFYESLGKSAYRLLINGGFIFIVLLVLLPYKLELTVLRFFQFALILLLSYVFVFF
FT                   FELLMGIIAFYTTSTWGIQSFKYVIVGIFSGRLMPISLYPPVFRKIVDWLPFRIIYFTP
FT                   IEFIMNKANYDFCNVVKYQTVSIALLLLLYVLVYRNALKKIKVQGG"
FT   gene            485455..486252
FT                   /locus_tag="Tmath_0456"
FT   CDS_pept        485455..486252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0456"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; KEGG:
FT                   smf:Smon_1505 protein of unknown function DUF990"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60224"
FT                   /db_xref="GOA:D7ASK0"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASK0"
FT                   /inference="protein motif:PFAM:PF06182"
FT                   /protein_id="ADH60224.1"
FT                   /translation="MKNMLLRYIKLYIHFTKINISSFMEYDADFLFGIVALILKNLINL
FT                   LIIFFIFHLIDNIKGWDFNQILFLYGFSSTSFAIWHCFFINTISLPFYTRTGLLDSFLL
FT                   KPVDVIFQIMADSFDEDGIGDLIFGIIVLTIAIVRLKIVSIKLIFLPVLLLSGSLIYAS
FT                   LGLISSSISFFTIGETGISNLVMDFFEFSKYPITIYNDILKIVFTVLIPIGFTAFYPSL
FT                   FYIANYKYGLVLVLITPVVSILFFLISYKVWNLALRHYSSTGN"
FT   gene            486451..487233
FT                   /locus_tag="Tmath_0457"
FT   CDS_pept        486451..487233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0457"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="KEGG: tpd:Teth39_0419 transcriptional activator of
FT                   acetoin/glycerol metabolism-like protein; PFAM: regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60225"
FT                   /db_xref="GOA:D7ASK1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASK1"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADH60225.1"
FT                   /translation="MNFLCPQEELISSYERCREIGIDPSITLPLVILNPEDLQKKIHKN
FT                   KELIEAFHMSVEEDWVKGEYLFLLTDVEGYLLETKCSIKEERCIKDSGFRLGISFEEES
FT                   CGTNAISMAMQLKRIVYIRPQEHYCDIFKKWHCIASPIIVEDGEIMGYIDISTIDKKIA
FT                   DEVSMVKKLLAEKIASEYEKIVKEKELNEIKIKLNDNQIKILALEAKGYRELDIAEALG
FT                   IGVVTVKYHKRKIVEKLGVKNIKEAVAKAIKLGLIDED"
FT   gene            487836..488039
FT                   /locus_tag="Tmath_0458"
FT   CDS_pept        487836..488039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0458"
FT                   /product="UTP20, small subunit (SSU) processome component"
FT                   /note="KEGG: gga:417933 UTP20, small subunit (SSU)
FT                   processome component, homolog (yeast)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60226"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASK2"
FT                   /inference="similar to AA sequence:KEGG:417933"
FT                   /protein_id="ADH60226.1"
FT                   /translation="MKEITKLSKIWLNIEKPVKKGLKISNELTLESNIKKLIRKEIDSE
FT                   IDIVETILDVGCHPSAPRRMIS"
FT   gene            488331..489848
FT                   /locus_tag="Tmath_0459"
FT   CDS_pept        488331..489848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0459"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: nfa:nfa34430 hypothetical protein; PFAM:
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60227"
FT                   /db_xref="GOA:D7ASK3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASK3"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADH60227.1"
FT                   /translation="MNAKVLWENREVSSFSRLYALFFILIILFFISLKRIIYLASDITV
FT                   VSWINDIVRKEFISGVGLKFFVLGLLPEIPYWIKFKREKNGIVIYNIRKNLFYRSNSLL
FT                   LYLILKMLSKNYSVEQIVEIISEDNKISFLKAKEKVDHYLTQLQKIIIGENREGNNTNY
FT                   SIDHIYEFESPLVLSLLLTYKCNLKCKHCLVGSLRHYQIKELELDDIKKLAEQMEKYEI
FT                   FKIILNGGEPTVRKDFFKILEIFNKHKIPIELVTNGINLSKEKIEIMNSYHVVGYSLSI
FT                   EGSNSETHDFIRGEGTFKKVISSISNLKKFSIAFQVDVEVIYGKHNMMQIEEIVKLLSD
FT                   LGVTSVKFARLKPWDWGQQLSNIVPNKEEIKKVNEKIWNIEGKYKGIKIMGDVPKSIED
FT                   QKVPGCNINVGFEIQPDGNVLPCRIFEQRVDDKIILGNIKSQDIFEIWNSEKAKRIRSY
FT                   SKRLSKKFLCTKCEFARFCSTNYCIAENFLTFGKFIPSEEDLNKCKI"
FT   gene            489836..491035
FT                   /locus_tag="Tmath_0460"
FT   CDS_pept        489836..491035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0460"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   tte:TTE0395 major facilitator superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60228"
FT                   /db_xref="GOA:D7ASK4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASK4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADH60228.1"
FT                   /translation="MQNLKRNERFFLTVTLFSSFFTSLMAPFWVIYFNKINLDFSQISL
FT                   LIIINHIAVILFEIPTGAFADTYSRKFSVLLSLLIGSLTSIGIYFNTSFTVLLFLYFLS
FT                   GVGATLNSGAFESWFADSFLFGQKEMDLTKYWGRLTSFNYLGSTIGFLGGSVLVRYNIF
FT                   REIWLIEGIGIFLVFIYVFLAGKEAKLQKKTDEYSYREYFNKIAKGTVYLFKHRILLSI
FT                   TVGSFFFFFSSGIMSMLWQPYFERAGIPVELFGIILALTMVLSIFVPRYADRIAERFGG
FT                   AARTLMIVSITSALFIFMMYAIPKYSFIPYIIYTAVYSAHTPIFMSYFNKLIPSSERAT
FT                   IISIYSLFISVSTILCTYSFGILSDKKGLYAALFLSLITALISSIPFKRAIGLEKELCL
FT                   "
FT   gene            complement(491186..491320)
FT                   /pseudo
FT                   /locus_tag="Tmath_0461"
FT   gene            491366..491647
FT                   /locus_tag="Tmath_0462"
FT   CDS_pept        491366..491647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0462"
FT                   /product="ATP-dependent transcriptional regulator,
FT                   MalT-like, LuxR family"
FT                   /note="KEGG: tte:TTE2750 regulatory proteins; PFAM:
FT                   regulatory protein LuxR; SMART: regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60229"
FT                   /db_xref="GOA:D7ASK5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASK5"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADH60229.1"
FT                   /translation="MVIKLLAEKIAVEYEKILKEKEINEIKIKLNDDQIKILTLEAKGY
FT                   RELDIAEALGIEVVTVKYNKRKIVEKLEVKNIKEAVIRAVKLGLIDVD"
FT   gene            491998..492195
FT                   /pseudo
FT                   /locus_tag="Tmath_0463"
FT   gene            492494..493078
FT                   /locus_tag="Tmath_0464"
FT   CDS_pept        492494..493078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0464"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcg:BCG9842_B2869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60230"
FT                   /db_xref="InterPro:IPR032624"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASK6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH60230.1"
FT                   /translation="MMKKIVIIMSIIALFTLVLSVPVQARELERGNEKNSLNSSLLIKS
FT                   PMRIDEKVCEYLKTVKENYEEEILESKTVQSFAAAPPLTYLQVYAVISSQHPTYEYFSE
FT                   NQLSSVEDHGGDEMYIVTIEIGYGHLRFAKMNGSLLNSVQSQPIDLDNDSIIDGWFYWW
FT                   DASGYDSGDFTYQNTSSNYPWNTMSDFIHIK"
FT   sig_peptide     492494..492571
FT                   /locus_tag="Tmath_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            493114..493554
FT                   /locus_tag="Tmath_0465"
FT   CDS_pept        493114..493554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0465"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dhd:Dhaf_3180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60231"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASK7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH60231.1"
FT                   /translation="MMIMPLCYQQQIRYDGEITKHDKRQEISNTFVIKNNDKANNSSDI
FT                   WKELSGKYNIRNASFSDIKNISYELYKAGQISLLDYGILTFDPSESPQRIKPNIFLTQF
FT                   DSNGRMDWIAEYEARVNRDLKIGNTTGYLNNKRILNILKRLL"
FT   gene            493991..494313
FT                   /pseudo
FT                   /locus_tag="Tmath_0466"
FT   gene            494546..494764
FT                   /pseudo
FT                   /locus_tag="Tmath_0467"
FT   gene            494800..495513
FT                   /locus_tag="Tmath_0468"
FT   CDS_pept        494800..495513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0468"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tex:Teth514_0346 ABC transporter related;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60232"
FT                   /db_xref="GOA:D7ASK8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASK8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH60232.1"
FT                   /translation="MNSVLSIKNLKKYYGKIKAVDGITFELYPGEVVGLIGPNGAGKST
FT                   TLKTIMGLLRKTEGEIKVCGYDYKDKEARKKLSYIPEIPDIYPMLTVWEHMKFIALAYN
FT                   LDNWEKEALRYLEAYDLLDKKDELGANLSKGMRQKVMVICGLLYKPEVMLFDEPFVGLD
FT                   PKAIRELKDTIRELKKEGKSVLLSTHMLDSVQNLGDRVLILKAGKLIYEGTLEEVMEKA
FT                   GPNGTLEDLFLEVTK"
FT   gene            495510..497102
FT                   /locus_tag="Tmath_0469"
FT   CDS_pept        495510..497102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tex:Teth514_0347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60233"
FT                   /db_xref="GOA:D7ASK9"
FT                   /db_xref="InterPro:IPR031584"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASK9"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0347"
FT                   /protein_id="ADH60233.1"
FT                   /translation="MTEIKALLTLDLLRFKNFVKDIIKNPKRIFIYLLQFIWYVFILIP
FT                   VITNRGKTFNEISTIKFEVFNAVLIAVMLLGVFASLFTSLRQPGIILSPGDTAFLLSSP
FT                   IRERMIFFWYMVRSIFKNLFIAVLFIIYLPFLSVTMEIFKYSQNLIWGYLGVFTFYLAL
FT                   SPLSFLFYSISMKFNAKEIIKYILWSVLVLLLGSAVYFAYKEQNIYSFIEYFDLKGWDY
FT                   VPIIGPSKGLILSYFTGNSHNAIIQIILQLVTIVLLVFIGLYFATDYYEEVVTYNEKIR
FT                   KIREKADKGDLSGTEENIKKKKRKVEVKFSPKGPWAFIWLKMVENKRQIGSIYFNFYNL
FT                   FLLVISIAFGYFLPKNDSTIIFVLAFMYAYMGWLLSMVSAIGAELNRMYIYIIPGEGIE
FT                   KLIAVNFVPLLKSFITAILLIVPASIFIKPGLLNTIAAILFIISLSVLQNFSYAFLLTF
FT                   MPSKEDIKIAIPFFRLFGLLFVLIPVGLVSIPLGIATKSMGIGILSASIIMLLEAGMFL
FT                   LFANYIFERLELK"
FT   gene            497115..497888
FT                   /locus_tag="Tmath_0470"
FT   CDS_pept        497115..497888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0470"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="KEGG: tex:Teth514_0348 regulatory protein, LuxR;
FT                   PFAM: regulatory protein LuxR; SMART: regulatory protein
FT                   LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60234"
FT                   /db_xref="GOA:D7ASL0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASL0"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADH60234.1"
FT                   /translation="MGDIKSNEILFSYKKCLEIGLTKSIVTPLISLEEEELKRKLQENK
FT                   KLIEVFRKCVNKVRAQLKKRYIFLLVDSEGYLLDVLCNRKIYKDITDLGIKRGTSFKEE
FT                   SCGTNAISLAMKLKQPIYLKPEEHYCDIFKQWYCIATPFHIDNQIVGYLDISIIEHNMA
FT                   DEMMGFIDLLVYKIANEYKREMDLESQEDLEKLTDKQIEIIKKCAKGYTELAISMELGL
FT                   KPATVKYHKKEIIKKLRVKNFQQAIAKAIRLNLIN"
FT   gene            498247..498756
FT                   /locus_tag="Tmath_0471"
FT   CDS_pept        498247..498756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0471"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bdu:BDU_514 p-512 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60235"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASL1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH60235.1"
FT                   /translation="MDVNLRDGIKFENLIYFEKEVVNPISIQQEVRKLIDRLKDGGIFY
FT                   KNRLITKVIEKDITKKTVTMRIMIEVEISEGSGIYNFLKNYPQYRYLEDFSIGKSYSIS
FT                   ISNDVEEFKNAISLLISKIDSDVKDINNYDLSKNNIIEIARIDYDGNVIGFDLFLEIDG
FT                   GEIKWE"
FT   gene            498747..499052
FT                   /locus_tag="Tmath_0472"
FT   CDS_pept        498747..499052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0472"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ptm:GSPATT00017601001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60236"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASL2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH60236.1"
FT                   /translation="MGVMLNLNKKMKFIKCNRYQYLVKRGSISNYSFEIIDEDKSGILE
FT                   VLFQQVTYPVGIENLKQIILEKCKFIDEKTIEDFLNKLLEIEVIISNLEQEKKIFV"
FT   gene            499049..499678
FT                   /locus_tag="Tmath_0473"
FT   CDS_pept        499049..499678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0473"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbh:CLC_0562 streptolysin associated protein
FT                   SagC"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60237"
FT                   /db_xref="GOA:D7ASL3"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASL3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH60237.1"
FT                   /translation="MIISKEDGIKIRNKFKDVRDENYNITYLTVIAPLNVITREGETEY
FT                   LGEEKLLDIIKQHDCVLVIQKYFNPNLFYKINRLCVDLEKKFVISYLDGDEGLIIPIMD
FT                   INRAGCYNDFELLRESSFYNLLDYQIMKESYIKENNVLIASDNLYFNTLLNLTMLILDK
FT                   YLKCTYINNYAYSVDFERMVITKIRLFRFPKCPSCQGDKNLTHPFI"
FT   gene            499699..500514
FT                   /locus_tag="Tmath_0474"
FT   CDS_pept        499699..500514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0474"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfd:PFDG_01032 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60238"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASL4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH60238.1"
FT                   /translation="MKEKSIKMLFDENNKEFTEEELAVFKRYLEENNVFTDNNFEFFEE
FT                   NLNYYASRYTNEFYFSPAELFHANSNFLSSEEMIRNIELYHKSVEWYNKTVHPEDSEWV
FT                   VKGEKYVYVSDLESKLKELIYYLNKYPKVDYHCLDILFYFKESIYKYLPQKNFTFRWKE
FT                   NAKDLIQKLLKHNFYQIHQIKSVNIIQESLQDIIIIFPIFIPIRVMLFLGEYGYRSAII
FT                   NYGAIIERFKNYGKCKEILDVNMFENHSVNNLLGLDGIEKSIFNILICR"
FT   gene            500534..501376
FT                   /locus_tag="Tmath_0475"
FT   CDS_pept        500534..501376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0475"
FT                   /product="SagB-type dehydrogenase domain protein"
FT                   /note="KEGG: svi:Svir_09420 nitroreductase; TIGRFAM:
FT                   SagB-type dehydrogenase domain; PFAM: nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60239"
FT                   /db_xref="GOA:D7ASL5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASL5"
FT                   /inference="protein motif:TFAM:TIGR03605"
FT                   /protein_id="ADH60239.1"
FT                   /translation="MDGVRLKYYNKKIQQLKELLANCSDLEQVSILHEIIDDTPYKTKN
FT                   YMKYMHKGYYIKHNKEELIDNSLKQIKLQVNDFPSKNIVEIIKNRYSVRDYENREVSFE
FT                   AFSQIIHYSFGVKHVAEGVYDRKSYLFKYTNSQGGLNYLDLYIIVNNVEGVEQGLYYYD
FT                   FIGNKICQIDNGNMRGIIKEIHFQNEFTAYSSFLCIVVADLRRVVPKYYKRAYRFAHVD
FT                   AGILLAYLQLLAENNGISSCIVAGFLEHKIETLLNLSKDEYPIATIGFGYKSRSFDVV"
FT   gene            501373..501960
FT                   /locus_tag="Tmath_0476"
FT   CDS_pept        501373..501960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0476"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: cbl:CLK_3701
FT                   CAAX amino terminal protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60240"
FT                   /db_xref="GOA:D7ASL6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASL6"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADH60240.1"
FT                   /translation="MNILKELLIYLVTFFILLTKVLKWDKNIALKLYISLLILAAWINV
FT                   LYAYNSNIQFTGTLSITILLVVSITSLVYYVLDFMLINIIKSDVLILDIAYYFKGRVKM
FT                   LEFLTSVIIGILEELVFRLYLIESSIKMEFLLLILSSMCFGMVHIFFSKYDVLSKMVMG
FT                   LVLGYIFIQTHNILYPITFHMIYNWFALKKKG"
FT   gene            501965..502876
FT                   /locus_tag="Tmath_0477"
FT   CDS_pept        501965..502876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0477"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: pmo:Pmob_0278 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60241"
FT                   /db_xref="GOA:D7ASL7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASL7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH60241.1"
FT                   /translation="MNTMFVEVKNLYKSYNNSMVLKDINIRIDKPGVYLIAGPNGSGKT
FT                   TLLEIIIGLRKADKGSVIINGKFGNDIETKEKVGFLTQENSLRKSSKVKEELNLVKDIF
FT                   NLNIDTYEYLCKFGLQKYYNKRTKQLSGGTKRRLLVTMLFMAGQDIVILDEPVSGLDPF
FT                   NRNEIWNMIKDYSRNKIVIVSDHYLNEAARYSDYIYLINEGRIILSGTTTDIMSLCKDR
FT                   YLIKVRKEFFDEVENFISAHFNDYEVRISGTVYHIFLKGDKNRLIRMLEEKGMSFAIHD
FT                   VDFEDIYFYYTGTIVNQEGVVK"
FT   gene            502876..503658
FT                   /locus_tag="Tmath_0478"
FT   CDS_pept        502876..503658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0478"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: tro:trd_A0466
FT                   putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60242"
FT                   /db_xref="GOA:D7ASL8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASL8"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADH60242.1"
FT                   /translation="MENSFKTTIRKMYGFFKVEVKALLRDPTTVFFMLVLPMVLTVVFG
FT                   SAFGKEPTHYGEHILGIDTVVPINIIFLLANAGLMGIPITISELKEQGVIKRYITYPVD
FT                   YKIYFGSLMATFSIVSIISTLLFTTVSFIFYKATLFIHLLGIMGFAMLYFLNMYIYYGI
FT                   GFLLSLLIKSARTTNIVTSFLFLTLIFTSGIVLPLDSLPPNIEKFANLLPMSHSIQVTQ
FT                   MWWYGLFSFKEQGKDLIYLVIVAIILYFLLRRVKVKWD"
FT   sig_peptide     502876..503025
FT                   /locus_tag="Tmath_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.679) with cleavage site probability 0.677 at
FT                   residue 50"
FT   gene            503649..505052
FT                   /locus_tag="Tmath_0479"
FT   CDS_pept        503649..505052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0479"
FT                   /product="protein of unknown function DUF181"
FT                   /note="PFAM: protein of unknown function DUF181; KEGG:
FT                   sai:Saci_0526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60243"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASL9"
FT                   /inference="protein motif:PFAM:PF02624"
FT                   /protein_id="ADH60243.1"
FT                   /translation="MGLNINVINKRKICEPQITQIDDYLNYKEMMSFVGYFNLIKKVDI
FT                   VLAPSSELPLFIGNCEFANLTYLFNYLLRRTSMSIRLEESIFAGGKGFSYYKAICSSLG
FT                   EAFERLMGCLDYFNQRENVLVGTYNKLIKEGYKLIDPAKINIFSDEQFNEKDFLFDKFD
FT                   RNSIVGWIKMLDMDTHEGIYVPASLIMMYYERQDSKERRIAYATSGGLTSHFNELYGYE
FT                   HGLLEIIERHEINLSWYCKIPPKEIVLNEIEDKRLLQYKDYIKEKNIRFYRHNIDQEVF
FT                   HVVTAVSFDKDMEKYSFNTGGGISVDIESAILSALEEYAQSVNNTRKVLYAPKWLTSIY
FT                   VNRVLDVQEEEDPRKFKVFYQAVSYYGLKRHKEKLSWYLENNEKIYLSEIKKNQERISA
FT                   TDYLKKEKIRPLCLKIMPGRFNHIFISKVFMVEFVPAFIAGIPMLGHEKYKEYLKEGEE
FT                   INKDILPYP"
FT   gene            505807..506145
FT                   /locus_tag="Tmath_0480"
FT   CDS_pept        505807..506145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE0407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60244"
FT                   /db_xref="GOA:D7ASM0"
FT                   /db_xref="InterPro:IPR024257"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASM0"
FT                   /inference="similar to AA sequence:KEGG:TTE0407"
FT                   /protein_id="ADH60244.1"
FT                   /translation="MKKLFWLLGFLGFLGFLGFFKSYMYFAFFAFFSNFFTSRYINIPQ
FT                   DKQLQNKMAEAHTVSFVVTSFFLSFMLIMLIFNVSYEIFKAMFCIIFALISIIDSYLLY
FT                   KYTGSNQK"
FT   gene            506464..507170
FT                   /pseudo
FT                   /locus_tag="Tmath_0481"
FT   gene            507167..507873
FT                   /pseudo
FT                   /locus_tag="Tmath_0482"
FT   gene            508059..508542
FT                   /pseudo
FT                   /locus_tag="Tmath_0483"
FT   gene            508616..509581
FT                   /locus_tag="Tmath_0484"
FT   CDS_pept        508616..509581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0484"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: pho:PH1849 ATP-binding transport protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60245"
FT                   /db_xref="GOA:D7ASM1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASM1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH60245.1"
FT                   /translation="MDTVINCTNIYKSYIKKRWFKVVKRNDVLKNLDIKVRKGEIYGLL
FT                   GLNGAGKTTLIRIITGILLPDKGNVEIFGMRYDKHEKEIKSKIGVVMGGDRSLYWKLSA
FT                   EENLEFFGTLYNVPKKKLKKNIEIYLDYVGLGEHKKDLVETYSKGMKQRLLIAKSLIID
FT                   PEVLILDEPTVGLDIQVAFEFRKLLKRLNEELGLTILLTTHYLHEAEELCSRVGILKGG
FT                   RIVEEGTIDYLKRKNKMEEVVEFKLKTEIDDNLEKEILNYGSINKLSMDNYFTYQVRTS
FT                   SIYREKIISLLSSQSKLTFLEVKGVTLEDIVSNYFEEGVI"
FT   gene            509583..510350
FT                   /locus_tag="Tmath_0485"
FT   CDS_pept        509583..510350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0485"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: llk:LLKF_1878
FT                   ABC-2 type transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60246"
FT                   /db_xref="GOA:D7ASM2"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASM2"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADH60246.1"
FT                   /translation="MRHILAAAKSEFLILSRYPLNLFYNIIAALFSLLPLFYIAKIYNV
FT                   EQTQYLWILSGSLFWMYISQALWTIGLSLRKEQEMGTLEQILMSPSNLIYIMLGKSIVT
FT                   VGINSLTLLVGLLLIRYVFDCRINYALIVVVILISMPSVFGFSYVISGIVLKFKEIFAF
FT                   LQVISGVLLIFSGVSQPATFLPYNLGKLSRFIVVEKMIYTFRRVVIGSASFLAIYSQLI
FT                   YIFIYGFVLNIIAVFVFYYFKKKVMKNGDVFYV"
FT   gene            510343..511164
FT                   /locus_tag="Tmath_0486"
FT   CDS_pept        510343..511164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0486"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: fno:Fnod_1602
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60247"
FT                   /db_xref="GOA:D7ASM3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASM3"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADH60247.1"
FT                   /translation="MFDKAYVFLKKELLFLIRYPMQIIFEILLPVINMLPAIFLAIYLT
FT                   SSNHIKSFEKVTGTNNYFIFISIGIVFSIFNSIQEQTSYVLSKEMWMGTLEQIWISPVK
FT                   KINLVLGWIFFSFIKAILYTIASAIILKFIFIYLNISFSIYSLPLLVLSVLLLLAVSIC
FT                   SGIIICSITLNIKQVDSFVFLITGAVPLLSGITFPISVLPPKIQMISKVLPTTYIFDLI
FT                   RHSILRSNTIFEPIMELTLVFFYVIIMMIISVFIFKLLKRRVEKCGTIYMM"
FT   gene            511140..511634
FT                   /locus_tag="Tmath_0487"
FT   CDS_pept        511140..511634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0487"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: mbn:Mboo_1660
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60248"
FT                   /db_xref="GOA:D7ASM4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASM4"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADH60248.1"
FT                   /translation="MWDNLYDVRDKFCSRKSVRNYLNVSLDQDVIKVLMEIGYSGPVSG
FT                   GLRCVFIKEVSNSEEKYICYKGTYYQKHVLRAPHIFLIGCNDSIIEEKYNGEFVNIFSC
FT                   QNSVIAAQNIIIAAHEMGIGTCFVGAIRKDVIIDGLKLDKGYNPWCILCLGIGRDDNIG
FT                   I"
FT   gene            511639..511782
FT                   /locus_tag="Tmath_0488"
FT   CDS_pept        511639..511782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60249"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASM5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH60249.1"
FT                   /translation="MDMIIKFDDEHKNFILIKGNNQIVMDTKQAIGCIVIFRDILEKIK
FT                   GK"
FT   gene            511862..512251
FT                   /locus_tag="Tmath_0489"
FT   CDS_pept        511862..512251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0489"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="KEGG: tex:Teth514_0348 regulatory protein, LuxR;
FT                   PFAM: regulatory protein LuxR; SMART: regulatory protein
FT                   LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60250"
FT                   /db_xref="GOA:D7ASM6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASM6"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADH60250.1"
FT                   /translation="MIFSNNGTYCIAMPLDIDNDIVGYLDISTIKHNMADEMMGFIDLL
FT                   VYKIVNEYKREMDLESQEDLEKLTDKQIEIIKKCANGYKEIAISRELGIKPETVKYHKK
FT                   EIVRKLRVKNFQQAIAKAIKLNLID"
FT   gene            512424..512531
FT                   /pseudo
FT                   /locus_tag="Tmath_0490"
FT   gene            512557..515024
FT                   /pseudo
FT                   /locus_tag="Tmath_0491"
FT   gene            515057..515725
FT                   /locus_tag="Tmath_0492"
FT   CDS_pept        515057..515725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0492"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: cbf:CLI_0667 ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60251"
FT                   /db_xref="GOA:D7ASM7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASM7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH60251.1"
FT                   /translation="MVILKTEKLFKEYNVEGNVTKVLNGIDLEINEGEFVSIMGPSGSG
FT                   KSTLLYVLSGLEKPTSGSIFFKGEDLTLLNDDKLSKLRRREFGFIFQFYNLIPNLNVEE
FT                   NITLPLEFEGINRKEYNSNIDKILERVGLIEKKQNFPYQLSGGQQQRVAIARALIIDPK
FT                   IIFADEPTGNLDSKAGEEILKLLYNLSKENNKTVLMVTHDNYAASFSDRIIKIKDGVIE
FT                   "
FT   gene            complement(516010..516957)
FT                   /locus_tag="Tmath_0493"
FT   CDS_pept        complement(516010..516957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0493"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: tpd:Teth39_1877
FT                   auxin efflux carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60252"
FT                   /db_xref="GOA:D7ASM8"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASM8"
FT                   /inference="protein motif:PFAM:PF03547"
FT                   /protein_id="ADH60252.1"
FT                   /translation="MQTFLSSVQGVLTIVFMLILGYYLAKAGWFDRTISDLFAKLVVNI
FT                   TLPLSMIVNITSTFSKKQLERSGRGLLIPFLSILISYLIAYILAEIFKVKRERKGVFTA
FT                   IFSLSNSIFVGLPMSQALFGEVATPYTLLYYMANTTIWWTLGVYGIARDTNGKDQKILT
FT                   LDTLKRIFNPPLIGFIGGVILVFVNIKLPTFIFDSFKMIGGLTTPLSIFYVGITIYEMS
FT                   FDKFKLDKDAFMVFIGRFLVTPALVWILDLFIPIPKLMRDVFIIMSAMPVMVNSSIIAR
FT                   VYKADYEFATSMITYTTIFSVVIMPFLMVLIKVI"
FT   gene            517059..517721
FT                   /locus_tag="Tmath_0494"
FT   CDS_pept        517059..517721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0494"
FT                   /product="protein of unknown function DUF1648"
FT                   /note="PFAM: protein of unknown function DUF1648; KEGG:
FT                   tpd:Teth39_1876 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60253"
FT                   /db_xref="GOA:D7ASM9"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="InterPro:IPR025962"
FT                   /db_xref="InterPro:IPR026272"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASM9"
FT                   /inference="protein motif:PFAM:PF07853"
FT                   /protein_id="ADH60253.1"
FT                   /translation="MHENYDVKQEMKKDWWLIGIILLIWIFTFAVFGHLPDKIPMHWNI
FT                   SGQVDSYGPKQDVFILPSVITVIYFLMVFVPLIDPKKANYSKFAGAYRMIRAVLVIILS
FT                   ILYFAATYSALGYKVNMDRLGSAVIPVMLIAFGSAMGKLRHNYFVGIRTPWTLADEEVW
FT                   NKTHQLGGKLWLIAGIIGLFASFFSGTWVAVLMFVLLITAVIVPIVYSYIIFKNEEK"
FT   gene            517954..518994
FT                   /locus_tag="Tmath_0495"
FT   CDS_pept        517954..518994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0495"
FT                   /product="peptidase M42 family protein"
FT                   /note="PFAM: peptidase M42 family protein; KEGG:
FT                   tpd:Teth39_1875 peptidase M42 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60254"
FT                   /db_xref="GOA:D7ASN0"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASN0"
FT                   /inference="protein motif:PFAM:PF05343"
FT                   /protein_id="ADH60254.1"
FT                   /translation="MDYKNLLKKLCESHGVSGHERGIYDLLKEEFATISDEVAEDKFGN
FT                   LFFLKKGTKGKYKVMLAAHLDEIGLIVKDIDDKGFIKFTTVGGVDQRTLPSQEVIVHGK
FT                   KNILGVIGSKPPHLLSSGDMEKAIKIEDMYIDVGMSKKEIEELIKIGDVITIKREFREL
FT                   LNDYVSGKALDDRAGIAVMAICLEELKKLYHYHDVYAIATLQEEVGVRGAATSAYNVEP
FT                   DIAIAIDVTHGKARGVSTEIELGRGPAIGKGPNIHPAVYKGLVDTAKEYNINHQIEPLP
FT                   GPSGTDAWAIQISRGGVPTGLVSIPLRYMHTSVETVNMKDIINSGKLLAYYIANLPEEL
FT                   EGQLCY"
FT   gene            518985..520007
FT                   /locus_tag="Tmath_0496"
FT   CDS_pept        518985..520007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0496"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="KEGG: tpd:Teth39_1874 cellulase; PFAM: peptidase M42
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60255"
FT                   /db_xref="GOA:D7ASN1"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASN1"
FT                   /inference="protein motif:PRIAM:3.2.1.4"
FT                   /protein_id="ADH60255.1"
FT                   /translation="MLLKELTDLMGASGDEKEVREKIKEIVKPYVDELYVDKMGNLIAC
FT                   KKGKKEKPKVMLAAHMDEVALMVKSINEDGTLSFSPVGGVDNRILVSKTVKVGEKRVNG
FT                   VIGAKPIHLQKREEQQKPLDFDALYIDIGATSKEEALKHVSVGDYVYFDANFELLGNGY
FT                   VKSKALDDRIGCNVLIEILKRDYEYPVCAAFTVQEEVGLRGAGVAAYNIEPDFAIVVEG
FT                   TVAADVSDSEPHLVSTELGKGPAISLMDRTTLYDKKIINKIVKIAEENGVPYQFRRIAS
FT                   GGNDAGKIHLTKGGIKAIAVSVPCRYIHSFNSVAFLEDFNNTVKLVDLIIKNIAKEALI
FT                   "
FT   gene            520004..520987
FT                   /locus_tag="Tmath_0497"
FT   CDS_pept        520004..520987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0497"
FT                   /product="peptidase M42 family protein"
FT                   /note="PFAM: peptidase M42 family protein; KEGG:
FT                   tpd:Teth39_1873 peptidase M42 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60256"
FT                   /db_xref="GOA:D7ASN2"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASN2"
FT                   /inference="protein motif:PFAM:PF05343"
FT                   /protein_id="ADH60256.1"
FT                   /translation="MSLNIELIKKLTQTYGPSGSEEKVLQVIKEEVKNFCDEITYDALG
FT                   NMICRKTGKGKKIMVAAHTDEIGLMITHIEDEGFLRFTTIGGVFVEQIVGRRVVFKNGV
FT                   QGAIGVEYLEDKKDFRVEKLYIDIGAKNKEEAQKYVNIGDSASFAGEFIEAGDRLISKA
FT                   FDDRIGCYVVIEALKNLKTENEVYFVFTVQEEVGTRGAAAAAYNIHPDFAVAVDVTSTG
FT                   DTPKAKKMAVSLGKGAAIKVMDRSIIVSPSVREMMIEVAKENNIPYQLEILEFGGTDAG
FT                   PIHLTKGGIPAGVISIPTRYVHSISEMVDKNDIEASIELLKKVLEK"
FT   gene            complement(521121..522209)
FT                   /locus_tag="Tmath_0498"
FT   CDS_pept        complement(521121..522209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0498"
FT                   /product="protein of unknown function DUF125 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF125
FT                   transmembrane; Rubrerythrin; KEGG: tpd:Teth39_1872
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60257"
FT                   /db_xref="GOA:D7ASN3"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR039376"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASN3"
FT                   /inference="protein motif:PFAM:PF01988"
FT                   /protein_id="ADH60257.1"
FT                   /translation="MNPIDQAINFYKEEVEAAELYTYLAKIEKNPQTKSNFDALAKMER
FT                   VHAKFWHQFLKTRNIEIQEGKFHKFKLFTYKILRTLLGSKLFVTILEMNEVISTESYYR
FT                   YFHEASLTEKEKAILSKIIEDELEHEKIFSRQKDKFSIENIRDFILGMNDGLVEILGTV
FT                   TGLSAVYPKSPITVGTAGLVVGVAGALSMAIGAYTSVRSQRQVNEGIKSKMELLFKVSK
FT                   DRAKEEFLSKLLESGIPEDVGTEILGKLSDNEDAMINLLTEEISENEIKSALYTGIAYL
FT                   VGLLFPVLPYFIITSSSLVALLFSVIFAAIALSIVGIVVSVASESLSVKGKVLEMVTTG
FT                   LGAAALSYLFGTLVQYVFGIQA"
FT   gene            complement(522356..525883)
FT                   /locus_tag="Tmath_0499"
FT   CDS_pept        complement(522356..525883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0499"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase; PFAM: pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain protein; thiamine pyrophosphate
FT                   protein domain protein TPP-binding; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; Pyruvate-flavodoxin
FT                   oxidoreductase, EKR domain; Pyruvate/ketoisovalerate
FT                   oxidoreductase; KEGG: tpd:Teth39_1842 pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain-containing
FT                   protein; SMART: Pyruvate-flavodoxin oxidoreductase, EKR
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60258"
FT                   /db_xref="GOA:D7ASN4"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="InterPro:IPR037112"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASN4"
FT                   /inference="protein motif:TFAM:TIGR02176"
FT                   /protein_id="ADH60258.1"
FT                   /translation="MAKVMKTMDGNTAAAHVAYAFTEVAAIYPITPSSPMAEVVDEWSA
FT                   HGRKNIFGQPVKVIEMQSEAGAAGAVHGSLAAGALTTTFTASQGLLLMIPNMYKIAGEL
FT                   LPGVFHVSARAVATHALSIFGDHSDVMACRQTGFAMLASGSVQEVMDLASVAHLSAIKG
FT                   RVPFLHFFDGFRTSHEVQKIEVLDYEDLAKLVDYEALKAFRKRALNPEHPVTRGTAQNP
FT                   DIFFQGREAANRFYNAIPEIVEYYMNEIKKLTGREYKLFNYYGAPDAERIIIAMGSVTE
FT                   TIEETVDYLMKKGEKVGVVKVHLYRPFSAKHLLDVIPKTVKKIAVLDRTKEPGSIGEPL
FT                   YEDVKTALFDSELRPVIVGGRYGLGSKDTTPAQIIAVFDNLKADKPKDHFTIGIIDDVT
FT                   FTSLPVGEEVDTTPEGTTSCKFWGFGSDGTVGANKNAIKIIGDNTDLYVQAYFSYDSKK
FT                   SGGVTVSHLRFGKKPIRSTYLINKADFIACHKQSYVYNYDILAGLKDGGTFLLNCNWKV
FT                   EELDKKLPASIKRYLARHNINFYIINAVDIAKEIGLGGRINMIMQSAFFKLTNIIPIEE
FT                   AVKHLKEAIVKEYGHKGEKIVQMNYEAVDRGINSLVKVEVPASWADAEEQPKAERQVPD
FT                   FVKNVADVMNRLEGDKLPVSAFLGREDGTFPPGTAAYEKRGIAVDVPEWQIDNCIQCNQ
FT                   CAFVCPHAAIRPFLLTEEEAKNAPEGFKVKKAIGKGFEGLYYRIQVSVLDCTGCGVCAN
FT                   ECPAKEKALVMKPLETQMEEAKNWEYAMTLSPKENPMNKETVKGSQFEKPLLEFSGACA
FT                   GCGETPYAKLVTQLFGDRMMIANATGCSSIWGASAPSTPYCTNHEGKGPAWANSLFEDN
FT                   AEFGLGMALAVKQQRAKLADIVKELLELNITPELKEALQFWLDHMMDGKKSKEATIKLL
FT                   PILQNYKTEDTKVKELINEVLERKDYLIKKSQWIFGGDGWAYDIGYGGLDHVLASGEDI
FT                   NVLVFDTEVYSNTGGQSSKATPVGAVAQFAAAGKPIGKKDLGRMAMTYGYVYVAQVAMG
FT                   ASQTQLIKALVEAESYPGPSLIIAYAPCIAHGIKQGMSCSQLEEKKAVEAGYWVLYRYN
FT                   PLLKKEGKNPFILDSKPPKLSVRDFLQGEVRFSALEKTFPEKAQKLFEEAEKQAQERYK
FT                   IYEKLAKDE"
FT   gene            526223..526939
FT                   /locus_tag="Tmath_0500"
FT   CDS_pept        526223..526939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0500"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   tpd:Teth39_1840 metal dependent phosphohydrolase; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60259"
FT                   /db_xref="GOA:D7ASN5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASN5"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ADH60259.1"
FT                   /translation="MIKKTVFFFFFFETFLKLTLEETNGIIFLVKLCRKEGETVEVYNY
FT                   NEYYLIKHLITSLKHYHYTTYLHSIRVAKLTYLVSKKLELPKDEQIYNCKGGLLHDIGK
FT                   VLVPVTILDKAGSLTELEYEFVKIHPTYGSEMLKIFPSLKDLVPGVLYHHERLDGSGYP
FT                   FGVSIIPLSAQIIGICDSFDAMTTRRPYNEKRLRNIQEAIFELKTQSQKYNYKIVEALE
FT                   EVLWEKKEKQQRFISI"
FT   gene            526956..528938
FT                   /locus_tag="Tmath_0501"
FT   CDS_pept        526956..528938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0501"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="KEGG: tpd:Teth39_1838 methyl-accepting chemotaxis
FT                   sensory transducer with cache sensor; PFAM: chemotaxis
FT                   sensory transducer; Cache domain protein; histidine kinase
FT                   HAMP region domain protein; SMART: chemotaxis sensory
FT                   transducer; histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60260"
FT                   /db_xref="GOA:D7ASN6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASN6"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADH60260.1"
FT                   /translation="MKSIRTKLLVFTILVIFIPLVITGYFSTNIAESILKSKINNSNQA
FT                   ALNVLNKHISYFKQNTESTLLMISESDTIMNYDGSSTSDEAVLRELEEVKKSMPDAMYV
FT                   YFGTPDKKYILYPPDPSLKDYDPTERPWYKDAEKAGESIVWTDPYQDFGTKVPMITIAK
FT                   AVRNSDGKLLGVLGIDISLEQLSKNLSSIKIGNSGYIYIITKDGTVISHPDAKQLFTSV
FT                   KKYDFGKKLLNLNNTTIHYVSGNTYKFASVRNLDSFGWKAVVTMEDSELTTDVMKIRNF
FT                   VITVSIIVLLIGFLVTYFFTNSISSGIKRVVTAMSLAAKGDITVKADVKAKDEVGILAN
FT                   SFNTMIEGIKKLIFDIKSVSESVNHSAENMAVASEQAAQATQDVAKAIEEIAQGASSQA
FT                   KETEESANATFLLGQLIDKSIKNADEINQEVSNVSMVSNEGLMIIDDLIKKTQLTVEAN
FT                   NNVKESTDYLLEKSTEISKIVETITGIADQTNLLSLNAAIEAARAGEAGRGFAVVADEV
FT                   RKLAEQSSQAARNIANLISEIQSTINNTYKTVEDSTKSIEEQSNAVNTTKDVFEGILHA
FT                   VNFIVEKIDNLDKSLKEIESHKNKIVDSIQNIAAVSEEAAASAEEVSATSEEQSAIVEE
FT                   MASTANELKNYANTLIEAIKQFKVE"
FT   gene            529124..530020
FT                   /locus_tag="Tmath_0502"
FT   CDS_pept        529124..530020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0502"
FT                   /product="glutamate formiminotransferase"
FT                   /EC_number="2.1.2.5"
FT                   /note="TIGRFAM: glutamate formiminotransferase; KEGG:
FT                   tex:Teth514_0390 glutamate formiminotransferase; PFAM:
FT                   Formiminotransferase domain protein; Formiminotransferase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60261"
FT                   /db_xref="GOA:D7ASN7"
FT                   /db_xref="InterPro:IPR004227"
FT                   /db_xref="InterPro:IPR012886"
FT                   /db_xref="InterPro:IPR013802"
FT                   /db_xref="InterPro:IPR022384"
FT                   /db_xref="InterPro:IPR037064"
FT                   /db_xref="InterPro:IPR037070"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASN7"
FT                   /inference="protein motif:TFAM:TIGR02024"
FT                   /protein_id="ADH60261.1"
FT                   /translation="MNQIIECVPNFSEGKDQEKIAQLVKEVVSTEGVKLLDYSSDKDHN
FT                   RTVITFCGDAKGVKEAAFKLIKRASEIIDMRYHKGEHPRIGATDVVPFIPVKNVTMEEC
FT                   VQIAREVGERVGKELNIPVYLYEEAATTPERKNLENIRRGEYENFFEKIKQPEWKPDFG
FT                   PQEMNPKSGATAIGARNFLIAYNVNLATDNIEIANKIAKAIRFSSGGYRYVKAIGVNLK
FT                   ERGIVQVSMNLTDFNKTPIYRVFETIKAEAERYGVNVIGSEIIGLVPAKALFDVANYYL
FT                   RIENFSENMVLENKIYE"
FT   gene            530029..530309
FT                   /pseudo
FT                   /locus_tag="Tmath_0503"
FT   gene            530309..530539
FT                   /pseudo
FT                   /locus_tag="Tmath_0504"
FT   gene            complement(530779..532449)
FT                   /locus_tag="Tmath_0505"
FT   CDS_pept        complement(530779..532449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0505"
FT                   /product="alpha amylase catalytic region"
FT                   /note="KEGG: csc:Csac_2428 alpha amylase, catalytic region;
FT                   PFAM: alpha amylase catalytic region; SMART: alpha amylase
FT                   catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60262"
FT                   /db_xref="GOA:D7ASN8"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASN8"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ADH60262.1"
FT                   /translation="MQRKWWKEAVVYQIYPRSFYDTNGDGIGDLQGIITKLDYLKELGI
FT                   DVIWLNPIYQSPNADNGYDISDYYGIMDEFGTMSDFDELLSQAHKRGIKIVMDLVVNHT
FT                   SDEHKWFLESRKSKDNPYREFYFWKKGKNGRPPNNWTSFFSGSAWEYDPLTNEYYLHLF
FT                   AVKQPDLNWDNPMVRQEIYKMMKWWLDKGIDGFRMDVINLISKVEGLPDDIQGERQGGL
FT                   VGAKYYANGPKVHQYLQEMNKEVLSKYDIMTVGETPFVTPEIAKLYVEYDRNELNMLFH
FT                   FELMDIDCGNSKWDIKPWKLTDFKKIMYKWYLALKDKGWNSLYLNNHDQPRMVSRFGND
FT                   KEYRVESAKLLATFLHTWQGTPYIYQGEEIGMTNCKFESIDEFRDIETLNWYNDMKKQG
FT                   KSDEKLLDILNKRSRDHARTPMQWDDTKNAGFTTGIPWIKVNPNYKEINVKKALEDKNS
FT                   IFYYYKKLIELRKKYPVIVYGNITMLYEDDEKIFAYTRSYGNQRLLVVLNFSEDNVNFA
FT                   VPKEMFTNSPQLLISNYPVNDNIQEKVILRPYEARVYKI"
FT   gene            complement(532493..533326)
FT                   /locus_tag="Tmath_0506"
FT   CDS_pept        complement(532493..533326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0506"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tex:Teth514_0395
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60263"
FT                   /db_xref="GOA:D7ASN9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASN9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH60263.1"
FT                   /translation="MKFKNTANQIVFYVFLIIFLVYIIFPFLWQLLTSFKTPQELFSIP
FT                   PTWIPSKIYTGYYINVFTKRPFLTYLKNSFIVASSTTLFSLFVSSFASYALARLKFKGK
FT                   AIILSLVLSVSMFPGIAIVSPLFLFLRKINLLNSYLGLILTYTTFAIPLSLWILTSFFK
FT                   EIPFELEESAKVDGATPMQAFLKIIMPLATPGMFTTAILTFIAAWNEFLFALVFNTQDS
FT                   MRTVPVGIAMFPGEHDLPWGDIAAASVVVTVPLIIMVLLFQKRIISGLTAGAVKG"
FT   gene            complement(533336..534259)
FT                   /locus_tag="Tmath_0507"
FT   CDS_pept        complement(533336..534259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0507"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tex:Teth514_0396
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60264"
FT                   /db_xref="GOA:D7ASP0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASP0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH60264.1"
FT                   /translation="MVEQKNLTSPTKQSKYQLSEAALGYILVAPALLCIIAIALYPVLN
FT                   TFKLSLYYMKLQLPGLTHFVGFQNYVALFHDPRFWSATSNTIVFTVVSVALELVLGMIM
FT                   ALLMNKKFKGTGLVRAAVLIPWAIPTIVSALMWKFIYNDQFGVLNDILMKTGLIDSYRA
FT                   WLGSPSLAMGSAIFADVWKTAPFMALLLLAGLQNISHDLYEAAKVDGAGSIRQFFSITL
FT                   PLLKPTILVALIFRTLDAFRVFDLIFVMTGGGPGNSTETLSIYAYKTLFRNLDFGIGSA
FT                   IAVIIFVFVFIFAMIYIKLLDKNILE"
FT   gene            complement(534332..535618)
FT                   /locus_tag="Tmath_0508"
FT   CDS_pept        complement(534332..535618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0508"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: tex:Teth514_0397 extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60265"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASP1"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH60265.1"
FT                   /translation="MGKKNKILTLIVSLALIVTLIAGCGSNTSSSTSSNTSKDEPVTIT
FT                   YSAGKDSTPATQKLIEAFEKKYPNIKVKFQELPNSTDDQHNSYVTALSAGDSSIDVLAM
FT                   DIIWTPEFAAADWLLPLDDKFTEEMREKFLPGPVEAVTYNGHVWAVPRFTDAGVLYYRK
FT                   DIIDTPPKTWDELIQMSKENVGKGGTKYGIVFQGNQYEGLVCDALELIGSNGGSVLEGD
FT                   KVTINTPQAVAGLQYLIDLVKIAPPGVTTYQEEEARNVFQQGEAIFMRNWPYAWSLVNG
FT                   DDSPIKGKVGIAPIPKGKNGQAGTPVLGGWNLGINKYSKHPEEAWKFIEFVTSEEGQKI
FT                   TALEGGNLPTIKSLYQDEEVLAKNPYWADFYDAFITAKPRPVSPFYPQMSDSMQINFHK
FT                   ALTGEITAQQAIQNIEKDLNDIIKNEGKK"
FT   sig_peptide     complement(535523..535618)
FT                   /locus_tag="Tmath_0508"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.245 at
FT                   residue 32"
FT   gene            535792..537495
FT                   /locus_tag="Tmath_0509"
FT   CDS_pept        535792..537495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0509"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: tex:Teth514_0398 histidine kinase internal
FT                   region; PFAM: histidine kinase internal region; histidine
FT                   kinase HAMP region domain protein; ATP-binding region
FT                   ATPase domain protein; Cache domain protein; SMART:
FT                   histidine kinase HAMP region domain protein; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60266"
FT                   /db_xref="GOA:D7ASP2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASP2"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADH60266.1"
FT                   /translation="MLYKKILLSYILIIVIPLVMVAAITGNITSRYINEEVRKSTFQTL
FT                   NQANKNISKMLENMKNTILYISMNKELQYNLSRNDKETPFQINREVTAIRNSILYPGIF
FT                   NKNYSSIEIFALRKNQYPMRLEQNDVMSSKVVEDKEWYKKTIQLNGRLYWYINNDFGKQ
FT                   MISVSRLVFDVKNFTKPIAVISVDMDMSKIASIISDIHLGKTGKVYLVDDKGELIYSED
FT                   KSFLYPYTTKLYNSSSRSNFITMNGNKIMVIYNTLPQNGWKLVGMIPLNELNEKAKMIR
FT                   NFIYLTALLSVVIAALISLYFSYSISQPIIKLATEMKRVEKGNFNISVEENWDGEIGVL
FT                   YSSFNYMIKRINELIHEVYLSKIKEKDAELKALQAQINPHFLYNTLDTVNWLAVKHNAP
FT                   EISKIVNSLASILRYSINKGNDVTTVDKELKHVESYITIQKIRFKDKFEVSFNIDKRIL
FT                   HYKTIKLILQPLVENAIIHGIETYEGKGKILINGYLGDGKIVFEVINNGNPIDLDVVNK
FT                   LLDSPSEDKDSYGIQNVNERIKLYYGEEYGLYYQVIDNNTVARIVIPAVL"
FT   gene            537506..538603
FT                   /locus_tag="Tmath_0510"
FT   CDS_pept        537506..538603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0510"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: tex:Teth514_0399 response regulator receiver
FT                   protein; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: response regulator receiver; Helix-turn-helix, AraC
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60267"
FT                   /db_xref="GOA:D7ASP3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASP3"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH60267.1"
FT                   /translation="MKILIVDDEPIVREGLKNNVNWQELDLRVVGCEANGKSALHVFNR
FT                   EQPDIILTDIRMPFMDGLQLTREVKKIDPLVVVILLSAYDDFKYAQQAIRLGAFDYILK
FT                   PIDIDTLKETVRRAVLKRKELLDKKKEPLPSLNKEDLKFFKAEYYKYPLKLEEKLSKAI
FT                   KRGDKDLALNIFNEIWNEFRDKNYTEDFIKRWGLELVAVITRSLIEIGENADILFKETD
FT                   PWRQISELSTKENLREWMGNIIEVVCEYVSLTKNSKNRKLIDEAIKLIQENYSDVNISL
FT                   NSIAEKLYITPNYLSTLFKSEMGVTFSDYLTACRIEKAKELLKDVKVKIYEVAEAVGYT
FT                   DQHYFSKVFKNITGFTPKEYREKIL"
FT   gene            538694..539335
FT                   /locus_tag="Tmath_0511"
FT   CDS_pept        538694..539335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0511"
FT                   /product="Glutamate formimidoyltransferase"
FT                   /EC_number="2.1.2.5"
FT                   /note="KEGG: tex:Teth514_0400
FT                   formiminotransferase-cyclodeaminase; PFAM:
FT                   Formiminotransferase-cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60268"
FT                   /db_xref="GOA:D7ASP4"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="InterPro:IPR036178"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASP4"
FT                   /inference="protein motif:PRIAM:2.1.2.5"
FT                   /protein_id="ADH60268.1"
FT                   /translation="MLINDSLKEYIEKVASESPTPGGGSVAAVSASLGIALSSMVYNLT
FT                   IGRKFYEDYTDDIKEKIQQGLSICRRLLAEYVKLIDEDTVAYDEVIKALKMPKDTEENR
FT                   KIRSEALQKAYINAMNVPLKLARLCGEAFTPTMLIAEYGNPNAISDAAVGAILLYAAIE
FT                   GAVLNVKVNIPYIKDREITESANKECDEILAKYKNIRDEIVNKVLNKISG"
FT   gene            539619..540680
FT                   /locus_tag="Tmath_0512"
FT   CDS_pept        539619..540680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0512"
FT                   /product="basic membrane lipoprotein"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG:
FT                   tpd:Teth39_1833 basic membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60269"
FT                   /db_xref="GOA:D7ASP5"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASP5"
FT                   /inference="protein motif:PFAM:PF02608"
FT                   /protein_id="ADH60269.1"
FT                   /translation="MMKKWRVVLAFVLILLLAVSVFLSGCSSKTKQESTQPQTTTQEAK
FT                   NKDFKVGLVTDVGGINDHSFNQMAYEGLQRAAKELGVTVNVIQSKQMTDYVPNLTNFAQ
FT                   QGYDLVIAVGFLMHDAVEEVSQKFPDTKFLIIDSEVTDRENVSSAIFKTEESSYLVGAM
FT                   AGLMEKEKVGKVKGTNVIGVIGGMQAPAIDRFIAGYQQGAKAVNPDIKILVNYANSFND
FT                   PATGKQMALTQISQGAEIIFQVAGGTGDGIIKAAQEKNVYAIGVDADQSYLAPDNILTS
FT                   ALKRVDVATFDIIKDTLNGNFKSGVVYFDLKNDGVGLGTVNKDVPQSIVDKVNQLAQDI
FT                   KDGKITVSDKVSK"
FT   sig_peptide     539619..539696
FT                   /locus_tag="Tmath_0512"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.478 at
FT                   residue 26"
FT   gene            541377..542570
FT                   /locus_tag="Tmath_0513"
FT   CDS_pept        541377..542570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0513"
FT                   /product="L-fucose isomerase-like protein"
FT                   /note="PFAM: L-fucose isomerase-like-like; KEGG: bfs:BF1600
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60270"
FT                   /db_xref="GOA:D7ASP6"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASP6"
FT                   /inference="protein motif:PFAM:PF02952"
FT                   /protein_id="ADH60270.1"
FT                   /translation="MSINVIKLASPVHNKKNVEESLKFFSDFLINEFDAKFVDECKENE
FT                   FTVVWNMTGGTEGIFKKIYKNLRQPIIVLTTDLINSLPAALEILSFIKSQNGKGYIIHG
FT                   DLREIACEIKKYYKFFTALKKIKEAKIASIGGASEWLIASSIDYIQASKKWGTSFIDIP
FT                   IDELYNILKNCHGSYDGYFDRAIEVVEPSNEDIRGVHLIYLALKKIIEERKLDAISLKC
FT                   FDLLKRVNNSSCLALSRLNDEGIIAGCEGDLPATFTMYLVLALTQKKSFMANPSKIDFN
FT                   KNTIIFAHCTVPTTLVKQYKLRSHFESGIGVGIAGEFEKETVTVVKIGGKNLDKIFVTT
FT                   GRIISNPTNDQRCRTQIEVEMDNDVREFLKNPIGNHMVIVRGNIKKELNEFMEYVGF"
FT   gene            complement(542693..543108)
FT                   /pseudo
FT                   /locus_tag="Tmath_0514"
FT   gene            543441..544970
FT                   /locus_tag="Tmath_0515"
FT   CDS_pept        543441..544970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0515"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_1832 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60271"
FT                   /db_xref="GOA:D7ASP7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASP7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH60271.1"
FT                   /translation="MSVILEVKNITKVFPKVVANDNVNLTVEKGEIHAILGENGAGKST
FT                   LMNIIYGLYKPDSGKLIFDGEELNLSGPHEAIEKGIGMVHQHFMLIPALTVAENIVLGA
FT                   EPKGITYDRKKANELIREISKKYHLEIEPEAKVKDLSVGLQQRVEILKAFYRKAKLLIL
FT                   DEPTAMLTPQEIEKLFEIMRGLVKQGMSIIFISHKLEEVLEISDRVTVMRRGKTVGTLN
FT                   TKETNEQELANLMVGREVILRIEKSEYKPGDVVLSVKNLNVVDQQNVPKVKNVSFEIHE
FT                   GEIFGLAGIDGNGQLELVEAIMGLRPKKSGNILFYGKDVTNFTTRQLYREGISYIPQDR
FT                   QADGLVLDFTIAENLILREYKDSAYSRHGVIQYKKVYENAERKVKEFDIRPPEYMLKAR
FT                   GLSGGNQQKVILAREVGYDPKLLIAVQPTRGMDVGAIEYIHKRILELRDRGAAVFLISL
FT                   ELEEIMSLSDRIGVIYNGQLMDILDGKTATREQIGMLMAGSRFDKTTLEAR"
FT   gene            544970..546028
FT                   /locus_tag="Tmath_0516"
FT   CDS_pept        544970..546028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0516"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   tpd:Teth39_1831 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60272"
FT                   /db_xref="GOA:D7ASP8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASP8"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADH60272.1"
FT                   /translation="MKNLLKELYIPAAAVLIAIIVGSIIMLITGFNPITAYISLFIGAF
FT                   GTINNIANTLAAAVPLILTGLGVAISFKAGLFNIGAEGQYWIGAIVGVWVGYSFTGLPW
FT                   YIHIPFAVIAAMIAGGLWAGLIPGLAKAHTGANEVITTMMMSYIAIYFSHFLLEFGPMM
FT                   EKGRTIPQSPRINESAVIPVLIKNTQLSYGIFIALAAAIFVYWLMFKTTWGFEMRAVGY
FT                   NQRAARYAGMNVPLNMMLSLGLSGAFAGLAGAVQMLGVQHRLYNSFTSGYGYTAIVVSL
FT                   LANNNPLGVIFSAILFAALGTGSQYMQLNAQVPGQMADVITGLIVFFVAAHRVAEVIKN
FT                   KFAKNRKKEVQA"
FT   gene            546028..546948
FT                   /locus_tag="Tmath_0517"
FT   CDS_pept        546028..546948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0517"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   tpd:Teth39_1830 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60273"
FT                   /db_xref="GOA:D7ASP9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASP9"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADH60273.1"
FT                   /translation="MEIFLNPQLWAATLAMATPLALPALGGTFSERSGVVNIAMEGIML
FT                   IAAFFAVVFSHATGSAWLGLLGAIIVGLIVALIFAWAAVSLTANQIILGMAINIFASGI
FT                   TAYLLNTMYGFTGTPTDTPMLPTIDIPGIKNIPFLGQVLSGHSVVVYLMIIILFISNYF
FT                   LFHTNLGLRLRAVGENPEAAETAGINVIKLRYLGVALSGILSAMGGAYLSIGALNSFNP
FT                   DMTSGRGYIALAAMIFGKWTPFGSFGAALLFGFATALSMQLQNTAFSKNIIMMLPYIVT
FT                   ILALVGVGGKSVPPAADGVPYTPKK"
FT   sig_peptide     546028..546108
FT                   /locus_tag="Tmath_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.853) with cleavage site probability 0.851 at
FT                   residue 27"
FT   gene            546958..547689
FT                   /locus_tag="Tmath_0518"
FT   CDS_pept        546958..547689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0518"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: tpd:Teth39_1829 GntR family transcriptional
FT                   regulator; PFAM: UbiC transcription regulator-associated
FT                   domain protein; regulatory protein GntR HTH; SMART: UbiC
FT                   transcription regulator-associated domain protein;
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60274"
FT                   /db_xref="GOA:D7ASQ0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASQ0"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ADH60274.1"
FT                   /translation="MSMLLPEKKPLYELALRKMEELIKTGQWKEGSKLPSESQLAKQFG
FT                   ISRATLREAMRILEEEGLIIKQQGVGTFVKRKPLIKSGLEELFSVTTLIERQGMVPGTK
FT                   DFTVYKLPATENEANHLKLKPGDIIYKVERVRTADEVPVVYCIDRLPQSIVGESFTGFE
FT                   QSVFSYLENEHSITITYAISNIRVIKHDPVVEKKLMMDKNDSILLLEQVHYDENNTPIL
FT                   YSSNYFNASKFDFYIIRKRIL"
FT   gene            547705..548112
FT                   /locus_tag="Tmath_0519"
FT   CDS_pept        547705..548112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0519"
FT                   /product="cytidine deaminase"
FT                   /note="KEGG: tpd:Teth39_1828 cytidine deaminase; TIGRFAM:
FT                   cytidine deaminase; PFAM: CMP/dCMP deaminase zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60275"
FT                   /db_xref="GOA:D7ASQ1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASQ1"
FT                   /inference="protein motif:TFAM:TIGR01354"
FT                   /protein_id="ADH60275.1"
FT                   /translation="MEHKDYEKLIELAKEAREKAYVPYSHFKVGACVLTEDGKTYQGCN
FT                   IENASYGLTNCAERTALFSAYANGERKLKAIAVVADTEGPVSPCGACRQVMMELGGEDM
FT                   VVVLSNMKGDYAVVTVKDLLPGAFTSKDLEK"
FT   gene            548145..549314
FT                   /locus_tag="Tmath_0520"
FT   CDS_pept        548145..549314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0520"
FT                   /product="phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="TIGRFAM: phosphopentomutase; KEGG: tpd:Teth39_1827
FT                   phosphopentomutase; PFAM: Phosphopentomutase domain
FT                   protein; metalloenzyme domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60276"
FT                   /db_xref="GOA:D7ASQ2"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASQ2"
FT                   /inference="protein motif:TFAM:TIGR01696"
FT                   /protein_id="ADH60276.1"
FT                   /translation="MFKRVILIVLDSVGVGELPDAYRFGDEGSNTLGHVTEKTGVELPN
FT                   MGQLGLGNIIPLKSVPENPNAIGGYGKMAEKSAGKDTTTGHWEIAGLFINKPFPTYPNG
FT                   FPDEIIKEFEKRIGRKVLGNKPASGTEIIKELGEEHVKTGFPIVYTSADSVFQVAAHED
FT                   VIPPVELYRICEIAREILKGDHAVGRVIARPFTGSSGNFVRTENRRDFSLKPFEPTILD
FT                   MLKEAGYEVFAIGKIEDIFAGQGITGKNHTTNNDEGITATIKAMDEVKDGLIFTNLVDF
FT                   DMLYGHRNDVEGYAKALKNFDDRLPEIMEKLTKEDLLIITADHGCDPATESTDHSREYV
FT                   PLLVYSPLMKHGVNLGVRSTYADIAATIAEVFEVGSTKHGTSFLRELPL"
FT   gene            549330..550625
FT                   /locus_tag="Tmath_0521"
FT   CDS_pept        549330..550625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0521"
FT                   /product="pyrimidine-nucleoside phosphorylase"
FT                   /EC_number="2.4.2.2"
FT                   /note="TIGRFAM: pyrimidine-nucleoside phosphorylase; KEGG:
FT                   tpd:Teth39_1826 pyrimidine-nucleoside phosphorylase; PFAM:
FT                   glycosyl transferase family 3; Pyrimidine nucleoside
FT                   phosphorylase domain; Glycosyl transferase, family 3-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60277"
FT                   /db_xref="GOA:D7ASQ3"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASQ3"
FT                   /inference="protein motif:TFAM:TIGR02644"
FT                   /protein_id="ADH60277.1"
FT                   /translation="MRMYDLIMKKRDGGVLTKEEIDFIISSYTKDYIPDYQMSALAMAI
FT                   YFRGMTPEETAHLTMAMAYSGDVMDLSAIKGIKVDKHSTGGVADTTTLVLAPMVAACGA
FT                   PVAKMSGRGLGHTGGTIDKLESIPGMRVELSEEEFIDNVNKYGIAIIGQTKNLTPADKK
FT                   LYALRDVTATVDSIPLIASSIMSKKIAAGADGIVLDVKVGRGAFMKDLERAKALAKLMV
FT                   DIGNSVGRKTVAHVTNMDYPLGLAIGNALEIVEAIHVLKGHGSRDLLEVCMLLGSDMLQ
FT                   IAGIAKDDKEARVKLKEALDSGKALQKFKEFIKAQGGDERVVDDVSLLPQAKYVRPWIA
FT                   DRNVYIKDLMALELGLIAMKLGAGREKKEDKIDLAVGIMLGGKVGDIIRKGEPIATIYA
FT                   NDESKLEWAFDEIKKYILLSDEPVERPTLIFE"
FT   gene            550738..552390
FT                   /locus_tag="Tmath_0522"
FT   CDS_pept        550738..552390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0522"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: tex:Teth514_0410 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   SMART: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60278"
FT                   /db_xref="GOA:D7ASQ4"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASQ4"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADH60278.1"
FT                   /translation="MQMGKTIRAQLIRSFVIIGILIVILTFTINVGLINTIQNIENLRK
FT                   YVVNQVINVSNAQVQVAVLSGNIQQTLNDYMRGNATNFSVGVPISSIETYVSNIQNSLD
FT                   DYKNTKNYELLKKNLSAINEGIQNLKKAVNELPEKYDSVNDSDKVVTIGYYLNHIQSSL
FT                   NDFSSTYSQGFLPYFNQMIEDNKKNFYVSLSISIAIIVIILIYAAIIVRKLRKFAKLIN
FT                   SEIDKAVKQSEEVMNYAVDIKNKSEENTTNITSSKQGLEDLVNGINVISENVNEVADSI
FT                   TKVSETNENLSQVSDKLMRDMNEAMMKIKEIEENAHRQGEEVKSLIESLQESLETSKNT
FT                   SKQLSELEKRMGGIKDILYSISDIAEQTNLLALNAAIEAARAGENGRGFAVVAEEIRKL
FT                   AAQSTESVERIGEIIESLTQFTRETVDNVIKNIDTSTKASIEVNKVLDIFEQTKEGFDK
FT                   VSDIISEISVAAEETAVSSNQTLQAMKNVMTASQNISAQVEELLASSQQLLAEINVVDE
FT                   NNLKNLDHIKEQVEYTEEQKANMQKITNIVKQL"
FT   gene            552513..553460
FT                   /locus_tag="Tmath_0523"
FT   CDS_pept        552513..553460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tex:Teth514_0411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60279"
FT                   /db_xref="GOA:D7ASQ5"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASQ5"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0411"
FT                   /protein_id="ADH60279.1"
FT                   /translation="MKRIFELTMKDIERMDKNTLIETIKTSEGRTVMAETIVTVPPLIY
FT                   GVSNMELAATFGSDMITLNFFDFQKPFIFGIDDIEINFSAGPSEVQKIVEIASKNAEDF
FT                   HYIKRVKKIVGRFIGVNIEPVPEGVKYVEGRKLNRENLLKAKEYGFDYIVITGNPNTGV
FT                   SVSTIIKGIELAKEILGENMMIIAGKMHGAGSGNIYEDKILKDFVKAGADCVLIPAPGT
FT                   VPGIDLNLAKRQIDAIHEESALAMTTIGTSQEGSQKSTIEFIGVQSKMAGADIQHIGDA
FT                   GYAGVALPENIMALSIAIRGVRHTYRRMAYSLNK"
FT   gene            553781..555181
FT                   /locus_tag="Tmath_0524"
FT   CDS_pept        553781..555181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0524"
FT                   /product="PTS system, N-acetylglucosamine-specific IIBC
FT                   subunit"
FT                   /note="KEGG: tpd:Teth39_1823 PTS system,
FT                   N-acetylglucosamine-specific IIBC subunit; TIGRFAM: PTS
FT                   system, N-acetylglucosamine-specific IIBC subunit; PTS
FT                   system, glucose-like IIB subunint; PFAM: phosphotransferase
FT                   system EIIC; Phosphotransferase system EIIB/cysteine,
FT                   phosphorylation site"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60280"
FT                   /db_xref="GOA:D7ASQ6"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASQ6"
FT                   /inference="protein motif:TFAM:TIGR01998"
FT                   /protein_id="ADH60280.1"
FT                   /translation="MKWLASVQKLGKALMLPVAVLPAAALLLRLGAPDVFNIPFIMQAG
FT                   AAVFDNLPLIFAIGIAIGFAEGDGVAALAAAVGYFVLTKGATTINKDINMGVLGGILMG
FT                   IIAGYLYNKYHDIKLPDFLGFFGGKRFVPIVTAFVAIVLAFAMGYVWPPIQNGIYAVGE
FT                   WIIGAGVLGVFVYGVLNRLLIPFGLHHVINSLVWFVFGTFKTAAGKVVTGDLNRFFAGD
FT                   PTAGTFMAGFYPIMMFGLPVAALAMWAAAKPNQRKAVSGVLISAALTAFLTGITEPIEF
FT                   SFMFLAPVLYVIHALLTGLSLAITYVLGIKDGFGFSAGLIDYILSYGIATKPLLLLLIG
FT                   IIYGAIYYVIFYYIIVKFNLATPGRLEEEAVDQYADMSKSELGNIAVQYVEVLGGTENI
FT                   QSLEACITRLRLTVKDDTIIDDDKLKKLGATGVIRMGKNALQVIVGTKADLIAQEMRKH
FT                   MKKAGGKI"
FT   gene            555264..555779
FT                   /locus_tag="Tmath_0525"
FT   CDS_pept        555264..555779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0525"
FT                   /product="PTS system, glucose subfamily, IIA subunit"
FT                   /note="KEGG: tpd:Teth39_1822 PTS system, glucose subfamily,
FT                   IIA subunit; TIGRFAM: PTS system, glucose subfamily, IIA
FT                   subunit; PFAM: sugar-specific permease EIIA 1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60281"
FT                   /db_xref="GOA:D7ASQ7"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASQ7"
FT                   /inference="protein motif:TFAM:TIGR00830"
FT                   /protein_id="ADH60281.1"
FT                   /translation="MVKNTERADYMFNIFKKKKYVDIYSPINGILLKIEDVPDPVFSQK
FT                   MVGDGVALEPTEGIVYSPVNGTIIQLFPTKHALGLKTEEGLELLIHIGMDTVEMKGNGF
FT                   ESFVSEGEKVKVGDKLIKFDMELVKKEHPLTSPIIITNMDIVDKIVKEPDGEEVRAEKT
FT                   KIMRVYLK"
FT   gene            555797..556624
FT                   /locus_tag="Tmath_0526"
FT   CDS_pept        555797..556624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0526"
FT                   /product="transcriptional antiterminator, BglG"
FT                   /note="PFAM: CAT RNA-binding domain protein; PRD domain
FT                   protein; KEGG: tpd:Teth39_1821 transcriptional
FT                   antiterminator, BglG"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60282"
FT                   /db_xref="GOA:D7ASQ8"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036650"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASQ8"
FT                   /inference="protein motif:PFAM:PF03123"
FT                   /protein_id="ADH60282.1"
FT                   /translation="MYQVVKVLNNNVCMAKDDKSVECVVIGKGIGFGKRPGDIIEEDKL
FT                   EKIFYVQEDVNKIKFSELMEEIRGDVIGIAEEIIAMAEKIKGKKLNEHIHIALADHIAF
FT                   AIERINMGIDIKNPFNMEIKALYKDDYNIALKALELIKQRLNISLPEDEAGFIALHLHA
FT                   AVENAGLSNTLKNTRLISQLVSIIENQLGKHIDRDSIDYLRLVTHLRFAIDRLEKNTPI
FT                   ANELLASIKKKFKGAYKIAMQVSKVIENTLGKEVPEEEIGYIAIHIQRLINTI"
FT   gene            556756..557907
FT                   /locus_tag="Tmath_0527"
FT   CDS_pept        556756..557907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0527"
FT                   /product="homocitrate synthase"
FT                   /note="KEGG: tpd:Teth39_1820 trans-homoaconitate synthase;
FT                   TIGRFAM: homocitrate synthase; PFAM: pyruvate
FT                   carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60283"
FT                   /db_xref="GOA:D7ASQ9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013477"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASQ9"
FT                   /inference="protein motif:TFAM:TIGR02660"
FT                   /protein_id="ADH60283.1"
FT                   /translation="MALKKGKKVYIVDTTLRDGEQTAGVVFANNEKIRIAQMLDEIGID
FT                   QLEVGIPTMGGDEKETVAKIAKLGLNASIMAWNRAVVKDVQESLECGVDAVAISVSTSD
FT                   IHIEHKLKKTRQWVLDNMTEAVRFAKKEGVYVSVNAEDASRTDMDFLIEFAKCAKQAGA
FT                   DRLRFCDTVGFLDPFKTYDMVKTIKEAVDIDIEMHTHNDFGMATANALAGMKAGANFIG
FT                   VTVNGLGERAGNAALEEVVMALKHVYKIDLGIDTTKFREISEYVALASGRQLPAWKAIV
FT                   GTNVFAHESGIHVDGALKNPYTYEIFNPDEVGLERQIVIGKHSGTAALINKFKEYGRVL
FT                   TEEEANQLLPHVRKLAIQLKRPLFDKELMYLYEDVIKNREKAI"
FT   gene            557932..559863
FT                   /locus_tag="Tmath_0528"
FT   CDS_pept        557932..559863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0528"
FT                   /product="aconitate hydratase"
FT                   /note="KEGG: tpd:Teth39_1819 aconitate hydratase; TIGRFAM:
FT                   aconitate hydratase; PFAM: aconitate hydratase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60284"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006250"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASR0"
FT                   /inference="protein motif:TFAM:TIGR01342"
FT                   /protein_id="ADH60284.1"
FT                   /translation="MNLTQKILSSHLVEGEMVKGREIAIKIDQTLTQDSTGTMAYLQLE
FT                   ALGIDRVKTELSVAYIDHNTLQQGPENADDHRYIQTVAAKYGIYFSRPGNGICHQVHLE
FT                   RFGRPGKTLLGSDSHTPTAGGLGMLAIGAGGLDVALAMAGEPYRIIMPSIVNVRLTGKL
FT                   RPWVSAKDVILELLRRLTVKGGIGKIFEYSGDGVKTLSVPERATIANMGAELGATTSIF
FT                   PSDERTYEFLKAQGRENAFVPLAADEDAEYDEVIEINLDELEPLVALPHSPDNVVKVKD
FT                   AGRPKVDQVAIGSCTNSSYADLMKVASILRGKVIPEHVSLVIAPGSRQVLNMLAKNGAL
FT                   SDLISAGARILESACGPCIGMGQAPATDAISVRTFNRNFYGRSGTKSASVYLVSPEVAA
FT                   AAALTGYLIDPRELGEAPEVPYVEKFEINDNMIVKPPEDREKVEVIKGPNIKPFPLNTP
FT                   LSDIEKRVLIKVGDDITTDHIMPSNAKLLPLRSNIPELSKHCFEIIDENFSKRAIEWDG
FT                   GIIVGGVNYGQGSSREHAALAPLYLGVKAVIAKSFARIHKANLINSGILPLTFVDEKDY
FT                   ENIEVGDVLKIENAVAQVKRGGRITVKNQTKGTTFEVNLDVSDRNREVLIAGGMINYVK
FT                   SKNTKKTG"
FT   gene            559971..561494
FT                   /pseudo
FT                   /locus_tag="Tmath_0529"
FT   gene            561897..563015
FT                   /locus_tag="Tmath_0530"
FT   CDS_pept        561897..563015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0530"
FT                   /product="Transcriptional regulator/sugar kinase-like
FT                   protein"
FT                   /note="KEGG: hor:Hore_00770 ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60285"
FT                   /db_xref="GOA:D7ASR1"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASR1"
FT                   /inference="protein motif:COG:COG1940"
FT                   /protein_id="ADH60285.1"
FT                   /translation="MRRKNNLKELKDRNKKLILKTLINKGALSRTEISQYTGLSLTAVS
FT                   DLTDELIEENIIKENGVGTSTGGRRPIMLQFNPESGYILVVKVDENKIIASLFDFSMNK
FT                   ISQKEIKFDYFEISKLEAKIKECYFSFEKEICKDDKKIFGIGICLNNDVKILKPRGILN
FT                   TSISSEFITIEQSLSLELGLTVVEEDELNLKAMAEYQNLNMRENLAYIKIDEDIESSVI
FT                   IKGKRLETSINIGQMIVDKNGPTLDEVVSIKSIIKRALIMIIEEHEKEQIDNIPPINID
FT                   SLCEILNDEKKNRLINEVSNYLKVAIINLKNLLDIKVFIFDGKILKLSAIINSLARSCE
FT                   NLVIKNPSTKDEDVMREAAKLTLKKIINIQEA"
FT   gene            563020..563697
FT                   /locus_tag="Tmath_0531"
FT   CDS_pept        563020..563697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tex:Teth514_0421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60286"
FT                   /db_xref="GOA:D7ASR2"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASR2"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0421"
FT                   /protein_id="ADH60286.1"
FT                   /translation="MEFLDLLNSNKMTLIVSLPENKLEFAQAAVKGGADALKVHANVYH
FT                   SASGNNFRGIMEQREVFEEIIKYANVPVGLVPGAQLYASKDEIKFVEEIGFSFLSMFAH
FT                   YMPLYMIDSNLDKMIAVNETYDLGHIRAVNRIGVDVIEADVLPDDRREKIYVFDLMRYG
FT                   RLVENVDKPVVVPTQRIIEPEEVRFLYELGVKGIMIGAIVTGNTVEGVERTTSLFREAI
FT                   NKL"
FT   gene            563711..564997
FT                   /locus_tag="Tmath_0532"
FT   CDS_pept        563711..564997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0532"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Citrate transporter; KEGG: apv:Apar_0160
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60287"
FT                   /db_xref="GOA:D7ASR3"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASR3"
FT                   /inference="protein motif:PFAM:PF03600"
FT                   /protein_id="ADH60287.1"
FT                   /translation="MQAVLILVLFLAIAVLMITRKLPTLIALPILAIGIAVIAGVPLKM
FT                   VDPKTKVDNGLLAYVIDGGAIKLAAAYVAVMFGAWLGQIMNQTGISKSIVKTAAELGGD
FT                   RPFIITILVAAAIALLFTTVGGLGAVIMIGSITIPILMSVGVAPMTAIAVFLFGMAIGL
FT                   ELNMGNWAFYITATGVTLEQVRNFALVLMVLTAITALVFIIIEFKRQGLKFAWAQANDE
FT                   EIEQKANSLALLTPLIPILFVLVFKWSIISSFMVGIVYSVITTQKSVKNALNTLTKTAY
FT                   DGIADSAPAVLLMIGIGMLLNAVMHPMVAKSLEPILKSIIPSSRISYIIFFSLLAPLAL
FT                   YRGPLNLWGLGSGIAGLIIGLKLLPPTAVMGALLSTERIQAIGDPTNTHNVWLSNYAGV
FT                   DVNKLLLKLLPYIWALAIAGVVTASIMFF"
FT   gene            565061..567205
FT                   /locus_tag="Tmath_0533"
FT   CDS_pept        565061..567205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0533"
FT                   /product="Hydantoinase/oxoprolinase"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG: tte:TTE2591
FT                   N-methylhydaintoinase A"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60288"
FT                   /db_xref="GOA:D7ASR4"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASR4"
FT                   /inference="protein motif:PFAM:PF01968"
FT                   /protein_id="ADH60288.1"
FT                   /translation="MKVRIGIDVGGTFTDAVAIDNDTYELIGTIKVPTTHTAKEGVAKG
FT                   IIEALMKLMEEHSIDPEDVLFIAHGTTQATNALLEGDVVPVGIIAAGKGLEGIKVKSDT
FT                   NIQDIELAPGKILKIANQYIELEDEFEKNVEMKIEDFKRQEIGAIVAAQAFSVDDPTIE
FT                   DKIVDIIEQKGLPATATHEITKLYGLKIRTRTAAINACILPKMIETANMTEESVKKSGI
FT                   KAPLMIMRGDGGVMNIAEVRKRPILTLLSGPAAGVAGALMYEKISDGIFLEVGGTSTDI
FT                   SAIKRGKVMVNYAEIGGHKTYLNSLDVRTVGIAGGSMVRLGDKDIEDVGPRSAHIADLP
FT                   YAVYSDPEEIIEPEIVYIKPKKNDPDNYVAIKSKNGKIFAITVSCAANVLGYVRPEDYA
FT                   YGNQEAARKALEPIAKKLNKTVEEVAKKIMDIASMKVIKVVEQLITDYKLDKSTTVLVG
FT                   GGGGSASIVPYVAKIMGMHHRIAKNAQVISTIGVALAMVREIVERTIQNPTEKDILSIR
FT                   NEAKEAVIKSGALEETVEIYVEIDSQKNIVRAIATGATELRSKDILNKNLGEEEIKKIA
FT                   SQSMKLESIKNLQIIDKTGSMYIIKGIENRKRFFGLLSQKQERVVVINKEGVIRLHKNN
FT                   GKVYRTTIKTFENDLNKALEQNIFYGDGGAEIPDCFIILPNRIVDLSGLIDKEQIISLA
FT                   KVEISGLSDNDRILILLSKR"
FT   gene            567210..567740
FT                   /locus_tag="Tmath_0534"
FT   CDS_pept        567210..567740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1812 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60289"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASR5"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1812"
FT                   /protein_id="ADH60289.1"
FT                   /translation="MVPSVFLNKQQLIDQELKFDIYYNRISDLNLDDILEIAWNRGIKE
FT                   AEKIKNKDIKQLIFQENILIETDEKSYNPAYTIFSDYNSKEKKITIYKKNIQNVFIPSI
FT                   PDKYFFWKDNEKIVDLFLTHEYFHHLEAKYIGLTSEIKKIQIKIGPFILKRRLRALSEI
FT                   AAHAFVKEFYDIW"
FT   gene            567749..569086
FT                   /locus_tag="Tmath_0535"
FT   CDS_pept        567749..569086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0535"
FT                   /product="glucose-inhibited division protein A"
FT                   /note="PFAM: glucose-inhibited division protein A; KEGG:
FT                   tte:TTE2589 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60290"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASR6"
FT                   /inference="protein motif:PFAM:PF01134"
FT                   /protein_id="ADH60290.1"
FT                   /translation="MKPYDVVVVGGGVSGTVAAIASARNGAQTLLIERYGFLGGSLTNM
FT                   GVGPMMTFHAGDRQVVKGIPQEIVDNLVKIGGSPGHVIDTTGFVSTVTPFDVELMKYIL
FT                   EKMLIDSGVGILYHSYLSGVEIDGSKIKSIKIVNKSGEMTIKSKIYIDSTGDADLAIRC
FT                   GVNYLLGRPKDNLTQPMTMNVRIGNVDIQKIKEYVLNNPTEFRMVDKEKIIKAKRLSVN
FT                   GFYSILKEARKKGEINFERDMVLFFETNTLGEVIVNMTRVQRLNGTDIKDLTKGEIIGR
FT                   NQAIELFNFMKRRIPGFENSILISTGPQIGVRETRKIVGEYILTAEDLVSNKRFDDCIA
FT                   KGGYPVDIHSPEGEDVVYMKLKKGSDYDIPYRCLYSKKVDNLLVSGRCISSTHEANAAI
FT                   RVSPIAMATGQAAGTAASIAAKENAKVSNVDVKMLRNILLKQGAYI"
FT   gene            complement(569130..569483)
FT                   /locus_tag="Tmath_0536"
FT   CDS_pept        complement(569130..569483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0536"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="TIGRFAM: aspartate 1-decarboxylase; KEGG:
FT                   tpd:Teth39_1810 aspartate 1-decarboxylase; PFAM: aspartate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60291"
FT                   /db_xref="GOA:D7ASR7"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASR7"
FT                   /inference="protein motif:TFAM:TIGR00223"
FT                   /protein_id="ADH60291.1"
FT                   /translation="MQRFMMKSKIHRAIVTETNLNYQGSITIDKDLMELADILPNEKVQ
FT                   VLNINNGARFDTYAVESKRGSGTICINGAAARLCQVGDTIIIISYAIIDDEEAKNYKPK
FT                   VIFVDENNKPVNM"
FT   gene            complement(569483..570334)
FT                   /locus_tag="Tmath_0537"
FT   CDS_pept        complement(569483..570334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0537"
FT                   /product="pantoate/beta-alanine ligase"
FT                   /note="KEGG: tex:Teth514_0426 pantoate--beta-alanine
FT                   ligase; TIGRFAM: pantoate/beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60292"
FT                   /db_xref="GOA:D7ASR8"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASR8"
FT                   /inference="protein motif:TFAM:TIGR00018"
FT                   /protein_id="ADH60292.1"
FT                   /translation="MIVTDKISDVRNIIKEQKLSGKKIGLVPTMGYLHEGHLSLVRIAK
FT                   KHSDFVAVSIFVNPIQFGPNEDFDRYPRDLERDLKLLEKEGCDLVFAPSVEEMYPSELL
FT                   TTVNVDKITEKLCGAFRPGHFKGVTTVVAKLFNIFTPDIAVFGQKDAQQVAVIKKMVED
FT                   LNFPVEIIKAPIVRESDGLAMSSRNVYLNPEERKAATILSKSLKEAEKLLLDGERNANT
FT                   IIKKVEEVLNSEPLCKVQYVSCVHPDTLKDLTYIKDKALIAIACFIGTTRLIDNLLWGE
FT                   NI"
FT   gene            complement(570331..571155)
FT                   /locus_tag="Tmath_0538"
FT   CDS_pept        complement(570331..571155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0538"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; KEGG: tpd:Teth39_1808
FT                   3-methyl-2-oxobutanoate hydroxymethyltransferase; PFAM:
FT                   Ketopantoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60293"
FT                   /db_xref="GOA:D7ASR9"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASR9"
FT                   /inference="protein motif:TFAM:TIGR00222"
FT                   /protein_id="ADH60293.1"
FT                   /translation="MEEKVTTLTLKKFKKEGRKIVALTAYDFPTAKILDNCGIDMILVG
FT                   DSLGMVVLGYQSTIPVTMEDMIHHTKAVSKAVNRAFVVADMPFMSYHISKEQAMTNAAK
FT                   LIAEGGAHAVKLEGGEEIASIVKAIVDAGIPVVGHLGLTPQSVHQLGGYKVQGKEKEKA
FT                   KKIFNDAKILEQAGICALVLESIPMELAKDIAENISVPTIGIGAGPYCDGQILVTHDML
FT                   GITQGHRPKFVKQYVNIEKIMIEGINAYIKEVQQGLFPDEEHSFTLEKRENK"
FT   gene            complement(571115..572005)
FT                   /locus_tag="Tmath_0539"
FT   CDS_pept        complement(571115..572005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0539"
FT                   /product="Domain of unknown function DUF2520"
FT                   /note="PFAM: Domain of unknown function DUF2520; NADP
FT                   oxidoreductase coenzyme F420-dependent; KEGG:
FT                   tpd:Teth39_1807 oxidoreductase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60294"
FT                   /db_xref="GOA:D7ASS0"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASS0"
FT                   /inference="protein motif:PFAM:PF10728"
FT                   /protein_id="ADH60294.1"
FT                   /translation="MKIGFIGAGVVGTSLAFLLSQKGINISGFLSRNLESAKKSAEFTQ
FT                   SKAFYNYEEIITNADVIIISTNDSSIPEVVNNLSQHKEILKEKIFAHLSGALNLEVLNP
FT                   LKDENNFIMVMHPIQTCPSVSAALELLPESYFTLEGDEKAVEIGKEIVNKISGKYIVLN
FT                   NIVRPLYHAACVVASNYLVALSKFSLLLLKESGFPFEDYPEALIPLMEGTLKNIKENGI
FT                   PKALTGPIARGDINTIKLHLENIKDPNLKELYKSLGKLTLDIAYKKGNLSDEKYFKLEG
FT                   ILNGGKSNNSHTKEI"
FT   gene            complement(572208..572972)
FT                   /locus_tag="Tmath_0540"
FT   CDS_pept        complement(572208..572972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0540"
FT                   /product="tRNA (adenine-N(1)-)-methyltransferase"
FT                   /note="KEGG: tpd:Teth39_1806 tRNA(1-methyladenosine)
FT                   methyltransferase and related methyltransferase-like
FT                   protein; PFAM: tRNA methyltransferase complex GCD14
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60295"
FT                   /db_xref="GOA:D7ASS1"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASS1"
FT                   /inference="protein motif:PRIAM:2.1.1.36"
FT                   /protein_id="ADH60295.1"
FT                   /translation="MTSPITTKRVIIGPDNFKKVVDLSSPSKIGLPKGQIDTEFLSQIK
FT                   PGNSFEVQGVKYYVLNCDTFDYIMHYLKRQTQIIYPKEANYIAMRLDIFPGKRVGEAGT
FT                   GSGAFTVYLSRILGPYGRVYTYEQREEFYKLAQKNLREFSEFDNVIMYNKSINEGIKER
FT                   DLDAFFLDVRKPWEVLEEVRKALKPAGHLGILVPTTNQVSESLAALEKAGFYISEVSEI
FT                   ILRKYKLNPQRLRPEDLMVGHTGYLIFARKLE"
FT   gene            complement(573048..573431)
FT                   /locus_tag="Tmath_0541"
FT   CDS_pept        complement(573048..573431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60296"
FT                   /db_xref="GOA:D7ASS2"
FT                   /db_xref="InterPro:IPR025373"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASS2"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1800"
FT                   /protein_id="ADH60296.1"
FT                   /translation="MRYVVPLMISVVIFIVLLDIISFKYLDKTSENLNKMLTKVQQNIE
FT                   KEHWEEAQKNIKTVEKEWKNINKKWAMLIEHREIDEIEINMEKLKSYVDTKNKDLSSAQ
FT                   LKAIKMLIRHIPQNEKPILENIL"
FT   gene            complement(573434..574108)
FT                   /locus_tag="Tmath_0542"
FT   CDS_pept        complement(573434..574108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0542"
FT                   /product="protein of unknown function DUF421"
FT                   /note="PFAM: protein of unknown function DUF421; KEGG:
FT                   tpd:Teth39_1799 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60297"
FT                   /db_xref="GOA:D7ASS3"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASS3"
FT                   /inference="protein motif:PFAM:PF04239"
FT                   /protein_id="ADH60297.1"
FT                   /translation="MLILFFRTLILYALIVIFMRISGKQQIGQLQPYELVVAIMIADLV
FT                   AIPMQNKGIPLLSGIIPILTLLVSQLFLSYLSMKSLRARAIICGTPTILIEKGKILTSQ
FT                   LQKERYNINDLLEELRVKGYPNIADVEYAILETNGSLSVIPKSDKRPVTPQDLNLTPQY
FT                   EGLPLPIIIDGRIMHQNMQKAGIDMEWLNEQLKMWKIQNVKEVLFASLDTNKVLTVYRK
FT                   ED"
FT   gene            574330..575151
FT                   /locus_tag="Tmath_0543"
FT   CDS_pept        574330..575151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0543"
FT                   /product="Cof-like hydrolase"
FT                   /note="KEGG: tpd:Teth39_1798 Cof-like hydrolase; TIGRFAM:
FT                   Cof-like hydrolase; HAD-superfamily hydrolase, subfamily
FT                   IIB; PFAM: Haloacid dehalogenase domain protein hydrolase
FT                   type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60298"
FT                   /db_xref="GOA:D7ASS4"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASS4"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ADH60298.1"
FT                   /translation="MYKLFVTDADGSLLNSNSEISDKTKEAIREVISKGVIFTIATGRM
FT                   FSSILPYALKLNINAPVISYNGALIKDIYTKKVYYYNPIQTEDAIFAIRLLKESGYHIN
FT                   LYIDDELYVEKITDRVEWYLSFNNVTVNAVGNLEEFLEKTGSVTAKIYAINDIKNPISI
FT                   DAQVYDEIAKRLTISTSGGGHLEINAKGVSKGNALKTLANMYNIKRDQVVAVGDNLNDL
FT                   SMIEYAGLGVAMGNAPDIVKIKADYTTLSNDEDGVAHVIDKFFLNKKSVAV"
FT   gene            575458..576474
FT                   /locus_tag="Tmath_0544"
FT   CDS_pept        575458..576474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0544"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: tpd:Teth39_1797 LacI family transcription
FT                   regulator; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60299"
FT                   /db_xref="GOA:D7ASS5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASS5"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADH60299.1"
FT                   /translation="MSATIKDVAREAKVSIATVSRVLNNSAVVTDETRQKVLEAIKKTG
FT                   YKPNALARSLKIQKTHTIGLIIPDISSTFYPEVVRGIEDIAAMYNYNIFLCNTDQKEEK
FT                   EIKYIEILGEKQVDGIIFMGDIVRDSVIQTFNEFGVPVVLAGTQDKDKRFPSVMIDNEK
FT                   AAYDAVKYLISLGHKKIAMISGPMNDPIGGLQRIEGYKKALQEHGIKYDPDLVVEGEFK
FT                   TRKAYLAMLKLLEYKVDAVFAASDDMAAAAINAIFDSNLKVPEDIHVVGFDNTYISTIF
FT                   KPTITTIQQPAYDIGAVSMRLLTKLLAKEPIEEMHVILPHQLIVRESTGFGEEKNSR"
FT   gene            576528..577205
FT                   /locus_tag="Tmath_0545"
FT   CDS_pept        576528..577205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0545"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: tpd:Teth39_1796 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain protein; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60300"
FT                   /db_xref="GOA:D7ASS6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASS6"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH60300.1"
FT                   /translation="MERLLIIDDEEMFVKGLKLSLEEEGFEVDTAYDGEEGLDKVRLGN
FT                   YDLVILDIMLPKLDGFSVCREIRTFSNIPIIMLTARGEDVDRIVGIEIGADDYLAKPFN
FT                   TRELIARIRALLRRATNPYTKKKDEIKRGELYISIPERAVYKRGKRIELTNKEFEILVL
FT                   LASNPGKVYTKDKLLDLVWGFDFYGDTNTVTVHVRKLREKIEDDPANPQYIFTKWGAGY
FT                   YMK"
FT   gene            577216..578616
FT                   /locus_tag="Tmath_0546"
FT   CDS_pept        577216..578616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0546"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: tpd:Teth39_1795 integral membrane sensor
FT                   signal transduction histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase HAMP region
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60301"
FT                   /db_xref="GOA:D7ASS7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASS7"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH60301.1"
FT                   /translation="MSLRWKIFSLYLTILIISLALTGLYLYRYIEGSYLDNVRVNNLMQ
FT                   ANMVSNFVSRFVGTASSHLIEPTIMEYAKQINSRILFTNINGKVLVDSASSKEFEGKVI
FT                   KDYNDIKEALNGKGSTSIHDINGVGWAMYTAVPVIAKNNVVGAILISSSIDNIIDLLKS
FT                   IKYRMIYTFTGIGFLVSFLSLLVASYITNPLKRLTEAANILSQGKLDYKVEVKSNDEIG
FT                   KLANAFNKMSFSLMKIDEERKRFVSDASHELKTPLASVKALIESLINSKNQDITFYKEI
FT                   LKDVNGELDRMTRLVNDLLELARMDKIKAVKVRKSEISEIILDVIESLFPLAKTKDINL
FT                   KFEGKNNVFAEVDPDRFYRMVYNIVENGIKYTNEGGNVMVSLEEDENNIYLTVADNGIG
FT                   ISEENLPKIFERFTRVDTARSKKSGGFGLGLAIAKEIIDIHEGKVTVVSKVGEGTVFKI
FT                   SLPKKKRD"
FT   gene            578699..580138
FT                   /locus_tag="Tmath_0547"
FT   CDS_pept        578699..580138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0547"
FT                   /product="Spore germination protein-like protein"
FT                   /note="PFAM: Spore germination protein-like Gmad2,
FT                   bacteria; Lipoprotein LpqB, GerMN domain; KEGG:
FT                   tpd:Teth39_1794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60302"
FT                   /db_xref="InterPro:IPR018911"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASS8"
FT                   /inference="protein motif:PFAM:PF10648"
FT                   /protein_id="ADH60302.1"
FT                   /translation="MKRIALVLIVMFVLTLAGCFAKVNNSEKNSPINPKPIVQDVSKEI
FT                   SLYFLNDKMNGLILERRLISKDADVLKQVVAEMIKGPTDEYAKPVFPNGTKLISIELQE
FT                   GIAFVNFSKEFLQDSEDEGIDKLRVAALVNALTDIPGVESVQILVEGNKIDAVGKYKIG
FT                   LDPLKRMILVGDVYNNPDRIKKLQERADLGKETWRFDPIQLLRQEGGIIGIGSEDELTL
FT                   KNENNGVAYVEAIHNNKMYSITLIQPLGKGNNYIWVIDNVKAKFTEIPETNPAEGETFI
FT                   YGIVKAIDYENRIITIEREYQDSQDMKNQVGPDIKVLPDAIIHFQAKVGYDSQGGFKYA
FT                   EKDISFAEIKIGDELGIILTKDKEARAIIVSDRSNISYEPNIKVVSPVKNDVVTSPFKV
FT                   IGKARVFEGNVNIRLVDSNGNILSETVVQATAGAPSWGDFEAIISYKALKEPQNGILQV
FT                   FSLSPKDGSVQNLVSVPLKLK"
FT   sig_peptide     578699..578764
FT                   /locus_tag="Tmath_0547"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.899 at
FT                   residue 22"
FT   gene            complement(580141..580650)
FT                   /locus_tag="Tmath_0548"
FT   CDS_pept        complement(580141..580650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0548"
FT                   /product="sporulation protein YyaC"
FT                   /note="KEGG: tpd:Teth39_1793 hypothetical protein; TIGRFAM:
FT                   sporulation protein YyaC; PFAM: protein of unknown function
FT                   DUF1256"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60303"
FT                   /db_xref="InterPro:IPR009665"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:D7ASS9"
FT                   /inference="protein motif:TFAM:TIGR02841"
FT                   /protein_id="ADH60303.1"
FT                   /translation="MEELRLKYDDSNAIYFISNFLSTCLSPNSIFLCIGTDRFISDSLG
FT                   PIVGNLLIKSLPPTYHVYGTLKSPIHAMNLEENIKYIKKKHPNSKIIAIDASLGGKESI
FT                   GKISIKKAPLYPGKGVGKILPSVGDVSIVGIVDVYDSFLLNSVRLGFVFEIAEVIAKSI
FT                   QLALRC"
FT   gene            580743..581294
FT                   /locus_tag="Tmath_0549"
FT   CDS_pept        580743..581294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1792 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60304"
FT                   /db_xref="GOA:D7AST0"
FT                   /db_xref="UniProtKB/TrEMBL:D7AST0"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1792"
FT                   /protein_id="ADH60304.1"
FT                   /translation="MLKRLKFYLVVVIVIALFTTMFMFKTNFEEPIYFSQQSLWEKNKE
FT                   QLTKEENNSCKEEQPIDSKKDKEKKEMARLENQQKEEEAYDLENNKKTQKENSNDDRVI
FT                   VTLERILQVRNEMDPSQKARVINILLKLGKDDMSEIMKMAQKGLTQEDSDKIMEILKNK
FT                   LSSEEISYLVEIANEYFAKK"
FT   gene            complement(581339..583702)
FT                   /locus_tag="Tmath_0550"
FT   CDS_pept        complement(581339..583702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE0486 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60305"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:D7AST1"
FT                   /inference="similar to AA sequence:KEGG:TTE0486"
FT                   /protein_id="ADH60305.1"
FT                   /translation="MNIKKILSLGVSILLLLLTFPTQNVKANTYTILDRKEFTQNLSKG
FT                   VVHKNIVYFTTEGWINVNVLKVDLTDKYTDVSVIFNPSGIKNRMSVRDMANTYGAVASV
FT                   NGDFFDTTTGFVIGATVKDGRLITDPSNIGKLATFSIDANGIPSIEYWSKSMSVTLPNG
FT                   TKLPLAAINKISSTFEYLVMYTRDWFSTSPGANENVPQLVEVVVDGNDRVLEVRQGQPP
FT                   VEIPQDGYVLAGAGYVGQNLLTLKPGDVIQKDIRTNPSFENLKMAVSGGTIIVKDGKIA
FT                   PFTHEIKGYTARSAIGYTQDKKYLIIATVDGSSTRGMTQQEMANLMISLGAYDALNLDG
FT                   GGSTQMAVRPLGDTEAKLANHPPEGYERKVANGIGIFNTAPQGNLYALKLEASDTNVFK
FT                   GLHRTITVKGYDENYNPVTINPEEVLFSVNGITGVFSGNTFMPTSVGEGVITARVGNAI
FT                   GTIKITSLDKPVDIRFNPANIVIDKNKSIPITVTAKNIKGYRALIEPQDITWEVYNNVG
FT                   NIDKNGMFVSSNLDVTGALVANVLGEKAILPVKVGQGSEFDTSVLPKVTEFTLIDPYNK
FT                   EVIVKNTYDSFKFMVFGDTKYNTLLKLHISLKAADIANAGYPLAIFLGDVNEKVLKNLK
FT                   VKYITTGDKYTMYNYNNSTFIVLNNRSGSLLNPDKNQWSWFKEQLNNVKGDNLFIILPK
FT                   PVWGNDGFKDVKEATLFEETLKEFKKNTGKNVWIIYNGKSKFYTTLNDEIRYITTYGTD
FT                   VEGNTNDIYNDFGFISIMVNGKEVNYQFKNLINK"
FT   sig_peptide     complement(583619..583702)
FT                   /locus_tag="Tmath_0550"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.873) with cleavage site probability 0.821 at
FT                   residue 28"
FT   gene            584002..584077
FT                   /locus_tag="Tmath_R0015"
FT                   /note="tRNA-Pro1"
FT   tRNA            584002..584077
FT                   /locus_tag="Tmath_R0015"
FT                   /product="tRNA-Pro"
FT   gene            584082..584157
FT                   /locus_tag="Tmath_R0016"
FT                   /note="tRNA-Val1"
FT   tRNA            584082..584157
FT                   /locus_tag="Tmath_R0016"
FT                   /product="tRNA-Val"
FT   gene            584179..584264
FT                   /locus_tag="Tmath_R0017"
FT                   /note="tRNA-Tyr1"
FT   tRNA            584179..584264
FT                   /locus_tag="Tmath_R0017"
FT                   /product="tRNA-Tyr"
FT   gene            584403..584906
FT                   /locus_tag="Tmath_0551"
FT   CDS_pept        584403..584906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0551"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; Rubredoxin-type Fe(Cys)4
FT                   protein; KEGG: tpd:Teth39_1791 rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60306"
FT                   /db_xref="GOA:D7AST2"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D7AST2"
FT                   /inference="protein motif:PFAM:PF02915"
FT                   /protein_id="ADH60306.1"
FT                   /translation="MREMTKHNLGEAYAGESQAHMRYQIFADVAEKEGKPNIARLFRAI
FT                   SYAELVHATNHYKTLGEVGNTVENLEKAIEGETFEVEEMYPAYNAVAELQEEAGAKKSI
FT                   HYAIEAEKIHAKLYTEAKEAALKGEDIKISKVYICPVCGYTTVDVLPEKCPICGVPKEK
FT                   FVAF"
FT   gene            585164..585358
FT                   /locus_tag="Tmath_0552"
FT   CDS_pept        585164..585358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0552"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein; KEGG: tte:TTE2469
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60307"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D7AST3"
FT                   /inference="protein motif:PFAM:PF02597"
FT                   /protein_id="ADH60307.1"
FT                   /translation="MTIIFVGKNNQVTIKGAKSVEKLAKELNISLESHVFVKNGEIVTP
FT                   DEILQDEDTVEVISVISGG"
FT   gene            585378..586280
FT                   /locus_tag="Tmath_0553"
FT   CDS_pept        585378..586280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0553"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: csc:Csac_0104
FT                   PP-loop domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60308"
FT                   /db_xref="GOA:D7AST4"
FT                   /db_xref="InterPro:IPR000541"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:D7AST4"
FT                   /inference="protein motif:PFAM:PF01171"
FT                   /protein_id="ADH60308.1"
FT                   /translation="MKCVRCKKKAVIVLRRHNAAFCADCFLHYYKNQVLKNIRKNRMFE
FT                   KGEKVLVVVSGGKDSMALWDILVKEGYNVVAMYINLGIGEYSNRSQEVVEKFAKENNLP
FT                   LIVKDIKKEFGLDIYKLSKTLRRSPCSVCGSIKRYLFNKVAYDGGFSAVATGHNLDDEA
FT                   ATLFGNVLNWEEGYLARQGPVLPQTHPKLIKKVKPLYTLTERENMYYVLLNKIEFLHEE
FT                   CPHSVGARSILYKEVLNKLEEESPGTKQRFLSGFLEKGKKHFQDVRERLELKECKNCGQ
FT                   VTTTEECSFCRFVRICNQQ"
FT   gene            586503..587108
FT                   /locus_tag="Tmath_0554"
FT   CDS_pept        586503..587108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0554"
FT                   /product="thiamine biosynthesis protein ThiF"
FT                   /note="KEGG: ate:Athe_0371 thiamine biosynthesis protein
FT                   ThiF; TIGRFAM: thiamine biosynthesis protein ThiF; PFAM:
FT                   UBA/THIF-type NAD/FAD binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60309"
FT                   /db_xref="GOA:D7AST5"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012729"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D7AST5"
FT                   /inference="protein motif:TFAM:TIGR02354"
FT                   /protein_id="ADH60309.1"
FT                   /translation="MNLFDMMLKNYFDEKMLEKLSKVKILIIGCGGLGSNIAVMLVRSG
FT                   IKNLTIVDFDKVDILNLNRQNYFFYQVGEEKVSALKDILSKINPSVNVKAKNVKIDESN
FT                   LDELILQHDIIVEAVDNELTKTLIFRKAHEHSKKVVLASGVAGFGDCENIKIKRGKDFA
FT                   IIGDFVTSINDKKPFAPKVIAVAAMQADEVLRIVSELE"
FT   gene            587406..588593
FT                   /locus_tag="Tmath_0555"
FT   CDS_pept        587406..588593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0555"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="TIGRFAM: S-adenosylmethionine synthetase; KEGG:
FT                   tpd:Teth39_1790 S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60310"
FT                   /db_xref="GOA:D7AT63"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT63"
FT                   /inference="protein motif:TFAM:TIGR01034"
FT                   /protein_id="ADH60310.1"
FT                   /translation="MRKLFTSESVTEGHPDKICDQISDAILDEILKKDPYARVACETAV
FT                   TTGLVLVMGEITTECYVDIPKVVRKVIEDIGYTRAKYGFDADTCAVITSIDEQSPDIAL
FT                   GVDKALEAKRGELSNSEIEAIGAGDQGLMFGFACDETEELMPMPIMLAHKLARRLAEVR
FT                   KNGTLSYLRPDGKTQVTVEYEDDRPVRVDSVVVSAQHAPDIDYKTIERDIIEHVIKVII
FT                   PENMLDDKTKIFVNPTGRFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDPTKV
FT                   DRSASYAARYVAKNIVAAGLAKKCEVQLAYAIGVATPLEIGVDTFGTGKIPDEKISEIV
FT                   KQVFDLRPAAIIRDLDLRRPIYRQVAAYGHFGRHDLDLPWEKTDKVDILKKLAGI"
FT   gene            588797..591004
FT                   /locus_tag="Tmath_0556"
FT   CDS_pept        588797..591004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0556"
FT                   /product="helicase, RecD/TraA family"
FT                   /EC_number="3.1.11.5"
FT                   /note="TIGRFAM: helicase, RecD/TraA family; KEGG:
FT                   tex:Teth514_0446 RecD/TraA family helicase; SMART: AAA
FT                   ATPase; Helix-hairpin-helix DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60311"
FT                   /db_xref="GOA:D7AT64"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT64"
FT                   /inference="protein motif:TFAM:TIGR01448"
FT                   /protein_id="ADH60311.1"
FT                   /translation="MVDIEGVVEEIIFRNEQNGYTVLELSTQGLAVTAVGYMPFVNIGE
FT                   RIKIEGEWVEHPDYGEQIKVLNYQTLAPTTLEGIEKFLASGLIPGIGPVTARKIVKKFG
FT                   VDSLNIIETAPERLKEIKGLSDEKIKRICEAYEMQKGVKEVMVFLQGYGISTAMAIKIY
FT                   KEYGNNAIEIIKQNPYRLADDIFGIGFKTADKIAENLGVDPHSLYRISSGTRYVLMQYA
FT                   ANGHTYVPKELLKKEAASLLEVSEEEVEDSFVLLVQNEKIHIETFEDNTVGIYYIPYYI
FT                   AELHTAERLFNMTLMENKDLGLDVQKEIRNFEKETGILLAENQKLAVEEAVKNSVVVIT
FT                   GGPGTGKTTIINCIIRIFEKAGKKVALAAPTGRAAKRITEATGKEAKTIHRLLEYTYSE
FT                   EEGKGFNKNEKDPLKYDVIIIDEASMVDILLMNALLKALPIGAKLILVGDADQLPSVGA
FT                   GNVLRDIIDSGIVKVIRLKEIFRQQKQSLIVVNAHKINNGEYPTYNDKNSDFFFINANT
FT                   QEDILKTILELVINRLPKAYGFHPINDIQVLTPMRKGIIGVHNLNLELQKALNPHDKTK
FT                   PEKTMKEFVFRVGDKVMQIKNNYKIKWKKGDEEGEGVFNGDIGIIQSIDEELQELTVYF
FT                   DDEKFVTYDFSDLDELNLSYAITVHKSQGSEFPVVIIPITYGPPMLLTRNLLYTAVTRA
FT                   RKLVILVGQEKYLKFMIDNNRISKRYSGLLSRLKKTLLYVN"
FT   gene            591103..591792
FT                   /locus_tag="Tmath_0557"
FT   CDS_pept        591103..591792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0557"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG:
FT                   tpd:Teth39_1788 phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60312"
FT                   /db_xref="GOA:D7AT65"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT65"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ADH60312.1"
FT                   /translation="MIFLDLLFPPKTTCIICKAAIKTGYLCDKCKTALKFIEDDRCNIC
FT                   GKPIDYEGTCLDCLEHGHEFKQNISPFEYDGVVKDLIGQFKYFKKRELAPFFADYMADA
FT                   VKKMNWPIDVIVPVPLHKVRLDERGYNQSELLARELSYRLNIFMSKALRRVRNTTTQTA
FT                   LHKEERMENVKGAFKVTYKDTIIGRNVLLVDDVLTTGATLDECAKVLKENGAKDVYVAT
FT                   IATGKNI"
FT   gene            591831..592247
FT                   /locus_tag="Tmath_0558"
FT   CDS_pept        591831..592247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1787 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60313"
FT                   /db_xref="InterPro:IPR022258"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT66"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1787"
FT                   /protein_id="ADH60313.1"
FT                   /translation="MEIRNCKRCGRLYTYTGIDLCPVCYRQDEEDFMKVRDYLDTHPSA
FT                   TMLEISQNTQVSPKKIMDFLKEGRLILTSNNVNIGLKCEKCGKPILTGRFCDECKTKLA
FT                   KELMKGYSMQSENKEEEKQRGERLYLYENHKNKK"
FT   gene            592304..592579
FT                   /locus_tag="Tmath_0559"
FT   CDS_pept        592304..592579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0559"
FT                   /product="Anti-sigma-28 factor FlgM family protein"
FT                   /note="PFAM: Anti-sigma-28 factor FlgM family protein;
FT                   KEGG: tpd:Teth39_1786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60314"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT67"
FT                   /inference="protein motif:PFAM:PF04316"
FT                   /protein_id="ADH60314.1"
FT                   /translation="MKIYNNNIEKVMSIYRVDSVEKVSNKKTQMKDKIEISEEAIKLAQ
FT                   SSNEFEKIKNQKIENIKAMLNAGTYNVKAEDVADAILKGILLNKKI"
FT   gene            592596..593072
FT                   /locus_tag="Tmath_0560"
FT   CDS_pept        592596..593072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0560"
FT                   /product="FlgN family protein"
FT                   /note="PFAM: FlgN family protein; KEGG: tpd:Teth39_1785
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60315"
FT                   /db_xref="GOA:D7AT68"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT68"
FT                   /inference="protein motif:PFAM:PF05130"
FT                   /protein_id="ADH60315.1"
FT                   /translation="MANSQKLIEVLRGETEIYKVLLDLAIKKTDVIIAGKIKELDKIVQ
FT                   MEKQLVKKLMELEGQREDILEKIDLEGEVTINDLIETVFPEEAENLKAIKYNLADILKK
FT                   LNERNKLNAALLEQALEYVNYTIQTISQALENNDGIYGNNGNVKKYTSLIDKKA"
FT   gene            593083..594525
FT                   /locus_tag="Tmath_0561"
FT   CDS_pept        593083..594525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0561"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="KEGG: tpd:Teth39_1784 flagellar hook-associated
FT                   protein FlgK; TIGRFAM: flagellar hook-associated protein
FT                   FlgK; PFAM: protein of unknown function DUF1078 domain
FT                   protein; flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60316"
FT                   /db_xref="GOA:D7AT69"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT69"
FT                   /inference="protein motif:TFAM:TIGR02492"
FT                   /protein_id="ADH60316.1"
FT                   /translation="MSTFQGLEIAKTGLFVSQKALDVTGHNIANANTPGYTRQVVDMVS
FT                   IAPPTTFGMYDQWGKAIGEGVKIQDIRQIRDQFLDNQYRRENKFLGEWETKAEVLAAIE
FT                   NIFNEPSDSGINTVLNDFFNSLQELSENPESLTVRAEVRERAIALADTFNTVYQHLYDK
FT                   LNELNSTIQSRIAEINSYAERISKLNNEIYRFELTGQTANDLRDQRNLLVDQLSKLVNI
FT                   TTYEDSNGNFRIDIAGQALVAGSTAFTMSLNNTGEVVWDLTGTPVNPSSGVLKGLLDMR
FT                   DGDGTNGVKGVPYYINEWNKLAYSMAQAINEVHKSGYGLDGSTDIPLFTDFTTPYDSTV
FT                   QYAQLIKVSSHILADDGLQKIAAASSDATLPGDNTNALKLIALRDQAISELDGATFDDF
FT                   VGALISNLGVDAEQANLMLENQEFMIEQIDLNRQSISGVSLDEEMTNMLKYQKAYAASA
FT                   RIITAIDELLDTLINKMGIVGR"
FT   gene            594542..595435
FT                   /locus_tag="Tmath_0562"
FT   CDS_pept        594542..595435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0562"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="KEGG: tpd:Teth39_1783 flagellar hook-associated
FT                   protein FlgL; TIGRFAM: flagellar hook-associated protein 3;
FT                   PFAM: flagellin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60317"
FT                   /db_xref="GOA:D7AT70"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT70"
FT                   /inference="protein motif:TFAM:TIGR02550"
FT                   /protein_id="ADH60317.1"
FT                   /translation="MRVTDGMLITNFLNNYHNNLEKLQKNQNMLSTGKKISRPSDDPVA
FT                   VATSLRIRTDIARNDAYTKNADEVQSWLDMTDTALGQLGDLLQRTRELAVEGANGTLTQ
FT                   ADMQKIAEEIEQLKAQMIQVGNTQYNGRYIFAGFKTTTQPFSEDNNSYNGDNGLIEFEV
FT                   GAGGNKIAVNVPGDKVFDVDLTGTSQLLVMMDNLKSALDSGDHQAVSNLIADVDKQLEN
FT                   VLAVRAEVGAKSNRVDLIKNRLQDDNYNFTVLLSKNEDADLAQVITNLKMDENVYRASL
FT                   AAGARIMQPSLIDFLG"
FT   gene            595440..595997
FT                   /locus_tag="Tmath_0563"
FT   CDS_pept        595440..595997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tex:Teth514_0453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60318"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT71"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0453"
FT                   /protein_id="ADH60318.1"
FT                   /translation="MNIVINQTFGRIGIDTTPAQISIQSPKAGLEIKQIPAKMEIDKKL
FT                   PQVHIDQYQCFYEAGLKSIFDLVYDEAQRSKQIAFEAIGKIAEDGDILASIENHQDAIV
FT                   KLSEEALIQDIDFNVDLIPKSRPKIWFEGYLKINWELGGVKIRAIPHNPQISVTPAHVN
FT                   IYMRQYPSIKIQYVGNNLDRRI"
FT   gene            596093..596545
FT                   /locus_tag="Tmath_0564"
FT   CDS_pept        596093..596545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0564"
FT                   /product="protein of unknown function DUF180"
FT                   /note="PFAM: protein of unknown function DUF180; KEGG:
FT                   tpd:Teth39_1781 flagellar assembly protein FliW"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60319"
FT                   /db_xref="GOA:D7AT72"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT72"
FT                   /inference="protein motif:PFAM:PF02623"
FT                   /protein_id="ADH60319.1"
FT                   /translation="MQINTKNFGIVEYNPEDVIYFEEGIPGFEDLHNFLIITDNNENMP
FT                   FKWLQSIDNTDIAFVIIDPRVFKPNYAFEIDEELIQALQIEDENHLLIYVIVVIPDEIE
FT                   KMTANLKAPIIINAKNNKGKQVILDNDEYLIKHPILEELKNAYSNA"
FT   gene            596526..596753
FT                   /locus_tag="Tmath_0565"
FT   CDS_pept        596526..596753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0565"
FT                   /product="carbon storage regulator, CsrA"
FT                   /note="KEGG: tpd:Teth39_1780 carbon storage regulator,
FT                   CsrA; TIGRFAM: carbon storage regulator; PFAM: carbon
FT                   storage regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60320"
FT                   /db_xref="GOA:D7AT73"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT73"
FT                   /inference="protein motif:TFAM:TIGR00202"
FT                   /protein_id="ADH60320.1"
FT                   /translation="MLILTRKVGQAIIIGEDIEIKILEIGEGQIKVGITAPKNISVLRK
FT                   ELVEIKDENLKAATVDKEALSQLENFIKKH"
FT   gene            596883..598139
FT                   /locus_tag="Tmath_0566"
FT   CDS_pept        596883..598139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0566"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG:
FT                   tpd:Teth39_1779 flagellin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60321"
FT                   /db_xref="GOA:D7AT74"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT74"
FT                   /inference="protein motif:PFAM:PF00669"
FT                   /protein_id="ADH60321.1"
FT                   /translation="MIINHNLSALNAWRALSINTTNTQKSLEKLSSGYRINRASDDAAG
FT                   LAISEKMRAQIRGLNQAQRNAQDGISLIQTAEGALNEVHSILQRMRELAVQAANDTNTV
FT                   ADRAELQKEVDQLAQEITRIGENTEFNTQKLLNGTYKGTFHIGANENQNISLNIGDMRA
FT                   YNLGVVGDAKIEVTATVTDGGDLTTDIADGTYTVKYNDSTGKYELLNANGVAVATSTNG
FT                   KDWTATVGDDTLTFSEAVISGNVTIASGTATATGTVDNGGLQAGEYTYVAADSALKDSN
FT                   GNVVATTSDGITFVDASGATVLTFGAALTDGEEISIGGVDISDQAAANAAITTINNAIE
FT                   AVSAERSKLGAYQNRLEHTINNLSVASENLTAAESRIRDVDMAKEMMEFTKNNILNQAA
FT                   TAMLAQANQLPQTILQLLR"
FT   gene            598319..598744
FT                   /pseudo
FT                   /locus_tag="Tmath_0567"
FT   gene            598945..599922
FT                   /locus_tag="Tmath_0568"
FT   CDS_pept        598945..599922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0568"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tex:Teth514_0143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60322"
FT                   /db_xref="GOA:D7AT75"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT75"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH60322.1"
FT                   /translation="MAYFLISVSNKVNLDLCIKYALAGFTNSINGLWTFMEIQEGDFVS
FT                   FLYGARVFNLYKVERKEAIENAETIPPWLPVTFKMSGKTYYFPFRLYLKPLRQFVEPMV
FT                   RPEFAYVAENLLLRGGYRKTHFQADQTTLQSVSQMGEIYNRPIETLTISNYKTFTPSIV
FT                   WDRKLESSPKTFYFQEFVLQSLIRQHLSVSTNLQIFLASAGLNTFQAEDFEVLGEKALS
FT                   EGYIDILIKDRMPVGYSRKIILEIKTGSAKSKDIEQLENYIREIGKECVAGVLVAQKFS
FT                   KKLKQECENRGIKPFIYTFGQIEKSRKYTLEDLKRKLQLLKIEL"
FT   gene            complement(600299..602140)
FT                   /locus_tag="Tmath_0569"
FT   CDS_pept        complement(600299..602140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0569"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); KEGG: tpd:Teth39_1774 asparagine
FT                   synthase (glutamine-hydrolyzing); PFAM: asparagine
FT                   synthase; glutamine amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60323"
FT                   /db_xref="GOA:D7AT76"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT76"
FT                   /inference="protein motif:TFAM:TIGR01536"
FT                   /protein_id="ADH60323.1"
FT                   /translation="MCGITGWVNFNMDLSLQNEVIEKMTNTLKERGPDGSGIWLSKHCA
FT                   LGHRRLIVIDPQGGSQPMIKKYGEKNFVIIHNGELYNMDELKNELISLGYIFKTRSDTE
FT                   IILTSYIEWGPTCVKKFNGIFAFAIWDEVQNRLFIARDHFGIKPLFYTIKNGSLIFGSE
FT                   IKAILAHPNVKPEIDSQGLAEIFVMGPSRTPGCGVFKDIKELKAGHYLIFTKNGVNINK
FT                   YWSLQSIPHEDSLEKTAEKIRYLLRDSSVRQLVSDVPLCSLLSGGLDSTAVSAFANEEL
FT                   KQKGQKLITYSVDYVGNDKYFTPNKFQPNSDADWVKFVAKKLDTNHNYVFIDNEELAYA
FT                   LKPALYARDLPGMADIDSSLYLFLKEVKKGATVALSGEGADEVFGGYPWFRNKEAIEAN
FT                   TFPWIRMINERMKLLLPEVVKYIRPIEYLNDRYNEALNEVPKLTGEDPYNARMREMFYL
FT                   NLTRFMPMLLDRMDRMSMAVGFEARVPYLDYRLVEYVWNIPWEMKNLNGREKGILRYAL
FT                   KGYIPNEVIERKKSPYPKTYNPVFRNIVKKWLKQIVDDSTSPLLQLVDKKAIITLIETD
FT                   AKAYDPAWFSQLMGSAQLFAYLVQINMWLKDYKISIV"
FT   gene            602281..602466
FT                   /locus_tag="Tmath_0570"
FT   CDS_pept        602281..602466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0570"
FT                   /product="Sporulation stage 0, Spo0E-like regulatory
FT                   phosphatase"
FT                   /note="PFAM: Sporulation stage 0, Spo0E-like regulatory
FT                   phosphatase; KEGG: tpd:Teth39_1773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60324"
FT                   /db_xref="GOA:D7AT77"
FT                   /db_xref="InterPro:IPR018540"
FT                   /db_xref="InterPro:IPR037208"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT77"
FT                   /inference="protein motif:PFAM:PF09388"
FT                   /protein_id="ADH60324.1"
FT                   /translation="MGKVIKEHYYEENDIAERIKFLKKKLNESNLELPKSLELSRELDE
FT                   LIVMYMKKEKQVKQVK"
FT   gene            602605..602946
FT                   /locus_tag="Tmath_0571"
FT   CDS_pept        602605..602946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0571"
FT                   /product="flagellar protein FlaG protein"
FT                   /note="PFAM: flagellar protein FlaG protein; KEGG:
FT                   tpd:Teth39_1772 flagellar protein FlaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60325"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="InterPro:IPR035924"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT78"
FT                   /inference="protein motif:PFAM:PF03646"
FT                   /protein_id="ADH60325.1"
FT                   /translation="MLEGINTARTEHVNSQFRKDSGLLEEIKAVKDILSKPVDDDKLNS
FT                   ALNKENRKISINDHTYFEFSVHKPTNTIVVKIVDSYTNEVIDEIPPEKILDLVAGLWEI
FT                   AGLFVDRKI"
FT   gene            602960..604483
FT                   /locus_tag="Tmath_0572"
FT   CDS_pept        602960..604483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0572"
FT                   /product="flagellar hook-associated 2 domain protein"
FT                   /note="PFAM: flagellar hook-associated 2 domain protein;
FT                   flagellin hook IN repeat protein; flagellar hook-associated
FT                   protein 2 domain protein; KEGG: tex:Teth514_0464 flagellar
FT                   hook-associated 2 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60326"
FT                   /db_xref="GOA:D7AT79"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT79"
FT                   /inference="protein motif:PFAM:PF07195"
FT                   /protein_id="ADH60326.1"
FT                   /translation="MDSISMNSYNVSNLLRISGLATGLDTDSIVQQLMEAASIPLDRLE
FT                   QQKQWYQWQQEDLRDINTQLLSLRDNSVFQLKLQGTFLAKTVASNSAVATATATSSAVN
FT                   GVYTLSVTQLAQAAYRTSGQLSITDPAAALNQTGTIVLNGISISITSTDSLNTIISKIN
FT                   SSGAGVTATYDTNLKTIFLVSTTTGSAAKIDFSGSDSGGYNILTNTMKISGLTLDTTTN
FT                   TVTDGAIAYGKDAQFTINNGSTVYSESTNSFTLLGLNITLTGTGTTTLSVSTDVDKIYN
FT                   AIKSFVDSYNDIITKINAKLTEKRYYDYPPLTSEQKQAMKDSDIELWEEKARSGNLNND
FT                   ETLMRVYYSMRNVVSSVVSGVGSLSSIGITTSQWYEGGKLYIDETKLRDAIANNPDTVM
FT                   KIFTGVYETDSNGNTTLVTPGIAQKLYDTLDQGIDAITRKAGSTTQLYDTSFIGNRIRE
FT                   IDERIAQMQDYLNDLEERYYAQFTLLEMYVGQMNSQSMWLSQQIEVMMG"
FT   gene            604497..604883
FT                   /locus_tag="Tmath_0573"
FT   CDS_pept        604497..604883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0573"
FT                   /product="flagellar protein FliS"
FT                   /note="KEGG: tex:Teth514_0465 flagellar protein FliS;
FT                   TIGRFAM: flagellar protein FliS; PFAM: flagellar protein
FT                   FliS"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60327"
FT                   /db_xref="GOA:D7AT80"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT80"
FT                   /inference="protein motif:TFAM:TIGR00208"
FT                   /protein_id="ADH60327.1"
FT                   /translation="MVNPYQQYKENAILTASPEELVLMLYNGIIRFIEEAKGAIEKKDY
FT                   MAANNNIQKAQDIITELMLTLDMNYDISKNLYSLYDYMLRRLIDANVKKDVAILEEVKG
FT                   FAVELRDTWSIALNKVREKVYAKG"
FT   gene            604870..605358
FT                   /locus_tag="Tmath_0574"
FT   CDS_pept        604870..605358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60328"
FT                   /db_xref="GOA:D7AT81"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT81"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1769"
FT                   /protein_id="ADH60328.1"
FT                   /translation="MRKVDDMHNNIEKLTRIVQDKIERLKEFYEVTEKIGISITSNNLE
FT                   ELKNLLATKQKIIEEIDKLDADFIPLYNAFKKENKVESIFALEGKITREISKLKALFIE
FT                   AKNLLEKIKEKDDKNLQNITAVFEKTENKLEELSKSKEGYIEYLKYYTPDSYFLDKKR"
FT   gene            complement(605384..607477)
FT                   /locus_tag="Tmath_0575"
FT   CDS_pept        complement(605384..607477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0575"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="KEGG: tpd:Teth39_1768 methyl-accepting chemotaxis
FT                   sensory transducer with cache sensor; PFAM: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; Cache domain protein; SMART: chemotaxis sensory
FT                   transducer; histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60329"
FT                   /db_xref="GOA:D7AT82"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT82"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADH60329.1"
FT                   /translation="MKKQKDYYKKEKFKLSLKIPKANVRLKFFNSASGIFAKLMTFIAF
FT                   VIIVPLAFTGYMSTSKSVEILQDTINISNTDTLGLINNYVDLFKNDIETQLIILSTNPQ
FT                   ILNFGQRDFETDKKNLQDLFTTILKAKSTKISLIYLATPDKKIIQSPDLPLDPNYDPTK
FT                   QEWYKKAIENPDAIIWTGPYSNDGTNGGVVTVSKAVRSSLTNVASDIVGVLAFDINLDS
FT                   LSNMISSIKVGKTGNVYLISNEGIIIADKDKKNLFSYITKYDYGKKILSMQEGSFEYND
FT                   NGTNKFASVKTLNNFGWKAAITMDSSELAEKTSQIKDNTIIFSLISLLIGILIAYFFSK
FT                   NITSKIGKVMTAMNKAANGDMTQKVEVKSNDEIGKLASSFNLMIDGIKRLVADVLSAAN
FT                   SVYEYSKKVSFASNKAEQITNEVVAAMEEIAKGAQEQAKEAEKGATITNLLSQNLDVTM
FT                   ENSKNINKETTSVIKAANTGLENIKELSEKTKVTEQMHSKVKESTSYLKKKSHEIGKIV
FT                   ETITTIADQTNLLSLNAAIEAARAGEAGRGFAVVADEVRKLANQSSEAAKNIEAIIKEI
FT                   QQNIDDTYKVVEEASASIEQQNESLAKTVHTFYGIQQAVNRIVEELNKLNESMLKISQS
FT                   RSEMLDSIQNIAAVTEEAAASTEEISSATEEQKTAIEEISKSAQDLSNIANTLMSIISK
FT                   FKI"
FT   gene            607687..607884
FT                   /locus_tag="Tmath_0576"
FT   CDS_pept        607687..607884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0576"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60330"
FT                   /db_xref="InterPro:IPR025306"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT83"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1767"
FT                   /protein_id="ADH60330.1"
FT                   /translation="MYQDKMIVCKDCGKEFVWTAGEQQFYAEKGFQNEPVRCKACRDAK
FT                   KRRNHQYNARKNKRAFGIER"
FT   gene            608220..609002
FT                   /locus_tag="Tmath_0577"
FT   CDS_pept        608220..609002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0577"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: tex:Teth514_0468 extracellular solute-binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   3; SMART: extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60331"
FT                   /db_xref="GOA:D7AT84"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT84"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADH60331.1"
FT                   /translation="MNKKSFTALLIITLVLSLFLAGCGSKPTNTLEKIKQKGVIVMGTS
FT                   ADFPPFEFHKVEGNKDTIVGFDIDIANAIAKKLGVKLEIKDMDFKGLIPALQSGRIDMI
FT                   VAGMTPTPDRAENVDFSDLYYNSQQVVVVKNDSPILKFDDLKGKTVAVQIGTTSEEAAK
FT                   KIPDVNLKQLNRVGDAFMDLKNGRCDAIVLEDTVANAYLKEYKDMKILSMKEINTEEGG
FT                   MAVAVAKGNKELVNIINEVIKDLKASGEYDKLVDKWFK"
FT   sig_peptide     608220..608288
FT                   /locus_tag="Tmath_0577"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.432 at
FT                   residue 23"
FT   gene            609070..609732
FT                   /locus_tag="Tmath_0578"
FT   CDS_pept        609070..609732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0578"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: tpd:Teth39_1764 polar amino acid ABC
FT                   transporter, inner membrane subunit; TIGRFAM: polar amino
FT                   acid ABC transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60332"
FT                   /db_xref="GOA:D7AT85"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT85"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADH60332.1"
FT                   /translation="MSVNFLSMLKYSHLFVSGLLMTLKLTFLAVTIGVILGLIVALIKM
FT                   SSIKPISFVGASYVEIIRGTPLLVQLLLIYNGLMQFGIDIPAFIAGVSALAINSAAYVA
FT                   EIIRAGIQAVDPGQNEAARSLGMTHTMAMRYVIIPQAIKNILPALGNEFIVMLKESAIV
FT                   SVIGFADLTRQADIIQSVTYKYFEPYIIIAAIYFIMTFIFSRLLGIFERRLRAGDTR"
FT   gene            609719..610441
FT                   /locus_tag="Tmath_0579"
FT   CDS_pept        609719..610441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0579"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_1763 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60333"
FT                   /db_xref="GOA:D7AT86"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT86"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH60333.1"
FT                   /translation="MIRVNEVYKTFGNLEVLKGVSLSVNKGEVVVIIGPSGSGKSTLLR
FT                   CINLLEVPTRGEIYIEGIKINDRKVNINKIRQKVGMVFQHFNLFPHLTALENVTLAPIK
FT                   VKRMDKKTAENIALGLLEKVGLLDKKDEYPIKLSGGQKQRLAIARALAMQPDIMLFDEP
FT                   TSALDPEMVKEVLNVMKGLANEGMTMVVVTHEMGFAREVGDRVIFMDDGMVIEEGTPED
FT                   IFYNTKNERTKEFISKIL"
FT   gene            610547..611092
FT                   /locus_tag="Tmath_0580"
FT   CDS_pept        610547..611092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0580"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="KEGG: tex:Teth514_0471 sigma 54 modulation
FT                   protein/ribosomal protein S30EA; TIGRFAM: ribosomal subunit
FT                   interface protein; PFAM: sigma 54 modulation
FT                   protein/ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60334"
FT                   /db_xref="GOA:D7AT87"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT87"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ADH60334.1"
FT                   /translation="MNITVSGKNGMAVTDGLRDAVVKKVSKLSKYFTEDTEVRTVLSVQ
FT                   KNHHIAEITIPFKGIIFRAEEVSDDMYGSIDRVVDKIERQILKHKTKLKNRFGANESIR
FT                   FEIPPVYQEAKEEEEETSFEIVKTKRFPIKPMSAEEAILQMNLLGHNFFVFTNADTDTI
FT                   NVVYKRKDGKYGLIEPIE"
FT   gene            611221..611862
FT                   /locus_tag="Tmath_0581"
FT   CDS_pept        611221..611862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1761 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60335"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT88"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1761"
FT                   /protein_id="ADH60335.1"
FT                   /translation="MGEITKDMVTSMEGYINKIQGVLSSRVVAENGEITEIHVLADSTR
FT                   NAKQIARDVQSVIMAQFEIDINYKIISVAQIDTGEKLQGEHRLVFSSYSFINNGLTSEA
FT                   RVILTRGDEVFEGYAEGPNTASNKYKIIANATLDSISKLIPKNHLFLLEDIDIFNIAKS
FT                   RIIVIGVTHVTNNQEELLTGSCLIKKDEGEAVVKATLDAVNRRVMSITSL"
FT   gene            612084..613358
FT                   /locus_tag="Tmath_0582"
FT   CDS_pept        612084..613358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0582"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   tex:Teth514_0473 metal dependent phosphohydrolase; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60336"
FT                   /db_xref="GOA:D7AT89"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT89"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ADH60336.1"
FT                   /translation="MLNKRVKIYISIVIILGLFFIVDSMLNVPTNSIVDIILFGFFAVL
FT                   AESMPIYIAKDFSVSVAFAVDLMALLIFGPYQGSLIAAIGMAGRVGRYSDGKTWHVFNM
FT                   PFYKTLFNVSQLALSVGIAGLIYEYTGGTPGYSIYPHHLLSAILAAIVYYLLNTSIVAM
FT                   LLSFLMNKSFIYILIKDFKWAIPNFFFLAFLGIIMSEAFVRIGYVSLILLFIPLFMIRY
FT                   MFKLYMDSKQSYYDTINVLVKALDAKDKYTAGHSKNVEKIAALLCREFGFSESHTEMVK
FT                   IAALLHDIGKIGVKEEVLNKPGKLSDEELSIIREHPQKGYEILKEVPALKEVSLWVKYH
FT                   HEWYNGNGYPDGIKGEEIPLEAQILSLADVFDALVSDRPYRKAFSQEGAYEIIVGNEGT
FT                   QFSPKIIKAFKKAFEKHREEFKHDI"
FT   gene            613348..613914
FT                   /locus_tag="Tmath_0583"
FT   CDS_pept        613348..613914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0583"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tex:Teth514_0474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60337"
FT                   /db_xref="GOA:D7AT90"
FT                   /db_xref="InterPro:IPR035168"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT90"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0474"
FT                   /protein_id="ADH60337.1"
FT                   /translation="MIFDSLGVSLIYGTLKKGKISGIADIEIKKPSLFIAAFVLEFGML
FT                   NFSNKFYGVIKYQSYIHFFVYLLLFIGLWYNRNNKYFRIISVGVFLNFIVIFANGGRMP
FT                   VSIDALKAAGLNNLILQLQANRIATHQVLKSSTRLKFLADVLVLPKPYPLPKAFSIGDF
FT                   IMATGTFLLVTNAMLKKVKSHDGTR"
FT   gene            613898..614410
FT                   /locus_tag="Tmath_0584"
FT   CDS_pept        613898..614410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0584"
FT                   /product="3H domain protein"
FT                   /note="PFAM: 3H domain protein; Helix-turn-helix type 11
FT                   domain protein; KEGG: tpd:Teth39_1758 3H domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60338"
FT                   /db_xref="GOA:D7AT91"
FT                   /db_xref="InterPro:IPR004173"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026043"
FT                   /db_xref="InterPro:IPR035922"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT91"
FT                   /inference="protein motif:PFAM:PF02829"
FT                   /protein_id="ADH60338.1"
FT                   /translation="MTAQDRRDKIVEILKNAKEPISGSDLAKRFGVTRQVIVQDIAILR
FT                   AKGIKILSTPQGYIIDTVKENTVKRVFAVKHGYDRTEEELNLIVDNGGKVLDVIVEHPF
FT                   YGEIKGLLMLSSRYDVSKFMEFVKEGKATLLSSLTDGVHLHTVEGESEEVLDRIQKALE
FT                   QKGFLIE"
FT   gene            614521..615021
FT                   /locus_tag="Tmath_0585"
FT   CDS_pept        614521..615021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0585"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tex:Teth514_0476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60339"
FT                   /db_xref="GOA:D7AT92"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT92"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0476"
FT                   /protein_id="ADH60339.1"
FT                   /translation="MKTREITIGGLLAALALVIPLAFGGVLGIVIPPFSATLASHVPVM
FT                   LAILISPATAVFVGVVSAIGFLIKLGPVIAARAAVHAVFGYVGAKMMQRRYSFPVALAV
FT                   TLPIHAVLEAIVVMPFGFDFYKAFVVVGVGTILHHTIDSVIALVVFYALNPILKLKIIG
FT                   TKN"
FT   sig_peptide     614521..614595
FT                   /locus_tag="Tmath_0585"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.939 at
FT                   residue 25"
FT   gene            615467..618160
FT                   /locus_tag="Tmath_0586"
FT   CDS_pept        615467..618160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0586"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="KEGG: tpd:Teth39_1755 preprotein translocase subunit
FT                   SecA; TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   SecA DEAD domain protein; SEC-C motif domain protein; SecA
FT                   preprotein cross-linking region; SecA Wing and Scaffold"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60340"
FT                   /db_xref="GOA:D7AT93"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT93"
FT                   /inference="protein motif:TFAM:TIGR00963"
FT                   /protein_id="ADH60340.1"
FT                   /translation="MLGLVEKIFGSYSEREVRRLEPIADKVLSYEDQMARLTDAELRAK
FT                   TDEFKNRLKNGETLDDILPEAFAVVREAAWRTLKMKHFRVQVIGGIVLHQGRIAEMKTG
FT                   EGKTLVATLPAYLNALEGKGVHIVTVNDYLAKRDRDWMGKIYEFLGLSVGVILHDMGPE
FT                   ERKKAYAADITYGTNNEFGFDYLRDNMVIYKEDMVQRGLNYAIVDEVDSILIDEARTPL
FT                   IISGVGEKSTDMYKLADRFVRTLKKDEDYVVDEKAKTVSLTEKGVVKAEKFFGIKNLAD
FT                   IENMEISHHINQALKAHAIMKRDIDYVVKDGQVIIVDEFTGRLMFGRRYSEGLHQAIEA
FT                   KEGVKVERESKTLATITFQNYFRMYKKLAGMTGTAQTEEQEFRAIYGLDVVVIPTNKPM
FT                   IRIDHPDVIYKTEEAKFRAVVEDIVEHHKKGQPVLVGTISIEKSERLSAMLKKRGIPHQ
FT                   VLNAKYHEKEAEIIAQAGRKGAVTIATNMAGRGTDILLGGNPEFIAKKKMLEEGYSKEI
FT                   INEAAGYGPISGEEVKKARERYFELLEEAKKETEREHDEVVKLGGLYIIGTERHEARRI
FT                   DNQLRGRAGRQGDPGETRFYISLEDDLMRLFGSERVKNMMDTLGIDDDQPIEHKILTKQ
FT                   IEQAQKKVEGINFDTRKHVLQYDDVMNKQREIIYAQRRKVLEGENLKESIFDMIRSIIE
FT                   RNVEVYTAGSKYPEEWDIKGLLDYLYDMFLEKDSVVIDVDIDRLDKEVLTNIIYEEAVK
FT                   QYEKKEAEIGPEQMRELERIVLLRVVDTKWMDHIDEMDQLRQGIGLRAYGQVDPLIEYK
FT                   KIAFDMFEDLVQSIQEETVKFLYHIQIDKNNMIQREQVAKPVFTNAGIQEKKQPVVKGK
FT                   KIGRNDPCPCGSGKKYKYCCGANLKY"
FT   gene            618176..619283
FT                   /locus_tag="Tmath_0587"
FT   CDS_pept        join(618176..618244,618246..619283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Tmath_0587"
FT                   /product="hypothetical protein"
FT                   /note="manually curated"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60341"
FT                   /db_xref="GOA:D7AT94"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT94"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH60341.1"
FT                   /translation="MLQDYKAEVSKMFEEIKEMGVSLDIEGVKREIEEIDKEMADPDFW
FT                   NDIKKSQELAKRQKELKELLEEYNSLVRKWEDLTTLIELGLEEGDESITEEVDKEYKEL
FT                   KKKLEDLKIKTLLNGPYDKNNAILSIHAGSGGTEAQDWAEMLLRMYTRWANDKGFDVET
FT                   LDYLQGEEAGIKSVTLMIKGPFAYGYLKSEAGVHRLVRISPFDAAGRRHTSFALVEVLP
FT                   ELEDDIEVEIRPEDLRIDTYRASGAGGQYVNKTESAVRITHLPTGIVVSCQNERSQIQN
FT                   RETAMKMLKAKLLDLMMKEKKEKIEDLKGEHKEAAWGNQIRSYVFQPYTLVKDHRTNFE
FT                   VGNVQAVMDGEIDDFINAYLKQKSQGIS"
FT   gene            619336..621474
FT                   /locus_tag="Tmath_0588"
FT   CDS_pept        619336..621474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0588"
FT                   /product="Tex-like protein"
FT                   /note="KEGG: tpd:Teth39_1753 RNA-binding S1
FT                   domain-containing protein; PFAM: Tex-like protein-like; RNA
FT                   binding S1 domain protein; SMART: Resolvase RNase H domain
FT                   protein fold"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60342"
FT                   /db_xref="GOA:D7AT95"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT95"
FT                   /inference="protein motif:PFAM:PF09371"
FT                   /protein_id="ADH60342.1"
FT                   /translation="MDRIKEALKREFGLKDFQVENTIKLIDEGNTIPFIARYRKEATGS
FT                   LSDEVLRNFYERLTYLRNLEEKKQDTIRLIDEQGKLTEEIKEKIENATTLQEVEDIYRP
FT                   FRQKRRTRATIAKEKGLEPLAKIISSNEVMNGDVKEYAKPYLNENVLTVEEAYQGAMDI
FT                   IAEDISDDAEIRKYIRNFTWNNGIIVTQALKKEKSPYEMYYDYKEAVKTIPPHRILAIN
FT                   RAEREKYISVKIEVDSERIINKLIETKVNKASIFAEYYKRAIEDSYKRLIAPSIEREIR
FT                   NALTEKAEEKAIIVFKENLKSLLLQPPIKGHVVMGFDPAYRTGCKIAIVDETGKLLDTA
FT                   TIYPTPPQNDIDNSKKVLKELIEKYNVTLIALGNGTASRESEMFIADLIKELSREVKYV
FT                   IVNEAGASVYSASPIATEEFPDINVSLRGAISLARRLQDPLAELVKIDPKSIGVGQYQH
FT                   DVDQKKLGEALNGVVEDCVNSVGVDLNTASVSLLKYVSGINTAIAKNIVEYRNQIGKFT
FT                   SREQLKNVKRLGEATFTQCAGFLRILEGDNIFDSTAVHPERYETLEKLLKKFGYKKETL
FT                   DRKKLKDFANSLEEYGLERISEEYDIGLPTLYDIVSELKKPGRDPREDLPKPILRSDVM
FT                   TINELKPGMELMGTVRNVTDFGCFVDIGVHTDGLVHISEMSQSYIKHPLDVVAVGDIVK
FT                   VKVLNVDLERNRISLSMK"
FT   gene            621564..622256
FT                   /locus_tag="Tmath_0589"
FT   CDS_pept        621564..622256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0589"
FT                   /product="copper amine oxidase domain protein"
FT                   /note="PFAM: copper amine oxidase domain protein; KEGG:
FT                   tte:TTE0524 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60343"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT96"
FT                   /inference="protein motif:PFAM:PF07833"
FT                   /protein_id="ADH60343.1"
FT                   /translation="MKKILAFVLTGLLIFSSVLTVYAKPDKVKHQVNVKAQTTLKAKGN
FT                   TKNKVEVQTQTKLEASVKAKEFKGKVSVNKKEIKFDIPPVIKEGRTLIPVRAIMNGFGA
FT                   KVDWDEETKTVTITKGDITIQLVLGESKVLINGKEDTLEVPAMEISNRTFVPLRFILEI
FT                   FGAKVNYNEETGDIEIEEEEDIEIEEGDQTEIENNEESTVSQDVYANTDETVSNSVYGT
FT                   NEEVEEND"
FT   sig_peptide     621564..621635
FT                   /locus_tag="Tmath_0589"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 24"
FT   gene            622407..622682
FT                   /locus_tag="Tmath_0590"
FT   CDS_pept        622407..622682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0590"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE0525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60344"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT97"
FT                   /inference="similar to AA sequence:KEGG:TTE0525"
FT                   /protein_id="ADH60344.1"
FT                   /translation="MPKAKWVGGNKDKVGFIFGIFGPGSQNVVKRSIRKIIIYGIGTGL
FT                   MLGAGKKYGKRVLPFVCGKGREYLNYAGRAVSQLYDYFVKIKKRNG"
FT   gene            622702..623382
FT                   /locus_tag="Tmath_0591"
FT   CDS_pept        622702..623382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0591"
FT                   /product="SNARE associated Golgi protein-associated
FT                   protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   tpd:Teth39_1751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60345"
FT                   /db_xref="GOA:D7AT98"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT98"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADH60345.1"
FT                   /translation="MKIHKTYVINLFLIVIFAITLVVIMATFGRDFVLLIDNPYEFRQW
FT                   IHSFDKFSVIVFIGVQILQVVIFAIPGEIVQIAGGYIFGTLLGTFYSVIGITIGSLICF
FT                   LIARGLGYKFVKSIVSEENLKKFDYIINNPKGETVLFLLFFIPGIPKDALSYIAGITPV
FT                   KFYNFFIITLFARLPGIFFSTYIGANLGSKNYFMAALVAAIAVILFLIGLYKKDFIMEK
FT                   LNKL"
FT   gene            623512..624663
FT                   /locus_tag="Tmath_0592"
FT   CDS_pept        623512..624663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0592"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: tex:Teth514_0482
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60346"
FT                   /db_xref="GOA:D7AT99"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7AT99"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ADH60346.1"
FT                   /translation="MYLLKGGKVLTMAGKIYEKGDVLIDNGKIADVGENLIAPLDAEVI
FT                   NVQGLTVMPGLIDAHCHLGMWENAVGFEGADGNEATDPVTPQLRAIDGINPMDKYFEEA
FT                   YQAGVTTVATGPGSANVIGGQFAVIKTYGKRIDDMIVKEPAAVKVAFGENPKSVYHEQH
FT                   KMPSTRMAVAALLRQELIKAQEYMEKMEQAEEDKKPERDLGLEALVKVLKREIPIKAHA
FT                   HRADDIFTALRIAKEFNVDITIDHCTDGHLIVDELVKENVKVIVGPSLSERSKIELVNL
FT                   SFKTAGILSKAGLTVAIMTDHPVIPINYLPLCAALAVKEGMDEMEALKAITINPAKILG
FT                   VDDRVGSIEKGKDADIVVFDGNPLEVKTRTKYVFINGKLVHKV"
FT   gene            625086..626231
FT                   /locus_tag="Tmath_0593"
FT   CDS_pept        625086..626231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0593"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bce:BC2283 quinolone resistence NorA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60347"
FT                   /db_xref="GOA:D7ATA0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7ATA0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADH60347.1"
FT                   /translation="MERLWTRSFIFMILGTFFLFTAFYMLYPTLPLFIKHIGGNETHVG
FT                   LSMGIFMLSAVIFRPVIGGLLDRFGRRSFIILGLFLFTLAMYMYNWVNGITALIWLRML
FT                   HGVSWAISTTAIGTVIADIVPKARYGEGMGWYGTAMTLAMAISPMLGVWIVQDLSYYTL
FT                   FLFAVAFSITALLLSFGVKMPFQPQSDAKKIEFFEKSVLSIAVSVLLLFISYASITTFV
FT                   PLFADFLKVNSGLFFLVYSATLFLSRPIGGKLSDQYGEMFVVVPALLISILALIVLSVS
FT                   TGLFGMLVSATLYGIGFGSAQPVLQATILRLVPPDRRGVASASFSTATDLGIGLGSIIF
FT                   GWVAKYASYQILFTISAVSVIFSLLVFVFFVKHLLKSKGLR"
FT   gene            626488..626610
FT                   /pseudo
FT                   /locus_tag="Tmath_0594"
FT   gene            626722..627663
FT                   /locus_tag="Tmath_0595"
FT   CDS_pept        626722..627663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0595"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; KEGG:
FT                   tex:Teth514_0484 ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60348"
FT                   /db_xref="GOA:D7ATA1"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D7ATA1"
FT                   /inference="protein motif:TFAM:TIGR00658"
FT                   /protein_id="ADH60348.1"
FT                   /translation="MAFNLKGRSLLTLKDYTPQEIRYILDIAKQVKAERKAGVVHQRFL
FT                   GKTIALIFEKRSTRTRCAFETAFGEEGGHPVFLSTDDIQLGAKESIEDTARVLGRMFDA
FT                   IEFRGFKQETVEILAKYAGVPVYNGLTDEYHPTQVLADLMTIEEEFGSLTGRKLVFVGD
FT                   GRNNMANTLAVGCAKMGMHYVINSPKELWPSQEFIDEIRQMAAENGGTFELTSVPGEGL
FT                   EGADAIYTDVWASMGEEAKAEEREALLRPFQVNEEMMKKTGREDTIFLHCLPAVKGQEV
FT                   TFDVIEGKQSRVWDQAENRKHTIKAVMIATLL"
FT   gene            627688..628629
FT                   /locus_tag="Tmath_0596"
FT   CDS_pept        627688..628629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0596"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="TIGRFAM: carbamate kinase; KEGG: tex:Teth514_0485
FT                   carbamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60349"
FT                   /db_xref="GOA:D7ATA2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D7ATA2"
FT                   /inference="protein motif:TFAM:TIGR00746"
FT                   /protein_id="ADH60349.1"
FT                   /translation="MKDKIVVALGGNALQDVNTPPTAEAQMEVVKRTAGYLADIIEKGY
FT                   SVVITHGNGPQVGNIVIQNETASKIVPAMPFDVCGAESQGMIGYMIQQALREVLKERNI
FT                   KKEVATIITQVVVDKNDPAFKKPTKPIGPFYTKEEAEVLIKEKGYEMVEDSGRGYRRVV
FT                   PSPDPKEIVELNTIKLLEKNGVIVITVGGGGIPVIRENGNLRGVAAVIDKDLASEKLAE
FT                   DIDADVLLILTAVEKVAINYNKPNQKFLDKMTVEEAIKYMEEGHFAPGSMFPKVKAAVR
FT                   FAKSKVGRRAIITSLDKALEAIEGEAGTVITL"
FT   misc_binding    628757..628875
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam
FT                   (RF00050), score 120.72"
FT   gene            628967..629551
FT                   /locus_tag="Tmath_0597"
FT   CDS_pept        628967..629551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0597"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: tpd:Teth39_1746 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60350"
FT                   /db_xref="GOA:D7ATA3"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:D7ATA3"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1746"
FT                   /protein_id="ADH60350.1"
FT                   /translation="MEKTKTQTIVKVGFLSATAFILMYLEFQVPLFPGFLKLDFSDVPA
FT                   LVASFAIGPLYGVMVELIKNILHATVTQSGAIGEIANFTVGSIFVYAAGVIYQFNKTRK
FT                   TALISMAIATVVMAVTASLLNYYVFLPLYQRVMGWPMDAIINMGKAANKNIVDVKTLIS
FT                   YGIFPFNILKGIVVSVITFLVYKKLSPFFKH"
FT   gene            629731..630192
FT                   /locus_tag="Tmath_0598"
FT   CDS_pept        629731..630192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0598"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   tpd:Teth39_1745 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60351"
FT                   /db_xref="GOA:D7ATA4"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7ATA4"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ADH60351.1"
FT                   /translation="MEKTYICKNRDETISLGEKLGRLLKRRDIILLYGDLGSGKTVFTK
FT                   GIAKGLGINEPITSPTFTLVNEHKGRIPLYHFDLYRLDDYTALYDIGYEEYFYDEGVCA
FT                   IEWPERLGPLLPKERLEVIIQKGEKEDERVILFKDFGKRYEELLKEMSQ"
FT   gene            630189..630884
FT                   /locus_tag="Tmath_0599"
FT   CDS_pept        630189..630884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0599"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   tex:Teth514_0489 peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60352"
FT                   /db_xref="GOA:D7ATA5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D7ATA5"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ADH60352.1"
FT                   /translation="MKILAIDSSSKTATVALVDEKGIIGEYSINYLRHSVILMPMIDEL
FT                   LKKCEVPINQITHVAVSEGPGSFTGLRIGAATAKGLAHALNIPIVGVSSLLALAYNVSE
FT                   FEGLICPLIDALNENVYGMLIRGGSLEILMDAKVYSLEEIAELVEGYSDKVLFVGEGVY
FT                   SYKDKLREMIRDKALFAKDKDNIARAASIGEIAIQMIKKGEVFSFFDFKPVYIRKSAAE
FT                   IRLGDRGVN"
FT   gene            630884..631330
FT                   /locus_tag="Tmath_0600"
FT   CDS_pept        630884..631330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0600"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; KEGG: tpd:Teth39_1743
FT                   ribosomal-protein-alanine acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60353"
FT                   /db_xref="GOA:D7ATA6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7ATA6"
FT                   /inference="protein motif:TFAM:TIGR01575"
FT                   /protein_id="ADH60353.1"
FT                   /translation="MDVIIRLMRKEDVEEVLEIEKLSFSTPWSKEAFISEVTKNSCAKY
FT                   IVAEVDNKIVGYGGFWVVVDEGHITNIAVHPEYRSKGIGSKIMEGLIELAKKNGIISMT
FT                   LEVRESNIVAQHLYAKFGFRPLGRRKGYYQDNNEDAIIMWKYDL"
FT   gene            631344..632372
FT                   /locus_tag="Tmath_0601"
FT   CDS_pept        631344..632372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0601"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /note="KEGG: tex:Teth514_0491 putative DNA-binding/iron
FT                   metalloprotein/AP endonuclease; TIGRFAM:
FT                   metalloendopeptidase, glycoprotease family; PFAM: peptidase
FT                   M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60354"
FT                   /db_xref="GOA:D7ATA7"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D7ATA7"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ADH60354.1"
FT                   /translation="MDKDVIILGIESSCDETAAGVVKNGKEVLSNVIYSQIEVHKKYGG
FT                   VVPEIASRKHIEVISFVVEEALEKARLTLDEVDVIAATYGPGLVGALLVGLSYGKALAY
FT                   AKNKPFIGVNHIEGHIAANYLGGEFAPPFICLVASGGHSHIVFVKDYGEYEVMGQTMDD
FT                   AAGEAFDKVARALGLGYPGGPAIEKAAKLGNMEAIEFPKSFMEEGNFDFSFSGLKTAVL
FT                   NYLNRQKQKREEINVYDVAASFQRNVVEVLVKKLIDAAKKKNINKISIAGGVAANSFLR
FT                   EKLEEEAKKIGIRLHYPDKIYCTDNGAMIAAAAYYDFIKGKTSELDLNAIPYLKIGEKF
FT                   CC"
FT   gene            632539..633489
FT                   /locus_tag="Tmath_0602"
FT   CDS_pept        632539..633489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0602"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: tpd:Teth39_1741 D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60355"
FT                   /db_xref="GOA:D7ATA8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7ATA8"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADH60355.1"
FT                   /translation="MKNILLFTKLNETYIKEIKERMDEYEVLYVQNEEEAEKYIKETEI
FT                   IISFDFEFYPNIVDKASNLKWIHLLSAGADTLPFEKLKEMKVLVTNSRDVHKYQISQQV
FT                   IGYLLMFERALNVFVRNQMKKLWDRSVRVSELTGKTALIIGVGSIGEEIARLLKEFGMK
FT                   VYGIRSSGKPSLYVEKMYTSIEDCDVLSFADYVISILPLTKDTYHLIGENVFSRMKNTS
FT                   YFINVGRGKVVDEKALINALENKVIKGAALDVFEEEPLREDSPLWDMENVIITPHMAGV
FT                   TPLYMQRAMEILKENLDAYKEGRTLRNIVNLDKGY"
FT   gene            complement(633498..635393)
FT                   /locus_tag="Tmath_0603"
FT   CDS_pept        complement(633498..635393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmath_0603"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_1740 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmath_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADH60356"
FT                   /db_xref="GOA:D7ATA9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:D7ATA9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH60356.1"
FT                   /translation="MAIITVNNVTKSYGIDIILQNISFIVNEKDKIGVIGKNGAGKSTL
FT                   FNLLAGFTEPDSGAISISANKIGYLQQNTLIDSEKSIYEEVKTVFDEIFQLEKQIKSLE
FT                   EKISQTKDSHLLNKLFLEYSFLTDKYMELDGYSVESKIRGVLNGLGFDVSQFDTPVSNL
FT                   SGGQKTRLMLAKTLLSNPDVLLLDEPTNHLDISSIEWLEQYLKFYSGTILIISHDRYFL
FT                   DKIVSRIFEIENTKLLVYEGNYTEYLKRKTLETKAKLKAYEEQQKEIKRIKSIIQIQKN
FT                   RRTEKSVKMAKSKQKLLEKMEIIEKP