(data stored in SCRATCH3701 zone)

EMBL: CP002040

ID   CP002040; SV 1; circular; genomic DNA; STD; PRO; 5767958 BP.
XX
AC   CP002040; ABUI01000000-ABUI01000063;
XX
PR   Project:PRJNA19709;
XX
DT   30-MAY-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111 chromosome 1,
DE   complete sequence.
XX
KW   .
XX
OS   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
OC   Bacteria; Actinobacteria; Streptosporangiales; Nocardiopsaceae;
OC   Nocardiopsis.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-5767958
RX   PUBMED; 21304737.
RA   Sun H., Lapidus A., Nolan M., Lucas S., Del Rio T.G., Tice H., Cheng J.F.,
RA   Tapia R., Han C., Goodwin L., Pitluck S., Pagani I., Ivanova N.,
RA   Mavromatis K., Mikhailova N., Pati A., Chen A., Palaniappan K., Land M.,
RA   Hauser L., Chang Y.J., Jeffries C.D., Djao O.D., Rohde M., Sikorski J.,
RA   Goker M., Woyke T., Bristow J., Eisen J.A., Markowitz V., Hugenholtz P.,
RA   Kyrpides N.C., Klenk H.P.;
RT   "Complete genome sequence of Nocardiopsis dassonvillei type strain (IMRU
RT   509)";
RL   Stand Genomic Sci 3(3):325-336(2010).
XX
RN   [2]
RP   1-5767958
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K.,
RA   Ovchinnikova G., Sun H., Brettin T., Detter J.C., Han C., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Jando J., Schneider S., Klenk H.-P., Eisen J.A.;
RT   "The complete chromosome of Nocardiopsis dassonvillei subsp. dassonvillei
RT   DSM 43111";
RL   Unpublished.
XX
RN   [3]
RP   1-5767958
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K.,
RA   Ovchinnikova G., Sun H., Brettin T., Detter J.C., Han C., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Jando J., Schneider S., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (18-MAY-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 8614bffc33b575d7d1571dd30e95cf2f.
DR   BioSample; SAMN02598425.
DR   CABRI; DSM 43111.
DR   EnsemblGenomes-Gn; EBG00001057869.
DR   EnsemblGenomes-Gn; EBG00001057870.
DR   EnsemblGenomes-Gn; EBG00001057871.
DR   EnsemblGenomes-Gn; EBG00001057872.
DR   EnsemblGenomes-Gn; EBG00001057873.
DR   EnsemblGenomes-Gn; EBG00001057874.
DR   EnsemblGenomes-Gn; EBG00001057875.
DR   EnsemblGenomes-Gn; EBG00001057876.
DR   EnsemblGenomes-Gn; EBG00001057877.
DR   EnsemblGenomes-Gn; EBG00001057878.
DR   EnsemblGenomes-Gn; EBG00001057879.
DR   EnsemblGenomes-Gn; EBG00001057880.
DR   EnsemblGenomes-Gn; EBG00001057881.
DR   EnsemblGenomes-Gn; EBG00001057882.
DR   EnsemblGenomes-Gn; EBG00001057883.
DR   EnsemblGenomes-Gn; EBG00001057884.
DR   EnsemblGenomes-Gn; EBG00001057885.
DR   EnsemblGenomes-Gn; EBG00001057886.
DR   EnsemblGenomes-Gn; EBG00001057887.
DR   EnsemblGenomes-Gn; EBG00001057888.
DR   EnsemblGenomes-Gn; EBG00001057889.
DR   EnsemblGenomes-Gn; EBG00001057890.
DR   EnsemblGenomes-Gn; EBG00001057891.
DR   EnsemblGenomes-Gn; EBG00001057892.
DR   EnsemblGenomes-Gn; EBG00001057893.
DR   EnsemblGenomes-Gn; EBG00001057894.
DR   EnsemblGenomes-Gn; EBG00001057895.
DR   EnsemblGenomes-Gn; EBG00001057896.
DR   EnsemblGenomes-Gn; EBG00001057897.
DR   EnsemblGenomes-Gn; EBG00001057898.
DR   EnsemblGenomes-Gn; EBG00001057899.
DR   EnsemblGenomes-Gn; EBG00001057900.
DR   EnsemblGenomes-Gn; EBG00001057901.
DR   EnsemblGenomes-Gn; EBG00001057903.
DR   EnsemblGenomes-Gn; EBG00001057905.
DR   EnsemblGenomes-Gn; EBG00001057906.
DR   EnsemblGenomes-Gn; EBG00001057907.
DR   EnsemblGenomes-Gn; EBG00001057908.
DR   EnsemblGenomes-Gn; EBG00001057909.
DR   EnsemblGenomes-Gn; EBG00001057910.
DR   EnsemblGenomes-Gn; EBG00001057911.
DR   EnsemblGenomes-Gn; EBG00001057912.
DR   EnsemblGenomes-Gn; EBG00001057913.
DR   EnsemblGenomes-Gn; EBG00001057914.
DR   EnsemblGenomes-Gn; EBG00001057915.
DR   EnsemblGenomes-Gn; EBG00001057916.
DR   EnsemblGenomes-Gn; EBG00001057917.
DR   EnsemblGenomes-Gn; EBG00001057918.
DR   EnsemblGenomes-Gn; EBG00001057919.
DR   EnsemblGenomes-Gn; EBG00001057920.
DR   EnsemblGenomes-Gn; EBG00001057921.
DR   EnsemblGenomes-Gn; EBG00001057922.
DR   EnsemblGenomes-Gn; EBG00001057923.
DR   EnsemblGenomes-Gn; EBG00001057924.
DR   EnsemblGenomes-Gn; EBG00001057925.
DR   EnsemblGenomes-Gn; EBG00001057926.
DR   EnsemblGenomes-Gn; EBG00001057927.
DR   EnsemblGenomes-Gn; EBG00001057928.
DR   EnsemblGenomes-Gn; EBG00001057929.
DR   EnsemblGenomes-Gn; EBG00001057931.
DR   EnsemblGenomes-Gn; EBG00001057932.
DR   EnsemblGenomes-Gn; EBG00001057933.
DR   EnsemblGenomes-Gn; EBG00001057934.
DR   EnsemblGenomes-Gn; EBG00001057935.
DR   EnsemblGenomes-Gn; Ndas_R0001.
DR   EnsemblGenomes-Gn; Ndas_R0002.
DR   EnsemblGenomes-Gn; Ndas_R0003.
DR   EnsemblGenomes-Gn; Ndas_R0004.
DR   EnsemblGenomes-Gn; Ndas_R0005.
DR   EnsemblGenomes-Gn; Ndas_R0006.
DR   EnsemblGenomes-Gn; Ndas_R0007.
DR   EnsemblGenomes-Gn; Ndas_R0008.
DR   EnsemblGenomes-Gn; Ndas_R0009.
DR   EnsemblGenomes-Gn; Ndas_R0010.
DR   EnsemblGenomes-Gn; Ndas_R0011.
DR   EnsemblGenomes-Gn; Ndas_R0012.
DR   EnsemblGenomes-Gn; Ndas_R0013.
DR   EnsemblGenomes-Gn; Ndas_R0014.
DR   EnsemblGenomes-Gn; Ndas_R0015.
DR   EnsemblGenomes-Gn; Ndas_R0016.
DR   EnsemblGenomes-Gn; Ndas_R0017.
DR   EnsemblGenomes-Gn; Ndas_R0018.
DR   EnsemblGenomes-Gn; Ndas_R0019.
DR   EnsemblGenomes-Gn; Ndas_R0020.
DR   EnsemblGenomes-Gn; Ndas_R0021.
DR   EnsemblGenomes-Gn; Ndas_R0022.
DR   EnsemblGenomes-Gn; Ndas_R0023.
DR   EnsemblGenomes-Gn; Ndas_R0024.
DR   EnsemblGenomes-Gn; Ndas_R0025.
DR   EnsemblGenomes-Gn; Ndas_R0026.
DR   EnsemblGenomes-Gn; Ndas_R0027.
DR   EnsemblGenomes-Gn; Ndas_R0028.
DR   EnsemblGenomes-Gn; Ndas_R0029.
DR   EnsemblGenomes-Gn; Ndas_R0030.
DR   EnsemblGenomes-Gn; Ndas_R0031.
DR   EnsemblGenomes-Gn; Ndas_R0032.
DR   EnsemblGenomes-Gn; Ndas_R0033.
DR   EnsemblGenomes-Gn; Ndas_R0034.
DR   EnsemblGenomes-Gn; Ndas_R0035.
DR   EnsemblGenomes-Gn; Ndas_R0036.
DR   EnsemblGenomes-Gn; Ndas_R0037.
DR   EnsemblGenomes-Gn; Ndas_R0038.
DR   EnsemblGenomes-Gn; Ndas_R0039.
DR   EnsemblGenomes-Gn; Ndas_R0040.
DR   EnsemblGenomes-Gn; Ndas_R0041.
DR   EnsemblGenomes-Gn; Ndas_R0042.
DR   EnsemblGenomes-Gn; Ndas_R0043.
DR   EnsemblGenomes-Gn; Ndas_R0044.
DR   EnsemblGenomes-Gn; Ndas_R0046.
DR   EnsemblGenomes-Gn; Ndas_R0047.
DR   EnsemblGenomes-Gn; Ndas_R0048.
DR   EnsemblGenomes-Gn; Ndas_R0049.
DR   EnsemblGenomes-Gn; Ndas_R0050.
DR   EnsemblGenomes-Gn; Ndas_R0051.
DR   EnsemblGenomes-Gn; Ndas_R0052.
DR   EnsemblGenomes-Gn; Ndas_R0053.
DR   EnsemblGenomes-Gn; Ndas_R0054.
DR   EnsemblGenomes-Gn; Ndas_R0055.
DR   EnsemblGenomes-Gn; Ndas_R0056.
DR   EnsemblGenomes-Gn; Ndas_R0057.
DR   EnsemblGenomes-Gn; Ndas_R0058.
DR   EnsemblGenomes-Gn; Ndas_R0059.
DR   EnsemblGenomes-Gn; Ndas_R0060.
DR   EnsemblGenomes-Gn; Ndas_R0061.
DR   EnsemblGenomes-Gn; Ndas_R0062.
DR   EnsemblGenomes-Tr; EBT00001660461.
DR   EnsemblGenomes-Tr; EBT00001660462.
DR   EnsemblGenomes-Tr; EBT00001660463.
DR   EnsemblGenomes-Tr; EBT00001660464.
DR   EnsemblGenomes-Tr; EBT00001660465.
DR   EnsemblGenomes-Tr; EBT00001660467.
DR   EnsemblGenomes-Tr; EBT00001660468.
DR   EnsemblGenomes-Tr; EBT00001660470.
DR   EnsemblGenomes-Tr; EBT00001660471.
DR   EnsemblGenomes-Tr; EBT00001660472.
DR   EnsemblGenomes-Tr; EBT00001660473.
DR   EnsemblGenomes-Tr; EBT00001660475.
DR   EnsemblGenomes-Tr; EBT00001660476.
DR   EnsemblGenomes-Tr; EBT00001660477.
DR   EnsemblGenomes-Tr; EBT00001660478.
DR   EnsemblGenomes-Tr; EBT00001660479.
DR   EnsemblGenomes-Tr; EBT00001660480.
DR   EnsemblGenomes-Tr; EBT00001660482.
DR   EnsemblGenomes-Tr; EBT00001660483.
DR   EnsemblGenomes-Tr; EBT00001660484.
DR   EnsemblGenomes-Tr; EBT00001660485.
DR   EnsemblGenomes-Tr; EBT00001660486.
DR   EnsemblGenomes-Tr; EBT00001660490.
DR   EnsemblGenomes-Tr; EBT00001660491.
DR   EnsemblGenomes-Tr; EBT00001660493.
DR   EnsemblGenomes-Tr; EBT00001660494.
DR   EnsemblGenomes-Tr; EBT00001660495.
DR   EnsemblGenomes-Tr; EBT00001660496.
DR   EnsemblGenomes-Tr; EBT00001660497.
DR   EnsemblGenomes-Tr; EBT00001660499.
DR   EnsemblGenomes-Tr; EBT00001660500.
DR   EnsemblGenomes-Tr; EBT00001660501.
DR   EnsemblGenomes-Tr; EBT00001660502.
DR   EnsemblGenomes-Tr; EBT00001660504.
DR   EnsemblGenomes-Tr; EBT00001660506.
DR   EnsemblGenomes-Tr; EBT00001660508.
DR   EnsemblGenomes-Tr; EBT00001660509.
DR   EnsemblGenomes-Tr; EBT00001660510.
DR   EnsemblGenomes-Tr; EBT00001660512.
DR   EnsemblGenomes-Tr; EBT00001660513.
DR   EnsemblGenomes-Tr; EBT00001660514.
DR   EnsemblGenomes-Tr; EBT00001660516.
DR   EnsemblGenomes-Tr; EBT00001660518.
DR   EnsemblGenomes-Tr; EBT00001660519.
DR   EnsemblGenomes-Tr; EBT00001660520.
DR   EnsemblGenomes-Tr; EBT00001660521.
DR   EnsemblGenomes-Tr; EBT00001660522.
DR   EnsemblGenomes-Tr; EBT00001660523.
DR   EnsemblGenomes-Tr; EBT00001660524.
DR   EnsemblGenomes-Tr; EBT00001660525.
DR   EnsemblGenomes-Tr; EBT00001660526.
DR   EnsemblGenomes-Tr; EBT00001660527.
DR   EnsemblGenomes-Tr; EBT00001660528.
DR   EnsemblGenomes-Tr; EBT00001660530.
DR   EnsemblGenomes-Tr; EBT00001660531.
DR   EnsemblGenomes-Tr; EBT00001660532.
DR   EnsemblGenomes-Tr; EBT00001660533.
DR   EnsemblGenomes-Tr; EBT00001660534.
DR   EnsemblGenomes-Tr; EBT00001660536.
DR   EnsemblGenomes-Tr; EBT00001660537.
DR   EnsemblGenomes-Tr; EBT00001660538.
DR   EnsemblGenomes-Tr; EBT00001660539.
DR   EnsemblGenomes-Tr; EBT00001660540.
DR   EnsemblGenomes-Tr; EBT00001660541.
DR   EnsemblGenomes-Tr; Ndas_R0001-1.
DR   EnsemblGenomes-Tr; Ndas_R0002-1.
DR   EnsemblGenomes-Tr; Ndas_R0003-1.
DR   EnsemblGenomes-Tr; Ndas_R0004-1.
DR   EnsemblGenomes-Tr; Ndas_R0005-1.
DR   EnsemblGenomes-Tr; Ndas_R0006-1.
DR   EnsemblGenomes-Tr; Ndas_R0007-1.
DR   EnsemblGenomes-Tr; Ndas_R0008-1.
DR   EnsemblGenomes-Tr; Ndas_R0009-1.
DR   EnsemblGenomes-Tr; Ndas_R0010-1.
DR   EnsemblGenomes-Tr; Ndas_R0011-1.
DR   EnsemblGenomes-Tr; Ndas_R0012-1.
DR   EnsemblGenomes-Tr; Ndas_R0013-1.
DR   EnsemblGenomes-Tr; Ndas_R0014-1.
DR   EnsemblGenomes-Tr; Ndas_R0015-1.
DR   EnsemblGenomes-Tr; Ndas_R0016-1.
DR   EnsemblGenomes-Tr; Ndas_R0017-1.
DR   EnsemblGenomes-Tr; Ndas_R0018-1.
DR   EnsemblGenomes-Tr; Ndas_R0019-1.
DR   EnsemblGenomes-Tr; Ndas_R0020-1.
DR   EnsemblGenomes-Tr; Ndas_R0021-1.
DR   EnsemblGenomes-Tr; Ndas_R0022-1.
DR   EnsemblGenomes-Tr; Ndas_R0023-1.
DR   EnsemblGenomes-Tr; Ndas_R0024-1.
DR   EnsemblGenomes-Tr; Ndas_R0025-1.
DR   EnsemblGenomes-Tr; Ndas_R0026-1.
DR   EnsemblGenomes-Tr; Ndas_R0027-1.
DR   EnsemblGenomes-Tr; Ndas_R0028-1.
DR   EnsemblGenomes-Tr; Ndas_R0029-1.
DR   EnsemblGenomes-Tr; Ndas_R0030-1.
DR   EnsemblGenomes-Tr; Ndas_R0031-1.
DR   EnsemblGenomes-Tr; Ndas_R0032-1.
DR   EnsemblGenomes-Tr; Ndas_R0033-1.
DR   EnsemblGenomes-Tr; Ndas_R0034-1.
DR   EnsemblGenomes-Tr; Ndas_R0035-1.
DR   EnsemblGenomes-Tr; Ndas_R0036-1.
DR   EnsemblGenomes-Tr; Ndas_R0037-1.
DR   EnsemblGenomes-Tr; Ndas_R0038-1.
DR   EnsemblGenomes-Tr; Ndas_R0039-1.
DR   EnsemblGenomes-Tr; Ndas_R0040-1.
DR   EnsemblGenomes-Tr; Ndas_R0041-1.
DR   EnsemblGenomes-Tr; Ndas_R0042-1.
DR   EnsemblGenomes-Tr; Ndas_R0043-1.
DR   EnsemblGenomes-Tr; Ndas_R0044-1.
DR   EnsemblGenomes-Tr; Ndas_R0046-1.
DR   EnsemblGenomes-Tr; Ndas_R0047-1.
DR   EnsemblGenomes-Tr; Ndas_R0048-1.
DR   EnsemblGenomes-Tr; Ndas_R0049-1.
DR   EnsemblGenomes-Tr; Ndas_R0050-1.
DR   EnsemblGenomes-Tr; Ndas_R0051-1.
DR   EnsemblGenomes-Tr; Ndas_R0052-1.
DR   EnsemblGenomes-Tr; Ndas_R0053-1.
DR   EnsemblGenomes-Tr; Ndas_R0054-1.
DR   EnsemblGenomes-Tr; Ndas_R0055-1.
DR   EnsemblGenomes-Tr; Ndas_R0056-1.
DR   EnsemblGenomes-Tr; Ndas_R0057-1.
DR   EnsemblGenomes-Tr; Ndas_R0058-1.
DR   EnsemblGenomes-Tr; Ndas_R0059-1.
DR   EnsemblGenomes-Tr; Ndas_R0060-1.
DR   EnsemblGenomes-Tr; Ndas_R0061-1.
DR   EnsemblGenomes-Tr; Ndas_R0062-1.
DR   EuropePMC; PMC3072421; 21490938.
DR   EuropePMC; PMC3558931; 23352141.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002040.
DR   SILVA-SSU; CP002040.
DR   StrainInfo; 167805; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082385
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-PGF
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Nocardiopsis dassonvillei dassonvillei DSM
CC                            43111
CC   Culture Collection ID :: DSM 43111, ATCC 23218, IAM 14287, IMET
CC                            9605, IMRU 509, JCM 7437, NCTC 10488
CC   GOLD Stamp ID         :: Gi02065
CC   Funding Program       :: DOE-GEBA 2007
CC   Gene Calling Method   :: GeneMark
CC   Host Name             :: Homo sapiens
CC   Body Sample Site      :: Blood
CC   Oxygen Requirement    :: Aerobe
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 28C
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: Actinomycetoma, Pulmonary infection
CC   Habitat               :: Blood, Host
CC   Phenotypes            :: Lacks Mycolic acids, Pathogen
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5767958
FT                   /organism="Nocardiopsis dassonvillei subsp. dassonvillei
FT                   DSM 43111"
FT                   /chromosome="1"
FT                   /host="Homo sapiens"
FT                   /sub_species="dassonvillei"
FT                   /strain="DSM 43111"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="blood"
FT                   /db_xref="taxon:446468"
FT   gene            308..2266
FT                   /locus_tag="Ndas_0001"
FT   CDS_pept        308..2266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COGs: COG0593 ATPase involved in DNA replication
FT                   initiation;
FT                   InterProIPR010921:IPR018312:IPR013317:IPR013159:IPR
FT                   003593:IPR001957:IPR020591; KEGG: tfu:Tfu_0001 chromosomal
FT                   replication initiation protein; PFAM: Chromosomal
FT                   replication initiator DnaA; Chromosomal replication
FT                   initiator DnaA domain; SMART: Chromosomal replication
FT                   initiator DnaA domain; AAA ATPase; SPTR: C1YR93 Chromosomal
FT                   replication initiator protein dnaA; TIGRFAM: chromosomal
FT                   replication initiator protein DnaA; PFAM: domain; Bacterial
FT                   dnaA protein; TIGRFAM: chromosomal replication initiator
FT                   protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65454"
FT                   /db_xref="GOA:D7B601"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D7B601"
FT                   /protein_id="ADH65454.1"
FT                   /translation="MADAQVNLAVVWSSVLDGIDNDSLPAHQRAWLPQTRPLGLIEDTA
FT                   LIAAPNEFTKKVLETRLYPAISKALSAHLGREIRVAVTVDPTAVPTPPPTPTPPAAPGP
FT                   QGPRSVEGHTAPAFSPVVPGTAPGPTRPTAPPAAPADAQRAVTGSRGQHARPAAEAAEQ
FT                   PAPWPSAPAPAPEQADLLGPTPPADHPSPTDEAPHTVRDAPAPWVQQTFASPQETPTAP
FT                   PLWEQPSALERPQEPAGWRQQSWTEPEWDRPNRWETPREEAPAPGAEAAEEAAQPAPEA
FT                   VEAPVEDEAPKAPSSPPGRSQEVPPGEHARLNPKYTFDTFVIGSSNRFAHAASVAAAEA
FT                   PAKAYNPLFIHGGSGLGKTHLLHAIGHYTHRLYEGSRVRYVSSEEFTNEFINSIRDGKA
FT                   DGFRRRYRDIDVLLVDDIQFLENKEQTQEEFFHTFNTLHNSDKQIVISSDRPPKQLTTL
FT                   EDRMRSRFEWGLLTDVQPPELETRIAILRKKAAQEGLAAPPEVLEFIASKISTNIRELE
FT                   GALIRVTAFASLNRQSVDLDLTSQVLRDLVPSTEVPEVTAGAIMSQTAAYFGLTVEDLC
FT                   GTSRSRVLVTARQIAMYLCRELTELSLPKIGQQFGRDHTTVMHAERKVRGLMAERRSIY
FT                   NQVHELTSRIKDQPSLT"
FT   gene            3397..4536
FT                   /locus_tag="Ndas_0002"
FT   CDS_pept        3397..4536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); InterPro IPR001001; KEGG: tfu:Tfu_0002 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain; PRIAM: DNA-directed DNA polymerase; SMART: DNA
FT                   polymerase III beta chain; SPTR: C1YR92 DNA polymerase III,
FT                   beta subunit; TIGRFAM: DNA polymerase III, beta subunit;
FT                   PFAM: DNA polymerase III beta subunit, C-terminal domain;
FT                   DNA polymerase III beta subunit, N-terminal domain; DNA
FT                   polymerase III beta subunit, central domain; TIGRFAM: DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65455"
FT                   /db_xref="GOA:D7B602"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D7B602"
FT                   /protein_id="ADH65455.1"
FT                   /translation="MKFRVERDVLAEAVAWTARTLPTRPSVPVLVGILLEAGEFDGLQQ
FT                   LRLSGFDYEVSTQAAVDVEVEEPGTVLVTGKLLAEITRNLPAQPVEISTDGAKVVVTGG
FT                   SAKFTLTTMPVEDYPTLPEMPGVSGTVGSDAFAAAVSQVAVAAGRDDTLPMLTGVRVEI
FT                   EGETITLASTDRYRLAVREFTWKPENPDLSAVALVPAKTLHDTAKSLTSGAEVSIALSD
FT                   GGSGEGMIGFEGGGRRTTTRLLDGEFPKYRALLPDTFNSVAEVSRSEFVEAVKRVSLVA
FT                   ERNTPLRLSFSQGQLVLEAGTGEEAQAVEVLEADLDGDDIQIAFNSGFLLDGLGAIGTD
FT                   VARLHFTTSTKPSILTGKPAEEGSSPEYRYLIMPVRQPG"
FT   gene            4635..5534
FT                   /locus_tag="Ndas_0003"
FT   CDS_pept        4635..5534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0003"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="COGs: COG1023 6-phosphogluconate dehydrogenase;
FT                   InterProIPR004849:IPR016040:IPR002204:IPR006115:IPR
FT                   013328:IPR008927:IPR006114:IPR006184:IPR006183; KEGG:
FT                   tfu:Tfu_0003 6-phosphogluconate dehydrogenase-like protein;
FT                   PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   6-phosphogluconate dehydrogenase domain protein; SPTR:
FT                   C1YR91 6-phosphogluconate dehydrogenase, decarboxylating;
FT                   TIGRFAM: 6-phosphogluconate dehydrogenase, decarboxylating;
FT                   PFAM: NAD binding domain of 6-phosphogluconate
FT                   dehydrogenase; 6-phosphogluconate dehydrogenase, C-terminal
FT                   domain; TIGRFAM: 6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65456"
FT                   /db_xref="GOA:D7B603"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7B603"
FT                   /protein_id="ADH65456.1"
FT                   /translation="MQLGMIGLGKMGGNMAARLREKGHEVVGYDVASPERDVDTLAGLV
FT                   ERLAAPRVVWVMVPAGDPTAATIAELGELLDEGDLVIEGGNSHYADDRVRAKALAEKGV
FT                   GYLDVGVSGGVWGRQNGYGIMVGGPAEEVAKARPVFDSLVPEEGVGFVHAGAVGAGHFV
FT                   KMVHNGIEYGMMQAFGEGYELMVASGLVDDVPGTFESWREGTVVRSWLLDLLSRALEED
FT                   PELSRLRGYAEDSGEGRWTVQAAVDLAVPAPAITSSLYARFASRQDDSPAMKVVAALRN
FT                   QFGGHAVHRAETSDDIDV"
FT   gene            5627..6760
FT                   /locus_tag="Ndas_0004"
FT   CDS_pept        5627..6760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="COGs: COG1195 Recombinational DNA repair ATPase
FT                   (RecF pathway); InterPro IPR018078:IPR003395:IPR001238;
FT                   KEGG: tfu:Tfu_0004 recombination protein F; PFAM: SMC
FT                   domain protein; SPTR: C1YR90 DNA replication and repair
FT                   protein recF; TIGRFAM: DNA replication and repair protein
FT                   RecF; PFAM: RecF/RecN/SMC N terminal domain; TIGRFAM: recF
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65457"
FT                   /db_xref="GOA:D7B604"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D7B604"
FT                   /protein_id="ADH65457.1"
FT                   /translation="MYVSHLQLADFRSYREALVEMGPGVSVFVGANGQGKTNLVEAIGY
FT                   VATLGSHRVSSDTPLVRQGAPRAIVRAKVVRDERSMVVDLELNPGRANRARINQAPAGR
FT                   PREVLGILRTVLFAPEDLALVKGDPGERRRFLDDLLVARAPRMAGVRSDYDRVLKQRNA
FT                   LLKSASGRMFRQRSAPDLSTLEVWDSHLAETGAELLAARLELVEELRPRIAEAYAGLTD
FT                   SGGPAVPDYRSGAVPEGVEPPTGRPQLVETLRAAMAEARDRELQRGVSLVGPHRDDLVL
FT                   RLGGMPAKGYASQGESWSYALSLKLAAFDLLRSDGDDPVLILDDVFAELDSERRRRLAE
FT                   RVGDAEQVLVTAAVPEDIPKELDGARFGVREGGVAGE"
FT   gene            6960..7313
FT                   /locus_tag="Ndas_0005"
FT   CDS_pept        6960..7313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="InterPro IPR007922; KEGG: tfu:Tfu_0005 hypothetical
FT                   protein; PFAM: protein of unknown function DUF721; SPTR:
FT                   C1YR90 DNA replication and repair protein recF; PFAM:
FT                   Protein of unknown function (DUF721)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65458"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D7B605"
FT                   /protein_id="ADH65458.1"
FT                   /translation="MPRGLQRSRRRGRLRSRNEPQMFGEAVRTWLIEHGWQEQVAIGGV
FT                   FGRWADIVGDFNAEHLRPESYSDGELVVVADSPTMAAHARAMVRDLMRRLNEELGDGTV
FT                   VAIKVRGPGFRRR"
FT   gene            7781..9718
FT                   /locus_tag="Ndas_0006"
FT   CDS_pept        7781..9718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="COGs: COG0187 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) B subunit;
FT                   InterProIPR013760:IPR003594:IPR020568:IPR014721:IPR
FT                   013759:IPR018522:IPR013506:IPR006171:IPR002288:IPR001241:I
FT                   PR011557:IPR000565; KEGG: tfu:Tfu_0006 DNA gyrase subunit
FT                   B; PFAM: DNA topoisomerase type IIA subunit B region 2
FT                   domain protein; ATP-binding region ATPase domain protein;
FT                   TOPRIM domain protein; DNA gyrase subunit B domain protein;
FT                   PRIAM: DNA topoisomerase (ATP-hydrolyzing); SMART: DNA
FT                   topoisomerase II; ATP-binding region ATPase domain protein;
FT                   SPTR: C1YR89 DNA gyrase subunit B; TIGRFAM: DNA gyrase, B
FT                   subunit; PFAM: Toprim domain; Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; DNA gyrase B; DNA gyrase B
FT                   subunit, carboxyl terminus; TIGRFAM: DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65459"
FT                   /db_xref="GOA:D7B606"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7B606"
FT                   /protein_id="ADH65459.1"
FT                   /translation="MAYDAGSITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEVVDNSV
FT                   DEALAGHADAIEVTLLADGGVCVADNGRGIPTDLHPVEKRPAVEVVLTTLHAGGKFDGK
FT                   SYAVSGGLHGVGVSVVNALSTALEVEIRLHGHVWRQRYEMTAPTGELVKGESTDETGTQ
FT                   ITFWPDGDIFETTTFSFETLARRMQEMAFLNKGLSITIRDERPEHTDGGPTVNTFHYDE
FT                   GLSDYVRHINAKKEPAHASIISFEEEGEGISVEIAMQWNQSYTSSVHTFANTINTAEGG
FT                   THEEGFRSALTTLVNRYARDQKLLREKDDNLTGDDIREGLTAIISVKLADPQFEGQTKT
FT                   KLGNTEAKSFVQKVTNEHLRDWFERNPGEAKDIVSKASQAARARVAARQARDLTRRKTL
FT                   LETTSLPGKLSDCQSTNPEECEVYIVEGDSAGGSAKGGRNPHNQAILPIRGKILNVEKS
FT                   RIDRILKNAEVQAIITALGTGIHEEFDAEKLRYHKVILMADADVDGQHIRTLLLTLLFR
FT                   FMKPLVEAGNVYLAAPPLYKIKWDQKGSDASYAFSDAERDRVIEAGIAQGKRDPRPRDM
FT                   VQRFKGLGEMNANELWDTTMDPDRRVLLQVSLEDAAQADELFSVLMGEDVESRRAFIQR
FT                   NAKDVRFLDI"
FT   gene            9880..12492
FT                   /locus_tag="Ndas_0007"
FT   CDS_pept        9880..12492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="COGs: COG0188 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) A subunit;
FT                   InterProIPR013760:IPR013758:IPR013757:IPR002205:IPR
FT                   006691:IPR005743; KEGG: tfu:Tfu_0007 DNA gyrase subunit A;
FT                   PFAM: DNA gyrase/topoisomerase IV subunit A; DNA gyrase
FT                   repeat beta-propeller; PRIAM: DNA topoisomerase
FT                   (ATP-hydrolyzing); SMART: DNA gyrase/topoisomerase IV
FT                   subunit A; SPTR: C1YR88 DNA gyrase subunit A; TIGRFAM: DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV,
FT                   subunit A; DNA gyrase C-terminal domain, beta-propeller;
FT                   TIGRFAM: DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65460"
FT                   /db_xref="GOA:D7B607"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D7B607"
FT                   /protein_id="ADH65460.1"
FT                   /translation="MTDANNPDAPEGGDSTVEAPPRVTDRIEPVDIQVEMQRSYLDYAM
FT                   SVIVGRALPDVRDGLKPVHQRVLYAMYDGGYRPDRGYFKCARVVGDVMGNYHPHGDSAI
FT                   YDTLVRLAQWWSMRMPLVDPNGNFGSAGNDPAAAMRYTECKLAPLAMEMLRDIDKDTVD
FT                   FRPNYDGRSSEPVVLPARFPNLLVNGSSGIAVGMATNIPPHNLREVADGVNWYLDNPEA
FT                   QDEELLDALIARVKGPDFPTRGLIVGKRGIEEAYRTGRGSITMRAVVEVEEDKRGRQTL
FT                   VVTELPYQVNPDNLALKIADLVKDGKITGIADVRDESSGRTGQRLVIVLKRDAVAKVVL
FT                   NNLYKHTQLQETFGANMLALVDGVPRTLRLDQMIRHWVKHQVEVIVRRTRYLLRKAEER
FT                   AHILRALLRAMDRIDEVINLIRASASADQARTGLMDLLEIDDIQARAILDMQLRKLAAL
FT                   ERNALTAEYDELMAQIADYNDILESDTRQRSIIREELGEIVEKYGDERRTHIIPFEGDM
FT                   RMEDFIAEEDVVVTISRGGYAKRTRIDNYRAQKRGGKGVRGAQLKQDDIVQHFFVTTTH
FT                   NWILCFTNQGRVYRTKAYELPEAARDARGQHVANLLPFQPGEEIAQIMALRDYEAAPYL
FT                   VLATREGLVKKSRLEDFDSARAAGIIAINLREGDELIAARLVFPDDDLLLISSDAQAIR
FT                   FPASDESLRPMGRATSGVIGMRFLEDDYLLSMDVIRPGDGSTDVLVTTENGYAKRTPSD
FT                   QYPVQNRGGKGVLTAKVVEARGKLVGALMIDPEVDEVFAITSAGGVIRTGADEVKRSGR
FT                   TTMGVRLMNLAKGNKIVAVARNAEAAEEEAVETAEDAGEANADTAEDVNANAEGNPEA"
FT   gene            12604..13362
FT                   /locus_tag="Ndas_0008"
FT   CDS_pept        12604..13362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0008 hypothetical protein; SPTR:
FT                   C1YR87 Putative uncharacterized protein; PFAM:
FT                   Transmembrane domain of unknown function (DUF3566)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65461"
FT                   /db_xref="GOA:D7B608"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D7B608"
FT                   /protein_id="ADH65461.1"
FT                   /translation="MSDNQRNTTTNETDPDTAETARDGDVETTEKDTAEAGAAVTTEVG
FT                   DKAEAATGATEAGTAEESGEESGSKPGDEDEGSADKADTGSGTAAGPAGSVAEDRAEAG
FT                   GTPVSESKTSVPEGPSAVKASLSSRKAHLSVSRVEPWSVMKFSFVVSLVCFIILFVAIA
FT                   VIYATLSMLGVFDELTNMLTALLEGDGTEDELGLDPASWFSPGRVLGYTGVVGALNIVL
FT                   ITALSTVGAMLYNLVADLVGGIDVTLSEAE"
FT   gene            13545..13618
FT                   /locus_tag="Ndas_R0001"
FT   tRNA            13545..13618
FT                   /locus_tag="Ndas_R0001"
FT                   /product="tRNA-Ile"
FT   gene            13986..14093
FT                   /locus_tag="Ndas_0009"
FT   CDS_pept        13986..14093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0009"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: C1YR86 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65462"
FT                   /db_xref="UniProtKB/TrEMBL:D7B609"
FT                   /protein_id="ADH65462.1"
FT                   /translation="MPGAGYRYAFSTGMSLLTRGFNVYVDLFPIPGARA"
FT   gene            14090..14227
FT                   /locus_tag="Ndas_0010"
FT   CDS_pept        14090..14227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0010"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: C1YR85 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65463"
FT                   /db_xref="UniProtKB/TrEMBL:D7B610"
FT                   /protein_id="ADH65463.1"
FT                   /translation="MRVTPSMKFGVVDWGEGGEVAASLHHHLGNMLQIQVNQGYGRGGR
FT                   "
FT   gene            complement(14379..15800)
FT                   /locus_tag="Ndas_0011"
FT   CDS_pept        complement(14379..15800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0011"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   tfu:Tfu_0753 putative ABC transporter periplasmic
FT                   substrate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; SPTR: C1YR84 Carbohydrate
FT                   ABC transporter substrate-binding protein, CUT1 family;
FT                   PFAM: Bacterial extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65464"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D7B611"
FT                   /protein_id="ADH65464.1"
FT                   /translation="MRARPRPPRPVVCALLSLLLLGSAACDARGERDERVLRVALPVDV
FT                   TATEDTGGGGVYTRLIERWEAENEGWEVDVRWLSPRADEQRSQMVVAMQADPAAYDVLL
FT                   LDNQWVPEFHERGWLAEVDTGGDGPLAWNGFLGRARDAVCYEGRARAVPFHMDVGLLYY
FT                   RADLVGPEEVTARIEEDGWRGLLGLADEVRDEHGLEHGYTGQFGDYEGLTVNALEFVLG
FT                   GHPGLEADSRGTFHGSDGADGGGAEDGCVTSAGASGEFQGLEVLEAGLEPEAGGVIPRA
FT                   ALEETETESLNRFRGGEVVFMRHWPRVVPQLQADSESAETLREGLRWVGWAGEAGGGDP
FT                   AFGVLRLPAAVLGGNSLAVTGESPHRDEAWSLVAAMTGQEVQAEFREAGLLPARGSGYR
FT                   LSDAEDRDVRYWEELRDAVGEGLLRPRTPYYPYVSEVLRDHVDTQIRPGSTDPHPEDMV
FT                   CELNAALAGKVSTCG"
FT   sig_peptide     complement(15726..15800)
FT                   /locus_tag="Ndas_0011"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(15797..18352)
FT                   /locus_tag="Ndas_0012"
FT   CDS_pept        complement(15797..18352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0012"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="InterPro IPR001254:IPR002035:IPR009003; KEGG:
FT                   tfu:Tfu_0752 von Willebrand factor, type A; PFAM: peptidase
FT                   S1 and S6 chymotrypsin/Hap; von Willebrand factor type A;
FT                   SMART: von Willebrand factor type A; peptidase S1 and S6
FT                   chymotrypsin/Hap; SPTR: C1YR83 Uncharacterized protein
FT                   containing a von Willebrand factor type A (VWA) domain;
FT                   PFAM: Trypsin"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65465"
FT                   /db_xref="GOA:D7B612"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D7B612"
FT                   /protein_id="ADH65465.1"
FT                   /translation="MDPRCVADVRVARAGAASRGGTGYLVGPSLVLTAAHVLDGHERVD
FT                   VRLGADRPSGFLRCSVVWSDRSTDVALLRLEEPRPHPSVRWGKLSADEPQPYRSLGYPD
FT                   LAANDGGRDLKDLRGTLSPWDGMVRKDLRLDVQREYGNDVSWKGASGTAVFVRERLVGV
FT                   IVDHDRRNGDLIARRSTRFARDKDFRRLVREDAGTEPWLVPVDLPRAARNTARRFVRAR
FT                   LSSLRRLPHTLAVAVRERRGHGTRAGTAAVPARRSRATAGMRERRGAGRPVWPLAVAAV
FT                   ALLTLVPNGVYWLRANGHLGLGLQCAPPTELTVLTTPDQHAVVQRAADDFSAHVGGRDE
FT                   RSGCVPVRVSVTVAGGAARTRELLREGWTDLRAGPRPHVWLPDSSADVALLRGDPGDAP
FT                   GLETGEGSATRLTPVVLGLPESAGEVPACSGTDPGGARSNLVVCTAAAAEAGLLLARPS
FT                   PEASVSALIQTEALYSAYGDGGAEEIQIAEARATSAGLDAEGNLGLLCALRGGSADPAS
FT                   VGVFSTEYAINAYNTGAQLGPGCGPTGEEPDEPLVPVYFSETPGLDHPFVRLDWGGDGV
FT                   EREAEAFGEWMRHPRETTAFQGYRTVEGAMIGGDAERSLMEVTHLNSARQDGEWRERLE
FT                   SGLRQQERSRAPVEVLLVVDRSDSMSGPGTGGTRLATAQQLARTAVGLLGEQDTVGIWT
FT                   FPEGGPGNDVTGQERVLPPEPGMDARREESAREAIDALSAEFPATPLADAVRDGAEELE
FT                   SCADRPGEPGACALVVLTDGVALPEPRGGARADDVAAVLEDLDERVRVHVVSVGDEGCG
FT                   GDGLLSRLAGAGAECHHPRADELEQVVYGIVAGTRAATP"
FT   gene            complement(18352..18672)
FT                   /locus_tag="Ndas_0013"
FT   CDS_pept        complement(18352..18672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_6969 hypothetical protein; SPTR:
FT                   C1YR82 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65466"
FT                   /db_xref="UniProtKB/TrEMBL:D7B613"
FT                   /protein_id="ADH65466.1"
FT                   /translation="MPTIGLSQAIDELRRELAAARRKGEGHEIGIEIVEAEVELLLEAH
FT                   HEGAGKAGVRFGVLSLNAEGKAGRKDTHRITLKLALTDADGRKLAIASDSGAVWEDRRD
FT                   LD"
FT   gene            complement(18963..19082)
FT                   /locus_tag="Ndas_0014"
FT   CDS_pept        complement(18963..19082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65467"
FT                   /db_xref="UniProtKB/TrEMBL:D7B614"
FT                   /protein_id="ADH65467.1"
FT                   /translation="MSDTGLSPRTPCHVTQGTFYTGAYFSQLESYVLTERSVR"
FT   gene            19199..20569
FT                   /locus_tag="Ndas_0015"
FT   CDS_pept        19199..20569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0015"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701:IPR016196; KEGG: aau:AAur_2544
FT                   major facilitator transporter; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: C1YR81 Arabinose efflux permease
FT                   family protein; PFAM: Sugar (and other) transporter; Major
FT                   Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65468"
FT                   /db_xref="GOA:D7B615"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7B615"
FT                   /protein_id="ADH65468.1"
FT                   /translation="MATSDSTAPGPGGAIETRERRRVLAGTMVGTTIEWYDFFIYAQAA
FT                   GLVLAPLFLSPLTEDSPGLAQVLSFATIGISFLFRPLGAIVAGALGDRFGRKRVLVATL
FT                   VMMGLATCLIGLLPTYAQIGVAAPVLLIILRILQGFSAGGEWGGAALMSVEHAPVDKRG
FT                   FFGAYPQIGVPCGMILATFVVWVITAAIGPEAFLEWGWRIPFLLSFLLIIIGHLIRKSV
FT                   EESPVFKLMQARKAETSAPLGRLFREHTREVVLSALIFIANNAAGYLVIAYLATYASRP
FT                   VEEFGLGMDRGPVLLATTLASFGWLISTLYGGILSDKLGRVRTFQLGYVLLAAWSVPMW
FT                   FMVDTGNIYLYFAGVFIFTLTLGLSYGPQSALYAEMFPAEVRYSGVSIGYALGAILGGA
FT                   FAPMIAELLLTETGASWSIGVYIVVACAVSFLGVTLVKEPKGVDLYADGTRPNAVGK"
FT   gene            complement(20740..20889)
FT                   /pseudo
FT                   /locus_tag="Ndas_0016"
FT   gene            complement(20922..22721)
FT                   /locus_tag="Ndas_0017"
FT   CDS_pept        complement(20922..22721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0017"
FT                   /product="thiamine pyrophosphate protein TPP binding domain
FT                   protein"
FT                   /note="COGs: COG0028 Thiamine pyrophosphate-requiring
FT                   protein; InterPro IPR011766:IPR012001:IPR012000; KEGG:
FT                   sen:SACE_5551 thiamine pyrophosphate protein; PFAM:
FT                   thiamine pyrophosphate protein TPP binding domain protein;
FT                   thiamine pyrophosphate protein domain protein TPP-binding;
FT                   thiamine pyrophosphate protein central region; SPTR: C1YR80
FT                   Thiamine pyrophosphate-dependent enzyme, possible
FT                   carboligase or decarboxylase; PFAM: Thiamine pyrophosphate
FT                   enzyme, central domain; Thiamine pyrophosphate enzyme,
FT                   N-terminal TPP binding domain; Thiamine pyrophosphate
FT                   enzyme, C-terminal TPP binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65469"
FT                   /db_xref="GOA:D7B616"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D7B616"
FT                   /protein_id="ADH65469.1"
FT                   /translation="MAELVSDHVLKRLREWGVDRVFSYAGDGINGLLAAWERADDRPRF
FT                   IQSRHEELAAFEATGYAKFSGRVGVCAATSGPGAIHLLNGLYDAKLDHVPVVAILGQTA
FT                   RSAMGGSYQQEVDLMSLYKDVASDYLQMVTVPEQLPNVLDRAIRIAASRRTVTAVIIPA
FT                   DVQDLEYSPPEHEFKMVPSSLGLPSPRSTPSPEGLAEAAEILNSGERVAMLVGQGARGA
FT                   ADAVVEMADRLGAGVAKALLGKDVLPDDLPFVTGSIGLLGTRPSYEMMRDCDTLLVVGS
FT                   SFPYSQFLPEFDQARAVQIDIDPTMVGMRYPFECNLVGDSAQTLRMLLPLVERKTDRSW
FT                   REKVEDGVARWRRVLERRAHVDADPVNPERVFHELSPLLPDDVMVTADSGSAANWYARH
FT                   LVFREGMRGTLSGTLATMCPGVPYATGAKFAHPDRPVVALVGDGAMQMSGINELITIGH
FT                   YWREWEDPRVVVAVLNNRDLNQVTWELRAMGGAPQFLPSQRIPDFPYAGFAESIGLRGI
FT                   KVDDPSDVRDAWQRALSADRPCVVEFVTDPAVPPIPPHATLDQMESVAKALAKGDPEAW
FT                   SVVKRGVVSKAQEFLPGDGRGGR"
FT   gene            23134..23598
FT                   /locus_tag="Ndas_0018"
FT   CDS_pept        23134..23598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro03416 hypothetical protein; SPTR:
FT                   C1YR79 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65470"
FT                   /db_xref="GOA:D7B617"
FT                   /db_xref="InterPro:IPR025492"
FT                   /db_xref="UniProtKB/TrEMBL:D7B617"
FT                   /protein_id="ADH65470.1"
FT                   /translation="MSNRTSTQGVTRVPGKPIRLAALIYGIVFLLVGVLGFIPGVTTNY
FT                   DQMQFAGHHSEALLLGLFQVSILHNLLHLVLGVAGVAMARTAGLARVYLIGGGLAYLVL
FT                   WLYGLLVGSDDPANFVPLNNADNWLHLFLGLSMIALGIILAPSRRDRVRR"
FT   gene            complement(23760..24227)
FT                   /locus_tag="Ndas_0019"
FT   CDS_pept        complement(23760..24227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpi:Cpin_6099 hypothetical protein; SPTR:
FT                   C1YR78 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65471"
FT                   /db_xref="UniProtKB/TrEMBL:D7B618"
FT                   /protein_id="ADH65471.1"
FT                   /translation="MERLARALAHTSSAVGRGLLAGVVGTAAMTVSSTVEARLRGRGGS
FT                   TSPADAAGKVLGVRPEGPSGEQRFSTAVHWGYGASWGAVRGLLGAAGLHGTAAAAAHLA
FT                   LVWGGEQVALPATGTAPPAWKWGAEEVGVDLLHHTVYACATGAAYEWLDRR"
FT   sig_peptide     complement(24117..24227)
FT                   /locus_tag="Ndas_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(24238..25896)
FT                   /locus_tag="Ndas_0020"
FT   CDS_pept        complement(24238..25896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0020"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="COGs: COG0753 Catalase;
FT                   InterProIPR002226:IPR018028:IPR010582:IPR020835:IPR 011614;
FT                   KEGG: sro:Sros_5497 catalase; PFAM: Catalase related
FT                   subgroup; Catalase domain protein; PRIAM: Catalase; SPTR:
FT                   C1YR77 Catalase; PFAM: Catalase; Catalase-related
FT                   immune-responsive"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65472"
FT                   /db_xref="GOA:D7B619"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="UniProtKB/TrEMBL:D7B619"
FT                   /protein_id="ADH65472.1"
FT                   /translation="MTDVSSQGSAPGDDREVLTNRQGHPVYDNQNQRTVGERGPATLEN
FT                   YQFLEKISHFDRERIPERVVHARGVTAFGYFESYGAWGDEPISRYTRAKLFQGRGKRTD
FT                   IALRFSTVIGGRDSSECARDPRGFAIKFYTEDGNWDLVGNNLAVFFIRDAIKFPDVIHA
FT                   LKPDPVTFRQEPNRIFDFMSQTPECMHMLVNLFSPRGIPADYRHQQGFGVNTYKWVNDV
FT                   GETVLVKYTWMPKQGVRSMTEADAANLQADETGHATKDLHEAIDRGDYPEWELLVQMMS
FT                   DEEHPELDFDPLDDTKTWPEQDFPPKAVGRIVLDRNVSDNFAENEQISFGTGVLVDGLD
FT                   FSDDKMLVGRTFSYSDTQRYRVGPNYLQLPVNQAKNADVRTNQRDGLMAYHQDSGGENP
FT                   HVNYEPSINGGLREGQYPTHDEQGPEIRGRMTRKRISRTNDYQQAGQRYTLMEEWERDD
FT                   LVRNFIGQLSQCDRPIQERMVWHFLMVDDDLGLRVGEGLGIGPGDVAHLEPLRSQTLDE
FT                   GERQRMANLGKNGPRDVSGLTMTHCVPNQRHVVER"
FT   gene            26261..29515
FT                   /locus_tag="Ndas_0021"
FT   CDS_pept        26261..29515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0021"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="COGs: COG0243 Anaerobic dehydrogenase typically
FT                   selenocysteine-containing;
FT                   InterProIPR009010:IPR006657:IPR006656:IPR006963:IPR 006443;
FT                   KEGG: sro:Sros_3728 formate dehydrogenase, alpha subunit;
FT                   PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; PRIAM: Nitrate reductase; SPTR: C1YR76
FT                   Formate dehydrogenase, alpha subunit; TIGRFAM: formate
FT                   dehydrogenase, alpha subunit; PFAM: Molybdopterin
FT                   oxidoreductase; Molydopterin dinucleotide binding domain;
FT                   Molybdopterin oxidoreductase Fe4S4 domain; TIGRFAM: formate
FT                   dehydrogenase, alpha subunit, proteobacterial-type"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65473"
FT                   /db_xref="GOA:D7B620"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D7B620"
FT                   /protein_id="ADH65473.1"
FT                   /translation="MGVRTWIESWPVYRQFTGDDPTGRGAAAKSRRSENLRSRTEEADR
FT                   VVKSVCPYCAVGCGQNVYVKDEKVVQIEGDPDSPISRGRLCPKGSASLQLTTGSAREER
FT                   VLYRRPYGTEWEELDLDTAMRMVAHRAVRTREQTWEREHEGQRVNRTLGIASLGGATLD
FT                   NEENYLIKKLLTSLGVVQVENQARVCHSSTVAGLGTSFGRGGATMFLQDLQNSDCIVIE
FT                   GSNFAEAHPVGFQWVMEAKARGAVVIHVDPRFSRTSALADMHVPIRAGTDIAFLGAIIN
FT                   HVLTEEKYFLDYVRAFTNAATIVGEDFQDTEDLDGLFSGFSEEDKSYDASTWSYEGAEV
FT                   AAASGNRNQLFRERLEENLGTSHSGRPEQQGSGGAVIREKPREDPTLTDPRCVFQVLKR
FT                   HYARYTPELVEEVCGIPKETFRRVCDHLTENSGRDRTSAFCYAVGWTQHTVGSQYIRAA
FT                   SILQLLLGNIGRPGGGIQALRGHASIQGSSDVPTLFDLLPGYLPMPHAHEEQSLETYIM
FT                   AAGNPRKGFWDGMEAYTVSLLKAWWGEHATAENDYCFDHLPRLTGSHSHYDTVMGQIAG
FT                   KCKGYFLMGENPAVGSANSRAQRMGMAELDWLVVRDFSLIESATWWKDGPEIESGEMRT
FT                   EDIGTEVFFFPAAAHTEKSGTFTNTNRLLQWHDRAVSPSGDQRSDLWFMYHLGREIRGI
FT                   LAGSEDPKDRPVLDLTWDYPLEEDGEPDAAAVLREINGHDAEGRPLTVYTELRDDGSTS
FT                   CGCWIYCGVFKDGVNQAARRKPHTEQDWIAGEWAWAWPDNRRVLYNRASADENGEPWSP
FT                   RKSLVWWDAEQGRWVGHDTPDFENRKAPDYEPEEDAEGVAALTGRDAFIMQADGKGWLY
FT                   APAGLNDGPMPTHYEPQDTPFENPLYGHQRNPTRLLYPHEYNRYHPAPGTPGSDVFPYV
FT                   VTTYRLTEHFTAGGMSRWTPYLAELQPEFFCEVGPELAEERGLEHGGWATVVTARNAIE
FT                   ARVMVTDRMAPLRVQGRVVHQIGMPYHWGPNGYSTGDAVNELMPIALDPNVHIQEVKAI
FT                   TADIRPGRRPRGVERLDLVREYRERAGITEQTGLEV"
FT   gene            29518..30402
FT                   /locus_tag="Ndas_0022"
FT   CDS_pept        29518..30402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0022"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="COGs: COG0437 Fe-S-cluster-containing hydrogenase
FT                   components 1; InterPro
FT                   IPR017900:IPR001450:IPR014603:IPR017896; KEGG:
FT                   svi:Svir_19180 formate dehydrogenase beta subunit; PFAM:
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein; SPTR:
FT                   C1YR75 Formate dehydrogenase beta subunit; PFAM: 4Fe-4S
FT                   binding domain; TIGRFAM: formate dehydrogenase, beta
FT                   subunit, Fe-S containing"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65474"
FT                   /db_xref="GOA:D7B621"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D7B621"
FT                   /protein_id="ADH65474.1"
FT                   /translation="MSAESNGDGRHERVGFFTDTSVCIGCKACEVACKEWNMVPEDGLD
FT                   FTSMSFDNSGGLSADTWRHVAFVEQREPLGHQDPGVGRPGAVDLGMPSFELPGAATGAD
FT                   ERGEFRWLMSSDVCKHCTSAACLDVCPTGSLFRTEFGTVVVQEDICNGCGYCVPACPYG
FT                   VIDKREEDGRVWKCTLCYDRIGDGLEPACAKACPTDSIQFGNLDELRARAEARVADLHE
FT                   AGVSSARLYGEDPDNGVDGAGAFFLLLDEPEVYGLPPDPLVTTRDLPSMWRHAGVAAAA
FT                   LVVGAAATFVGRR"
FT   gene            30402..31502
FT                   /locus_tag="Ndas_0023"
FT   CDS_pept        30402..31502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0023"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="InterPro IPR005614; KEGG: kra:Krad_1604 polysulphide
FT                   reductase NrfD; PFAM: Polysulphide reductase NrfD; SPTR:
FT                   C1YR74 Formate-dependent nitrite reductase, membrane
FT                   component; PFAM: Polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65475"
FT                   /db_xref="GOA:D7B622"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:D7B622"
FT                   /protein_id="ADH65475.1"
FT                   /translation="MSSSDVTKEGVRGQRPGREAVTGAADVVGEEQRREHGEGRRRKKG
FT                   RGEPTRVPDAEFRSYYGKPVLNQIVWKASDIGGYLFLGGLAGASSVLAAGAELTGRPEL
FT                   ARPLKYTALGAISGSTAALIHDLGRPERFLNMLRVVKPTSPMSVGSWILMTYGPLAGVA
FT                   AVTSATGWFPRIGLAATLGAGAVGPLVATYTAPLVCDTAVPSWHDGYRYMPFVFASSAA
FT                   AAAGGMGLVTAPLAQSGPARRAAVGGALVETAVSSAMERGMGLSGEPYRQGRAGALMRA
FT                   ARTLTLAGAAGAVLGRRSRVASAVSGAALLAGSACTRLGVFQAGKQSVADPKYTVVPQR
FT                   RRLAEREAERRGADAAAVPRARSAGD"
FT   gene            complement(31595..32092)
FT                   /locus_tag="Ndas_0024"
FT   CDS_pept        complement(31595..32092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0024"
FT                   /product="phosphoribosyltransferase"
FT                   /note="COGs: COG2236 phosphoribosyltransferase; InterPro
FT                   IPR000836; KEGG: sgr:SGR_3439 putative purine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase;
FT                   SPTR: C1YR73 Predicted phosphoribosyltransferase; PFAM:
FT                   Phosphoribosyl transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65476"
FT                   /db_xref="GOA:D7B623"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D7B623"
FT                   /protein_id="ADH65476.1"
FT                   /translation="MSDERENLDYGLFGTAIRDLAHAIADDGFEPDMILSIARGGLFVA
FT                   GGLGYALDVKNLHVMNVEFYTGVGTTLDMPVMLPPVPNAVDLSSKRVLVADDVADTGRT
FT                   LRLVHDFCAEHVAEVRSAVIYEKPRSLVKCEYVWRHTDRWINFPWSVEPPVVSRPDQVR
FT                   DA"
FT   gene            32374..33459
FT                   /locus_tag="Ndas_0025"
FT   CDS_pept        32374..33459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0025"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="COGs: COG1071 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dehydrogenase (E1) component eukaryotic type alpha
FT                   subunit; InterPro IPR017596:IPR001017; KEGG: art:Arth_3193
FT                   pyruvate dehydrogenase (acetyl-transferring); PFAM:
FT                   dehydrogenase E1 component; PRIAM: Pyruvate dehydrogenase
FT                   (acetyl-transferring); SPTR: C1YR72 Pyruvate dehydrogenase
FT                   E1 component, alpha subunit; TIGRFAM: pyruvate
FT                   dehydrogenase (acetyl-transferring) E1 component, alpha
FT                   subunit; PFAM: Dehydrogenase E1 component; TIGRFAM:
FT                   pyruvate dehydrogenase E1 component, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65477"
FT                   /db_xref="GOA:D7B624"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D7B624"
FT                   /protein_id="ADH65477.1"
FT                   /translation="MADDRDLLPSEQPVRLLDETGSPVDGAALPFPDRERLLAAYTSLV
FT                   IGRRVNDQASALVRQGRLAVYPSSHGQEACQTGAALALAEGDWLFPTYRDTAAVVARGV
FT                   DPVQVLTLLKGDWHSGYDPYAHRVAPQATPLATQLLHAVGVAHAARLRGEDTVVMAMCG
FT                   DGATSEGDFHEALNFAAVFRAPVVFFVQNNEYAISVPLARQTAAPSLAHKGVGYGVNAE
FT                   RVDGNDTPAVLAVLDRAVAAARAGEGPQLVEAHTYRMQAHTNADDATRYRTQEEVDPWE
FT                   ARDPLLRMEAYLTRKRVLTKARKARIAEDAEAVAAAMREGVTRDTDPEPAELFAHVFAT
FT                   PTPQLDEQAAFLADELSREGN"
FT   gene            33461..34453
FT                   /locus_tag="Ndas_0026"
FT   CDS_pept        33461..34453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0026"
FT                   /product="Transketolase central region"
FT                   /note="COGs: COG0022 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dehydrogenase (E1) component eukaryotic type beta
FT                   subunit; InterPro IPR009014:IPR005476:IPR005475:IPR015941;
FT                   KEGG: art:Arth_3192 transketolase, central region; PFAM:
FT                   Transketolase central region; Transketolase domain protein;
FT                   SMART: Transketolase central region; SPTR: C1YR71
FT                   Pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase component beta subunit; PFAM: Transketolase,
FT                   C-terminal domain; Transketolase, pyrimidine binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65478"
FT                   /db_xref="GOA:D7B625"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D7B625"
FT                   /protein_id="ADH65478.1"
FT                   /translation="MATDPTKLSMAQALNRALRDAMAEDPAVYVFGEDVGPLGGVFRIT
FT                   DGLTAEFGEDRCFDTPLAESGIVGMAVGMAMNGMRPVVEMQFDAFAYPAFEQIVSHVAK
FT                   TRNRTRGRVGLPMVIRVPYAGGIGGVEHHCDSSEAYYAHTPGLTVVTPSTPADAYFLLR
FT                   GAIASDDPVVFMEPKKLYWGKDEVDLSAPEPPIGRAVVRRPGTDATLIAYGPSVPTALE
FT                   AAEAAAQEGRSLQVVDVRSLVPFDDATVCEAVRSTGRAVVVAEASGYASVASEIVARVT
FT                   ERCFHSLAAPVRRVTGFDIPFPPPKLERFQLPGVDRILDAVDDLQWEDQ"
FT   sig_peptide     33461..33529
FT                   /locus_tag="Ndas_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            34450..35850
FT                   /locus_tag="Ndas_0027"
FT   CDS_pept        34450..35850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0027"
FT                   /product="Dihydrolipoyllysine-residue(2-methylpropanoyl)
FT                   transferase"
FT                   /EC_number="2.3.1.168"
FT                   /note="COGs: COG0508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dihydrolipoamide acyltransferase (E2) protein;
FT                   InterProIPR011053:IPR004167:IPR003016:IPR000089:IPR 001078;
FT                   KEGG: aau:AAur_3154 branched-chain alpha-keto acid
FT                   dehydrogenase subunit E2; PFAM: catalytic domain of
FT                   components of various dehydrogenase complexes;
FT                   biotin/lipoyl attachment domain-containing protein; E3
FT                   binding domain protein; PRIAM: Dihydrolipoyllysine-residue
FT                   (2-methylpropanoyl)transferase; SPTR: C1YR70
FT                   Pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dihydrolipoamide acyltransferase component; PFAM: 2-oxoacid
FT                   dehydrogenases acyltransferase (catalytic domain); e3
FT                   binding domain; Biotin-requiring enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65479"
FT                   /db_xref="GOA:D7B626"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:D7B626"
FT                   /protein_id="ADH65479.1"
FT                   /translation="MTTQTFDLPDLGEGLTEAEVVRWLVAVGDTVAVDQPIVEVETAKS
FT                   IVEVPSPFAGTVSELHGEEGRVMEVGRPLISVTDGSGSGAEAGAASGSGAAAKASAEGE
FT                   RYREEERAGTGSGNVLIGYGTPEAAAPGRRRRPRERPPAHPAQPAAPAATPVSAARASA
FT                   APAARPPLVTSPLVRQMAREAGLRISEVHGSGPGGLITRRDVREAIEAARAPAADSAAP
FT                   AAGPEPVATGGVDARTGLAESRRVAMSGFRRSVAASLSRSRSEIPEATVWVDVDATELV
FT                   RLRRSDPSGPGLMSYVARFVVAGLRAHPELNGRVDAERGELVQYDGINLGLAVQTDRGL
FT                   VAPAVLGAHRLTTAELDGEIRRLTAAAREGRASRAEMTGGTFTLNNYGSLRVDGSAAII
FT                   NHPQVAILGLGRIMDRPWVVDGELTVRKITQLSFAFDHRVCDGGAAAGFMRVVADAMEN
FT                   PAAAIARL"
FT   gene            complement(36038..37195)
FT                   /locus_tag="Ndas_0028"
FT   CDS_pept        complement(36038..37195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0028"
FT                   /product="peptidase M20"
FT                   /note="COGs: COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylase; InterPro
FT                   IPR001261:IPR011650:IPR017150:IPR002933; KEGG:
FT                   sen:SACE_4623 carboxypeptidase G2 precursor; PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; SPTR:
FT                   C1YR69 Acetylornithine deacetylase/succinyldiaminopimelate
FT                   desuccinylase-like deacylase; PFAM: Peptidase family
FT                   M20/M25/M40; Peptidase dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65480"
FT                   /db_xref="GOA:D7B627"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D7B627"
FT                   /protein_id="ADH65480.1"
FT                   /translation="MSQTVTARLADAAERALPGMIDDLRALVELETPSGDRDLLSAGLD
FT                   GIEGWLARRLGAPETRVRYDGGSFGDVLEVSYPGTGAGTVLFVSHYDTVWPAGTLAGWP
FT                   VTVEGDRFSGPGCFDMKAGIVQSAWALRLLRELDLPRPAVRMLLTGDEEIGSPASRPHI
FT                   ERASEGVDLTLVLEPSREGMPKTRRKGMGIFDVDVRGVESHAGLDPAAGASAVHALAQV
FT                   VPALTALSAPELGTTVNVGLVSGGTGYNVVAGHARCGVDVRVQDPAEMARVDAGLAALA
FT                   AADPRVAVRVTGGWNRPPMNPNPPSEKAFGLLREVAGELGASLEEVSVGGASDANFVSA
FT                   LGRPVLDGLGAVGAGPHSRDEHVLVGGTPRQVALVAGLMERIAGR"
FT   gene            complement(37254..38774)
FT                   /locus_tag="Ndas_0029"
FT   CDS_pept        complement(37254..38774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0029"
FT                   /product="AbgT putative transporter"
FT                   /note="COGs: COG2978 Putative p-aminobenzoyl-glutamate
FT                   transporter; InterPro IPR004697; KEGG: sen:SACE_4622
FT                   putative aminobenzoyl-glutamate transporter; PFAM: AbgT
FT                   putative transporter; SPTR: C1YR68 Putative
FT                   p-aminobenzoyl-glutamate transporter; PFAM: AbgT putative
FT                   transporter family; TIGRFAM: p-Aminobenzoyl-glutamate
FT                   transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65481"
FT                   /db_xref="GOA:D7B628"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:D7B628"
FT                   /protein_id="ADH65481.1"
FT                   /translation="MRLLLGSLQVIERVGNKLPHPFWLFTIMAGIVIALSALLNALGVS
FT                   AVSPVDGERIAVRSLLSPEGVQTIVGDAIDNFATFPPLAIIIVVMLGVSVAERSGLLNA
FT                   MLRGSVTRVPARWLTFAVALTGITGSVASDAAYVVLIPLGALLFKAAGRSPVLGLVVAF
FT                   GSVSAGYNASLLITPTDALLAALSTEAASIIDPGYTVTALDNYFFSVVSAVVLAALITL
FT                   VTEFLLSRGSGSLAEDGDGEGDREAQELGSMTLSDAERRGLRNAGLTVVAAVAVLAAAL
FT                   APPASPLRGEDGTVLGSPIITGVAYVLGVLFLLAGVVYGRATGTVASARDVPEAMTAGV
FT                   RDLAPVVVLFFAASQFLAYFRWTGIGEIVAIRGAALLDSAGVHPLVLFLGMIVFSSLLN
FT                   LLITSGSAQWTLIAPVFVPMFMLLDVPPETTQAVYRIADSSTNVISPMSPYFVMALGFL
FT                   QRYRRDAGIGTLISLTLPLCLTVLVGWTLLFLGWWALDIPLGPGVPVR"
FT   sig_peptide     complement(38637..38774)
FT                   /locus_tag="Ndas_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            38977..40008
FT                   /locus_tag="Ndas_0030"
FT   CDS_pept        38977..40008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0030"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="COGs: COG1522 Transcriptional regulators;
FT                   InterProIPR011008:IPR011991:IPR019887:IPR019888:IPR 000485;
FT                   KEGG: sen:SACE_4712 transcription regulator AsnC; PFAM:
FT                   Transcription regulator, AsnC-type-like; SMART:
FT                   Transcription regulator, AsnC-type; SPTR: C1YR67
FT                   Transcriptional regulator; PFAM: IclR helix-turn-helix
FT                   domain; AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65482"
FT                   /db_xref="GOA:D7B629"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7B629"
FT                   /protein_id="ADH65482.1"
FT                   /translation="MLDELDMDLVAALQLAPRAPVSALAEAVGSSASTVGRRLQRLQSE
FT                   RSVRVVGQVDWPLLSDAHPHHVWITTAPGRSRRVARRLAERPETQFTAVTSGGSDVYCV
FT                   VHPFRRDRAADLLADGIPSVEGVAATRSDLVLRAVSRADSWRLDRLDPVRSRALDPYTD
FT                   TGEDGAAEEPRGPLSAQEALVVRMLHRDARAGSGEVARALGVSQSTAYRLVQSVLERRM
FT                   VRPRVEVEPALLGMGVEAVLALEVSPREIGGVADALGAHPSARYVSVVAGTSSVIHHAV
FT                   FRDEAELADFLSADLGRLSGITGLRVSVVLDVLRRYWTAREGARLGPPGPSALLDGEPS
FT                   AGE"
FT   sig_peptide     38977..39051
FT                   /locus_tag="Ndas_0030"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(40318..42354)
FT                   /locus_tag="Ndas_0031"
FT   CDS_pept        complement(40318..42354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0031"
FT                   /product="phenylacetic acid degradation protein paaN"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterProIPR016161:IPR016162:IPR015590:IPR002539:IPR 011966;
FT                   KEGG: rop:ROP_25870 phenylacetic acid degradation protein
FT                   PaaN; PFAM: MaoC domain protein dehydratase; Aldehyde
FT                   Dehydrogenase; SPTR: C1YR66 Phenylacetic acid degradation
FT                   protein paaN; TIGRFAM: phenylacetic acid degradation
FT                   protein paaN; PFAM: MaoC like domain; Aldehyde
FT                   dehydrogenase family; TIGRFAM: phenylacetic acid
FT                   degradation protein paaN"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65483"
FT                   /db_xref="GOA:D7B630"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR011966"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D7B630"
FT                   /protein_id="ADH65483.1"
FT                   /translation="MPETLQSYARGAWFTPADEGAPLADANTGETVARISSDGPDVAGM
FT                   VDHARTVGGPALRALTFHQRANILKEVAKHLTGYKEEFYALSHRTGATARDTAVDVDGG
FT                   FGTLFSFSSKGRRELPNSTVILDGPLEPLGRQGTFVGQHVYTSRPGVAVQINAFNFPVW
FT                   GMLEKFAPAFLAGMPSIVKPAGQTAYLTVAVVRRMVESGLLPEGSLQLLVGSHRGLLDA
FT                   LGPQDVVGFTGSAATGAILRNHPNVVSGGVQLNVEADSLNCSILGPDVTEEDPEFDLYV
FT                   KQVVTEMTVKAGQKCTAIRRVIVPASMAEAVTGALTERLARVVVGAADHPDTRMGALVS
FT                   LDQREEVRKAVKALRATSELVYGDPESVEVAGADDESGAFMSPILLRAEPGAREPHEVE
FT                   AFGPVSTVITYDGVAEAVELAARGSGSLVGSLVTRDPDVAREVVLGLAPWHGRILVLNR
FT                   DDAKESTGHGSPLPVLVHGGPGRAGGGEEMGGVRGVKHHMQRTAVQAPPDMVTAITGHW
FT                   TTGSERTVGDVHPFRKDLSQLRIGDTIRSAERTVTRADIDHFAEFTGDTFYAHTDEEAA
FT                   AANPLFGGIVAHGYLVVSLAAGLFVDPAPGPVLANFGVDNLRFLTPVKEDATIRVTLTA
FT                   KQITPRTNADYGEVRWDALVTDQDGEAVATYDVLTLVAKGGEG"
FT   gene            42614..43207
FT                   /locus_tag="Ndas_0032"
FT   CDS_pept        42614..43207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0032"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="COGs: COG1595 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24 homolog;
FT                   InterProIPR013324:IPR013249:IPR013325:IPR014284:IPR 007627;
FT                   KEGG: sgr:SGR_872 RNA polymerase ECF-subfamily sigma
FT                   factor; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein; SPTR: C1YR65 RNA polymerase, sigma subunit,
FT                   ECF family; TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70, region 4; Sigma-70 region 2;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65484"
FT                   /db_xref="GOA:D7B631"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D7B631"
FT                   /protein_id="ADH65484.1"
FT                   /translation="MSSEDTDTEEPAKSEFTRFFERYHGDVYRYAVRRLGPDLADDVAA
FT                   ETFGVAWRRYDRLPKDQPLPWLYGVARNVIRTRLRGERRRGEVLGAGVAADAPGTADTV
FT                   RQVEERDAALRALDRLSATDRELVMLLAWEGLEPAEAARVLGCTTATVRVRLHRARRRI
FT                   ERFLDSSPPAGRDQPPPRPATPGPTHVRVPVEEK"
FT   gene            43204..44301
FT                   /locus_tag="Ndas_0033"
FT   CDS_pept        43204..44301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_2617 hypothetical protein; SPTR:
FT                   C1YR64 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65485"
FT                   /db_xref="GOA:D7B632"
FT                   /db_xref="UniProtKB/TrEMBL:D7B632"
FT                   /protein_id="ADH65485.1"
FT                   /translation="MNRNPASRGSRGDTEAVRGMLAAHDPAASVRPDPAARDLTRIEAI
FT                   ASGDRLRGRGLTPRRTAPRLALGAAAAFTAVAVLGTLGWNSVQPAYAGPPPAPLEVPLA
FT                   ADAPAGREHLLALAEAAEEQPPPPAGGEVAYVHTAEWTLTYSQDADTGEAGWGVLPTDE
FT                   QVWRTPHRSGRSVSTPSLPEHGGGDPAPLRWLFESGPEEFEWGGGEGGNGMFFTLEPDS
FT                   LSADPDQLAEQLLAVGGRASGATRDPSPAVGLVYALQLLYEEAPVGPDVQAAALRALAG
FT                   QEDVRYAGTARDREGREGELFLVEEDAGDGIVLERRIMFDADTGTPLYHETVAVESPGE
FT                   EGLPRVNNYTVLVETAWVAEVGAAP"
FT   gene            complement(44497..45015)
FT                   /locus_tag="Ndas_0034"
FT   CDS_pept        complement(44497..45015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0034"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="COGs: COG2606 conserved hypothetical protein;
FT                   InterPro IPR007214; KEGG: sro:Sros_8118 hypothetical
FT                   protein; PFAM: YbaK/prolyl-tRNA synthetase associated
FT                   region; SPTR: C1YR63 Uncharacterized conserved protein;
FT                   PFAM: YbaK / prolyl-tRNA synthetases associated domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65486"
FT                   /db_xref="GOA:D7B6T2"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6T2"
FT                   /protein_id="ADH65486.1"
FT                   /translation="MSDGLNWVRADEHPELLAAPVLAAVRGREDARVAPIDPELADTAQ
FT                   FCERYGMPLATSANCVVVAARRGGEVSYAACMVLATQRADVNGVVRRRLGARKISFAPM
FT                   DEATGLTGMEYGGITPLGLPQGWPVLVDEAVAAEAEVVVGSGVRRSKLLVPGKLLADLP
FT                   GAEVLALTR"
FT   gene            complement(45094..46056)
FT                   /locus_tag="Ndas_0035"
FT   CDS_pept        complement(45094..46056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0035"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="COGs: COG1397 ADP-ribosylglycohydrolase; InterPro
FT                   IPR005502; KEGG: gbr:Gbro_0383 ADP-ribosylation/crystallin
FT                   J1; PFAM: ADP-ribosylation/Crystallin J1; SPTR: C1YR62
FT                   ADP-ribosylglycohydrolase; PFAM: ADP-ribosylglycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65487"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6T3"
FT                   /protein_id="ADH65487.1"
FT                   /translation="MHLPSPGTREDRAAGVLLGTACGDALGVPYEFGPPLSEDRVPEMV
FT                   GGGLGPYAPGEYSDDTQMAVCIAEALREHGDPLSAEALRHTADAFLRWRNEGATDIGNQ
FT                   TAWVMGRAGHAYRRPEVAEVMERVAAERFAEGVPSAGNGSLMRTGPLALAYPDDPEGLA
FT                   AAADRYSRLTHGDPLASEACVLWCEGIRHAVAHGDLAGVRAGLELLPPERRAAWAARLD
FT                   EAEERPPRAFSPNGFVVTALQAAWSAVVREPDGFAPALRAAVRAGDDTDTVAAIAGALL
FT                   GARWGAGAIPGEYLEAVHGWPGYRAGDLAELALRIAGRH"
FT   gene            46154..48034
FT                   /locus_tag="Ndas_0036"
FT   CDS_pept        46154..48034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0036"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="COGs: COG2815 conserved hypothetical protein;
FT                   InterProIPR011009:IPR003610:IPR005543:IPR002290:IPR 000719;
FT                   KEGG: tfu:Tfu_1041 tyrosine protein kinase:serine/threonine
FT                   protein kinase:PASTA; PFAM: PASTA domain containing
FT                   protein; Carbohydrate-binding family V/XII; SMART:
FT                   Carbohydrate-binding family V/XII; PASTA domain containing
FT                   protein; serine/threonine protein kinase; SPTR: C1YR61
FT                   Uncharacterized conserved protein; PFAM: Protein kinase
FT                   domain; Carbohydrate binding domain; PASTA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65488"
FT                   /db_xref="GOA:D7B6T4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6T4"
FT                   /protein_id="ADH65488.1"
FT                   /translation="MRGNRIRAMETPTPDPLFGITLHERYILGKRLRSGASGTVHVAHD
FT                   LGGDQTVTVTVLHPWLVGDHGAVHAFLDRAQTLEGLSHPGIARVLGHGRDGEHVYAVGE
FT                   YLSGHTLAEALGEGGGGLRYPVQAALAIVAGALTALDAAHGAGVVHGALDPHTVVVDGE
FT                   GGVRVTGFPLLFDAEEDAGPETRTDVHAVGRLLYTLLTGVPADPEARPLRPSAVIPGLP
FT                   SDLDMLVANATDPNPRYRPRDAGQYLTVVEQVLRSLSGAPVNPADVDTRPIPVITDAPP
FT                   ERGEERAAPVPPWRRVPVLVTAGVLVLVLFAAGWALVPDDRVALPDLVGASSEQAEERL
FT                   AGLGMDLAVRFEDAYSDTVGAGAVADSTPAPGSDVARGAEVLLHVSTGPRYSGVPDVVG
FT                   GTENEARETLRQAGFTGIEIVQEHSPDQPPGTVLSTEPAAGEEGDREEPVVLSVSEGVI
FT                   VPTLIGMGQEEAATALAGLGLVVQVTEEHHDTAPVGEVSGQTPEPGTILPEEAAVSLTV
FT                   SLGPEPEEEEEESEEEASPSDEDDPRVDEGEQDGRGDQDGWGGRGDDDDDRGRGDGGGS
FT                   CDAPQWNGGTVYDTGDRVQHDGREYEARWWIQGYPPSGDQWGVWEDKGSC"
FT   gene            complement(48143..48985)
FT                   /locus_tag="Ndas_0037"
FT   CDS_pept        complement(48143..48985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0037"
FT                   /product="NmrA family protein"
FT                   /note="COGs: COG0702 nucleoside-diphosphate-sugar
FT                   epimerase; InterPro IPR008030:IPR016040; KEGG:
FT                   saq:Sare_0634 NmrA family protein; PFAM: NmrA family
FT                   protein; SPTR: C1YR60 Predicted nucleoside-diphosphate
FT                   sugar epimerase; PFAM: NmrA-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65489"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6T5"
FT                   /protein_id="ADH65489.1"
FT                   /translation="MAETILVTGATGNTGRHVVAGLLAEGVAVRALVRDPGRARLPEGV
FT                   EVVGGDITDPGAVSAAAEGATGAYLLWPGYGTEGIEETVAALTGHVRRVVYFSAVAAGE
FT                   DADSVWGRVEAAVRASGREWTFLRVTGMAANTLVWAEQVRAGAVRAPHGLASRSLVHER
FT                   DVAAVAVRALLDEGHAGRAYTVTGPESLTQAEQVRILGEETGQPVRWEEQPEEEARAEI
FT                   AESMGADFATAGLAYWASLVDTPEPVSGDVEAVTGRPALTFRAWARERAAHFTAGASV"
FT   gene            49274..50449
FT                   /locus_tag="Ndas_0038"
FT   CDS_pept        49274..50449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0038"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="COGs: COG0683 ABC-type branched-chain amino acid
FT                   transport systems periplasmic component; InterPro
FT                   IPR001828; KEGG: tfu:Tfu_0074 ABC branched-chain amino acid
FT                   transporter substrate-binding protein; PFAM: Extracellular
FT                   ligand-binding receptor; SPTR: C1YR59 Amino acid-binding
FT                   protein; PFAM: Receptor family ligand binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65490"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6T6"
FT                   /protein_id="ADH65490.1"
FT                   /translation="MRKTPLTAASCAVVLAVTACGTPGEAAGGGEDAPVRVGIVYSATG
FT                   PLATYGEQYRQGFEAGLDHATGGTMEIDGRPIEVEYMDDAGDPTKAVTATRDLIGTGHD
FT                   IIAGSTASGIAVQVAPLAEQNDILFISGSAATDAVTGVNDHTFRSGRQTYQDILTAGTF
FT                   MDDPEGADVLVLAQQNAFGQDNVAAVTDVLGAEGADVDSVLAPPETTDLTPFAEQVSQA
FT                   EPDLVFVAWAGETASAMWRALDQQGILDSTEVVTGLDIKPSYPVFGEAGGRISFLSHYF
FT                   DGASDTELARTMKESVEEAGGTVDLFTPDGFTAAQMVVHAAGAGDEVRERIDALEGWTF
FT                   DGVKGELTIRAEDHALLQPMYQVELVGEGEDAHPELVAEIPAADVDPAVAE"
FT   sig_peptide     49274..49351
FT                   /locus_tag="Ndas_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            50452..51324
FT                   /locus_tag="Ndas_0039"
FT   CDS_pept        50452..51324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0039"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG0411 ABC-type branched-chain amino acid
FT                   transport systems ATPase component; InterPro
FT                   IPR017871:IPR003593:IPR003439; KEGG: tfu:Tfu_0075 ABC-type
FT                   branched-chain amino acid transport systems ATPase
FT                   component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: C1YR58 ABC-type branched-chain amino acid
FT                   transport system, ATPase component; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65491"
FT                   /db_xref="GOA:D7B6T7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6T7"
FT                   /protein_id="ADH65491.1"
FT                   /translation="MATEPAGPTEPAGPTEPAGPTEPAGPTGTAVAEAVAAPPAPGAVP
FT                   VLALENLTWSVGGALIVDDVTMAVDEGEFVALIGPNGAGKTSLFNLVSGLTRPTGGRVR
FT                   LAGTDVTRHAPHRRARLGMGRTFQTSSVFGDLTVGANVGLAVQARTGESRRFWRPATPD
FT                   GGPGATAALDLVRLSHRADALAGDLSHGDKRKLELALLLARRPRLILLDEPMAGVSAGE
FT                   VGELTTVIRDVHREQGCTVLMVEHHMEVLLDMADRLAVMHHGALLALTDPDSAMADPEV
FT                   QAAYLGDGA"
FT   gene            51321..52061
FT                   /locus_tag="Ndas_0040"
FT   CDS_pept        51321..52061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0040"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG0410 ABC-type branched-chain amino acid
FT                   transport systems ATPase component; InterPro
FT                   IPR017871:IPR003439:IPR003593; KEGG: tfu:Tfu_0076 ABC-type
FT                   branched-chain amino acid transport systems ATPase
FT                   component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: C1YR57 ABC-type branched-chain amino acid
FT                   transport system, ATPase component; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65492"
FT                   /db_xref="GOA:D7B6T8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6T8"
FT                   /protein_id="ADH65492.1"
FT                   /translation="MSAGGPLLEAADLHVWIEGSHILQGVSLTVPGRGVTALLGRNGVG
FT                   KTTTVKALLGLVPRTGRVSFDGADITARPTHAIVTMGIGYVPEERGVFSALTVAENLRL
FT                   AERRPGQPRYGLVHELFPELRERADQPAGTLSGGQQQMLAIGRALLNDNKLLIVDEPTK
FT                   GLAPRIVREVADAVARAAEQVPVLLVEQNPSLVRRVAERAVVLDAGRVTHTGPALELLD
FT                   DADRVRELLGVSRAAAGTEGRRTA"
FT   gene            52058..52957
FT                   /locus_tag="Ndas_0041"
FT   CDS_pept        52058..52957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0041"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG0559 Branched-chain amino acid ABC-type
FT                   transport system permease components; InterPro IPR001851;
FT                   KEGG: tfu:Tfu_0077 branched-chain amino acid ABC
FT                   transporter permease protein; PFAM: inner-membrane
FT                   translocator; SPTR: C1YR56 Branched-chain amino acid
FT                   ABC-type transport system, permease component; PFAM:
FT                   Branched-chain amino acid transport system / permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65493"
FT                   /db_xref="GOA:D7B6T9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6T9"
FT                   /protein_id="ADH65493.1"
FT                   /translation="MSTVVLLATTGLGLGALYFLIASGLSLIFGLMDVLNFAHGAFLAL
FT                   GAYGTWWAAGHLPGAGTDGFGFLLAVAFGVGAGTLAATLVELCVIRPLYGRHREQILAT
FT                   VGLSLAVPALIQAVWGADPLTFPKPELVSGTAAVLGVNIPRDRFLLILAAAAVFAALWL
FT                   FNSRTRYGLVVRAGVQDRAMVTALGIDVRRSFTLVFAIGGAAAALAGALGGLYFGVVTP
FT                   TQGMSLLVFAFIVVVIGGTASLTGCAIAAVAVGLIQQFANYYTVAGLGDIAVVIVLALV
FT                   LLTRQGGLTAKKSAERVA"
FT   gene            52954..54081
FT                   /locus_tag="Ndas_0042"
FT   CDS_pept        52954..54081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0042"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG4177 ABC-type branched-chain amino acid
FT                   transport system permease component; InterPro IPR001851;
FT                   KEGG: tfu:Tfu_0078 branched-chain amino acid ABC
FT                   transporter permease protein; PFAM: inner-membrane
FT                   translocator; SPTR: C1YR55 ABC-type branched-chain amino
FT                   acid transport system, permease component; PFAM:
FT                   Branched-chain amino acid transport system / permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65494"
FT                   /db_xref="GOA:D7B6U0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6U0"
FT                   /protein_id="ADH65494.1"
FT                   /translation="MMTDTDVATRSSRGPESPGAASGGSARGRRLPRWAVPVAVLAAAL
FT                   CLPFSTLRIPVLFEGALNSPPTLHLLAFCLVFGGLATSYDLLYGRVGLLSFGHALYFAC
FT                   GAYTAALLMRVVELPLLWAAPVAVVGGTLLSLLLGAVSLRVNGIALAMVTLAFAQAGSI
FT                   LVSRDPGRLTGGEEGLSLDTDRVPGAFVGVANTVNLYWAAVAFAAFAVGVVWWLTSSPV
FT                   GRVWRGIRANEQRVAVLGVNPYPYKLAAFTVGGGLASLGGVAYLLVTGGVTPGITTAEF
FT                   TLTLLVMVALGGAGTRWGPLLGAALYTYADHRLLQLGGSEAFAALPAWIAAPLSQPLFI
FT                   LGTLFVLMVFFFPGGLVALPGRVRSALRDRKAART"
FT   gene            54078..54977
FT                   /locus_tag="Ndas_0043"
FT   CDS_pept        54078..54977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0043"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COGs: COG0596 hydrolase or acyltransferase
FT                   (alpha/beta hydrolase superfamily); InterPro IPR000073;
FT                   KEGG: tfu:Tfu_0079 alpha/beta hydrolase superfamily
FT                   protein; PFAM: alpha/beta hydrolase fold; SPTR: C1YR54
FT                   Predicted hydrolase or acyltransferase of alpha/beta
FT                   superfamily; PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65495"
FT                   /db_xref="GOA:D7B6U1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6U1"
FT                   /protein_id="ADH65495.1"
FT                   /translation="MTDVWTDGDEYTVPVPGGDLAVTRWGGRSTTPVLAVHGITANGHS
FT                   FARVAAELDGTGLIAPDLRGRGLSGHLGGPRGLVAHADDMIAVLDAHGVGATVLVGHSM
FT                   GAFVACLAAVRHPDRVSGLLLVDGGYGLPLPPGTDIDTVLGPATARLRMTFEGPDHYRE
FT                   FWRGHPAFAGRWNTWTDHYVLRDLVGEPPAMRSACDEEAVRADGAQVLADPDALGAVHR
FT                   LPCPARLLWTARGLLDDSPGLYTPERLAGLPEGVVTVELPDDNHYSPLFSPTAGLVAEH
FT                   VRALVRAVAPGVPRRSAR"
FT   gene            complement(55372..56103)
FT                   /locus_tag="Ndas_0044"
FT   CDS_pept        complement(55372..56103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0044"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR002198:IPR016040:IPR002347;
FT                   KEGG: fre:Franean1_3110 short-chain dehydrogenase/reductase
FT                   SDR; PFAM: short-chain dehydrogenase/reductase SDR; SPTR:
FT                   C1YR53 Putative uncharacterized protein; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65496"
FT                   /db_xref="GOA:D7B6U2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6U2"
FT                   /protein_id="ADH65496.1"
FT                   /translation="MNSKVAVVTGASRGIGRAVAERLGADGARVIVNYHSDAVAAKDAV
FT                   AAVERAGGRATAVRADVRDATQLSSLFEAAVAEYGGLDVLVSNTGMARPTSLADATDED
FT                   LDLHFAINTRPVFRALKEAVLHMRHGGRVVVISSGATVVAHPGAGLYAASKAAAEQLAR
FT                   TAAHELGPRGITVNSVLPGATRTEALQAQMPADVAASIRSQTPLGRLGEPADIASVVAF
FT                   LVSDEGAWINGQTIHASGGLF"
FT   gene            56196..56624
FT                   /locus_tag="Ndas_0045"
FT   CDS_pept        56196..56624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0045"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="COGs: COG1846 Transcriptional regulators; InterPro
FT                   IPR000835:IPR011991; KEGG: fre:Franean1_3111 MarR family
FT                   transcriptional regulator; PFAM: regulatory protein MarR;
FT                   SMART: regulatory protein MarR; SPTR: C1YR52
FT                   Transcriptional regulator; PFAM: MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65497"
FT                   /db_xref="GOA:D7B6U3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6U3"
FT                   /protein_id="ADH65497.1"
FT                   /translation="MTSHALAAAVTTLHREAAALYALLGREFGLTTQQAQLLCVLTSDR
FT                   PSFSELAATLGCDRTNVTGMIDRLERRGLLARERDSEDRRVHRVTATQEGEQLIARLRD
FT                   RFAESVADRFSRLTPEEHDRLAALATALTPGTAPNSKH"
FT   gene            complement(56715..58712)
FT                   /locus_tag="Ndas_0046"
FT   CDS_pept        complement(56715..58712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0046"
FT                   /product="transcriptional regulator, CdaR"
FT                   /note="COGs: COG3835 Sugar diacid utilization regulator;
FT                   InterPro IPR003018; KEGG: tfu:Tfu_0080 GAF
FT                   domain-containing protein; PFAM: GAF domain protein; SMART:
FT                   GAF domain protein; SPTR: C1YR51 Transcriptional regulator,
FT                   CdaR family; PFAM: GAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65498"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6U4"
FT                   /protein_id="ADH65498.1"
FT                   /translation="MERELNTTTSGSTGVPADDGAAGADGQALFLDLLLRDAPAVEYER
FT                   PVLRARARGDDPEVVAALEAAKMTALRVRSVMRDRRRRESELGALFETANDLAGMRSLD
FT                   QVLQAIVERARNLLGTDTAYLTLSDPEAGGTYMRVTSGSVSAAFQRLRLAPGKGLGGLV
FT                   ATTALPYVTANYFADPRFTHAENIDHAVRDEGLVAILGVPLKMNGRDVGVLFAANRRER
FT                   PFAHSEVALLSSLAAHAAIAIDSANLIDDTRRALDELHTVNERLQRHTASVERSAAAHD
FT                   RLTDLVLRGGGVREVAAAVAEVLGGTVLIHDATSDSSVTASPEGVVREGVPWDAGDGDL
FT                   AEAVRSSLASGRAVRAGRAWVATAAAGTEPLGTLVLRGVELDSTDQRVLERSAMVTALL
FT                   LLIRRSVSETEHRLRGDLLDELLEVPARDPVSLRQRAALLHADLDAPHVLVVAEAPGGD
FT                   PGRLRSAATHVAETTGGLAGSRSGRLVLALPGRDPSAVGRRVADELSGAVNGPVTAGLA
FT                   GPTAGPASFGDAFAEAARCLQTLRALGREGDVATTGDLGFSGLLLSQDRDVPGFVSATL
FT                   GPLLEYDARRGTLLVETLRAYFAAGGNLSRAKEDLHIHVNTVAQRLERIGQLIGADWQR
FT                   PGRALELQLALHLHGLLDRGVDLLGDQNGG"
FT   gene            complement(58697..59530)
FT                   /locus_tag="Ndas_0047"
FT   CDS_pept        complement(58697..59530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0047"
FT                   /product="3-hydroxybutyrate dehydrogenase"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro
FT                   IPR002198:IPR016040:IPR011294:IPR002347; KEGG: tfu:Tfu_0081
FT                   3-hydroxybutyrate dehydrogenase; PFAM: short-chain
FT                   dehydrogenase/reductase SDR; SPTR: C1YR50 3-hydroxybutyrate
FT                   dehydrogenase; TIGRFAM: 3-hydroxybutyrate dehydrogenase;
FT                   PFAM: short chain dehydrogenase; TIGRFAM: 3-hydroxybutyrate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65499"
FT                   /db_xref="GOA:D7B6U5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011294"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6U5"
FT                   /protein_id="ADH65499.1"
FT                   /translation="MTTHEFPSGTARQATRPPVPGTAGNPRTTRVDLTGRTALVTGAAS
FT                   GIGRACALRLADAGARVRMVDLDGRALDELADRGVGEAVELDLTDLDAAEEAARGADVV
FT                   VNNAGVQTVAPVQDFPPERFSLILRLMVESPFRVVRGALPHMYARGWGRVVNISSVHGL
FT                   RASAYKSAYVTAKHGLEGFSKVVALEGAAHGVTSNCVNPGYVRTPLVERQIADQAAAHG
FT                   IPEERVLSEVLLARSPLKRLIEPSEVAELVAYLCGEDASFVNGASLPVDGAWSAS"
FT   gene            59755..61008
FT                   /locus_tag="Ndas_0048"
FT   CDS_pept        59755..61008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0048"
FT                   /product="esterase, PHB depolymerase family"
FT                   /EC_number="3.1.1.73"
FT                   /note="COGs: COG3509 Poly(3-hydroxybutyrate) depolymerase;
FT                   InterPro IPR010126; KEGG: tfu:Tfu_0082 esterase, PHB
FT                   depolymerase; PFAM: Esterase PHB depolymerase; PRIAM:
FT                   Feruloyl esterase; SPTR: C1YR49 Esterase, PHB depolymerase
FT                   family; TIGRFAM: esterase, PHB depolymerase family; PFAM:
FT                   Esterase PHB depolymerase; TIGRFAM: esterase, PHB
FT                   depolymerase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65500"
FT                   /db_xref="GOA:D7B6U6"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6U6"
FT                   /protein_id="ADH65500.1"
FT                   /translation="MDSTAPPASRPLPATALSLTATLATVAVMVAALLIALAPRASAAT
FT                   LTPVPSFGANPGNLAMHSYVPDGLPADAPLVVLLHGCAQNAAAYHDHSGWAGYADEHGF
FT                   ALVYPEQRPANNATGCFNWFQPGDTARDSGEARSVRSMVGHAVSAHGLDADRVYVSGLS
FT                   AGGAMAGELLAAYPDLFAGGSVVAGIPVGCASGMIDAFGCMNPGKTRNPQQWGDEVRAQ
FT                   NPGWDGPWPRVAVWHGTADTTVAPANGEAVASQWTNVHGLSGAPDATERLPGSTTAAYH
FT                   GGDAATAAVAHYTVSGMGHGTPVDPSAGCGTAGAYFLDTVCSTGYTVDFWGIGDGGGPV
FT                   PDPTDPPTEEPTDPPTGPGTCVRDSNYDHVSAGRAVQRSGLVYAVGSGDALGLWNVFVT
FT                   TSLTETSPGHWEHTPGGC"
FT   sig_peptide     59755..59883
FT                   /locus_tag="Ndas_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(61005..61238)
FT                   /locus_tag="Ndas_0049"
FT   CDS_pept        complement(61005..61238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0049"
FT                   /product="conserved hypothetical protein; DNA excision
FT                   repair protein ERCC-3"
FT                   /note="KEGG: hypothetical protein; K10843 DNA excision
FT                   repair protein ERCC-3; SPTR: C1YR48 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65501"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6U7"
FT                   /protein_id="ADH65501.1"
FT                   /translation="MSIWTSDNRSGQVREALTMLLSQGVIDDFRIRPDEEFPFRVTVPA
FT                   GVVPMTEHQAAHFALGAAVSHFGRLARGGNGS"
FT   gene            complement(61446..61940)
FT                   /locus_tag="Ndas_0050"
FT   CDS_pept        complement(61446..61940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0050"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="COGs: COG1846 Transcriptional regulators; InterPro
FT                   IPR000835:IPR011991; KEGG: msl:Msil_2325 transcriptional
FT                   regulator, MarR family; PFAM: regulatory protein MarR;
FT                   SMART: regulatory protein MarR; SPTR: C1YR47
FT                   Transcriptional regulator, MarR family; PFAM: MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65502"
FT                   /db_xref="GOA:D7B6U8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6U8"
FT                   /protein_id="ADH65502.1"
FT                   /translation="MVAMADRTPAPAGGFSLPAVDEQMCFALYAASRAVTNLYRPLLEP
FT                   LGLTYPQYLVMMLLWERGECWVKDFGSVLQLDYGTLTPLLKRLEARGLLVRGRDPRDER
FT                   SVLVALTEEGGRLRARAEGIPEAIGRVIDLPEEEFEATRLALRRLTANVLAGQAQLPEG
FT                   G"
FT   gene            complement(62377..64017)
FT                   /locus_tag="Ndas_0051"
FT   CDS_pept        complement(62377..64017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0051"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG0318 Acyl-CoA synthetase
FT                   (AMP-forming)/AMP-acid ligase II; InterPro
FT                   IPR020845:IPR000873; KEGG: cai:Caci_4817 AMP-dependent
FT                   synthetase and ligase; PFAM: AMP-dependent synthetase and
FT                   ligase; SPTR: C1YR46 Acyl-CoA synthetase
FT                   (AMP-forming)/AMP-acid ligase II; PFAM: AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65503"
FT                   /db_xref="GOA:D7B6U9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6U9"
FT                   /protein_id="ADH65503.1"
FT                   /translation="MAPNAEGPHATSRTRHVLETVRVLVRAGVLSPGRPDRVVRQLRAL
FT                   RTWGATIAGGYAAANERVPDAVAVVDELGPTTFREMDLRGRELARDLRRAGVGAGARVG
FT                   VLCRNHSGFVQTMVACGRLGADTVLLNTGLSAGQLAAAVGGNGVSVVVADAEFEGMCAE
FT                   LDPGVVRVTAWGEPSDGGPGVPWRAREVSESDPEPPERPGRLVVLTSGTTGAPKGARRP
FT                   TPRGPQDAASVLSRIPLRSSDRILVSAPIFHTWGLAGVQLGMSMRATLVMRRLFEPEDA
FT                   LRTVQEERCTALFAVPVMLRRIMDLPRSTRERYDTSSLRIVACSGSAMSPQLITGFMDA
FT                   FGDVLYNLYGSTEVSWATIATPGEMRLSPTTAGRPPLGTRIAVLDPGGVEVPPGTEGSI
FT                   HVGNDMLFDGYTDGRSRRVADGLMETGDRGHVDANGLLHVAGRDDDMIVSGGENVFPRP
FT                   VEEAIVTLPEVREVVVTGVPDEEFGQRFAAYVVPHEGRGVDPNQVRTHVRRVLGRFSVP
FT                   RDVVVVDELPRNATGKVVKRLLPRREERG"
FT   gene            complement(64275..64946)
FT                   /locus_tag="Ndas_0052"
FT   CDS_pept        complement(64275..64946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0052"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: C1YR45 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65504"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6V0"
FT                   /protein_id="ADH65504.1"
FT                   /translation="MSVPRPISPARALLATAAAGVLALAWGGSASAQQGPTTVTPAGAA
FT                   FEAALSGSATFTAGSVVVTCDASSTSPGNGNNLVPTAPGNHNPGGAVSSTINAPDFTDC
FT                   STNVPFVSATVTVADPVWEMTMQHGSPTVGTMVIPAGGIVVTTSGLASCTATVSPDAAA
FT                   AIGGTWTNGSPASTLAFDTAAPVEVTGGFGCPTSATQAPFEAVYEVTNADAPSSPITVT
FT                   G"
FT   sig_peptide     complement(64851..64946)
FT                   /locus_tag="Ndas_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(65111..65479)
FT                   /locus_tag="Ndas_0053"
FT   CDS_pept        complement(65111..65479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2330 hypothetical protein; SPTR:
FT                   C1YR44 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65505"
FT                   /db_xref="GOA:D7B6V1"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6V1"
FT                   /protein_id="ADH65505.1"
FT                   /translation="MILSGAVMASLVAMPVELMIQTGVGGVSSLMFGGMLAVLGLVTWF
FT                   TPNQHVITGSLAGFLGLGALILSNLGGLVVGTLLALAGGGLAFSWRPVARPPRRRGRRR
FT                   RRREEEGVEAPPDTRAGD"
FT   gene            complement(65551..66171)
FT                   /locus_tag="Ndas_0054"
FT   CDS_pept        complement(65551..66171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0054"
FT                   /product="cholesterol esterase"
FT                   /note="KEGG: saq:Sare_0214 cholesterol esterase; SPTR:
FT                   C1YR43 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65506"
FT                   /db_xref="GOA:D7B6V2"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6V2"
FT                   /protein_id="ADH65506.1"
FT                   /translation="MDTTSPDTPESHTSWKRFALFSIPAGAAVGGILVAMAQGALAASF
FT                   TVSGQDFKISAEELNGEGFVQYGWLDQTVREEAVPVAVAGIREAEIQGLCQSVLTEFPI
FT                   VGQISLRLTAGDRGTPVVAENLVIDMSQMDGNASFEDIEIGRDAGTLDQGPQGSRGFDD
FT                   LFGMQSDTIVIEDLEQTARAASAGTFRLSGLSLGISMGDDECF"
FT   sig_peptide     complement(66046..66171)
FT                   /locus_tag="Ndas_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            67127..68647
FT                   /locus_tag="Ndas_R0002"
FT   rRNA            67127..68647
FT                   /locus_tag="Ndas_R0002"
FT                   /product="16S ribosomal RNA"
FT   gene            68973..72064
FT                   /locus_tag="Ndas_R0003"
FT   rRNA            68973..72064
FT                   /locus_tag="Ndas_R0003"
FT                   /product="23S ribosomal RNA"
FT   gene            72169..72283
FT                   /locus_tag="Ndas_R0004"
FT   rRNA            72169..72283
FT                   /locus_tag="Ndas_R0004"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(72411..73478)
FT                   /locus_tag="Ndas_0055"
FT   CDS_pept        complement(72411..73478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0055"
FT                   /product="Peptidase M23"
FT                   /note="InterPro IPR011055:IPR016047; KEGG: sgr:SGR_755
FT                   hypothetical protein; PFAM: Peptidase M23; SPTR: C1YI09
FT                   Metalloendopeptidase-like membrane protein; PFAM: Peptidase
FT                   family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65507"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6V3"
FT                   /protein_id="ADH65507.1"
FT                   /translation="MPLPSAPGLRALGSRTRTLGAAAVAVATSAVLVVTAPTAHARPIP
FT                   AGTPLASADNVEITVDSDTAEALPGGSAAASPEDVLAESVIADVLQARDSSLGALARQE
FT                   RDVRVDVREAADGSAFGVAIVTAPMNVDESPYAWLFAADYEGSAWTVGLEGTEEFSSIL
FT                   ADSALLEEDERETVAASTDPSGVSTSSYIGVGLPFAIGSSMIMTGGPHGNSGGRPYSSV
FT                   DFAGGSGQARAARGGYAYSLCTGWTRVIHDNGYSTDYYHLENYQWLPGNNVGVGHYLGT
FT                   QGNSLCAGGSTTGAHIHFSLRGYSDPNAAGWYVALHGRTLGGWTFVEGGAYGGYAYRNG
FT                   VGTVYPGGSMYNYGF"
FT   sig_peptide     complement(73356..73478)
FT                   /locus_tag="Ndas_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(73668..74192)
FT                   /locus_tag="Ndas_0056"
FT   CDS_pept        complement(73668..74192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0056"
FT                   /product="methylated-DNA/protein-cysteinemethyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="COGs: COG0350 Methylated DNA-protein cysteine
FT                   methyltransferase; InterPro
FT                   IPR014048:IPR011991:IPR001497:IPR008332; KEGG: pfl:PFL_5108
FT                   methylated-DNA--protein-cysteine methyltransferase; PFAM:
FT                   Methylated-DNA-[protein]-cysteine S-methyltransferase DNA
FT                   binding; methylguanine DNA methyltransferase ribonuclease
FT                   domain protein; PRIAM: Methylated-DNA--[protein]-cysteine
FT                   S-methyltransferase; SPTR: C1YI08 O-6-methylguanine DNA
FT                   methyltransferase; TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: 6-O-methylguanine DNA
FT                   methyltransferase, ribonuclease-like domain;
FT                   6-O-methylguanine DNA methyltransferase, DNA binding
FT                   domain; TIGRFAM: O-6-methylguanine DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65508"
FT                   /db_xref="GOA:D7B6V4"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6V4"
FT                   /protein_id="ADH65508.1"
FT                   /translation="MATVEFRAPLPGPTRYTTMESPVGDLTLFGDGAALGGVLTPAKDG
FT                   LTRVVPQDWVADHKPFADAEEQLRAYFAGELREFTLPLAPVGTDWQLRVWAALTTIPFG
FT                   ETASYGQLAEELGRPTASRAVGMANGRNPISIIVPCHRVIGANGSLTGYAGGLERKEFL
FT                   LGLEGRVAGIR"
FT   gene            complement(74282..76021)
FT                   /locus_tag="Ndas_0057"
FT   CDS_pept        complement(74282..76021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0057"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="COGs: COG2169 Adenosine deaminase;
FT                   InterProIPR011257:IPR004026:IPR012294:IPR009057:IPR
FT                   010316:IPR000005:IPR003265:IPR018060; KEGG: nca:Noca_3301
FT                   DNA-3-methyladenine glycosylase II / transcriptional
FT                   regulator Ada / DNA-O6-methylguanine--protein-cysteine
FT                   S-methyltransferase; PFAM: Ada metal-binding domain
FT                   protein; helix-turn-helix- domain containing protein AraC
FT                   type; AlkA domain protein; HhH-GPD family protein; SMART:
FT                   Helix-turn-helix, AraC domain; HhH-GPD family protein;
FT                   SPTR: C1YI07 DNA-O6-methylguanine--protein-cysteine
FT                   S-methyltransferase; DNA-3-methyladenine glycosylase II;
FT                   Transcriptional regulator Ada; PFAM: Metal binding domain
FT                   of Ada; AlkA N-terminal domain; Bacterial regulatory
FT                   helix-turn-helix proteins, AraC family; HhH-GPD superfamily
FT                   base excision DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65509"
FT                   /db_xref="GOA:D7B6V5"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010316"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6V5"
FT                   /protein_id="ADH65509.1"
FT                   /translation="MSENRQLRCAASANMDGVMDDDQRYRAVHSRDARFDGVFYTAVRT
FT                   TGIYCRPSCPAVTPKRANVRFYPTAAAAQESGFRACKRCRPDLTPGSPEWNLRADVVGR
FT                   AMRLIQDGAVDRGGVSALASAVGYSERQLNRLLSAEVGAGPLALARTERAQTARVLVET
FT                   TDMPMADVAFAAGFASVRQFNETMRAVFDRSPTEMRTMGGRRASASGGSRPGDARPPAT
FT                   EPGTVTLRLPYREPIDLARMLRFLGDRAVPGVEEYRDGVYRRTLMLAHGPAVVELSEGS
FT                   GTGRAGRTGRAGATGGVRPADAVDGGVSVSGGGHVLCRLRLSEARDLTSAVRRCRRLLD
FT                   LDADPGAVAEALGGDPLLGPIVAAHPGLRSPGHVDPAELAVRAVLGQQVSVRAARTLAG
FT                   RLVERFGEPLAPGLEAPGGGLTHVFPSPDALAAADPAGFSVPVARGRALAGLCEAIASG
FT                   WIDLGPGCDRDEAERRLVELRGIGPWTAGYVRMRGLGDPDVFLHGDLGVRMALEAGGRR
FT                   ATPAAAAREAREWSPWRSYANHALWASLADRERESTAVRADVVVRDGVRDASKERQERK
FT                   ESA"
FT   gene            complement(76102..76545)
FT                   /locus_tag="Ndas_0058"
FT   CDS_pept        complement(76102..76545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0058"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2579 hypothetical protein; SPTR:
FT                   C1YI06 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65510"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6V6"
FT                   /protein_id="ADH65510.1"
FT                   /translation="MGDDVTEFDQTSTEDLRDRAVELARQRWDLRFFWRLLRLIPAAEA
FT                   AAGNEEASEASVAQLSGFVYEALSAEADPDVQEALRPVYVQYLLDHGETAEGVTGDGGA
FT                   GATGIPGGADAPASGTEGPVRGGADAPASPPAPGTRDDRGGPL"
FT   gene            76692..77102
FT                   /locus_tag="Ndas_0059"
FT   CDS_pept        76692..77102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0059"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="COGs: COG2185 Methylmalonyl-CoA mutase C-terminal
FT                   domain/subunit (cobalamin-binding); InterPro
FT                   IPR006158:IPR006159; KEGG: stp:Strop_3814 cobalamin
FT                   B12-binding domain-containing protein; PFAM: cobalamin
FT                   B12-binding domain protein; SPTR: C1YI05 Methylmalonyl-CoA
FT                   mutase family protein; PFAM: B12 binding domain; TIGRFAM:
FT                   methylmalonyl-CoA mutase C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65511"
FT                   /db_xref="GOA:D7B6V7"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6V7"
FT                   /protein_id="ADH65511.1"
FT                   /translation="MAEGAPRIVVAKPGLDGHDRGVKIVARVLRDAGVEVIYTGLRQTP
FT                   EMIVAAALQEDADAIGLSVLSGAHMTMFSRVLELLRENGAEDIRVFGGGIIPDADIAEL
FT                   ERLGVAKIFTPGAPTSEIADWVRENVRPAHAA"
FT   gene            77516..78697
FT                   /locus_tag="Ndas_0060"
FT   CDS_pept        77516..78697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0060"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="COGs: COG0045 Succinyl-CoA synthetase beta subunit;
FT                   InterProIPR016102:IPR013816:IPR017866:IPR013650:IPR
FT                   005811:IPR005809:IPR011761; KEGG: tfu:Tfu_2577 succinyl-CoA
FT                   synthetase subunit beta; PFAM: ATP-grasp domain protein;
FT                   ATP-citrate lyase/succinyl-CoA ligase; PRIAM:
FT                   Succinate--CoA ligase (ADP-forming); SPTR: C1YHN3
FT                   Succinyl-CoA synthetase (ADP-forming) beta subunit;
FT                   TIGRFAM: succinyl-CoA synthetase, beta subunit; PFAM:
FT                   CoA-ligase; ATP-grasp domain; TIGRFAM: succinyl-CoA
FT                   synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65512"
FT                   /db_xref="GOA:D7B6V8"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6V8"
FT                   /protein_id="ADH65512.1"
FT                   /translation="MDLFEYQAKQLFAEYGVPVPQGKVASTAAEARAIADEFAAAGKPR
FT                   VVVKAQVKTGGRGKAGGVKVAEGPEDAQAKAEQILGMDIKGHTVHRVLVEEASDIAEEY
FT                   YFSFLLDRANRTFLSICSAEGGMDIEEVAETNPDAVAKFPVDALTGAPASIAAEIVKAG
FT                   KLPEAATEGATEVITKLWDAFVGKDATLVEVNPLILTKDGRVVALDGKVTLDENAEFRQ
FT                   DLESLTFAEEGDPLEVAAKAKGLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEAHGGV
FT                   KPANFLDIGGGASAEVMANGLDIILGDPSVKSVFVNVFGGITACDAVANGIVQALELLE
FT                   SRGDDVSKPLVVRLDGNNAELGREILTKRAHPAVRQVDTMDGAAAQAAELAAK"
FT   gene            78712..79590
FT                   /locus_tag="Ndas_0061"
FT   CDS_pept        78712..79590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0061"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="COGs: COG0074 Succinyl-CoA synthetase alpha subunit;
FT                   InterProIPR016040:IPR005810:IPR016102:IPR003781:IPR
FT                   017440:IPR005811; KEGG: tfu:Tfu_2576 succinyl-CoA
FT                   synthetase subunit alpha; PFAM: CoA-binding domain protein;
FT                   ATP-citrate lyase/succinyl-CoA ligase; SMART: CoA-binding
FT                   domain protein; SPTR: C1YHN2 Succinyl-CoA ligase
FT                   [ADP-forming] subunit alpha; TIGRFAM: succinyl-CoA
FT                   synthetase, alpha subunit; PFAM: CoA binding domain;
FT                   CoA-ligase; TIGRFAM: succinyl-CoA synthetase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65513"
FT                   /db_xref="GOA:D7B6V9"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6V9"
FT                   /protein_id="ADH65513.1"
FT                   /translation="MAIFLNKDSKVLVQGMTGSEGTKHTRRMLASGTTIVGGVNPRKAG
FT                   QKVDFDGTEVPVFGSVAEGMAATGADVTVIFVPPKFSREAVFEAIDAEIGLAVVITEGI
FT                   PVHDTAAFWAHAQAKGNKTRIIGPNCPGLITPGQSNAGIIPSDITKPGRIGLVSKSGTL
FT                   TYQMMYELRDIGFSSAVGIGGDPIIGTTHIDALAAFEADPDTDVIVMIGEIGGDAEERA
FT                   AEFIRDNVTKPVVGYVAGFTAPEGKTMGHAGAIVSGSSGTAAAKKEALEAVGVKVGKTP
FT                   SETAQLARALF"
FT   gene            complement(79680..80150)
FT                   /locus_tag="Ndas_0062"
FT   CDS_pept        complement(79680..80150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0062"
FT                   /product="protein of unknown function DUF1707"
FT                   /note="InterPro IPR012551; KEGG: tfu:Tfu_2402 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1707; SPTR:
FT                   C1YI04 Putative uncharacterized protein; PFAM: Domain of
FT                   unknown function (DUF1707)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65514"
FT                   /db_xref="GOA:D7B6W0"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6W0"
FT                   /protein_id="ADH65514.1"
FT                   /translation="MPGPEHPRPYRLSDAERDVALARLRTAFEEGRLDVDEHEERASLA
FT                   VRAVTSSDLVPLFDDLPATDTRAPASGRGSAQVPAPRRAEGRTAPACADGGGRSAPWWG
FT                   VLPWVGFVFLFWGLPAVLDGSREALIGWGIFLAVMIVPHVVVGVAGHFRRPA"
FT   gene            80292..82079
FT                   /locus_tag="Ndas_0063"
FT   CDS_pept        80292..82079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0063"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2575 hypothetical protein; SPTR:
FT                   C1YI01 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65515"
FT                   /db_xref="GOA:D7B6W1"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6W1"
FT                   /protein_id="ADH65515.1"
FT                   /translation="MSTSGSPPDRGRPSQRTRSSGAAEPDAAAAPRPVYATGGIAAATA
FT                   AALGLAVIVTLTIIGWVAAPHDTFGEDIIDILQGAVLAWLVGHHVSFSVPDGQIALLPL
FT                   GLVLLPGLLLYRSGRWLARSCDIPRLRYVYRAALAIAGPYAAIAGTLALLARTEAVEPS
FT                   MPRALVMGFVTAFLAGGLGVLRQLMRDKEVPVRDLLRLMPARSRSLLVGMLASTGTLLL
FT                   GGLVLFLVALAMSLPEVVETTRVLGPGLVGGALLIVVQLAYLPNAVVFALCYALGPGFA
FT                   VGAGTVVAPTGVSVGALPMLPMLAALPSNGAAPVASLLALAVPFVAGAVGGALTQRSAP
FT                   DVVSEAAPLWGFVCGVTTGLLCAALAALAGGPLGDERLSEVGPSAWQVGLVAALEVGVA
FT                   AAVVAWVANWWYTRGERPARRAPRWTAWRGRRRAKEDTASSAGEAPAARATPRSAKGVT
FT                   RPAKEAARSARDAARSAEEEPRERPEVELPPDVPVGEGLATVTPLRRREQEVRPDPEED
FT                   ASPEAPEDEEPDADRAAERAERKRARRELRDQRRAERRARRAEGGRWWRRRPAEDEESE
FT                   EMYGITYEAEPDGVDTPQR"
FT   gene            complement(82228..85833)
FT                   /locus_tag="Ndas_0064"
FT   CDS_pept        complement(82228..85833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0064"
FT                   /product="transcription-repair coupling factor"
FT                   /note="COGs: COG1197 Transcription-repair coupling factor
FT                   (superfamily II helicase);
FT                   InterProIPR011545:IPR004576:IPR003711:IPR001650:IPR
FT                   014021:IPR005118:IPR014001; KEGG: tfu:Tfu_0424
FT                   transcription-repair coupling factor; PFAM: transcription
FT                   factor CarD; DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; TRCF domain protein; SMART:
FT                   DEAD-like helicase ; helicase domain protein; SPTR: C1YHZ5
FT                   Transcription-repair coupling factor Mfd; TIGRFAM:
FT                   transcription-repair coupling factor; PFAM: Helicase
FT                   conserved C-terminal domain; TRCF domain; CarD-like/TRCF
FT                   domain; DEAD/DEAH box helicase; TIGRFAM:
FT                   transcription-repair coupling factor (mfd)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65516"
FT                   /db_xref="GOA:D7B6W2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6W2"
FT                   /protein_id="ADH65516.1"
FT                   /translation="MSLIGLLADVSRDPALHSAIEAARGGRDPHLDLVAPAALRPFMVG
FT                   ALAADAPVGAQRPVLAVTATEREASDLADALGCLLPEDSVALFPAWETLPHERLSPRSD
FT                   TVGQRLAVLRRLAHPDPSDPLTTPLRVVVAPVRSVLQPLVSGLGDLEPVRIRPGDEVPL
FT                   EEVVQALANTGYARVDLVEKRGDMAVRGGILDVFPPTEEHPLRLEFWGDTVEDVRYFQV
FT                   ADQRSIESGGGDDPRTSASSGLFAPPCRELLLTDTVRGRARALAEEHPSLAEILHKIAD
FT                   GVAVEGMEAFAPVLAERMEPFLAHLPEGAMVVGCDPERIRTRAVELEATSAEFLDASWI
FT                   NAASGGEAPIDLGESAYMSISELRSTAAELGLPWWGLTPFAADEQGGAAEEDDAVVVGA
FT                   VPSESYRGDTERALADIKGWLHDNWSVVLVTQGHGPAERLVAMLRDAGLGASLSADLTE
FT                   RPKPAVATVTTGLVDHGFLLRSVRTVVLTETDLAGQKSSTRDMRRMPSRRRGTVDPLQL
FT                   KPGDYVVHEQHGVGRYLEMVSRQVQGATREYLLIEYAPSKRGQPGDRLFVPTEQLGEVT
FT                   RYVGGEAPTLSKMGGAEWSKAKSRARKVVREIAGDLIRLYSARQASPGHAFGPDTPWQR
FT                   ELEDAFPYVETPDQLAAIDEVKKDMSRSVPMDRLICGDVGYGKTEVAVRAAFKAVQDGK
FT                   QVALLVPTTLLVQQHLSTFTERYASFPVTVKPMSRFQTDGEVEATREGLRSGEVDVVIG
FT                   THRLLSSETRFKDLGLVIIDEEQRFGVEHKEALKRLRTQVDVLAMSATPIPRTLEMGLT
FT                   GIREMTTILTPPEERHPVLTFVGPYEDKQITAAIRRELMREGQVFFVHNRVASIDKVAA
FT                   SIQRLVPEARVAYAHGQMNEQQLEKVMVDFWEKNFDVLVSTTIVESGLDVPNANTLIID
FT                   RADTYGLSQLHQLRGRVGRGRERAYAYFLYPPERPLTETAYERLATVAQHTETGAGMYV
FT                   AMKDLEIRGAGNILGAEQSGTIAGVGFDLYVRMVGEAVAELKGDPDAAEEVETKVELPI
FT                   NAYIPHDYVPGERLRLQSYKRIASVTSEEDILAAYEELTDRYGTPPEQVDNLMAVARFR
FT                   VLAKSAGLSDVVMQGNQIRFAPVELRESQELRLRRLYPKTIHKETTRTLLVPVPKSGGL
FT                   GGRPLRDLELLKWCTDLVNSIFEPQKRKPAPKENA"
FT   gene            86156..87739
FT                   /locus_tag="Ndas_0065"
FT   CDS_pept        86156..87739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0065"
FT                   /product="adenylylsulfate kinase"
FT                   /note="COGs: COG0529 Adenylylsulfate kinase and related
FT                   kinase; InterPro IPR015947:IPR002650:IPR002891; KEGG:
FT                   tfu:Tfu_0425 adenylylsulfate kinase; PFAM: adenylylsulfate
FT                   kinase; ATP-sulfurylase; SPTR: C1YI00 Adenylylsulfate
FT                   kinase ApsK; TIGRFAM: adenylylsulfate kinase; PFAM:
FT                   ATP-sulfurylase; Adenylylsulphate kinase; TIGRFAM:
FT                   adenylylsulfate kinase (apsK)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65517"
FT                   /db_xref="GOA:D7B6W3"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6W3"
FT                   /protein_id="ADH65517.1"
FT                   /translation="MVSANRRGSAPQGGVGSPDAPVFAPGPDGLAHLELILNGAYPLPG
FT                   FMTRDEAVSVERDGRLPDGRPWPVPVTLEVPEELSGADHLTLSDPEGAPLAGLDVTEHW
FT                   RDAGGRHLLAGSVTLLRPPTYGVLRELRPSPAEVRAQRELEPSERPLLAVVTDRPLHHR
FT                   ALHQIRAEADALGLVHGEGGRADVLVIVDTGLEDEGMATAVLAAGPLLPARTSFVVCTL
FT                   PRSADRARGLFGGPWGPRQVGLAAHVAASYGATHMLAVTGGDGPDVERVMALRPPLTVL
FT                   DPEPWRYHSSDGLWLPMTRTDPASARVELTDEQVETELAHGRELPSWFTPARVGAELAR
FT                   LRPARTSRGLTVLFTGLSGSGKSTIARGVCDGIRRSGRPVTLLDGDVVRRMLSSGLTFS
FT                   REHRELNIRRIGYVASEITRHGGVTVCAPIAPYAKGRAEVRAMVEEFGDFFLVHVATPL
FT                   EVCEARDRKGLYAKARAGEIPEFTGISDPYEEPDDADLVVDTESVDPAESVARVLSALR
FT                   AGGWLPEHDG"
FT   gene            87769..88566
FT                   /locus_tag="Ndas_0066"
FT   CDS_pept        87769..88566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0066"
FT                   /product="MazG family protein"
FT                   /note="COGs: COG3956 Protein containing tetrapyrrole
FT                   methyltransferase domain and MazG-like (predicted
FT                   pyrophosphatase) domain; InterPro IPR004518:IPR011551;
FT                   KEGG: tfu:Tfu_0426 MazG family protein; PFAM: MazG
FT                   nucleotide pyrophosphohydrolase; SPTR: C1YI03 MazG family
FT                   protein; TIGRFAM: MazG family protein; PFAM: MazG
FT                   nucleotide pyrophosphohydrolase domain; TIGRFAM: MazG
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65518"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6W4"
FT                   /protein_id="ADH65518.1"
FT                   /translation="MNDPRDPRDVRDAQGGRDGGPPVGHRVLRLVEVMDTLRRECPWDR
FT                   DQTHGSLAKYLIQEAYETLETIEEGDFALLREELGDVLLQVVFHAAVAAERPEGDPARF
FT                   TVDDVADAIIDKMTRRHPHVFGGVEVSGADEVGSNWEAIKAAERAEKARAAGGDGRNSV
FT                   LDGVPFAQPAVLLADELQRRAVRNGFPADLVGDDGAEGGELFSAVAAERGRGRDAESDL
FT                   RAAARRFDARVRAAEDAARADGREPRELSEREWRTYWDKAGEA"
FT   gene            complement(88714..89916)
FT                   /locus_tag="Ndas_0067"
FT   CDS_pept        complement(88714..89916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0067"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="COGs: COG0654 2-polyprenyl-6-methoxyphenol
FT                   hydroxylase and related FAD-dependent oxidoreductase;
FT                   InterPro IPR002938:IPR003042; KEGG: sen:SACE_6186
FT                   monooxygenase, FAD-binding; PFAM: monooxygenase
FT                   FAD-binding; SPTR: C1YI02 2-polyprenyl-6-methoxyphenol
FT                   hydroxylase-like oxidoreductase; PFAM: FAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65519"
FT                   /db_xref="GOA:D7B6W5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6W5"
FT                   /protein_id="ADH65519.1"
FT                   /translation="MTAVRNVLISGAGIAGPTLAHWLHHHGIEATVVERAPAPRTGGYA
FT                   IDVRGTALDVAERMGVLDGVRASATEMSRATTVDARGRRTGGFEASSVTADGRSAELLR
FT                   GDLVRLVHAPTTAYTEYLYGDSVTAIEQEPDGVRVTFERSRPRVFDLVVGADGLHSTTR
FT                   RLAFGPEAPHRRFLGSYISIFTVPNHPGLDREAVLFNTPGRLVAMYQTPRARGAKAMLA
FT                   LSAREENGVDRRPPGQQREFLRRAFAGHGWEADRILEAMERAPDFYFDSVAQIRMDRWS
FT                   TGRVTLLGDAGYCPSPMSGQGSSLAVVGAHVLARELARHDDHRAALAAYEARMRPFVAA
FT                   NQDIADRGQAFLLPRTRPALLARGLLLRLAPLLSSLGGFDNRLSRASEALELDAPAPAG
FT                   A"
FT   sig_peptide     complement(89851..89916)
FT                   /locus_tag="Ndas_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            90067..90624
FT                   /locus_tag="Ndas_0068"
FT   CDS_pept        90067..90624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0068"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR009057:IPR012287:IPR001647; KEGG:
FT                   svi:Svir_26800 transcriptional regulator; PFAM: regulatory
FT                   protein TetR; SPTR: C1YHZ9 Transcriptional regulator, TetR
FT                   family; PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65520"
FT                   /db_xref="GOA:D7B6W6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6W6"
FT                   /protein_id="ADH65520.1"
FT                   /translation="MPRARSDTKAQIRAVALELFARKGFEKTSLREIAERLDITKAALY
FT                   YHFPSKNDLLTSLVRPLGEDMEALFARYGGRGGADDPRALLGDYFDVCVRHSALLLAVL
FT                   NDLGALADVGLVESVISWRRRLDALLVGPEGGVPARMGAVIALGGIQDLSVMFSPEEAA
FT                   DHRERAIDIAMAALESGMSDMD"
FT   gene            90729..92012
FT                   /locus_tag="Ndas_0069"
FT   CDS_pept        90729..92012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0069"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="COGs: COG0148 Enolase; InterPro
FT                   IPR020809:IPR020811:IPR020810:IPR000941; KEGG: tfu:Tfu_0428
FT                   phosphopyruvate hydratase; PFAM: Enolase-like; PRIAM:
FT                   Phosphopyruvate hydratase; SPTR: C1YHZ8 Enolase; TIGRFAM:
FT                   enolase; PFAM: Enolase, N-terminal domain; Enolase,
FT                   C-terminal TIM barrel domain; TIGRFAM: phosphopyruvate
FT                   hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65521"
FT                   /db_xref="GOA:D7B6W7"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6W7"
FT                   /protein_id="ADH65521.1"
FT                   /translation="MASIEAVQAREILDSRGNPTVEVEVLLDDGTIARAGVPSGASTGQ
FT                   FEAVELRDGGDRYGGKGVTKAVTAVNDEIADELLGHAPDEQRIIDRALIDLDGTPDKSR
FT                   IGANAILGASLAVARAAAAEAGLPLFRYIGGPNAHVLPVPMMNILNGGAHADSNVDIQE
FT                   FMVAPIGAPTFSEAVRWGTEVYHALKSVLKAHGLATGVGDEGGFAPNLDSNRAALDLIV
FT                   EAIEKAGYTPGTDIALALDVAASEFFSDGVYTFEGKARSSEEMAAYYAELVEAYPLVSI
FT                   EDPLDEEDWEGWKKLTAQLGDKVQLVGDDLFVTNPERLQRGILADTANSLLVKVNQIGT
FT                   LTETLDAVSLAQRSGYTAMISHRSGETEDTTIADIAVATNAGQIKTGAPARSERVAKYN
FT                   QLLRIEEELDDAAVYAGVSAFPRFAARG"
FT   gene            92154..92525
FT                   /locus_tag="Ndas_0070"
FT   CDS_pept        92154..92525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0070"
FT                   /product="Septum formation initiator"
FT                   /note="InterPro IPR007060; KEGG: tfu:Tfu_0429 hypothetical
FT                   protein; PFAM: Septum formation initiator; SPTR: C1YHZ7
FT                   Septum formation initiator; PFAM: Septum formation
FT                   initiator"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65522"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6W8"
FT                   /protein_id="ADH65522.1"
FT                   /translation="MLTSRAAILALVVCVIALSLAYPLREYIAQRAQLAELREERARME
FT                   QSVQDLRQREEEMTQDAYVEREARVRLHYQYPGETAYIVIPPDSEDEDEDDTGPSEPWF
FT                   TTLWRSVEEADSPPPDDGL"
FT   sig_peptide     92154..92216
FT                   /locus_tag="Ndas_0070"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(92536..92913)
FT                   /locus_tag="Ndas_0071"
FT   CDS_pept        complement(92536..92913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0071"
FT                   /product="CrcB protein"
FT                   /note="COGs: COG0239 Integral membrane protein possibly
FT                   involved in chromosome condensation; InterPro IPR003691;
FT                   KEGG: sro:Sros_5461 camphor resistance protein CrcB; PFAM:
FT                   Camphor resistance CrcB protein; SPTR: C1YHZ6 Protein crcB
FT                   homolog; TIGRFAM: CrcB protein; PFAM: CrcB-like protein;
FT                   TIGRFAM: crcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65523"
FT                   /db_xref="GOA:D7B6W9"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6W9"
FT                   /protein_id="ADH65523.1"
FT                   /translation="MNWDVWLVGLGGGAGAALRYLVDRAVSRAVGTGLPWGTFTVNVAG
FT                   TLLLGLLVGAAGAAALPPRLWALLSVGLCGALTTYSTFSHEVLSLAREGRVPAAAGYAA
FT                   LTGGCALAALAAGAWAAGALL"
FT   gene            complement(92910..93350)
FT                   /locus_tag="Ndas_0072"
FT   CDS_pept        complement(92910..93350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0072"
FT                   /product="CrcB protein"
FT                   /note="COGs: COG0239 Integral membrane protein possibly
FT                   involved in chromosome condensation; InterPro IPR003691;
FT                   KEGG: sro:Sros_5463 integral membrane protein possibly
FT                   involved in chromosome condensation-like protein; PFAM:
FT                   Camphor resistance CrcB protein; SPTR: C1YHZ4 Protein crcB
FT                   homolog; TIGRFAM: CrcB protein; PFAM: CrcB-like protein;
FT                   TIGRFAM: crcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65524"
FT                   /db_xref="GOA:D7B6X0"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6X0"
FT                   /protein_id="ADH65524.1"
FT                   /translation="MSADDRAPRSRHVAAMAGIAACGGAAGAVARHLVAQAWPTPDGGP
FT                   PLATLAVNLAGSVLIGVLVAAAAGPRPAPPWVRQLLGTGFLGGFTTYSAHVLDTGALAA
FT                   SGRVAEAAAYMALTLVGAVAGTALGAWATGRAVRALVRRRRP"
FT   sig_peptide     complement(93240..93350)
FT                   /locus_tag="Ndas_0072"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            93618..94205
FT                   /locus_tag="Ndas_0073"
FT   CDS_pept        93618..94205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0073"
FT                   /product="protein of unknown function DUF501"
FT                   /note="COGs: COG1507 conserved hypothetical protein;
FT                   InterPro IPR007511; KEGG: tfu:Tfu_0430 hypothetical
FT                   protein; PFAM: protein of unknown function DUF501; SPTR:
FT                   C1YHZ3 Uncharacterized conserved protein; PFAM: Protein of
FT                   unknown function (DUF501)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65525"
FT                   /db_xref="InterPro:IPR007511"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6X1"
FT                   /protein_id="ADH65525.1"
FT                   /translation="MTSADQPAPGHAAGRPAPVAERDTAAVELQLGRPPRGVRAIAHRC
FT                   PCGLPDVVRTAPRLENGEPFPTLYYLTCPRAASAIGRMENEGRMRRMQERLGEEPELRA
FT                   AYTRAHEAYLAERAEQARLDGVEPLPEGMQSTGGMPTRVKCLHALVAHELAEPGTNPFG
FT                   AEALEELPHWWDRGPCVCVDEDAPEGDEGNAS"
FT   gene            94202..95182
FT                   /locus_tag="Ndas_0074"
FT   CDS_pept        94202..95182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0074"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="COGs: COG0248 Exopolyphosphatase; InterPro
FT                   IPR003695; KEGG: tfu:Tfu_0431 Ppx/GppA phosphatase; PFAM:
FT                   Ppx/GppA phosphatase; SPTR: C1YHZ2 Ppx/GppA phosphatase;
FT                   PFAM: Ppx/GppA phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65526"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6X2"
FT                   /protein_id="ADH65526.1"
FT                   /translation="MSGVAAIDCGTNSVRLLIADVVHVGEDEVQVVDVDRRMEIVRLGE
FT                   GVDETGAFAPQALERTFEALRGYAEAIEAHGIALGPDAVRMVATSATRDASNRQVFVDG
FT                   VRDILGVEPEVVTGLDEAELSFVGATAELEAEGPGEDLAPPFLVVDIGGGSTEFVLGGA
FT                   LSGDDGELVRASLSVDIGCVRMTERHLRSDPPTAQEVAAATADIEAALDEVERVVPLRE
FT                   AASVVCVAGTATTVAGIALDLPEYDPERIHHTRVGVADLDRITGELLKATSRERSMIGV
FT                   MHPGRVDVIGAGALVLSRVLARTGADSFTASEHDILDGVAWSLVV"
FT   gene            95529..96905
FT                   /locus_tag="Ndas_0075"
FT   CDS_pept        95529..96905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0075"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG1252 NADH dehydrogenase FAD-containing
FT                   subunit; InterPro IPR013027:IPR001327; KEGG: tfu:Tfu_0432
FT                   NADH dehydrogenase; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; SPTR: C1YHZ1 NADH
FT                   dehydrogenase, FAD-containing subunit; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65527"
FT                   /db_xref="GOA:D7B6X3"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6X3"
FT                   /protein_id="ADH65527.1"
FT                   /translation="MTESRNYRLVHGGGDDAEIPHILIVGGGYLGMYTARRLEKKLGAG
FT                   EARITVIDPNSYMTYQPFLPETASGSISPRHVVVPLRKVFKRVRVLGGRVVRIDHADRT
FT                   VRYEPNVGEAQTLAYDYLVMAAGAVSRTLPIPGLAEWGIGIKTVEEAAFLRNHVLDQLS
FT                   IADSTDDEAIRRKALNFVFVGGGFAGAEAIAELEDMVRDAVRHHPSIGLEDVQFYLIEA
FT                   ADKILPEVGPEVGSKALNQLRRRGIDVRLKTFLESAVDQHIKLSDGTEFDSGTLVWTAG
FT                   VKPSPVVAASDLPLGPKGHLDTSEYLAVNGVENAFAGGDNAQVPDGNGGYYPPNAQNAV
FT                   RQAPVLADNVIAALRGTEPKAYRHKNLGAVAGLGVHKGAAQLFGKIKLNGRLAWYAHRS
FT                   YHLFAVPTFNRKMRVLSDWTLALFLRRDYAALPEMAEPRQAFEEASHPQIEDGRLRRVS
FT                   "
FT   gene            97034..97110
FT                   /locus_tag="Ndas_R0005"
FT   tRNA            97034..97110
FT                   /locus_tag="Ndas_R0005"
FT                   /product="tRNA-Leu"
FT   gene            complement(97212..99047)
FT                   /locus_tag="Ndas_0076"
FT   CDS_pept        complement(97212..99047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0076"
FT                   /product="transcriptional regulator, CdaR"
FT                   /note="COGs: COG3835 Sugar diacid utilization regulator;
FT                   KEGG: sen:SACE_1980 transcriptional regulator, CdaR; SPTR:
FT                   C1YHZ0 Sugar diacid utilization regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65528"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6X4"
FT                   /protein_id="ADH65528.1"
FT                   /translation="MSNDRPASDPRPASGGGSPRPHPRPEVPPVQDGSSDDRTTGLPLR
FT                   GLLLALGDPVVDVAAAPDGLDVQVDNVVILDPEDRTEVREGDLVLLIGARGASARRLVR
FT                   ALAERGATAVAVKTSAHPASEEAPPTAGTRPGRPRPGGGDEARALRTEAREAGIALLAV
FT                   RPEVRWDQLQSVCRSILDEARLTASEDLGESGGDLFSMAQTIARLTGGLVSIEDAASRV
FT                   LAYSSGAEVDELRRLSVLGRRGPESYLALLREWGVFAKLRAGEEVVRVEEHPELGIRRR
FT                   LAVGIHAGRQPLGAIWVQEGDRPLAEHAEEALLGAARTTALQMIRQRTQASAGLRLRED
FT                   LLSSLLEGRIDAGALADTVEVHADRGALVVAFALVEGSEGAAEERPDRPERELRRRQLI
FT                   DLVSVHTAAYRRSALVTALGGRVYVLLPDLARVREGRRGVERSVLALTRKTVAAARAAL
FT                   GLEVRAAVGSLVERLGDVPDSRAEADRVLDAVERSPDRGPGWDVATISDVRSRVLVSET
FT                   LARLREDPSLRDPRVSRLIEHDRAGGADLVRSLLAYLEAFGDARAAAERLHIHPNTLRY
FT                   RVRRAASVSGIDLGDPGERLFTQLQLLMEQQGPTR"
FT   gene            99189..100814
FT                   /locus_tag="Ndas_0077"
FT   CDS_pept        99189..100814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0077"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterProIPR005931:IPR016161:IPR015590:IPR016160:IPR 016162;
FT                   KEGG: ami:Amir_1082 delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase; PFAM: Aldehyde Dehydrogenase; SPTR: C1YHY9
FT                   Delta-1-pyrroline-5-carboxylate dehydrogenase, group 1;
FT                   TIGRFAM: delta-1-pyrroline-5-carboxylate dehydrogenase;
FT                   PFAM: Aldehyde dehydrogenase family; TIGRFAM:
FT                   delta-1-pyrroline-5-carboxylate dehydrogenase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65529"
FT                   /db_xref="GOA:D7B6X5"
FT                   /db_xref="InterPro:IPR005931"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6X5"
FT                   /protein_id="ADH65529.1"
FT                   /translation="MDAVTNVPLPQNEPVLSYAPGSAEREELVAKLEELGSRSIDLPMR
FT                   IGGESRMGGGEPIDVVQPHRHAAVLGTMRNATHEDARDAVAAAKAAAPAWRAMSFDDRA
FT                   AILLRAAELLSGPWRATINAATMLGQSKTVQQAEIDSACELIDFWRFNVSYARDLIAQQ
FT                   PLSVKGVWNRMEQRPLEGFVYAITPFNFTAIAGNLPTAPALMGNVVVWKPSPTQQFAAE
FT                   LTMRLLEEAGMPPGVINMVTGDGLAVSDVALNDPELAGVHFTGSTRTFQHLWKSVGENI
FT                   ANYRSYPRIVGETGGKDFIVAHSSADPEVLRTAIVRGAFEYQGQKCSAASRAFVARSVW
FT                   EQVRDDLVAETEALTMGDVTDLSNFVGAVIDRRAFDKLAKVLEDAKSDPTLTVLAGGTA
FT                   DDSVGYFVRPTIIEGTDPSHDVFRTEYFGPVVAVHVYEDEKFDEVLKTVDEGSAYALTG
FT                   AVLARDRAAVAKASEALRFAAGNFYVNDRPTGSIVGQQPFGGGRASGTNDKAGSAQNLS
FT                   RWSSPRAIKETFVAPTVSSYPHQG"
FT   gene            100950..101876
FT                   /locus_tag="Ndas_0078"
FT   CDS_pept        100950..101876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0078"
FT                   /product="Proline dehydrogenase"
FT                   /note="COGs: COG0506 Proline dehydrogenase; InterPro
FT                   IPR008219:IPR002872; KEGG: ami:Amir_1081 proline
FT                   dehydrogenase; PFAM: Proline dehydrogenase; SPTR: C1YHY8
FT                   L-proline dehydrogenase; PFAM: Proline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65530"
FT                   /db_xref="GOA:D7B6X6"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6X6"
FT                   /protein_id="ADH65530.1"
FT                   /translation="MLRKPLLLAARSQTCRTIVERTPVTRAMVKRFVAGSTQDEALPVV
FT                   GELTRDRHVTLDFLGEDTTDTAQAEATVTAYRDLLAALGEAGLAERAEVSVKLSAVGQF
FT                   LNSDGEKIALDNARRIAEAAKAVGTTMTLDMEDHTTTDSTLGILRELRQDFPFVGAVLQ
FT                   AYLRRTEADCRDLSGAGSRVRLCKGAYDEPESVAFRDKAEVDKAYVRALRVLMEGEGYP
FT                   MVASHDPRMIAIAGSLAAANGRGEDDFEYQMLYGIRDAEQVRLAAEGNRMRVYVPYGDE
FT                   WYGYYMRRLAERPANVLFLARSLVTRG"
FT   gene            102126..103058
FT                   /locus_tag="Ndas_0079"
FT   CDS_pept        102126..103058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0079"
FT                   /product="protein of unknown function DUF1112"
FT                   /note="COGs: COG4760 membrane protein; InterPro IPR010539;
FT                   KEGG: tfu:Tfu_0435 hypothetical protein; PFAM: protein of
FT                   unknown function DUF1112; SPTR: C1YHY7 Predicted membrane
FT                   protein, COG4760"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65531"
FT                   /db_xref="GOA:D7B6X7"
FT                   /db_xref="InterPro:IPR010539"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6X7"
FT                   /protein_id="ADH65531.1"
FT                   /translation="MRMRSSNPVLKRALQQAGPAGHAQQGFNGQPGYGYGQQQGPYGQP
FT                   GYGQPYPQQGYGQPYPQQGYPGGPVQSTDNQPMTIDDVVVRTGMTLGVVAAFAVVNYFL
FT                   FSSAPGIAVVLTLVGALGGLVLGLVISFKQITNPVAILSYAALEGLLVGGISAILANSL
FT                   SVTTGDASAGGTLVTQAVLGTVVVFAVMLALYKFRVIKVTDGFVKVVTYAVIGAAALML
FT                   VNFVASFFIAGGIGLREPSPLGLLVGLVFVVLAALTLAIEFRGIEEGLNAGIPNKFAWQ
FT                   FAFGLTVSLVWLYIEILRLLWIIKSIFAE"
FT   sig_peptide     102126..102191
FT                   /locus_tag="Ndas_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(103187..103438)
FT                   /locus_tag="Ndas_0080"
FT   CDS_pept        complement(103187..103438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sro:Sros_8571 hypothetical protein; SPTR:
FT                   C1YHY6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65532"
FT                   /db_xref="InterPro:IPR025629"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6X8"
FT                   /protein_id="ADH65532.1"
FT                   /translation="MSVTHSPEIHAKLIERIPVVTGRGLHEWFDALDGGPGLVRCQDRS
FT                   NWLADEYELPQWYAQALVTEYDRRRRNRSIPAPRRGKA"
FT   gene            complement(103784..105004)
FT                   /locus_tag="Ndas_0081"
FT   CDS_pept        complement(103784..105004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0081"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="COGs: COG0183 Acetyl-CoA acetyltransferase; InterPro
FT                   IPR016039:IPR002155:IPR016038; KEGG: tfu:Tfu_0436
FT                   acetyl-CoA acetyltransferase; PRIAM: Acetyl-CoA
FT                   C-acyltransferase; SPTR: C1YHY5 Acetyl-CoA
FT                   acetyltransferase; TIGRFAM: acetyl-CoA acetyltransferase;
FT                   PFAM: Thiolase, C-terminal domain; Thiolase, N-terminal
FT                   domain; TIGRFAM: acetyl-CoA acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65533"
FT                   /db_xref="GOA:D7B6X9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6X9"
FT                   /protein_id="ADH65533.1"
FT                   /translation="MPEAVIVATARSPIGRAFKGSLKDIRPDDLTTQIVRAALAKVPEL
FT                   DPGSIDDLMLGCGLPGGEQGFNMARIVAVQLGLDTVPGTTVTRYCSSSLQTTRMAYHAI
FT                   KAGEGDVFVSAGVETVSRFVNGSSDDGNNENPLFDDAKARTAKRAEGGAGTWTDPREDG
FT                   NLPDAYIAMGQTAENVAQATGVSRQRQDEFAVRSQNLAEKSLDNGFWEREITPVTLPDG
FT                   TVVSTDDGIRRGTTYEKVSELKPVFRPDGTVTAGNACPLNDGASAVVVMSDTKAAQLGI
FT                   TPLARIVSTGVTGLSPEIMGLGPVEASRQALARANMAMGDIDLVEINEAFAAQVLPSAD
FT                   QLGIDIDSQLNVNGGAIAIGHPFGSTGARITGTLINGLRFHDRTFGLETMCVGGGQGMA
FT                   AVFERLS"
FT   gene            complement(105138..106193)
FT                   /locus_tag="Ndas_0082"
FT   CDS_pept        complement(105138..106193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0082"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="InterPro IPR013830:IPR013831:IPR001087; KEGG:
FT                   tfu:Tfu_0437 putative secreted protein; PFAM: lipolytic
FT                   protein G-D-S-L family; SPTR: C1YHY4 Lysophospholipase
FT                   L1-like esterase; PFAM: GDSL-like Lipase/Acylhydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65534"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6Y0"
FT                   /protein_id="ADH65534.1"
FT                   /translation="MLRAARARRIAAATAFGGGGLTLVGGGTVALLYLQARLARRAVGS
FT                   PRWDRPVVNGVYGGGSGPPIRMLMMGDSTAAGFAVERADQTPGVLLASGLAAAAERPVR
FT                   LRCTASPGTTSANLAVQIERSRALEEATRYDLAVIFVGANDVIRRVRPNDAVAQLRETV
FT                   RKLVDHGTQVVVGTCPDLGTVRPIGWPLRSVARLASRQLAAAQVIAVTEAGGRAVSMSD
FT                   VLADDFRTDPASMFGPDRFHPSALGYSQAAFAVLPSACAALGLLPELDDAERSSGVLPV
FT                   DRAAVVAAQTPGTEVSRVDAQASGVITSGRHGRWAALVRGPFHLRGGRGHPDGSTGMAT
FT                   TENADRSGEGG"
FT   sig_peptide     complement(106116..106193)
FT                   /locus_tag="Ndas_0082"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            106572..107948
FT                   /locus_tag="Ndas_0083"
FT   CDS_pept        106572..107948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0083"
FT                   /product="cystathionine beta-synthase"
FT                   /note="COGs: COG0031 Cysteine synthase;
FT                   InterProIPR001926:IPR005829:IPR001216:IPR000644:IPR 005857;
FT                   KEGG: tfu:Tfu_0438 cystathionine beta-synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit; CBS
FT                   domain containing protein; SMART: CBS domain containing
FT                   protein; SPTR: C1YHY3 Cystathionine beta-synthase; TIGRFAM:
FT                   cystathionine beta-synthase; PFAM: CBS domain;
FT                   Pyridoxal-phosphate dependent enzyme; TIGRFAM:
FT                   cystathionine beta-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65535"
FT                   /db_xref="GOA:D7B6Y1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005857"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6Y1"
FT                   /protein_id="ADH65535.1"
FT                   /translation="MRVYDSLIDLVGDTPLVRLNKVTQVLGPNAPTVLAKVEYFNPGGS
FT                   VKDRIALRMVEAAEKSGELKPGGTIVEPTSGNTGIGLAIVAQEKGYRCVFVCPDKVGPD
FT                   KLSVLRAYGAEVVVCPTTVAPDHPESYYSVSDRLATEIPGAWKPNQYENTNNPESHYHS
FT                   TGPEIWEQTEGRITHFVAGIGTGGTISGTGRYLKEVSGGAVRIVGADPEGSVYSGGSGR
FT                   PYLVEGVGEDIWPGTYDTSVCDDIVAVSDKDSFLMTRRLAREEALLVGGSCGLAVEAAL
FT                   RVARDAGPDDVVVVLLPDGGRGYLGKIFNDEWMADYGFLSAETEEATAGQVLAAKGGEM
FT                   PDFVHAHPDETVGTAVAIMREYGVSQVPVMKEEPPVMAAEVVGSIAERDLLDALFDGRA
FT                   QLDDLVETHMGRPLATVGTGTPVSDCVRLLRGSGALVVLRDGKPVGILTRQDLLAHLSG
FT                   "
FT   gene            108098..108838
FT                   /locus_tag="Ndas_0084"
FT   CDS_pept        108098..108838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0084"
FT                   /product="putative sugar acetyltransferase"
FT                   /note="COGs: COG0110 Acetyltransferase (isoleucine patch
FT                   superfamily); InterPro IPR001451:IPR011004; KEGG:
FT                   tfu:Tfu_0439 putative sugar acetyltransferase; SPTR: C1YHY2
FT                   Acyltransferase family protein; PFAM: Bacterial transferase
FT                   hexapeptide (three repeats)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65536"
FT                   /db_xref="GOA:D7B6Y2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6Y2"
FT                   /protein_id="ADH65536.1"
FT                   /translation="MGARVSRLLSWVLRSVWSYARTKAEIRADSRAARRFARFGTGSAI
FT                   AFPTATLYGEPWIEIGVHTVLGGDMTLAAGMGPDYDLGPGTVVRIGSGCAIGRGSHIVA
FT                   HRSVDIGDHVYTGPYVYITDQNHAYGNTEIPVGLQWPVDDPVSIGDGTWIGANAVILPG
FT                   VHLGRNSVVAAGTVVRPGTYPDHAVIAGVPGKVVRTHDPELGWDPPLRETGTPTRVPTP
FT                   VTGLPPEVPAEPPRPGSSTRFPPV"
FT   gene            109027..110172
FT                   /locus_tag="Ndas_0085"
FT   CDS_pept        109027..110172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0085"
FT                   /product="Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /EC_number="4.4.1.1"
FT                   /note="COGs: COG0626 Cystathionine beta-lyase/cystathionine
FT                   gamma-synthase; InterPro
FT                   IPR000277:IPR015424:IPR015422:IPR015421; KEGG: tfu:Tfu_0440
FT                   cystathionine gamma-synthase; PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; PRIAM: Cystathionine
FT                   gamma-synthase; SPTR: C1YHY1 Cystathionine gamma-lyase;
FT                   PFAM: Cys/Met metabolism PLP-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65537"
FT                   /db_xref="GOA:D7B6Y3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6Y3"
FT                   /protein_id="ADH65537.1"
FT                   /translation="MKFDGFETLAIHAGQEPDAGTGSVVVPIYQTSTYAQDGVGGLRQG
FT                   YEYSRTGNPTRAALEECLAALESGVRGLAFASGMAAEDTLLRTVLSPGDHLIIPGDAYG
FT                   GTFRLVSKVVERWGVQWDAVDQSDPEAVRAAVRPNTRVVWTETPTNPLLNITDIEAVAQ
FT                   IAHDAGALHVVDNTFASSYLQQPLTLGADVVVHSTTKYLGGHSDVVGGALVVSDAELGE
FT                   RLAFHQNTMGAVPGPFDSWLTLRGIKTLGVRMDRHSANAEKVVAALEGHPAVRRVFYPG
FT                   LDAHPGHKTAERQMRAFGGMVSFALRDGEKAALALCERTEVFTLGESLGGVESLIEHPG
FT                   RMTHASTAGSPLEVPADLVRISVGIESADDLVADLLQALEG"
FT   gene            complement(110253..110492)
FT                   /locus_tag="Ndas_0086"
FT   CDS_pept        complement(110253..110492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_5682 carbonate dehydratase; SPTR:
FT                   C1YHY0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65538"
FT                   /db_xref="GOA:D7B6Y4"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6Y4"
FT                   /protein_id="ADH65538.1"
FT                   /translation="MIPIVIALVGVVLLGLAAGFFLAVSIGIRRQDRRGAYRSLREDGE
FT                   GTPLSRTGSLVVGLRFRDGEHPSTPSTDRTPTAV"
FT   sig_peptide     complement(110418..110492)
FT                   /locus_tag="Ndas_0086"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            110805..111530
FT                   /locus_tag="Ndas_0087"
FT   CDS_pept        110805..111530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0087"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR011663:IPR000524:IPR011991; KEGG: sro:Sros_2096 putative
FT                   transcriptional regulator, GntR family; PFAM: UbiC
FT                   transcription regulator-associated domain protein;
FT                   regulatory protein GntR HTH; SMART: regulatory protein GntR
FT                   HTH; UbiC transcription regulator-associated domain
FT                   protein; SPTR: C1YHX9 Transcriptional regulator; PFAM:
FT                   Bacterial regulatory proteins, gntR family; UTRA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65539"
FT                   /db_xref="GOA:D7B6Y5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6Y5"
FT                   /protein_id="ADH65539.1"
FT                   /translation="MRAESRYRQIARTLRREIQEGSLTRGAQLPSEKQLEERFEASRNT
FT                   IRLALGMLRNQGLIVSRPGRGHYVQDVVPETFHANRVGPGGLHESGMTGQVLEELQLLS
FT                   ATPDIASRLRVPEGDMTVVRRMYRFSGEVSASVSTAYYPMDLVEGTPLMLPEDVESALS
FT                   VLAEYGQRQVGFVDELETRMPSPQEAGQLELPPGVPVLTVHRTDLSEERPIRLVHTVYA
FT                   GHSIRYQYENGNMNAYHRD"
FT   gene            111539..112351
FT                   /locus_tag="Ndas_0088"
FT   CDS_pept        111539..112351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0088"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR011663:IPR000524:IPR011991; KEGG: sro:Sros_0156 putative
FT                   transcriptional regulator, GntR family; PFAM: regulatory
FT                   protein GntR HTH; UbiC transcription regulator-associated
FT                   domain protein; SMART: regulatory protein GntR HTH; SPTR:
FT                   C1YHX8 Transcriptional regulator; PFAM: Bacterial
FT                   regulatory proteins, gntR family; UTRA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65540"
FT                   /db_xref="GOA:D7B6Y6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6Y6"
FT                   /protein_id="ADH65540.1"
FT                   /translation="MSTSRKTVVADHLREALARGDYKPGERLPGEEELAEQLDVSRATA
FT                   RLGMRILQDEGRVAIQPGRGAFVADHRPIVHLATPVTGGGDSERFEAGYQPHLREAGYD
FT                   QVQEKIKVSLDTMRPKVAKRLRSDGAEGRTRGDLVVIRSSDRFVDGGLWQSQVTYFPYG
FT                   IASNTPLMSPERLEEGVAAVLRSLGYREEWNWDIVGARMPSQDEADSFGLGPGIPLLVQ
FT                   ERVVYEGMRPLRFTETVMPANRHQLLYSGGGAPEELLVLASDVSIFER"
FT   gene            complement(112554..113810)
FT                   /pseudo
FT                   /locus_tag="Ndas_0089"
FT   gene            complement(113966..115399)
FT                   /locus_tag="Ndas_0090"
FT   CDS_pept        complement(113966..115399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0090"
FT                   /product="magnesium protoporphyrin chelatase, putative"
FT                   /note="COGs: COG1239 Mg-chelatase subunit ChlI; KEGG:
FT                   sro:Sros_8559 magnesium protoporphyrin chelatase, putative;
FT                   SPTR: C1YHX5 Mg-chelatase subunit ChlI; PFAM: Sigma-54
FT                   interaction domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65541"
FT                   /db_xref="GOA:D7B6Y7"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6Y7"
FT                   /protein_id="ADH65541.1"
FT                   /translation="MSALPEAPSPAPPPLPRTRADLRGSGHVHRPVAAEVRENLLRRMA
FT                   SGRPRFPGVHGFDATVLPQVERALLAGHDIVLLGERGQGKTRLIRTLATLLDEWSPAVA
FT                   GCPVNDHPYTPVCPACVRRSAREGDGLPVVWRHRSERYGEKLGTPDTGVGELIGDVDPA
FT                   LLARGRSLGDPETIHYGLVPRANRGVFCVNELPDLPARAQVALFNVLEERDLQVRGYNL
FT                   RLPLDLLLVASANPEDYTSRGRIVTPLKDRFGAQVRTHYPLTLADELALIRQEAALPEG
FT                   TTVPSHLLEAVARFTRLVRASKKVDARSGVSVRFSVSAAETVAASALRRAALTGGEVPV
FT                   ARVCDLPAAVEPLLGKVEFETGSEGREAEILHALLRRAVAEVFRERLGTADLSELADRF
FT                   SGGGTVETGDLVGAAELLRRVGAVPGLAAMIGHAAPEDEDGPPTPGLAAAVVEFALEGL
FT                   YLERRLSKDALPDGGVYRF"
FT   gene            115642..116793
FT                   /locus_tag="Ndas_0091"
FT   CDS_pept        115642..116793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0091"
FT                   /product="domain of unknown function DUF1745"
FT                   /note="COGs: COG4398 conserved hypothetical protein;
FT                   InterPro IPR013702:IPR019494:IPR016741; KEGG: tfu:Tfu_0444
FT                   hypothetical protein; PFAM: domain of unknown function
FT                   DUF1745; FIST C domain; SPTR: C1YHX4 Uncharacterized
FT                   conserved protein; PFAM: FIST C domain; FIST N domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65542"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR016741"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6Y8"
FT                   /protein_id="ADH65542.1"
FT                   /translation="MARFGDALTTGADLVNAAERAVLSALEQVDGPTDLVCFFVCGADP
FT                   EEVTLAGKRVMELAGDAATLGCSSTGVIGGGRSVEGQGSVSVWCAGLPGVEITPFRLDT
FT                   VVEDDHLAVIGMQEPGPRDSVAILLTNPYEFPTQAFVRESTEALGGLPLVGGMADGMRG
FT                   EESVRLFCDGEVAEHGAIGVLVGGENVLGTVVSQGCRPIGSPMTVTKAEGNLLLELAGT
FT                   NAYEKLEELVESLSEEDRELAEHGLHIGIAMDEYVDRHEQGDFLIRTLAGADPELGALT
FT                   IDDMVEVGQTVRFQVRDAGTADEDLARRLSDFGAEHPVGAGLLFSCNGRGSSLFPQSDH
FT                   DVLAVHRVLGVDAVAGFFAAGEIGPVGGVNHVHGFTACLLAFA"
FT   gene            117026..118483
FT                   /locus_tag="Ndas_0092"
FT   CDS_pept        117026..118483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ami:Amir_6699 hypothetical protein; SPTR:
FT                   C1YHX3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65543"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6Y9"
FT                   /protein_id="ADH65543.1"
FT                   /translation="MFHTRRERARSTAKTLASLGALVLLAPPAPVPALAEEGWLRQEPG
FT                   SADRIGLVLESGTLRLDGDAGRGPVARWDPEPRRGGLAVFPPQPLEAPAATVDVRVRTD
FT                   GGPGEVTTELRGDRTGGAWTEWHPVGDGRVTLPHEVARVQVRVRLSGEGNGLTGLRIRP
FT                   LEEDGEPPRGGATGEPGDGQDGHATAPTGPAAPTDPSEPVEPGSSGAPPGPSAPGGPET
FT                   PTDPSGPDDSGDHGDSTEPFSATLFATRIGLVGNTTANDHRIRENDHFAALPSRRGLAV
FT                   RGGGEYTVRVCTTGALGPEGRDVTEDHRPRCAYLPVWDVGPWNTRDDHWNAERETWPDL
FT                   ARGRPQAQAAYTLGHNGGLDGFGRRVRNPAGIDLADGAFRQGLELPTNGWVRVDYLWTG
FT                   EYRRRARITAADQRHPVVVRGGPGLEHEPVGLAAHSANVDVACQAVGDAMAGTFGTSSA
FT                   WYRIGEGDYVPAVFADGGNGAPACPEP"
FT   sig_peptide     117026..117130
FT                   /locus_tag="Ndas_0092"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(118742..119377)
FT                   /locus_tag="Ndas_0093"
FT   CDS_pept        complement(118742..119377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0093"
FT                   /product="RDD domain containing protein"
FT                   /note="InterPro IPR010432; KEGG: tfu:Tfu_0445 hypothetical
FT                   protein; PFAM: RDD domain containing protein; SPTR: C1YHX2
FT                   Predicted membrane protein/domain; PFAM: RDD family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65544"
FT                   /db_xref="GOA:D7B6Z0"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6Z0"
FT                   /protein_id="ADH65544.1"
FT                   /translation="MSSLHWNPQEPRPGAYPPPNGGWGPGGPVPGQGVSPPGAGWGVPG
FT                   QGAFPGPVPGPFPTPTPERAAFGRRLAARAIDYVLVVIAAVVFFVLMAVVTVVLTGSDQ
FT                   TTDAEGTLWALLFVFGWGLLLFFYDWLYLVTWGRTLGKMMVGIKVVSAADGGRLSQGQA
FT                   MGRSAFFGFPQSLPVVGHIFTLAESMAAFGEEKRALHDRAAGTVVIRT"
FT   gene            complement(119567..120067)
FT                   /locus_tag="Ndas_0094"
FT   CDS_pept        complement(119567..120067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0094"
FT                   /product="GreA/GreB family elongation factor"
FT                   /note="COGs: COG0782 Transcription elongation factor;
FT                   InterPro IPR001437:IPR018151:IPR006359; KEGG: tcu:Tcur_1064
FT                   transcription elongation factor GreA; PFAM: transcription
FT                   elongation factor GreA/GreB domain protein; SPTR: C1YHX1
FT                   Transcription elongation factor; TIGRFAM: transcription
FT                   elongation factor GreA; PFAM: domain; Transcription
FT                   elongation factor, GreA/GreB, C-term; TIGRFAM:
FT                   transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65545"
FT                   /db_xref="GOA:D7B6Z1"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6Z1"
FT                   /protein_id="ADH65545.1"
FT                   /translation="MTQTRDDNVTWLTQEAYDRLKSELDHLSGSGRIEIAEKIEAAREE
FT                   GDLKENGGYHAAKEEQGKMEARILQLTEILRTARVGEAPHTEGVVGPGMTVTVKFDGDD
FT                   DEVTFLLASREESGSPIDVYSPRSPLGSAINGKRVGENVSYTLPNGKSLGVEIIDAVPY
FT                   TGM"
FT   gene            complement(120205..120657)
FT                   /locus_tag="Ndas_0095"
FT   CDS_pept        complement(120205..120657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0448 hypothetical protein; SPTR:
FT                   C1YHX0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65546"
FT                   /db_xref="GOA:D7B6Z2"
FT                   /db_xref="InterPro:IPR025443"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6Z2"
FT                   /protein_id="ADH65546.1"
FT                   /translation="MQPTPEEDAVKSAETTADTAADSSASTAPALRKRHGNGPVFFVIA
FT                   TLFAVACAVGWGYSLMNFSGLGGGVYHQVITFSAPTPEEATISYEVNSRNGAECLVVAL
FT                   DEQFVEVGQTRSKAEAGNRMVTTTVETVRQAATVEVASCREQGSQD"
FT   gene            120814..121692
FT                   /locus_tag="Ndas_0096"
FT   CDS_pept        120814..121692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0096"
FT                   /product="mycothiol conjugate amidase Mca"
FT                   /note="COGs: COG2120 conserved hypothetical protein LmbE
FT                   homologs; InterPro IPR000209:IPR003737:IPR017811; KEGG:
FT                   tfu:Tfu_0449 hypothetical protein; PFAM: LmbE family
FT                   protein; SPTR: C1YHW9 Mycothiol conjugate amidase Mca;
FT                   TIGRFAM: mycothiol conjugate amidase Mca; PFAM: GlcNAc-PI
FT                   de-N-acetylase; TIGRFAM: mycothiol conjugate amidase Mca"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65547"
FT                   /db_xref="GOA:D7B6Z3"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR017811"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6Z3"
FT                   /protein_id="ADH65547.1"
FT                   /translation="MSERLRLMAVHAHPDDESSKGAATMARYVEEGVDVLVVTMTGGER
FT                   GDILNPAMERPDIRENIAQVRREEMERAREILGVQQEFAGFVDSGLPEGDPLPPLPEGC
FT                   FATLPVEEGAAPLVESIRRFRPHVILTYDENGGYPHPDHIMTHKVTMHAFDTAGDPDAY
FT                   PDAGDPWQPLKLYYFVSFPPERFEALADVLAARGLENPFEEWMKRIADRDHPRWEITTR
FT                   VHCSEYFDVADEALKAHATQVDPNGFWFAVPNEVVAEAWPSEDYHLVRSLVDTEIPEKD
FT                   LFAGVREAVRV"
FT   gene            121698..121958
FT                   /locus_tag="Ndas_0097"
FT   CDS_pept        121698..121958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0097"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kra:Krad_4568 hypothetical protein; SPTR:
FT                   C1YHW8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65548"
FT                   /db_xref="GOA:D7B6Z4"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6Z4"
FT                   /protein_id="ADH65548.1"
FT                   /translation="MNTLLTSATVLAGSFQLDKDTVTPGVLGFLVIFAIGVGLYFLMRS
FT                   LLGKLRALPKDDDFGARATASDDGGPADAAQVSAEDTAPRS"
FT   gene            122232..124265
FT                   /locus_tag="Ndas_0098"
FT   CDS_pept        122232..124265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0098"
FT                   /product="protein of unknown function DUF255"
FT                   /note="COGs: COG1331 Highly conserved protein containing a
FT                   thioredoxin domain; InterPro
FT                   IPR008928:IPR012336:IPR004879:IPR012335; KEGG: tfu:Tfu_0451
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF255; SPTR: C1YHW7 Conserved protein containing a
FT                   thioredoxin domain; PFAM: Protein of unknown function,
FT                   DUF255"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65549"
FT                   /db_xref="GOA:D7B6Z5"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6Z5"
FT                   /protein_id="ADH65549.1"
FT                   /translation="MSNRLSDATSPYLLQHADNPVEWWPWGEEALAEARRRDVPLLVSV
FT                   GYAACHWCHVMAHESFEDEATAALMNSLFVNVKVDREERPDVDAVYMEATQAMTGQGGW
FT                   PMTVFATPDGAPFYCGTYFPREHFQRLLRGVADAWRDQRTELVGQGARVVEALSGPRTL
FT                   AAAPPPSADRLDLAVRALVRDYDSAHGGFGTAPKFPPSMLLSFLTAQDERTRPLQSADE
FT                   STPAWLMASGTALAMAQGGMYDQLGGGFARYSVDREWTVPHFEKMLYDNALLLRAYARM
FT                   GRRPSGPGVSDAATHALLRRVAGETADWMLRDLRTPEGGFASALDADSEGEEGTYYVWT
FT                   PAQLREVLGEEDAAFAAEVFGVTEEGTFERGASVLQLPAPPADAWRYQRVREALLAARA
FT                   ERVAPARDDKVVAAWNGLAVAALAEAGVLLERPDLVEAARAAADLLLRVHLRDGRLVRT
FT                   SRDGRAGTSAGVLEDYADVAEGLLVLHGVTGEARYAHEAGRLLDTVLERFGDGSGGFYD
FT                   TADDAERLFNRPQDPTDNVTPSGRSAAASALLSYAALTGSERHRTAAEEALSPVAVLAE
FT                   KAARFAGWGLATGEALLTGPRAVAVVGDPDDPRTAELVHAALVWAPLGTVLSRGDGRDD
FT                   GGVPLLRDRAPVGGRPTAYVCEGFVCKLPVTSPEDLREQLLA"
FT   gene            complement(124280..125650)
FT                   /locus_tag="Ndas_0099"
FT   CDS_pept        complement(124280..125650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0099"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterPro IPR011009:IPR017442:IPR000719:IPR017441; KEGG:
FT                   tfu:Tfu_0454 tyrosine protein kinase:serine/threonine
FT                   protein kinase; PFAM: Serine/threonine-protein kinase-like
FT                   domain; SPTR: C1YHW6 Protein kinase family protein; PFAM:
FT                   Protein kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65550"
FT                   /db_xref="GOA:D7B6Z6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6Z6"
FT                   /protein_id="ADH65550.1"
FT                   /translation="MSQPEAFGRYRVIRRLGSGSFATVWLAQDDLLNYSVAIKVLAENW
FT                   AHQMDIQHRFLEEARILRQTDSTWLVAVHDVDVLPDGRPYMVMTYADQGSVADLIHRGT
FT                   LPLDEALRLLTEIGQGITVLHNHGTIHRDIKPSNVLLQSSPVGQRVLVADLGFAKSIDE
FT                   ASGFTAAAGTPGYMSPEQSIPGGDLDVRSDVYSLGAVAYELITGRPPSRPPVKVAPGQI
FT                   RPGLPPALDELILSALSVDRESRPADAKTFTDRVRTIRMAPDLPKAAVPWWQRLRMPWR
FT                   RATALAGALVLTGASLSGSLGRPGVSLTTVHDAAQGVYLEVPSVWAHEIHTAQEALPAA
FT                   AEAGAGPGLLVATDAEDWDSTRETAYGVYATVVRGPADLSGIAGAQPCGDPPEERPLDT
FT                   GEWEGTVWDWPECHGNGSLSSAAVHEPGEPTTVYMEIRQPGYRPDLVDRIIAGTHLG"
FT   sig_peptide     complement(125570..125650)
FT                   /locus_tag="Ndas_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            125960..126571
FT                   /locus_tag="Ndas_0100"
FT   CDS_pept        125960..126571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0100"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="COGs: COG1595 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24 homolog;
FT                   InterProIPR013325:IPR013324:IPR007627:IPR013249:IPR 014284;
FT                   KEGG: tfu:Tfu_0455 sigma subunit sigma24 -like protein;
FT                   PFAM: sigma-70 region 2 domain protein; Sigma-70 region 4
FT                   type 2; SPTR: C1YHW5 RNA polymerase sigma factor, sigma-70
FT                   family; TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70, region 4; Sigma-70 region 2;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65551"
FT                   /db_xref="GOA:D7B6Z7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6Z7"
FT                   /protein_id="ADH65551.1"
FT                   /translation="MRSSDHADHEESPAPRRRVASNVDEELEDLARRAKAGDAMALDDL
FT                   LRRIQPEVLRRCSRFLPYRQDAEEACQDALLRVARKIDSFKGDSLFTTWLYTVVSNSAR
FT                   QTYRSMKRRSAEFPTEAERMPHQSDPRTTSVIAGSRIDLLEALDQLEKDRPNLVAPLVL
FT                   RDLCQMDYNEIASELNLALGTVKSRIHQGRKHVRKSLAVT"
FT   gene            126665..127426
FT                   /locus_tag="Ndas_0101"
FT   CDS_pept        126665..127426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0101"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="COGs: COG0020 Undecaprenyl pyrophosphate synthase;
FT                   InterPro IPR001441:IPR018520; KEGG: tfu:Tfu_0456
FT                   undecaprenyl pyrophosphate synthetase; PFAM:
FT                   Di-trans-poly-cis-decaprenylcistransferase; PRIAM:
FT                   Di-trans,poly-cis-decaprenylcistransferase; SPTR: C1YHW4
FT                   Undecaprenyl pyrophosphate synthetase; TIGRFAM:
FT                   undecaprenyl diphosphate synthase; PFAM: Putative
FT                   undecaprenyl diphosphate synthase; TIGRFAM: undecaprenyl
FT                   diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65552"
FT                   /db_xref="GOA:D7B6Z8"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6Z8"
FT                   /protein_id="ADH65552.1"
FT                   /translation="MGLRDPLYWLYERRLERRLTSQEIPRHVGVAMDGNRRWAKVSGLG
FT                   AAEQGHQAGANKIFELLRWCDEVGVQVVTLWMLSTDNLSRDESELGPLVRIIEQTIARL
FT                   REEGWNTRPVGALDILPASTAQALKEAETATSGNPGLVVNVAVGYGGRREIADAVRSLL
FT                   QAEAAKGTGIQELAERLDIEDIARHLYTRGQPDPDLLIRTSGEQRLSGFMLWQSVHSEF
FT                   YFCEVYWPAFRRVDFLRALRSYGARNRRYGS"
FT   gene            127685..129031
FT                   /locus_tag="Ndas_0102"
FT   CDS_pept        127685..129031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0102"
FT                   /product="PhoH family protein"
FT                   /note="COGs: COG1875 ATPase related to phosphate
FT                   starvation-inducible protein PhoH; InterPro
FT                   IPR003714:IPR006596; KEGG: tfu:Tfu_0457 nucleotide binding
FT                   protein, PINc; PFAM: PhoH family protein; SMART: Nucleotide
FT                   binding protein PINc; SPTR: C1YHN1 PhoH family protein;
FT                   PFAM: PhoH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65553"
FT                   /db_xref="GOA:D7B6Z9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D7B6Z9"
FT                   /protein_id="ADH65553.1"
FT                   /translation="MASSSTDRRDTQSPDPRTEVGQDGRVYVLDTSVLLADPAALSRFA
FT                   EHEVVIPVVVITELESKRHHPELGYFARHALRRLDDLRVAHGRLDAPVPVNDAGGTLRV
FT                   ELNHSDPQILPAGFRLGDNDTRILTVARNLQEEGGDVVLVSKDLPMRIKAASIGLAADE
FT                   YRAELAIEHGWTGMAELDVPAHQIGELFTSGESDIDAARDLPCHTGLVLVSERGKALGR
FT                   VQPDKSVKLVRGDRDVFGLHGRSAEQRIALDLLTDPEVGIVSLGGRAGTGKSALALCAG
FT                   LEAVLERRQHRKVMVFRPLYAVGGQELGYLPGSENDKMTPWGQAVHDTLSAVTSEEVIE
FT                   EIVDRGMLEVLPLTHIRGRSLHDAFVIVDEAQSLERNVLLTVLSRLGQNSRVVLTHDIA
FT                   QRDNLRVGRHDGVVAVIEKLKGHPLFAHVTLTRSERSPIAALVTEMLEN"
FT   gene            complement(129131..132505)
FT                   /locus_tag="Ndas_0103"
FT   CDS_pept        complement(129131..132505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0103"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_8883 hypothetical protein; SPTR:
FT                   C1YHN0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65554"
FT                   /db_xref="GOA:D7B700"
FT                   /db_xref="UniProtKB/TrEMBL:D7B700"
FT                   /protein_id="ADH65554.1"
FT                   /translation="MNVHGSPPSPAGPRLSCPDCRAPLAAQPRSCRRCGLLLVGATAQR
FT                   LWHIDTEIALLNSRERHLREERAAVVALLREESGRGASPAGAVPESADGERPWAPGPQG
FT                   RPPGPARVPGAAPEPAVLPGGALPDGHGAHAHGQTGGAPPGRAPGEVTRRSAQNVILGL
FT                   GGVLVGIAALVFAIWTWSDMGTGARAGVLGLTTAAFAALALPLHRRGLRATAETFGCLA
FT                   AALLCVDALALWLLTSERLGSGPGYTATALLVIGALLASYPLLVPLRTPRVLAVLLLQP
FT                   VPVLLLAASGSPGLWSWALPVLAATGLADLLLALWFGRPRAGVPVRALRVSATVLWVLT
FT                   TVLALLYTAFVLAASAAGADHVGARWFVAAVLLLSGVTGLLSARGPLRHVPEGPGPVGA
FT                   VSGAAGPGAPGGTGASGVPAAIALLVLGAAPLVAGPAHLPALPRAPLPPWNGGPPTTPV
FT                   SDVLGLPATTAPDAGFHLLAVLVCALLSLGAVFLLRRRALVPAAALTAPPALLTVVHLL
FT                   DPPHAVAVVCALLVGAALVLATALVPRRPGAWVPALTGTLTLLTGGLWSLPDRYTSLAA
FT                   LVVVEATVLVALLLYARSGRPAVLHATGLLLWALALLTGAFFGLGLVISDTVPPPAWWL
FT                   LAACALLAGANAVVLGRIPLPRAGGAGGDPRPVFTVVGLLLLSSAPLLAGRGHSPGLPL
FT                   LSGAYGPWTAPVRALGDPAYSVLGLHRVAGPAEAVGTAAGMLLAGAAAVALVALLDRGR
FT                   TAAAAVLAAPPALVALPLVLDAPFLGALLWVFAVGSALALWSALTRDGRLGWLAGLTGL
FT                   LTLLLGTGWALVQEHATTGALMGVAVAAAVAAALARTTVAAVGATAVATAATGGFALAL
FT                   PLLLGAPVEHAALAPIAMVAAVAVAAPRLRGPLVPAAEVPAWVWAAVSLGVTAAAGARL
FT                   GLVALALAVVGVVALATAARPERRWFALVGALLMLAALWTVLSAWDVAVPEAYTVPPAL
FT                   AALAVGWEWSRRAAEPPSSWAAHGGGLALLFLPTVVLVLTEDGMVWRVPAVLVLGLAVT
FT                   VWGLRRRLQAALVTGGLVLVATSLRAFGPPLWDLTRLVPNWVPFAVAGVLLLVIGARYE
FT                   ANLERVRRLGRLVAEMR"
FT   gene            132921..133640
FT                   /locus_tag="Ndas_0104"
FT   CDS_pept        132921..133640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0104"
FT                   /product="secreted protein"
FT                   /note="KEGG: tfu:Tfu_0458 secreted protein; SPTR: C1YHM9
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65555"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D7B701"
FT                   /protein_id="ADH65555.1"
FT                   /translation="MLLNLISLRHAGAVGAATLVAGGTFSVAAFAQSDAADPSQLASAA
FT                   VVPDQRSAAGGDGGSDRPEDFFAAQAGQSDQERQTQREESMEQARAAVEGAVRADSGTA
FT                   SDIAEPEPEPEEEPEADTSGGSDSSGGGSAGSAPSGDPKDIALQMVLDEGWAASEFHDC
FT                   LEPLWEKESNWNHTAENPSSGAYGIPQSLPGDKMASHGSDWRTNPATQIAWGIDYIKDR
FT                   YGNPCGAWSHSQANNWY"
FT   sig_peptide     132921..133013
FT                   /locus_tag="Ndas_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            133699..134328
FT                   /locus_tag="Ndas_0105"
FT   CDS_pept        133699..134328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0105"
FT                   /product="secreted protein"
FT                   /note="KEGG: tfu:Tfu_0458 secreted protein; SPTR: C1YHM8
FT                   Putative uncharacterized protein; PFAM: Transglycosylase
FT                   SLT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65556"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D7B702"
FT                   /protein_id="ADH65556.1"
FT                   /translation="MSLRSTAAVGAATLVAGATFAVTAFADDELDPDTVASAAIPETEE
FT                   PAADTEAGEESFFSEQLSQEELQTLRSQAQEQRDAALTEGVLTAQVEGSDIEEEEEEEE
FT                   TPVFTGDPKGIALQMVTDQGWAASEFHDCLEPLWQKESNWNPSAQNPSSGAYGIPQSLP
FT                   GDKMATHGDDWQTNPATQIAWGIDYIKGRYGTPCEAWAHSQSVGWY"
FT   sig_peptide     133699..133776
FT                   /locus_tag="Ndas_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(134450..136474)
FT                   /locus_tag="Ndas_0106"
FT   CDS_pept        complement(134450..136474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0106"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterProIPR008271:IPR011009:IPR017442:IPR000719:IPR 017441;
FT                   KEGG: cai:Caci_1619 serine/threonine protein kinase; PFAM:
FT                   Serine/threonine-protein kinase-like domain; SPTR: C1YHM7
FT                   Protein kinase family protein; PFAM: Protein kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65557"
FT                   /db_xref="GOA:D7B703"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D7B703"
FT                   /protein_id="ADH65557.1"
FT                   /translation="MSSNSGSERIVADRYVLRRELGRGGMGVVWQAFDPTLDRDVAIKQ
FT                   VLLPDHFTDSERADAHGRVRREARSAARISHPTVITIHDVFEYDGNPWVVMELVEGGSL
FT                   QDRLDERGALPPDEVAEIAGSLLRAVRAANAAGVLHRDIKPGNIMTSLDGRVILTDFGI
FT                   ATMEGGPSITRTGALIGSPEYMPPERLAGGPAEHRGDLWSIGVTLFAAVEGTSPFRRDS
FT                   ITAAIAAVMSAPLPPMTRAGWLEPVISGLLERDPERRLSADGALALLRERGGPNAGGDD
FT                   SGGFGAAGAVGAAGAGAFADGTPASGSGPHTTPGVSGRQSPHHTPSGGHPGTGPRGGYP
FT                   HTRTPLPQGPMTGQRLPRGGPADPVTPASPFAHGHRTVHQHRPPHSAGGGLGGTGRGPG
FT                   GPGGPGVPLHSGGHGGARPGSGSGNTRLLVGVGAAVVVLTLIGGVAVVGATLFAGAEAE
FT                   GGASEALSASESARPPAEPSASVGGDEGGAGSGGGEGRGEGGQTGGGDENGEPPSYDEL
FT                   ETFRSQWFHVDYPAGWQVDDSEIENTLAVFVAPGSDHQVWVTGWTEQEFTGTSAEYLED
FT                   TNGGTKVEGDVTTGYTQLELEEFDDGDFEEGWDVALVESDLVNETWASQERRFWAYAIS
FT                   TEHEGDRVFYLVSVNVPREDADYYDDLHEDVMETFDPLL"
FT   gene            complement(136693..138081)
FT                   /locus_tag="Ndas_0107"
FT   CDS_pept        complement(136693..138081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0107"
FT                   /product="fumarate lyase"
FT                   /EC_number="4.2.1.2"
FT                   /note="COGs: COG0114 Fumarase;
FT                   InterProIPR000362:IPR008948:IPR020557:IPR003031:IPR 018951;
FT                   KEGG: tfu:Tfu_0459 fumarate hydratase; PFAM: fumarate
FT                   lyase; Fumarase C-like; SPTR: C1YHM5 Fumarase; PFAM:
FT                   Fumarase C C-terminus; Lyase; TIGRFAM: fumarate hydratase,
FT                   class II"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65558"
FT                   /db_xref="GOA:D7B704"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D7B704"
FT                   /protein_id="ADH65558.1"
FT                   /translation="MSEFRIEHDSMGEVRVPAEAKWRAQTQRAVENFPISGQGLEGAHI
FT                   AALGQIKAAAAKVNAELGVISDDLGKAIREAALEVAEGRWNDEFPIDVFQTGSGTSSNM
FT                   NTNEVVATLATERLGAPVHPNDHVNASQSSNDVFPSSIHIAATSAVQNDLVPALRHLEE
FT                   ALGAKATEFASVVKSGRTHLMDATPVTLGQEFAGYAAQVRYGVERLEAVLPRVAELPLG
FT                   GTAVGTGINTPEGFSARVIAEIAEHTGLPLTEARDHFEAQGARDGLVELSGQLRTIAVG
FT                   FAKIANDIRWMGSGPTTGLGEILLPDLQPGSSIMPGKVNPVLCEAVLQVTSQVVGNDAA
FT                   VAFGGASGNFELNVQLPMIARNVLESIRLLSNVSRVFADRCVSGIEANVEQCRVYAESS
FT                   PSIVTPLNRYIGYEEASKVAKQSLKEKKTIREVVIERGYVEDGKLTEAQLDEALDVLRM
FT                   TNSQ"
FT   gene            complement(138240..138944)
FT                   /locus_tag="Ndas_0108"
FT   CDS_pept        complement(138240..138944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0108"
FT                   /product="protein of unknown function DUF1707"
FT                   /note="InterPro IPR012551; KEGG: tfu:Tfu_0460 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1707; SPTR:
FT                   C1YHM2 Putative uncharacterized protein; PFAM: Predicted
FT                   membrane protein (DUF2154); Domain of unknown function
FT                   (DUF1707)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65559"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:D7B705"
FT                   /protein_id="ADH65559.1"
FT                   /translation="MGPGGRTRSAPPDAPTRDAPRTGDRPGVSPSVGGVSEEVSPDRLR
FT                   ASNTDRERVLRVLREAAADGRLDLEEFEERSSLAHEARTLGELPGITADLLPAEQQPIR
FT                   LDRQPVLGLFGRAERRGRWVAYPDELAVALVGRVEVDMREALLMHNHHRMTVTAVLGRV
FT                   EIDVPEGVEVRMTGWSFLGRRTTTARRSELSHPPVLEIDGFSLFGVVRVRAPRRRRLLG
FT                   WRRRDRRRGIGA"
FT   gene            complement(139050..139472)
FT                   /locus_tag="Ndas_0109"
FT   CDS_pept        complement(139050..139472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR007087; KEGG: stp:Strop_4428
FT                   hypothetical protein; SPTR: C1YHL9 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65560"
FT                   /db_xref="InterPro:IPR024439"
FT                   /db_xref="UniProtKB/TrEMBL:D7B706"
FT                   /protein_id="ADH65560.1"
FT                   /translation="MGRRNTRVTRRPQRPKTVLHAHGEAGGAGSFRCVRCRLEIPARAP
FT                   GTAHRNHCPHCLTSLHVDLRVPGDRASGCRGAMDALSMAARPDGEWMIVHRCVRCGELG
FT                   SNRVAGDDNARALVRVAVRPLAAASDAVARRALMDL"
FT   gene            complement(139475..139846)
FT                   /locus_tag="Ndas_0110"
FT   CDS_pept        complement(139475..139846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa30130 hypothetical protein; SPTR:
FT                   C1YHM6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65561"
FT                   /db_xref="InterPro:IPR024439"
FT                   /db_xref="UniProtKB/TrEMBL:D7B707"
FT                   /protein_id="ADH65561.1"
FT                   /translation="MSTTDSSDRSATRTGAFACVRCGLSVSRLGPDGEPRDHCPSCLSS
FT                   RHVLDRVGGGASDCGGRMAPISVAVPRGGSWTLIHRCGVCDEMSESAVSPDDNHLVLMR
FT                   IAVRPLAEPPFPLDLFGEV"
FT   gene            140304..141536
FT                   /locus_tag="Ndas_0111"
FT   CDS_pept        140304..141536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0111"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="COGs: COG0675 Transposase and inactivated
FT                   derivatives; InterPro IPR001959:IPR010095; KEGG: sma:SAV_47
FT                   IS200-like transposase; PFAM: putative transposase
FT                   IS891/IS1136/IS1341 family; transposase IS605 OrfB; SPTR:
FT                   C1YHM4 Transposase, IS605 OrfB family, central region;
FT                   TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   Helix-turn-helix domain; Putative transposase DNA-binding
FT                   domain; Probable transposase; TIGRFAM: transposase, IS605
FT                   OrfB family, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65562"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D7B708"
FT                   /protein_id="ADH65562.1"
FT                   /translation="MARKSVKRAFRYRFYPTDAQAAELSRTFGCVRLVYNRALAEHTAA
FT                   WNTEQRRLSYTDSSAALTVWKRTEELAFLTEVSCVPLQQTLRHLHTAFRNFFDRRAKYP
FT                   RFKSKKKSRASAEYTRSGFRYRGGQLTLAKMTVPLDVVWSRPLPEGARPSTVTVSRDTA
FT                   GRWFVSLLCEDTITSAQATRVVVGVDAGITSVVTLSTGEKVANPRHEQRDRAKLARAQR
FT                   ALSRKAKGSTNRDKARRKVARVHARITDRRRDFLHKLSTRLVRENQAVVIEDLAVRNLV
FT                   KNRRLARAISDAAWRELRTMLEYKCAWHGRDLVVVDRFLPSSKACSTPGCGYLNASLPL
FT                   RVREWTCPVCGVAHDRDVNAALNLEAAGLAVLACGAGVRPQRESFRTGRPVMKQEGHGA
FT                   TRDEALASSHQ"
FT   sig_peptide     140304..140366
FT                   /locus_tag="Ndas_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            141581..142096
FT                   /pseudo
FT                   /locus_tag="Ndas_0112"
FT   gene            complement(142172..143836)
FT                   /locus_tag="Ndas_0113"
FT   CDS_pept        complement(142172..143836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0113"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0463 hypothetical protein; SPTR:
FT                   C1YHM1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65563"
FT                   /db_xref="UniProtKB/TrEMBL:D7B709"
FT                   /protein_id="ADH65563.1"
FT                   /translation="MSYPDPPQQPQWQPQPPGQGYPPPQAPGQHPAGFGAGAPGGPPPA
FT                   GPFPGGQYSGGQVPPPSGGGRNRRWLIPAAAGTALLLMGGTVWATVSLVSFGGPQPEDV
FT                   LPGSALAFGKIDLSIDGSQAMELLRFVDQLPDEVTAEMDEPDGDMTGLVAEGFVAAFPE
FT                   ARQSEVEEWIGQRVGFAMWPASGEAELGEGAGVAGAFALAVEDERLAQENLERLSGEYD
FT                   DLYFEVINDFALLTTSDAALADLHAQVEEHGPLADADTFSGDMAEVPGGSLAAAWSDLA
FT                   GLMEVEEFAREFEADLAAETGELSGRMTASLRVDGEYLEARTDIFDLTVDGTDLAWLAE
FT                   TPGASVAAMESLPESTVMAVGASGLDTALADAYESDSIPFMTSSGQMQEMERQFNSMGA
FT                   PLPEGFTQLLGSSTAFGVTDMDLEGFFGSSYSGGGEASFQYRAVGGDEQILGDFVESAV
FT                   VDSYSTPPGVSTDGDAVVVSQGSSATGRLGDDPVFQQTMQEMDSAVMAGYMDLRQVLTE
FT                   SEVEAPGQWGAVGLALSVTEEGQRSSVELRWSPSGGE"
FT   gene            complement(144036..145076)
FT                   /locus_tag="Ndas_0114"
FT   CDS_pept        complement(144036..145076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0114"
FT                   /product="fructose-1,6-bisphosphatase, class II"
FT                   /EC_number="3.1.3.11"
FT                   /note="COGs: COG1494 Fructose-1
FT                   6-bisphosphatase/sedoheptulose 1 7-bisphosphatase and
FT                   related protein; InterPro IPR004464; KEGG: tfu:Tfu_0464
FT                   fructose 1,6-bisphosphatase II; PFAM: GlpX family protein;
FT                   PRIAM: Fructose-bisphosphatase; SPTR: C1YHM0
FT                   Fructose-1,6-bisphosphatase, class II; TIGRFAM:
FT                   fructose-1,6-bisphosphatase, class II; PFAM: Bacterial
FT                   fructose-1,6-bisphosphatase, glpX-encoded; TIGRFAM:
FT                   fructose-1,6-bisphosphatase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65564"
FT                   /db_xref="GOA:D7B710"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:D7B710"
FT                   /protein_id="ADH65564.1"
FT                   /translation="MSQSSSPHKAPDRNLALELVRVTETAALAAARWVGKGDKIGADGA
FT                   AVRGMRHMISTVSMNGTVVIGEGEKDNAPMLYNGERVGDGGGQDWDVAVDPIDGTTLTA
FT                   MGMPNAVSVIAMSPRNTMFDPSAVFYMEKLATGPEAADVVDIAAPVADNVRAVARAKGK
FT                   SPQDVTVVILDRPRHKQIVQDVRDAGARIKFISDGDVAGAIMAARAGTGVDLLLGIGGT
FT                   PEGIITACAMKCLDGVIQGRLWPKDEEERRKALDAGHDLDRVLRTDDLVSSDDVFFAAT
FT                   GITDGELVGGVRYESARVVTDSLVMRGRSGTVRQVLSEHRLGKLASYSGVDLTSAPYRG
FT                   EEPESV"
FT   gene            145231..145830
FT                   /locus_tag="Ndas_0115"
FT   CDS_pept        145231..145830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0115"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR009057:IPR012287:IPR001647; KEGG:
FT                   tfu:Tfu_0465 hypothetical protein; PFAM: regulatory protein
FT                   TetR; SPTR: C1YHL8 Transcriptional regulator, COG1309;
FT                   PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65565"
FT                   /db_xref="GOA:D7B711"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7B711"
FT                   /protein_id="ADH65565.1"
FT                   /translation="MDKTDRPARVSPRGAATRGALLKAASQVFRTVGFAKAGVSEVVAA
FT                   AGASVGSLYHHFSGKADLYLALYEEFQQRQQDRTHQAVVRARSEGEKDPTRLMNIAARA
FT                   YLLGCIEERETTRLFFSGDGPPGFDYQLRTRLTQWTDRNVALFRKADEPVDEALLIVVS
FT                   GAMLLAVAEVVQREDAEARRLADDITGLLTQLEPRR"
FT   sig_peptide     145231..145341
FT                   /locus_tag="Ndas_0115"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            145881..146435
FT                   /locus_tag="Ndas_0116"
FT   CDS_pept        145881..146435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0116"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: tfu:Tfu_0466 putative secreted protein; SPTR:
FT                   C1YHL7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65566"
FT                   /db_xref="GOA:D7B712"
FT                   /db_xref="InterPro:IPR025339"
FT                   /db_xref="UniProtKB/TrEMBL:D7B712"
FT                   /protein_id="ADH65566.1"
FT                   /translation="MSEYSRSSATFKNYAISLGIIVGIVLIMAFVVSTRSGESIPSVEY
FT                   RPDADVLRDAADYPVTVPSADLEQEGWTPTSSTVDVSGPVQWSVGFATAEDSHAMVTQS
FT                   DAEPGAVLAERVPGAERVGTVQVDGREWEHHASQDENALVLREEGVTLVVFGPADMDEL
FT                   TRLAEGLETDADGGEGSADGA"
FT   sig_peptide     145881..145991
FT                   /locus_tag="Ndas_0116"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            146517..146933
FT                   /locus_tag="Ndas_0117"
FT   CDS_pept        146517..146933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0117"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="COGs: COG0789 transcriptional regulator protein;
FT                   InterPro IPR015358:IPR000551:IPR009061; KEGG: nml:Namu_0947
FT                   transcriptional regulator, MerR family; PFAM: regulatory
FT                   protein MerR; Transcription regulator MerR DNA binding;
FT                   SMART: regulatory protein MerR; SPTR: C1YHL6
FT                   Transcriptional regulator, MerR family; PFAM: MerR family
FT                   regulatory protein; MerR, DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65567"
FT                   /db_xref="GOA:D7B713"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:D7B713"
FT                   /protein_id="ADH65567.1"
FT                   /translation="MRIGELARRTGTTARALRFYESQGLLSARRSANGYRDYGEDDYRL
FT                   VSEILTLQAVGLSLDDTRPFVECLRSGHETGDSCPDSVEVYRRRLAEVDACLERLGAMR
FT                   DSLTAKLSEALARGAGGRGATGLCTGEANDPEEP"
FT   gene            146933..147280
FT                   /locus_tag="Ndas_0118"
FT   CDS_pept        146933..147280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0118"
FT                   /product="thioredoxin"
FT                   /note="COGs: COG3118 Thioredoxin domain-containing protein;
FT                   InterProIPR017936:IPR017937:IPR012336:IPR005746:IPR
FT                   006662:IPR013766:IPR012335; KEGG: nml:Namu_0946
FT                   thioredoxin; PFAM: Thioredoxin domain; SPTR: C1YHL5
FT                   Thioredoxin; TIGRFAM: thioredoxin; PFAM: Thioredoxin;
FT                   TIGRFAM: thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65568"
FT                   /db_xref="GOA:D7B714"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7B714"
FT                   /protein_id="ADH65568.1"
FT                   /translation="MPSTNSTAEVSAVTDATFERDVLDVEGPVLVEFWADWCPPCRMLA
FT                   PVLDRIADERAGTLAVRKVDADDNPLTTRGHGVLSLPTLMLFRDGEPLLKLVGARSRAR
FT                   LLSEVDTALRG"
FT   gene            complement(147408..148379)
FT                   /locus_tag="Ndas_0119"
FT   CDS_pept        complement(147408..148379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0119"
FT                   /product="hydroxymethylbutenyl pyrophosphate reductase"
FT                   /EC_number="1.17.1.2"
FT                   /note="COGs: COG0761 Penicillin tolerance protein; InterPro
FT                   IPR003451; KEGG: tfu:Tfu_0471 4-hydroxy-3-methylbut-2-enyl
FT                   diphosphate reductase; PFAM: LytB protein; PRIAM:
FT                   4-hydroxy-3-methylbut-2-enyl diphosphate reductase; SPTR:
FT                   C1YHL4 4-hydroxy-3-methylbut-2-enyl diphosphate reductase;
FT                   TIGRFAM: hydroxymethylbutenyl pyrophosphate reductase;
FT                   PFAM: LytB protein; TIGRFAM:
FT                   (E)-4-hydroxy-3-methyl-but-2-enyl pyrophosphate reductase
FT                   (IPP and DMAPP forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65569"
FT                   /db_xref="GOA:D7B715"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:D7B715"
FT                   /protein_id="ADH65569.1"
FT                   /translation="MTAMTTATNQRRVLLANPRGYCAGVDRAVITVEKALEQYGAPIYV
FT                   RKQIVHNTHVVRTLEERGAIFVEETEEVPEGAIVVFSAHGVSPAVHEEAHRRSLKTIDA
FT                   TCPLVTKVHKEAKRFAAEDRDIILIGHIGHEEVEGTSGEAPEHIQIVESPDEVHKVQVR
FT                   NPDNVSWLSQTTLSVDETTQTVDALRERFPNLLDPPSDDICYATSNRQDAVKAMAPECE
FT                   LVIVVGSDNSSNSVRLVEVALDAGADAAHLIDNASLMNDSWLEGVTTVGVTSGASVPDI
FT                   LVRELLDKLAGHGYGTVTPVTTADETLTFSLPKELRRDLRAE"
FT   gene            148676..149530
FT                   /locus_tag="Ndas_0120"
FT   CDS_pept        148676..149530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0120"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0470 hypothetical protein; SPTR:
FT                   C1YHL3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65570"
FT                   /db_xref="UniProtKB/TrEMBL:D7B716"
FT                   /protein_id="ADH65570.1"
FT                   /translation="MSKPTLATKLVALVKGIFGRKETAAAPEPAAQEAAGTAQSPAPAT
FT                   AETEDVTARGTDQAQPSAEKSTEAGAHGAESADEPQAAPKTEEPAAAAAPVEAEKAEAA
FT                   EPAAEQEPVKEEAEEPAAAAQDEPAVQEKAPAEKKPAAKKKSAKSAKAAETPAAPEAAE
FT                   PAVAGEAGSGREERTGPATPATADVPEEGAAIAEEIAVAEAHTKVSSDEILERVRKGAA
FT                   PSLEDLAVPTYDELTLPSVRARLRKLTIEQVRDLRAYEVAHQSRPEFIKMYDNRIAKLE
FT                   SAE"
FT   sig_peptide     148676..148753
FT                   /locus_tag="Ndas_0120"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(149539..150807)
FT                   /locus_tag="Ndas_0121"
FT   CDS_pept        complement(149539..150807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0121"
FT                   /product="integrase family protein"
FT                   /note="COGs: COG4974 Site-specific recombinase XerD;
FT                   InterPro IPR013762:IPR002104:IPR011010; KEGG: sma:SAV_3980
FT                   phage-related integrase; PFAM: integrase family protein;
FT                   SPTR: C1YHL2 Site-specific recombinase XerD; PFAM: Phage
FT                   integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65571"
FT                   /db_xref="GOA:D7B717"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D7B717"
FT                   /protein_id="ADH65571.1"
FT                   /translation="MPVVDTWHKTVKLPDGSARREKSASYGRGKRWAARYRDSNGQQKS
FT                   PKFRTKPEAERHLKKVEGELARGLYVDPSAGQVTLKEFAEDVVKNASVEESSRHDLERR
FT                   FRKHVYPFLGGSQLRAIRPSMIQEWIKGRSAELGDQTVRTVFDNLSMVFQAAVDDELIA
FT                   RNPCRAGSVKPPSVTRRKVIPWSVELVSGIRSALPARYQALVVPGAGCGLRQGEVLGLA
FT                   VDDLSASKHTLHVRRQVKLMAGKPVFAPPKGGKEREVPLPGHVLSALAAHMERFPPVAV
FT                   TLPWKHFGGKPVTVSLIFTSRERKALNATYVNAYLWKPALVAAGVLPAPPAGERIQAAH
FT                   DKGFHQLRHHYASVMLDSGVSVRALADFLGHHDPGFTLRTYAHMMPKNEERAREAIDRA
FT                   WSAVDGLRSPCAPDVRPSDSQGS"
FT   gene            complement(150807..152243)
FT                   /locus_tag="Ndas_0122"
FT   CDS_pept        complement(150807..152243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0122"
FT                   /product="replication initiation protein"
FT                   /note="KEGG: sco:SCO5347 replication initiation protein;
FT                   SPTR: C1YHL1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65572"
FT                   /db_xref="UniProtKB/TrEMBL:D7B718"
FT                   /protein_id="ADH65572.1"
FT                   /translation="MPHPSDATQPRRAPSTEQISERVATGALDDVLSTIKRVRGCSEPL
FT                   RLRGQLSTVDTATGACDAVWSTTGQPGQVLMVACGNRRASRCPACADTYQGDTFHLIRA
FT                   GLVGGDKGVPEAVRSHPRVFATLTAPSFGPVHRGPDASGRAVVCHPRRSGAACYRRHTA
FT                   DDALIGQPLDAESYDYDGHVLWNNHAGDLWSRFTVYLRRHLADAAGIGRTEFNRTVRVS
FT                   YAKVAEFQARGLVHFHAVIRLDTKRPDGTVEPPPAWASVELLTAAIRSAAAAVVVPAET
FT                   ANGSRFLSWGEQVDVHAITSGAFASGGVDEEAVAAYIAKYATKSTTDDGTLDRRVFAGA
FT                   PLDHLGLSDHQRRLILTCWRLSEVPGLEERKLDRWAHTLGFRGHFSTKSRRYSTTLGQL
FT                   RQVRRDFRAGQARAMGHDDLLGDLPEMTEDTTLVVGSFSYAGQGYAHPVDRWLAESHHR
FT                   SRVYSRRVGREQLADLEEAA"
FT   gene            complement(152408..152944)
FT                   /locus_tag="Ndas_0123"
FT   CDS_pept        complement(152408..152944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0123"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: apv:Apar_0057 ABC transporter related; SPTR:
FT                   C1YHL0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65573"
FT                   /db_xref="UniProtKB/TrEMBL:D7B719"
FT                   /protein_id="ADH65573.1"
FT                   /translation="MAPVATAPAAVSAPTIPAQGRLPLIPRGEMAVALNVSPMPTDAPG
FT                   SVSTEQIAAWVRTGYDTLGAFHIWWCDYVARKLNAKVLFEEATAAQVGIYRAWFPSDDR
FT                   YQKAVDLAFALYNRLPETAQVGDRTVYLDMGDVMGDGCSYELPVSARDVEMANANADRV
FT                   REQLAMTGGALPIHF"
FT   gene            153050..153823
FT                   /locus_tag="Ndas_0124"
FT   CDS_pept        153050..153823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0124"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR011991:IPR000524:IPR011663; KEGG: svi:Svir_33520
FT                   transcriptional regulator; PFAM: UbiC transcription
FT                   regulator-associated domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH; SPTR: C1YHK9
FT                   Transcriptional regulator; PFAM: Bacterial regulatory
FT                   proteins, gntR family; UTRA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65574"
FT                   /db_xref="GOA:D7B720"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7B720"
FT                   /protein_id="ADH65574.1"
FT                   /translation="MTPTEEPLLPSRRIANDLRDSITSGALEPGEKLPSERELAQRYGA
FT                   ARNTAREAMRLLADEGLVDAQHGRGVFVRAKRQLFRFGSERYSRRLREETGLSPYRAEL
FT                   ARQGMAARVDCTSIERVDPPGRVRERLGLADDAQVIRRENWYYADEAPVQLGITYIPVE
FT                   IAGDTVLANSANMGKGSLYARFEERGHAITRVREEICARMPTRDEVKGLSIPDGVPVID
FT                   VLHTGIDQEGTPFEVTNFIMRADFAALDYNMPVED"
FT   gene            153830..154342
FT                   /locus_tag="Ndas_0125"
FT   CDS_pept        153830..154342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0125"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="InterPro IPR000182:IPR016181; KEGG: svi:Svir_33510
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   SPTR: C1YHK8 Acetyltransferase; PFAM: Acetyltransferase
FT                   (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65575"
FT                   /db_xref="GOA:D7B721"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7B721"
FT                   /protein_id="ADH65575.1"
FT                   /translation="MRDEVEVRPRAEQDLDACARLLVEVHERDGYPVEGVADPRGWLEL
FT                   DDSGRAWVALTEGAVAGHVSLSRNSSDDAVKLWRAQNSGRQEAVASVGRLFVSPAARGQ
FT                   GAAQALMRRAMEFGRGQGWQLVLDVMEKDQAAMRLYERLGWVCIGEITHRFGEGQEMPG
FT                   RAYALTC"
FT   gene            156087..156599
FT                   /locus_tag="Ndas_0126"
FT   CDS_pept        156087..156599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_1197 hypothetical protein; SPTR:
FT                   C1YHK7 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF3060)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65576"
FT                   /db_xref="InterPro:IPR021417"
FT                   /db_xref="UniProtKB/TrEMBL:D7B722"
FT                   /protein_id="ADH65576.1"
FT                   /translation="MRSAAPAAALLAATAFWLTGCSVGIPGTDQEVSVDPDGVSVGSED
FT                   GEVSVDSNGDVSVGNQDGDVTLDEGGGISVDSETGDLTIATVEGSVTEECDGQNVNVTA
FT                   SGAEVVLNGQCGEVSILGNELTVHIGSADSIRVTGADNTVHHAEGEPSVTDIGLNNTVS
FT                   AGGEATA"
FT   sig_peptide     156087..156158
FT                   /locus_tag="Ndas_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            156718..157950
FT                   /locus_tag="Ndas_0127"
FT   CDS_pept        156718..157950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0127"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="COGs: COG1570 Exonuclease VII large subunit;
FT                   InterPro IPR004365:IPR020579:IPR003753; KEGG: tfu:Tfu_0468
FT                   exodeoxyribonuclease VII large subunit; PFAM: Exonuclease
FT                   VII, large subunit-like; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; PRIAM: Exodeoxyribonuclease VII; SPTR:
FT                   Q47SR1 Exodeoxyribonuclease 7 large subunit; TIGRFAM:
FT                   exodeoxyribonuclease VII, large subunit; PFAM: Exonuclease
FT                   VII, large subunit; TIGRFAM: exodeoxyribonuclease VII,
FT                   large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65577"
FT                   /db_xref="GOA:D7B723"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:D7B723"
FT                   /protein_id="ADH65577.1"
FT                   /translation="MGMDSSAEAPQPVRVVLNAVGQWIGRLGRIWVEGQIAELNRRGRM
FT                   AYITLRDPVANVSVRVVCQTSVLDAQSPPPEPGARVVVHAKPDFYEVRGTFSLRALEIR
FT                   HVGLGELLARLEQLRRTLTAEGLFDAARKRPLPFLPNTVGLICGRDSAAERDVLENGRR
FT                   RWPAVRFEVRPVAVQGDRAVREVTEALKDLDSHPDVDVIVIARGGGSLEDLLPFSDEAL
FT                   VRAVASAGTPVVSAIGHEQDAPLLDHVADVRASTPTDAAKKTIPDVGEQLEIIRQLRDR
FT                   GRRVLRGGVERELAWLEGVRSRPALASPVREVDRLAEQVADLRDRARRSLTVSLDRSAD
FT                   GLGHTRARLHALSPATTLARGYAIVQREDGSVVRSAREPDAGESLRVRFAEDSLTATVE
FT                   SVHTEDTSEEG"
FT   gene            157954..158220
FT                   /locus_tag="Ndas_0128"
FT   CDS_pept        157954..158220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0128"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /note="InterPro IPR003761; KEGG: tfu:Tfu_0467
FT                   exodeoxyribonuclease VII small subunit; PFAM: Exonuclease
FT                   VII small subunit; SPTR: C1YHK4 Exodeoxyribonuclease VII
FT                   small subunit; TIGRFAM: exodeoxyribonuclease VII, small
FT                   subunit; PFAM: Exonuclease VII small subunit; TIGRFAM:
FT                   exodeoxyribonuclease VII, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65578"
FT                   /db_xref="GOA:D7B724"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:D7B724"
FT                   /protein_id="ADH65578.1"
FT                   /translation="MAAKGAKTREEGTAEPELSYEESREELNNVVRQLESGGLSLKDSL
FT                   ALWERGEELARVCEQWLEGARAKLAAAMDERRGDEPGDGDTPF"
FT   gene            complement(158264..158803)
FT                   /locus_tag="Ndas_0129"
FT   CDS_pept        complement(158264..158803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0472 hypothetical protein; SPTR:
FT                   C1YHK3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65579"
FT                   /db_xref="GOA:D7B725"
FT                   /db_xref="UniProtKB/TrEMBL:D7B725"
FT                   /protein_id="ADH65579.1"
FT                   /translation="MPPRKADGPERGRAPYFVRPDGRVRDVPHVRKRERPVPRPKENVP
FT                   GAPPRLTGRGGVLAIVVFSFAGAMIAQWAGTPAAPGVAFTLACVLGAFLVRPSDLLSLS
FT                   VSPPIAFFVAMVAAESVLALGSEGFARVLLLGLASRLAEVAPWLFLGTALVLVIGVFRG
FT                   LPGNIRDLGDQLNGRR"
FT   gene            complement(158839..160263)
FT                   /locus_tag="Ndas_0130"
FT   CDS_pept        complement(158839..160263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0130"
FT                   /product="protein of unknown function DUF195"
FT                   /note="COGs: COG1322 conserved hypothetical protein;
FT                   InterPro IPR003798; KEGG: sro:Sros_8478 hypothetical
FT                   protein; PFAM: protein of unknown function DUF195; SPTR:
FT                   C1YHK2 Uncharacterized conserved protein; PFAM: RmuC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65580"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:D7B726"
FT                   /protein_id="ADH65580.1"
FT                   /translation="MDGLALVLMLLIGLAVGTAVGWILARGREAETRADARAAQERAAY
FT                   VEEQLADRFRALSAQALDQTNQRFMELAEGRLRAVSAEAGGDLDERRRAVERMVEPLTR
FT                   TLDRVERQLREADAGRAAAHAELAKQVEYVREGSERLRDQTQSLVTALRRPEARGRWGE
FT                   LQLRRVAELAGMGSHCDFEEQAATRDGSRRPDMVVRLAGGKNIVVDSKVPLAAYLDAVE
FT                   AGAEEAARHLRVHARHLRTHVDQLAAKAYWSAFTPAPEFVVLFIPGEAFLAPALEYDPE
FT                   LLEYAMGRRVHIATPTTLISLLRTAQYAWQQEALSENARAVFDLGKQLHERLGTLGGHV
FT                   EGLGRALTRTVSAYNQTVGSLESRVLVTARRFGELGLVDGELDRPVGVEERPRAVAAPE
FT                   LSDPGGAGSAARERSGPDSGGQGNGTDVVRETSEPQWPKPVSNGEEGVFVADGTSSRKG
FT                   DTIRGKDTEHSREVTH"
FT   sig_peptide     complement(160174..160263)
FT                   /locus_tag="Ndas_0130"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            160568..161266
FT                   /locus_tag="Ndas_0131"
FT   CDS_pept        160568..161266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0131"
FT                   /product="putative hydrolase"
FT                   /note="KEGG: cmi:CMM_0113 putative hydrolase; SPTR: C1YHK1
FT                   Predicted hydrolase or acyltransferase of alpha/beta
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65581"
FT                   /db_xref="GOA:D7B727"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7B727"
FT                   /protein_id="ADH65581.1"
FT                   /translation="MRLETYTRGTGDLTVLLVHGSMATHETWHAVEDALVERGRRVVSV
FT                   DMRGHGDSPRGSYSVAALGDDLADSLPAGADLAIGHSMGAVALSLAVERLRPARAVYVD
FT                   PAFRLPPMHADAGERVRRVFVTADATRVRQSNPRWTDDDVEREVRGFAAFDPEFFDFVA
FT                   EEIAGRDFLPGEPVVPSLVLRAGDSVTVTPQTAEELTGRGFTVRVVEGAGHCVHRDDLP
FT                   GFLAALEGWL"
FT   gene            complement(161263..162243)
FT                   /locus_tag="Ndas_0132"
FT   CDS_pept        complement(161263..162243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0132"
FT                   /product="methyltransferase FkbM family"
FT                   /note="InterPro IPR006342; KEGG: mpt:Mpe_A0618 hypothetical
FT                   protein; SPTR: C1YHK0 Methyltransferase, FkbM family;
FT                   TIGRFAM: methyltransferase FkbM family; TIGRFAM:
FT                   methyltransferase, FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65582"
FT                   /db_xref="GOA:D7B728"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7B728"
FT                   /protein_id="ADH65582.1"
FT                   /translation="MVTDQLRALVRRYPLVRFATRKIRVRLPRRLGGLDPDRVPPWTRE
FT                   VAFSLPRLDSDTRRVGPDGLTLRLPGDLTVPRRLAAFGLARHEPDSLACFMAMLDHTRP
FT                   GAVFDVGSGVGVYSLLAAARTRRPVFAFEPTPEVAAAARVVSSSADLGFTVVELALSNH
FT                   TGTAHLRRARHNDMCNTLVHSARADLSHIAVEVTTLARWNEDASAFPTVLKIDTVGTEP
FT                   DVVAGGLEVLRRYRPWMLVKVRPDRGVEERLMALLDPLEYTWYPVSGPPPYEPRPEISG
FT                   RASPAWERMWLFTPEPVPEEFWPSVRGWRRALESCRPGSRGNPDP"
FT   gene            162716..163801
FT                   /locus_tag="Ndas_0133"
FT   CDS_pept        162716..163801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0133"
FT                   /product="GTP-binding protein YchF"
FT                   /note="COGs: COG0012 GTPase probable translation factor;
FT                   InterProIPR012676:IPR012675:IPR002917:IPR013029:IPR
FT                   004396:IPR006073; KEGG: tfu:Tfu_0473 GTP-dependent nucleic
FT                   acid-binding protein EngD; PFAM: Protein of unknown
FT                   function DUF933; GTP-binding protein HSR1-related; SPTR:
FT                   C1YHJ9 GTP-binding protein YchF; TIGRFAM: GTP-binding
FT                   protein YchF; PFAM: GTPase of unknown function; Protein of
FT                   unknown function (DUF933); TIGRFAM: GTP-binding protein
FT                   YchF"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65583"
FT                   /db_xref="GOA:D7B729"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:D7B729"
FT                   /protein_id="ADH65583.1"
FT                   /translation="MSLSIGIVGLPNVGKSTLFNALTKNDALAANYPFATIEPNVGVVG
FT                   VPDARLGKLAEIFGSAKVIPATVDFVDIAGIVRGASTGEGLGNKFLANIRESDAICQVI
FT                   RAFDDPDVTHVDGDVEPSRDIETINTELILADLQTLEKALPRLEKDAKRNAKDKDAQEL
FT                   LQAARDAQQVLDGGTSLSAAEGVDLDRLRELSLLTVKPFIYVFNLDTDELADGALRTKL
FT                   QDLVAPAEAIFLDAKIEAELAELDEDEAQELLESMGQTESGLAQLARVGFATLGLQTYL
FT                   TAGPKEARAWTIRKGATAPEAAGVIHTDFQRGFIKAEVVSFDDLVAAGDMQTARAAGKV
FT                   RMEGKEYVMADGDVVEFRFNV"
FT   sig_peptide     162716..162802
FT                   /locus_tag="Ndas_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(163905..164480)
FT                   /locus_tag="Ndas_0134"
FT   CDS_pept        complement(163905..164480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0134"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="COGs: COG0204 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; InterPro IPR002123; KEGG: bfa:Bfae_22670
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase; PFAM:
FT                   phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; SPTR: C1YHJ8
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase; PFAM:
FT                   Acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65584"
FT                   /db_xref="GOA:D7B730"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D7B730"
FT                   /protein_id="ADH65584.1"
FT                   /translation="MLRYLAARVFWSLSRWKLTTEPKPERPTVLIGAPHTSNWDFVLML
FT                   AISWRLGLELHWLGKQSLFTGWRGPIMRALGGIPVDRANPGRVVDDVVRRVRSGETFGL
FT                   VITPDGTRGAHTHWKSGFYRIARETGMPVTLGFVDRTTMTTGLGPTFELTGDVAEDMGR
FT                   VRAFYADKAGHSPERRVEPRLREEGGAG"
FT   gene            164923..165873
FT                   /locus_tag="Ndas_0135"
FT   CDS_pept        164923..165873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0474 hypothetical protein; SPTR:
FT                   C1YHJ7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65585"
FT                   /db_xref="GOA:D7B731"
FT                   /db_xref="InterPro:IPR024735"
FT                   /db_xref="InterPro:IPR035628"
FT                   /db_xref="UniProtKB/TrEMBL:D7B731"
FT                   /protein_id="ADH65585.1"
FT                   /translation="MAKASRRGAAAGEPDDGGAGLDAPRARRPRAGAGGRWWVGVGRAV
FT                   LWAFIIVVVFNGIWFPLRGGFALPDTSEEPEQSDTVTYPETAAAAFGMRFAEAYLDTAD
FT                   PEARLSDLAAYVPEGEAAALDVPADSLTGDNLTVVAVHVEDDHNGLVVVRADVNGQPMR
FT                   LDVPVYADGESLVVSGNPALLAAPTQAGLPEGSAFETDPEAEEQLGEVLSGFFEAYAGE
FT                   PAHLERYVEPGVTIAPLPENSLEFGELSDITVPTRASTGNDDVRQVAATVRWNVPASDG
FT                   TDTGQITQNYLVTVVDSGSEWHVRDIQGAPRSFGG"
FT   gene            165946..166263
FT                   /locus_tag="Ndas_0136"
FT   CDS_pept        165946..166263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0475 hypothetical protein; SPTR:
FT                   C1YHJ6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65586"
FT                   /db_xref="GOA:D7B732"
FT                   /db_xref="UniProtKB/TrEMBL:D7B732"
FT                   /protein_id="ADH65586.1"
FT                   /translation="MLPLLSSTPDVFHAAGGADLLFLAAQTTENAPDTGGLADFLRGFF
FT                   GPLFLVIVSIVAVFFLFTREITRFAQFIILAIFIGIVFYVPGIIEVIAVALARAMGVST
FT                   E"
FT   gene            166282..170841
FT                   /locus_tag="Ndas_0137"
FT   CDS_pept        166282..170841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0137"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0476 ATPase involved in chromosome
FT                   partitioning; SPTR: C1YHJ5 ATPase involved in chromosome
FT                   partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65587"
FT                   /db_xref="GOA:D7B733"
FT                   /db_xref="InterPro:IPR025608"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7B733"
FT                   /protein_id="ADH65587.1"
FT                   /translation="MDLPTYTNIWRIEKRLYKLYDFRLPMPLPVGTFGVALGVFALWVV
FT                   LLSLVNAPFVFGNGWHLVLWVVPPGVITVLATRPVIEGKRLTELLISQARFLAEARVYN
FT                   RLAPEYEPAEVRVTVRVWHRDPASGPLPSASRRRAEPEAETAGDGVAETVGTAVRPSRS
FT                   DAPPLLGVRAPADPAPSAETEEEAPARGGSGRPDRGQERAPAGAPRIRPRSDGETGRRA
FT                   PVRAKAVPARSETVSAGAESAPAEPKAVPVRSEAASARTANAPALERETPAEKAPAASE
FT                   RAPVAVAARPDPEERHAPSRPRGERPDASAASEGGGGAPDGPRRGVGRRVLNYFGFALG
FT                   SAPREPREEEPRGPEADTAEDPEDGFARERIYETEGEEQRDSDEWFSRLRASSGETPLG
FT                   LTSKSAYSVGDTAAMSRGEVVDAVDERRVSGSDEEETAAARRLRGRTQGLRVAKDLEEQ
FT                   RRTERVRERGPRELPTSRARGQGLPGTGEEPEPPRRRGRPHAAPWELEKKAEPAAGYGD
FT                   LSDYAARYAAATGRPPAEAGALPWLPPSSATPQEEARATEDADAPARTERREDPVGAED
FT                   TASATGAPGTTDADGAAETARPVARAEQDTARDGSGVSAEAVPGTGTRDAEASGRGSAS
FT                   GPEGPSVAPRRSTTGSEDAQRGSVTGDEETVPQRGLAGHGDTAGPGDVGYRSATGHEAT
FT                   SGHGDTDGRASTAGPGDVTGNGSPTGAEETVEHRPATGRGDTVLPEDTAGNGDTTSPET
FT                   AAARTAPRGVDARPAVDAAAQGTTAPDDTTTPDTPDTRVTPDTAVPVAPAAERSPHKPV
FT                   LELDHGTGEQDAMPGTPREESQDRGPEWNEHMSVLDNHLITADTPAPPRPKFADAVPTQ
FT                   ERDAKDPSRWFEDGRKRHPDQPKVGDRGNPLIPANELREENAVPAASGDAPETTAGEVA
FT                   GEAAPAGRAPADEPKPPTQLDHGTGELVSFVEVRDDHGRGDGNVRVDPGTDQVHRRTAS
FT                   DLERAEAEALARRRQNVRRDERDPGEARGSDGAAAPAASGSAGADRGDASFRARWSMRA
FT                   TGTADSASRDTDTSAKPDPAAGRRSGHQGAGTARAASGAREDRNGAARDPRANPSMADA
FT                   LAQEGTSTEEERTSPPAVQDTGRTEDGALTDRPTPTAGQEHPAEEPRESEDPHDGVFHR
FT                   VAQNARRLGQLFGQPAPGEEPEPPAREPGTALELDHGTGEQERLGDTPNGVPAHRTEEP
FT                   EPRRRAEEPAASDSGGTRGWRRLAKVVTGGAAPVRSDLPPSDIERLRTPLDGPRSLVVL
FT                   GCTGGAGQTVTALMIGHTLAAHRDDLVVAVDVNPGPNGLSRRVGAQTPETLTGLLANAE
FT                   AIQDYSRMSGYTSRTATGLEVVQTLDDPYVQTLDDRDYGQLASLLGGFYGVTLLDPAAT
FT                   GVARALPVADGLVLVAPANADAERAVSMTFDWLDGNGYGALRARSVLVVNGVSKRSLQD
FT                   VDAAERVARGRCRAIVRIPWDDHLGSSYTRIDVGALRPATKRAHGALGGVLVNSLTQQ"
FT   gene            complement(171072..171980)
FT                   /locus_tag="Ndas_0138"
FT   CDS_pept        complement(171072..171980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0138"
FT                   /product="ectoine hydroxylase"
FT                   /note="InterPro IPR008775:IPR012774; KEGG: sen:SACE_0486
FT                   ectoine hydroxylase; PFAM: Phytanoyl-CoA dioxygenase; SPTR:
FT                   C1YHJ4 Ectoine hydroxylase; TIGRFAM: ectoine hydroxylase;
FT                   PFAM: Phytanoyl-CoA dioxygenase (PhyH); TIGRFAM: ectoine
FT                   hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65588"
FT                   /db_xref="GOA:D7B734"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="InterPro:IPR012774"
FT                   /db_xref="UniProtKB/TrEMBL:D7B734"
FT                   /protein_id="ADH65588.1"
FT                   /translation="MTLQMDLPTSTADEYPTRKSTEPALLYRRDPAVWGTDEGPFSHDE
FT                   LCAYDERGYTQIDSLITPDEVGAYSAELERLSSDPDLRGDERVVVEPSSDEVRSVFEVH
FT                   KVSKVFADLVNDPRLVDRARQILGSDVYVHQSRVNYKPGFGGGSFYWHSDFETWHAEDG
FT                   MPRMRAVSFSVALTDNYAYNGALMIMPGSHRTFVSCVGQTPDDHYRDSLKSQHVGTPDQ
FT                   SSLSYLADQHGIDVLTGPAGGVTVFDSNCMHGSGGNITPYPRSNVFIVFNSVENACDRP
FT                   FSAPAPRPEFLSAREFTPVGR"
FT   gene            172492..173154
FT                   /locus_tag="Ndas_0139"
FT   CDS_pept        172492..173154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0139"
FT                   /product="Domain of unknown function DUF1994"
FT                   /note="InterPro IPR010916:IPR018532; KEGG: hypothetical
FT                   protein; PFAM: Domain of unknown function DUF1994; SPTR:
FT                   C1YHJ3 Putative uncharacterized protein; PFAM: Domain of
FT                   unknown function (DUF1994)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65589"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:D7B735"
FT                   /protein_id="ADH65589.1"
FT                   /translation="MPSPRPRALPRALAALSAAVLAVVLGWSAPAAADHVLPPGIPSAS
FT                   TAQSQLDSLTVRAKGPQTGYDRGLFPHWSVVDSPCTARQYVLVRDGHDVVTDSDCQPTS
FT                   GRWYSTFDDVWWDGDVSQISVDHMVPLSEAWKTGAADWTTERRRDFANDVDSPQLWAVT
FT                   VSSNSAKGDKDPSQWMPENTAIHCDYVKAWVNVKHRYDLTVTSAERSAIQDTIDTAC"
FT   sig_peptide     172492..172590
FT                   /locus_tag="Ndas_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            173385..175856
FT                   /locus_tag="Ndas_0140"
FT   CDS_pept        173385..175856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0140"
FT                   /product="AAA ATPase"
FT                   /note="InterPro IPR003593:IPR016628; KEGG: tfu:Tfu_0477
FT                   ATPase; SMART: AAA ATPase; SPTR: C1YHJ2 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65590"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR016628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7B736"
FT                   /protein_id="ADH65590.1"
FT                   /translation="MTGTRGTRGTTRLAVRYFDDRVLFSDSEAWAYFRLPTVSYEFTTP
FT                   EERQALATNVTIALAAIRMNDAEVHLRVAHRTYPAAEWATRLDATSDSGPGWYDYLDET
FT                   YRHVWAKDFWTKEVYLGVRLGQRNAGAGLGLFSQVFGAYQRTEQVLGINDDAVDDREIA
FT                   RWTDQAERLGRALAASSLHARHATSDEIAWLIRHAVSGTAEEIRPSAAGRRTWGRGEIE
FT                   ALVDGVVHNGRSALRLEQPAGSTHVAFLSFARFPDLMPFPDGEPWMHHADALPFPVEMS
FT                   LRMKLIPPAKASKDVGRKLAHARDMDAHIREAGVEAPIALAEQIDAARMLEHGITKERL
FT                   PFVYGWHRLMVSAPTERLLGQHVEAVIEHYRDIGIDVINSTGDQFSLFNESLPGDRIRL
FT                   NAYAQRQPLRTIAGGMPTATVDVGDRVDHSGGGWVGPYVGETIGRARSIVHFDPMVAAA
FT                   RNRPTAIAITGEPGGGKTTLALLLIYQLALRGVTVAAIDPKGDAESLVELLQRRGRKAR
FT                   MMSLGSAQPGLLDPFAFGDDLSAKKTMATETLRLLLPRMSEERESAMIQAVAAVANQPQ
FT                   PSLAKVVDHLVSSPGAASRNLGAVLQSMSEMRLASLCFDPQGEARIDTEGWTTVFTLGG
FT                   LTLPDSGVGRDDYSYEQRLSVALLYLVSQFARRLMNGLDRHLPKAIFLDEAWAVTSTPE
FT                   GAKLVPEVSRMGRSRNTALILVSQNAGDLLNEQVTNCLSSVFAFRSSERFEVESVMSLL
FT                   GVETNEDHLAVLRNLGNGECLFRDLDGRVGRIGVDLVSENLLRWLDTNPTRQRPGEEEN
FT                   LVPAGGRDEQL"
FT   gene            176130..177164
FT                   /locus_tag="Ndas_0141"
FT   CDS_pept        176130..177164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_1269 hypothetical protein; SPTR:
FT                   C1YHJ1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65591"
FT                   /db_xref="GOA:D7B737"
FT                   /db_xref="UniProtKB/TrEMBL:D7B737"
FT                   /protein_id="ADH65591.1"
FT                   /translation="MREDAIRPRPVIDPALPDRQRREASLGARPPEPPPRGGGGPPEAR
FT                   PPRLSDSGVHLLGVGFTTTLALITAGWYLGMVIASVSLVAYVAALAFRRDAHPAVRAAG
FT                   AAAGAGTLVTAPVWLLDVVPQDPSPGIPWVVFGVLVAVVTADTLTSRVRRTDRERYRER
FT                   VVLPDDVSEGDHALLVEVQRTIDLVRGARTELGGESLDTDRALTVLHEQEWRIASLLAR
FT                   QRELRRSHQRRWQRAVSPRVREALKPQREHLHAVEEAVRARVAQITEYGRLVEQAVAAH
FT                   REWEQCQDAVDSTAEYTEHLAAAGFLGTRAADVAELAATAALARQVRDERVSRLAGHDL
FT                   VAHG"
FT   gene            177319..178611
FT                   /locus_tag="Ndas_0142"
FT   CDS_pept        177319..178611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_5996 hypothetical protein; SPTR:
FT                   C1YHJ0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65592"
FT                   /db_xref="UniProtKB/TrEMBL:D7B738"
FT                   /protein_id="ADH65592.1"
FT                   /translation="MSEVRESVHPLTSAKETVSVGVASGRGGFVELLRDARRSLLDTLE
FT                   DGDPGGREVREASARLHDHVDRVLAEHVQRQRRWPARTDGERLTRAFRALDESGVIARE
FT                   EFTCCERCARTALEGELAARNSRPADTPARGYAFYHDQDAAHAVAGSSLTIGFGASHPI
FT                   RRAAVGEEVAEALRAHGLTVEWDGDPDRKLHVGMDWNRRRFGRGAAFPGPAVDGEPMVH
FT                   VSFNNPGPYEVPEWVSHYQGRVSVRELSRMVLPWLPRFFVATLSSDRGHTIALERDFDL
FT                   LRVRHGPALSRERVEEPLSRWVVGAVWPREEARSAHTGLVEVHYADAAEEGLGFMDYAE
FT                   PLETAAARLVVHQLTPSKGTFAVFTAPSGAVVQMVWESGPRLWMESPSPAEAVSRGRYV
FT                   TLSEAEETVRVLAEEGRVALAELGELKLTHW"
FT   gene            complement(178816..179331)
FT                   /locus_tag="Ndas_0143"
FT   CDS_pept        complement(178816..179331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sro:Sros_0985 hypothetical protein; SPTR:
FT                   C1YHI9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65593"
FT                   /db_xref="GOA:D7B739"
FT                   /db_xref="InterPro:IPR025058"
FT                   /db_xref="UniProtKB/TrEMBL:D7B739"
FT                   /protein_id="ADH65593.1"
FT                   /translation="MLLAMHEDPRDRGDGAASGLWGRVACAWAVAFAVFHLYWALGGDW
FT                   GLGVSAGPVAVERPGWFVVVGLWGVGLLCLFGGALGWLLARPRPPGPTGRVVRTLGWCV
FT                   CAVLLLRAVTVEVMLLADPAGRETTVSPEQRMWTLLLWNPWFLVGGLVFGLAALGFART
FT                   REPGNGDA"
FT   gene            complement(179413..181365)
FT                   /locus_tag="Ndas_0144"
FT   CDS_pept        complement(179413..181365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0144"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterProIPR008271:IPR011009:IPR017442:IPR017441:IPR 000719;
FT                   KEGG: sro:Sros_8510 serine/threonine protein kinase-like
FT                   protein; PFAM: Serine/threonine-protein kinase-like domain;
FT                   SPTR: C1YHI8 Protein kinase family protein; PFAM: Protein
FT                   kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65594"
FT                   /db_xref="GOA:D7B740"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D7B740"
FT                   /protein_id="ADH65594.1"
FT                   /translation="MSASGHSSVGRYELRERLGAGGMGTVWRAWDPSLQRDVAIKEVLL
FT                   PQGMDPEARAEAHARTLREAQATARISNTAVVTVHDVLEHEDSPWIVMELLSGKSLQYQ
FT                   LDHHGPMPVERVEEAARSLLGGLKAVHAGGVTHRDVKPANIMLTDDDRTVLTDFGIANV
FT                   DGGAALTQTGVYIGSPEYMAPERFEGKRALPASDLWSLGVTLYALLEGRSPFKRESITG
FT                   IISAVLTAPMPPRLSLDDAEHSPASAPLRALIAALLARDASARPSPDEALALLEREKQA
FT                   QEGDGGVGAGAQDSPGTGGQPLPLTGPQEADSGSWRAPGTGAQSAPGGAVPTGPSGGYR
FT                   PPFPVAGPGTPGQAGPGQGAPGTGPHPPWHAAPGGPNSPGAPRGGPAFPSGPHTPHGPG
FT                   GPGFAGGPHNPAFPSGPHGPGFPGGQTGPNLPGGTAAHGPGTGPGANPQAPHAAGRQPE
FT                   PQPPPGATGQFSLPFPSAGTPTGRGPLPGQPVGGPGHPGMFPGHGGGPATGAQMPWERP
FT                   RTGMPATVVTAAVMLVLNGLYLLVLAVLFTVESTSGSLEVNGASMAQLYVWGLLSTVAA
FT                   PALLTRSRLVYGGVVLLQMVAAVVLVLNMFTVVVYDPEQLPVYVLVLLLNLAVAGLLLI
FT                   PARARAYFGFGADFR"
FT   gene            complement(181419..182102)
FT                   /locus_tag="Ndas_0145"
FT   CDS_pept        complement(181419..182102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0145"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fra:Francci3_0071 hypothetical protein; SPTR:
FT                   C1YHI7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65595"
FT                   /db_xref="UniProtKB/TrEMBL:D7B741"
FT                   /protein_id="ADH65595.1"
FT                   /translation="MSWMTAEEEARRARAELMRDVVDFPFPLVIAALDSPRWEPAQMWF
FT                   HEDPWSAGTRYVPVGPSPEPDGFGPTLRSHPLEGTHDPAWTPLHEGYGLEGGSRLCGAH
FT                   GDVVIVDSADDAVGATPSTDPPTVETGAPTTEFPDIGTVELSGHVRAARPGGRGDRLGG
FT                   HGMTFREHPKRGVPFPLPAPYRAARVTATGHPHTGVWGTVRNGGRMVQETRTSVTKCCC
FT                   RAFLG"
FT   gene            182676..185024
FT                   /locus_tag="Ndas_0146"
FT   CDS_pept        182676..185024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0146"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0478 hypothetical protein; SPTR:
FT                   C1YHI6 Putative uncharacterized protein; PFAM: TrbL/VirB6
FT                   plasmid conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65596"
FT                   /db_xref="GOA:D7B742"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:D7B742"
FT                   /protein_id="ADH65596.1"
FT                   /translation="MTHQHVRRRGWRRLLMTFLMLTGLVVLPLTGAQANPLCPGEPAPL
FT                   PESAGSGSDGLLVPPQSQSSIEGSTDGLPPDASMYGQYGTAGQQWHMITESCVDGISNG
FT                   AQATLANTAWDLSKTINQSTITVYQAATSDGLLASFNELVENVVVTLREGIWRPLIPTV
FT                   VILGALWLGWYGLIRKRMTLTIESSVWMVAATALGLWILVNPSQIMGMASGLVNSGSQL
FT                   VTSTIGQVPYGGGSGTCPSGAEPPERADWESEADFQVRRNADMLWSSLVCQPWVAGQFG
FT                   NGDIAESAAHVHGTDLIAAQGISRIEQQQIADEEIDANELVAEKQEAYEAIAADVQEFY
FT                   PSVYPLFAGDDQGSRLGVATLALFASVFAGGLILAGSVALIVLKIAFLLLFLLAPIFLL
FT                   IGIHPGYGRMVLLRWVELMIGFLLKQIFVVLLISLLVMCYGMVMSTSLGWGLQMILLAL
FT                   FTVALFVYRKPFAYLFSSVNANTFTSRIVSDAAQSQALSRSAVVLPPVANLKAQAWGLR
FT                   RGPQIAGAAAGVPAGGGGVPNGGVDTGVGDEVPADGGPVRADGARARGTAGYGRVRDNA
FT                   APPLNVTRSAPAGGGGGTRPAGSARSGDQAPSLSGGSASGAIPPRPSGGYTGTGDSGWA
FT                   SVFGTASGGRGGSERRDGGGSSGGGSVFGGGAPAAGSGRAASSERPEPSTGQGIFGGRA
FT                   DTPARGNPNARASRWGSPRERRERPAPQRPARPAPSGESRGRGDGDGGWLTGSGKRRDN
FT                   APITPFWGESASSTTRDRKRDVPFWLNDD"
FT   sig_peptide     182676..182777
FT                   /locus_tag="Ndas_0146"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            185044..185721
FT                   /locus_tag="Ndas_0147"
FT   CDS_pept        185044..185721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0479 hypothetical protein; SPTR:
FT                   C1YHI5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65597"
FT                   /db_xref="GOA:D7B743"
FT                   /db_xref="UniProtKB/TrEMBL:D7B743"
FT                   /protein_id="ADH65597.1"
FT                   /translation="MPNPLPERAQRAVFTGLIVVLVVFGLYLSFGGFGGTEEDGPSEAS
FT                   PEPGTAQEESPGGPGGPDGLSTVEPSPIPTTAAEDVDVLDWFPFTEAELQAAGAAARAF
FT                   AEAYGTIDYTQSPESYYASMEELATPEFAGVLAETSRVGAFWSEMSEAGAVAEGRAQVD
FT                   SVRTFGADSVTFVVTAQSITETGSAEFDENLGEFAVTVVRSGGSWRVFDFQPADAGQFG
FT                   GEE"
FT   sig_peptide     185044..185175
FT                   /locus_tag="Ndas_0147"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            185726..186904
FT                   /locus_tag="Ndas_0148"
FT   CDS_pept        185726..186904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0148"
FT                   /product="NLP/P60 protein"
FT                   /note="COGs: COG0791 Cell wall-associated hydrolase
FT                   (invasion-associated protein); InterPro IPR000064; KEGG:
FT                   tfu:Tfu_0480 cell wall-associated hydrolase
FT                   (invasion-associated proteins); PFAM: NLP/P60 protein;
FT                   SPTR: C1YHI4 Cell wall-associated hydrolase,
FT                   invasion-associated protein; PFAM: NlpC/P60 family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65598"
FT                   /db_xref="GOA:D7B744"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D7B744"
FT                   /protein_id="ADH65598.1"
FT                   /translation="MISLFTRRPSDRGAAGLWFGAAVAVTVALMTVFAMLVIPVITNTT
FT                   QQIGSMMANGLVCGPDTDAEQPDASGYAMDSIPENYLRIYMEVGEDRGIPWNILAGVGQ
FT                   VESHHGRWEGPGITEGHNDWGAAGPMQFGSLDGSAAGNSWGGEPVQPVDERPEQGYGVD
FT                   GNDDGIVSVYDPADAIPAAADYLIAHGLKEDVRQAIYGYNHAWWYVDDVLEWAQQYAEG
FT                   EYDTSGSIETAVACQLDAQGAPIGSAPDELTQAVVDWALAQRGKPYVWGGVGPNGFDCS
FT                   GLMQKAYESIGVTIPRISQDQWGFGPEVSQGEEQPGDLVFFHVSRAGEPPGPGHVGMVI
FT                   GDGLMVEAWCTNCGPIAVREYDDPNRADIMGFTRPLEHPDVQAQLEAQDSRG"
FT   sig_peptide     185726..185827
FT                   /locus_tag="Ndas_0148"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(187734..188285)
FT                   /locus_tag="Ndas_0149"
FT   CDS_pept        complement(187734..188285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0149"
FT                   /product="Thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /note="COGs: COG1435 Thymidine kinase; InterPro
FT                   IPR020633:IPR001267; KEGG: bcv:Bcav_1932 thymidine kinase;
FT                   PFAM: thymidine kinase; PRIAM: Thymidine kinase; SPTR:
FT                   C1YHI2 Thymidine kinase; PFAM: Thymidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65599"
FT                   /db_xref="GOA:D7B745"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR020633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7B745"
FT                   /protein_id="ADH65599.1"
FT                   /translation="MAELKYFTGSMNSGKSTMALQEHHSRGGEGVLYTKQDRAGAGIIS
FT                   SRLGLESPAVEVGDDLDLYDDIADRKAPYVICDEAQFLSYKQVGQLAGVVDGMRIDVYC
FT                   YGILTDFQGQLFPGSKRLVELADKIEVLPVSARCWCGGRATHNARVVDGVMIYEGEQVH
FT                   IGGNESYATLCRHHFMAGVA"
FT   gene            188805..189752
FT                   /locus_tag="Ndas_0150"
FT   CDS_pept        188805..189752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0150"
FT                   /product="Ion transport protein"
FT                   /note="InterPro IPR005821; KEGG: tfu:Tfu_0383 hypothetical
FT                   protein; PFAM: Ion transport protein; SPTR: C1YHI1 Ion
FT                   transport protein; PFAM: Ion transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65600"
FT                   /db_xref="GOA:D7B746"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="UniProtKB/TrEMBL:D7B746"
FT                   /protein_id="ADH65600.1"
FT                   /translation="MRRAQVTRLVESQWFSNIVLAVILVNAVILGWMTYGGSALPYLVV
FT                   IEYVVIGVFVVEMILKIHAWRGRFFRSAWNWFDFLVVLVSVIPATGPFAVLRILRVLRI
FT                   LRVITAVPQMRQIITALFKAMPGVGTVIGLLLVVIYTSAIIAHQLFGEAVPVFFGNLGT
FT                   SLYTMFLLMTTEGWPDVSDAVLAEHPTAWIFFVCYIVLTAFIMLNLVIAVIVTSLEQEI
FT                   SEVRWAEDQQLEEVQHEAVMARLVELGQQVERLDRMLRERDADPGAAGLPGSVQADRAT
FT                   QTAQAVRTIQPGEPAESVRRGNGDAAQPPPPSPL"
FT   gene            190029..191084
FT                   /locus_tag="Ndas_0151"
FT   CDS_pept        190029..191084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0151"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0736 hypothetical protein; SPTR:
FT                   C1YHI0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65601"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:D7B747"
FT                   /protein_id="ADH65601.1"
FT                   /translation="MKAVFHPLKPEKRALMPDLTEFAGLPVVEFPASGTWEERLERIRE
FT                   RGGDPRDPASRAWRLRTSEHLRRPPEDKGADYLARFLSEVDTGQLTALVIGEWGYASDG
FT                   GLYQAADLLVEHADALPNLRSVFFGDITFDECELSWISQPDLAPLVAAFPRLEELTVKG
FT                   ADGMEGQLGLHVPSHEALRSLTLESGGLPGRVVREVASSALPGLEHLELWLGMEEYGGC
FT                   ASPQDLAPVLSGEAFPRLRYLGVRNAEHWTEWVPVLAGAPVVKRLEVLDLSLGILTDQG
FT                   ARELVDRAEAFSGLRKLDLHHHFLSEGMVERVRAAFAGTGVELDLDVGRDEEDREDDED
FT                   EEPYYYTAASE"
FT   gene            191246..191473
FT                   /locus_tag="Ndas_0152"
FT   CDS_pept        191246..191473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_3128 hypothetical protein; SPTR:
FT                   C1YHH9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65602"
FT                   /db_xref="UniProtKB/TrEMBL:D7B748"
FT                   /protein_id="ADH65602.1"
FT                   /translation="MAEPESPLKDKNYNLVWAVHQSLENVWRLEGYIKDAEKQGDDELA
FT                   QWFRRIQENNQKAGEQGKKMLVERIKKENG"
FT   gene            191776..192399
FT                   /locus_tag="Ndas_0153"
FT   CDS_pept        191776..192399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0153"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ach:Achl_1859 hypothetical protein; SPTR:
FT                   C1YHH8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65603"
FT                   /db_xref="UniProtKB/TrEMBL:D7B749"
FT                   /protein_id="ADH65603.1"
FT                   /translation="MSDGPHDDRWTSGKRKETRAELAYFHVGGHREDLSGRTWSEYPVL
FT                   PLPPHEADTGEHPELRGRRFVEVPESGWHALVAWAVGPEHAVRCPERHPPSPVHVTCEN
FT                   RGRRVQRWEERTRTDRAGVDRGVDDFLTEAGVPHQPCGYRWFAELPGGIRDGDHLFGSF
FT                   SSHLASVGSNEQDPPGMRRSMRNLARRLYGDAGRSALPDSLGGS"
FT   gene            192612..193619
FT                   /locus_tag="Ndas_0154"
FT   CDS_pept        192612..193619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0736 hypothetical protein; SPTR:
FT                   C1YHH7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65604"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU46"
FT                   /protein_id="ADH65604.1"
FT                   /translation="MADLTEFAGLPVVEFPAEGTREERLEQVRRRGGDPRDPASTAWRL
FT                   RTSGSDGRRPEDDYDQYFSLFMSEVDTERVTALVLGDWVSPDQCGPEQAVELLAEHADA
FT                   LPNLRSVFVGDITADECELSWINQGDMAPLLAAFPRLERLATRGADGIRGGGGLSLHVP
FT                   SHTGLRSLTLESGGLPGRVVREVASSGLPALEHLELWLGMEDYGRDVSPRDLEPVLSGG
FT                   AFPGLRYLGVRNAEDVDAWVPVLADAPVVGRLEVLDLSLGVLTDRGARALVERADAFAG
FT                   LRRLDLHHHYLDQEAVERVGAAFAGSGVEVDLSDPREPEDYGDGELEYYTAAAE"
FT   gene            complement(193682..194533)
FT                   /locus_tag="Ndas_0155"
FT   CDS_pept        complement(193682..194533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0155"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_1378 hypothetical protein; SPTR:
FT                   C1YHH6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65605"
FT                   /db_xref="GOA:D7AU47"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU47"
FT                   /protein_id="ADH65605.1"
FT                   /translation="MSLFPVGIWDTARALTLSGAGQGALLLAPVVAGVVLLMFWLASQW
FT                   LERSGVNHPFASAALVTATAMVTPVVVAFLAPEVMTLPWGTAANTAFLTGTVATLGMGA
FT                   SMLLDRPSDRWRPGVLPAVAVVAVLLAALPAVEDAVLARAADERSRAQIMSFERTIAVL
FT                   DHPGWSLAQVHEVEDGLRLTYRDGNGAPLHVLTWDGTRSADAGLDAGCGFPGTWCRDLG
FT                   EAVVVHHADGHPSELRTHLDDGTVASLLPEPGTPTDLLGVSRALRPEEPGERRDLVEAV
FT                   TA"
FT   gene            complement(194810..195976)
FT                   /locus_tag="Ndas_0156"
FT   CDS_pept        complement(194810..195976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0596 hypothetical protein; SPTR:
FT                   C1YHH5 Putative uncharacterized protein; PFAM: Family of
FT                   unknown function (DUF695)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65606"
FT                   /db_xref="InterPro:IPR016097"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU48"
FT                   /protein_id="ADH65606.1"
FT                   /translation="MALFRRRRSTDSASSVTAFWDAWPAEREALASAVESDQPVPAEVS
FT                   ERVTALVRSIHPDMEWEVGRAPKPSGGLEDLDLSTDVDPGKLLEQLAALDDPSRLTDGP
FT                   AYALTLRPGGSEEARILSERWARSAPEDSRWLFRPVRPADHDQLSSTVNLDDHELDLSH
FT                   VSVSMRVDHATGKVEVGVYHPDNMFLPESTRAAVAEHVTLLALGEDDRVRWIGETAPLD
FT                   EPPLDPLPPTSMPAVVRQMADMLGGSGGWATLHGRIPLQGAVEILLRHPLTRRDFPAFT
FT                   LFVQVIVPYTHTDEDKLPAGASASALDDLEARISGVLGDNGALFMRQTVGGRRDYRYYL
FT                   DPDSGVLPEFEAVLTDWSEGEVKLRSQLDPSWAQFNAARRPFRRQLGE"
FT   gene            196166..197254
FT                   /locus_tag="Ndas_0157"
FT   CDS_pept        196166..197254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0157"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /note="COGs: COG0482
FT                   tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase
FT                   contains the PP-loop ATPase domain; InterPro
FT                   IPR014729:IPR018318:IPR004506; KEGG: tfu:Tfu_0597
FT                   tRNA-specific 2-thiouridylase MnmA; PFAM: tRNA methyl
FT                   transferase-like; SPTR: C1YHH4 tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   TIGRFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   PFAM: tRNA methyl transferase; TIGRFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65607"
FT                   /db_xref="GOA:D7AU49"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU49"
FT                   /protein_id="ADH65607.1"
FT                   /translation="MTLRVLAAMSGGVDSAVAAARVAEAGHDVTGVHLALSKNPQSYRT
FT                   GARGCCTVEDSHDARRAADVIGIPFYVWDMSEEFDREVVQDFVAEYEAGNTPNPCLRCN
FT                   EKIKFEAVLDRAVALGFDAVATGHHVRKVDGRLVRSVDAAKDQSYVLGVLNAEQLERAV
FT                   FPLGDCTKDEVRAEAERRGLSVADKPDSHDICFIADGDTAGFLNRRIGERPGPIRDEDG
FT                   TVVGTHNGSHTFTVGQRKGLGLGGAAHPRYVLSIEPVDNSVTVGPRASLRVDAITGVRP
FT                   VWSGSEPLTEPTDCHVQLRAHGEVYPASVWQREADGGPELVVRLAEPATGVATGQAVVV
FT                   YQGDTVLGSATISATSRTGAAV"
FT   sig_peptide     196166..196240
FT                   /locus_tag="Ndas_0157"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            197410..197940
FT                   /locus_tag="Ndas_0158"
FT   CDS_pept        197410..197940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0158"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="COGs: COG0586 membrane-associated protein; InterPro
FT                   IPR015414; KEGG: tfu:Tfu_0598 hypothetical protein; PFAM:
FT                   SNARE associated Golgi protein; SPTR: C1YHH3
FT                   Uncharacterized membrane-associated protein; PFAM: SNARE
FT                   associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65608"
FT                   /db_xref="GOA:D7AU50"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU50"
FT                   /protein_id="ADH65608.1"
FT                   /translation="MPEFDFLDGQPFWIVYFTLLGVVLCRAQATYWIGRGLGAGVTRSR
FT                   MGARLGPRLDAARRRIDRYGAPVVTLSFCTVGVQTAVNLAAGAMRMRFPRYLAAMFVGS
FT                   LIWAGLWGVVIGGLVGTWFSLFLDSPWAALGVAALASAVVAVMVLRARRSRAAEEPSEE
FT                   PEDATDAHRASAG"
FT   sig_peptide     197410..197496
FT                   /locus_tag="Ndas_0158"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            198000..199043
FT                   /locus_tag="Ndas_0159"
FT   CDS_pept        198000..199043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0159"
FT                   /product="Methionine synthase vitamin-B12 independent"
FT                   /note="InterPro IPR002629; KEGG: tfu:Tfu_0602 hypothetical
FT                   protein; PFAM: Methionine synthase vitamin-B12 independent;
FT                   SPTR: C1YHH2 Cobalamin-independent methionine synthase;
FT                   PFAM: Cobalamin-independent synthase, Catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65609"
FT                   /db_xref="GOA:D7AU51"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU51"
FT                   /protein_id="ADH65609.1"
FT                   /translation="MSEQHPYPWPAASSTGVGSWPGEDPDEAMRTVLGELPDLPHLPEL
FT                   PARGVGADMVGRTCGLLVEFPVQVQPSGWRVADSPGRDLGRAASLMSYDLDALTEHAHG
FT                   FTGTLKVQVAGPWTLAASVELRNGQRLVSDPGACRDLTESHLEGVLAHLGEVRRRVPGA
FT                   RLLVQVDEPSLPAVLLGALPTASGYGRLPAVDRVRVEAALRVLFAAIDATGAVPAAHCC
FT                   APGVPVDLLRRSGARALSLNALLLTRDHDETVGTAVEAGTGLLLGVVPSSDGAEPARTA
FT                   RMSDPAATVDPVRELWNRLGFSPDLLSRAVVTTPTCGLAGASPGHARAALNASRAGARV
FT                   LRDEPRR"
FT   gene            199084..201411
FT                   /locus_tag="Ndas_0160"
FT   CDS_pept        199084..201411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0160"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="COGs: COG0272 NAD-dependent DNA ligase (contains
FT                   BRCT domain type II);
FT                   InterProIPR010994:IPR016027:IPR001357:IPR012340:IPR
FT                   018239:IPR013839:IPR004150:IPR004149:IPR000445:IPR013840:I
FT                   PR003583:IPR001679; KEGG: tfu:Tfu_0603 NAD-dependent DNA
FT                   ligase LigA; PFAM: NAD-dependent DNA ligase adenylation;
FT                   NAD-dependent DNA ligase OB-fold; zinc-finger NAD-dependent
FT                   DNA ligase C4-type; helix-hairpin-helix motif; BRCT domain
FT                   protein; PRIAM: DNA ligase (NAD(+)); SMART: NAD-dependent
FT                   DNA ligase ; Helix-hairpin-helix DNA-binding class 1; BRCT
FT                   domain protein; SPTR: C1YHH1 DNA ligase; TIGRFAM: DNA
FT                   ligase, NAD-dependent; PFAM: NAD-dependent DNA ligase
FT                   OB-fold domain; NAD-dependent DNA ligase adenylation
FT                   domain; NAD-dependent DNA ligase C4 zinc finger domain;
FT                   Helix-hairpin-helix motif; BRCA1 C Terminus (BRCT) domain;
FT                   TIGRFAM: DNA ligase, NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65610"
FT                   /db_xref="GOA:D7AU52"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU52"
FT                   /protein_id="ADH65610.1"
FT                   /translation="MSAPDTTTDIPDEVRARHTELCQELDDHSYRYYLGTPVISDAEYD
FT                   TLMRELVGIEDSYPALATQDSPTQKVGAPISVDFAAVEHLVRMESLGNAFDVDELNAWA
FT                   DRASAEVPVNGYLCELKIDGLAVDLVYEKGRLVRAATRGDGRVGEDITLNVRTIGVVPE
FT                   RLDESVRPAPELLEVRGEVFLPVEDFGKLNERITASGEHTPFANPRNAAAGSLRQKDPR
FT                   VTATRPLSMIVHGVGAYSPAKDGGGEVAFTSQSQAYRLLGEWGLPLSDRYRVVTTMDEV
FT                   REYVAHYAAHRHEPAYEIDGIVIKVDDFALQRRLGSTSRVPRWAIAYKYPPEEVTTRLL
FT                   DIKVGVGRTGRVTPYGVMEPVVVAGSEVEFATLHNAREVERKGVLIGDTVVLRKAGDVI
FT                   PEIVAPVLDRRDGTERAFAMPESCPECGTTLGQQKEGDVDLRCPNARSCPGQLRERLFF
FT                   VASRKALDIEALGYVAATALTQPLEPARPPVRDEGDLFDLTVDMLLPIRTHVLDPDTTE
FT                   PKTDPKTGEPKVVSFFANKKGEPKKTVEKLFEQLEEAKSKPLWRVLVALSIRHVGPRAA
FT                   EDLARHFRSMDAIRAASEEELAAVDGVGPTIAASIREWFSVDWHAEIVRKWADAGVRME
FT                   DEDDGSRPRHLEGVTVVVTGSLEGFSRDGAKEAIAERGGRATASVSKKTGFVVVGDSPG
FT                   SKYDKAVKLGVPVLDEEGFRVLLEAGPEAAEAMRVNPAPREPGTEDAEAGATGTEGATG
FT                   TDAVPGTSETVADAEEAVRDEA"
FT   gene            201719..203767
FT                   /locus_tag="Ndas_0161"
FT   CDS_pept        201719..203767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0161"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="COGs: COG5001 signal transduction protein containing
FT                   a membrane domain an EAL and a GGDEF domain; InterPro
FT                   IPR000160:IPR001633; KEGG: tfu:Tfu_0604 diguanylate
FT                   cyclase/phosphodiesterase; PFAM: EAL domain protein; GGDEF
FT                   domain containing protein; SMART: EAL domain protein; GGDEF
FT                   domain containing protein; SPTR: C1YHH0 Diguanylate cyclase
FT                   (GGDEF) domain-containing protein; TIGRFAM: diguanylate
FT                   cyclase; PFAM: EAL domain; GGDEF domain; TIGRFAM:
FT                   diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65611"
FT                   /db_xref="GOA:D7AU53"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU53"
FT                   /protein_id="ADH65611.1"
FT                   /translation="MKDPNSTRDIGPRVGTPLWLYMLGATAAGAVLLLVSGLGLRTDEL
FT                   RALAVEPLTWVLLCMIVLGELRPLTLPGQAPGDGVPTSLPFSLALVILHGLPVAALAQV
FT                   TATAVSGFARGHAPHRIAFNAAQYTLSLGVADAVLRLLLPGAVQGTWLPAAGELLTVAL
FT                   AGAGYFAVNRVLVLCAVAMHERVPLRQVMSKGLAQQVHVNSVLLSLAPLVVVAATHSVL
FT                   YVPLFALPLGALYTSAMLSVQRDHQANHDELTGLANRKLLTLRAREEIAHAQQRGGSVG
FT                   LLLLDLDRFKEVNDTLGHPTGDRLLQTVARRLTHSVRPGDLVSRLGGDEFAVLLPQVRD
FT                   SASACEVAFRLRGALAEPVRLDGMDFDLQASIGIALHPHDAPDFALLMQRADVAMYVAK
FT                   ADRTGVESYDPGKDRNSTARLSLYTELRRGLSEGALEMHYQPKVDLGDERPIGLEALAR
FT                   WRHPSRGLLTPEEFMPVVEQSNLLRAFTGQVLDITLARAAGWHAEGLDLPVAVNLGVRE
FT                   LLDPALPATVASALREHGVPADRLVLEIGEHALITDTDAATAAVRRLRDLGVGLSLDDF
FT                   GTGHFTLAQLAGLPLDEVKIHESFTARLVDRTDNGHTVVRAAIALVKALGMRATAEGVQ
FT                   SGELARAARDTGCHAAQGHHFSAPLTAREVADWVAARDGGTAAGTRV"
FT   sig_peptide     201719..201808
FT                   /locus_tag="Ndas_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            203912..204211
FT                   /locus_tag="Ndas_0162"
FT   CDS_pept        203912..204211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0162"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="COGs: COG0721 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase C subunit; InterPro IPR003837; KEGG:
FT                   tfu:Tfu_0605 aspartyl/glutamyl-tRNA amidotransferase
FT                   subunit C; PFAM: Glu-tRNAGln amidotransferase C subunit;
FT                   SPTR: C1YHG9 Aspartyl/glutamyl-tRNA(Asn/Gln)
FT                   amidotransferase subunit C; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, C subunit; PFAM: Glu-tRNAGln
FT                   amidotransferase C subunit; TIGRFAM: glutamyl-tRNA(Gln)
FT                   and/or aspartyl-tRNA(Asn) amidotransferase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65612"
FT                   /db_xref="GOA:D7AU54"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU54"
FT                   /protein_id="ADH65612.1"
FT                   /translation="MTAITRDEVAHLARLSRLALDESELDTLAAQLGDILTAVAKVQEV
FT                   AQGDIPPSSHALPLTNVYRPDEARPGLAHDQALAGAPAVEDQRFRVPRILGEGE"
FT   gene            204214..205713
FT                   /locus_tag="Ndas_0163"
FT   CDS_pept        204214..205713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0163"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /note="COGs: COG0154 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase A subunit and related amidase; InterPro
FT                   IPR000120:IPR020556:IPR004412; KEGG: tfu:Tfu_0606
FT                   aspartyl/glutamyl-tRNA amidotransferase subunit A; PFAM:
FT                   Amidase; SPTR: C1YHG8 Aspartyl/glutamyl-tRNA(Asn/Gln)
FT                   amidotransferase subunit A; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; PFAM: Amidase; TIGRFAM:
FT                   glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)
FT                   amidotransferase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65613"
FT                   /db_xref="GOA:D7AU55"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU55"
FT                   /protein_id="ADH65613.1"
FT                   /translation="MSDVISLTAAELGEAIREGRVTSEEATTAYLDRIESVDGEINAFL
FT                   HVRRETALEQARAVDARRAAGEELGPLAGVPVAHKDVFTTKDMPTTAASKILEGWQPPY
FT                   DATVTARLREAGLVILGKTNMDEFAMGSSTENSAYKVTRNPWDTDRIPGGSSGGSSAAV
FT                   AAFEAPLATGTDTGGSIRQPAAVCGLVGAKPTYGGSSRYGMIAFASSLDTPGPFARNVL
FT                   DAALLHEAFSGHDPRDSTSIDAPVPPVVDAARLGDVEGLRVGVVSELDSDGFQPGVRQR
FT                   FHETLELLESLGAKIVELSCPSFDAALSAYYLIAPSECSSNLARFDAMRYGLRVGDDGT
FT                   RSAEEVMSLTRAQGFGPEVKRRIMLGTYALSSGYYDAYYGSAQQVRTLIKRDFDAAFEN
FT                   VDVLVSPTTPTTAFPIGERAEDPMAMYLADLCTIPSNLAGNASLSVPCGLAPEDGLPVG
FT                   FQIMAPPLADDRTYRVAAAVERALTERDGDLLARSPYAVAR"
FT   gene            complement(205968..207206)
FT                   /locus_tag="Ndas_0164"
FT   CDS_pept        complement(205968..207206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0164"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="InterPro IPR019948:IPR019931; KEGG: tfu:Tfu_0607
FT                   surface protein; PFAM: Gram-positive anchor; SPTR: C1YHG7
FT                   Putative uncharacterized protein; TIGRFAM: LPXTG-motif cell
FT                   wall anchor domain protein; TIGRFAM: LPXTG-motif cell wall
FT                   anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65614"
FT                   /db_xref="GOA:D7AU56"
FT                   /db_xref="InterPro:IPR013552"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR023849"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU56"
FT                   /protein_id="ADH65614.1"
FT                   /translation="MTYVSLPHSVGRATLAASAAALLAFGLAAPASADPVETYEGSVRA
FT                   QYPATAASGVDVRINGEMESTSLFDLRLENGTALTAYCIDLETRIKDNAWYLEDDWANY
FT                   PGRGDFAEPGKVHWILQNSYPTVSAAQLAENAGLNRGNARHFGDEEAIAATQAAIWHFS
FT                   NGAEVTANDPNGVRAVYDYLVGEAQDLPQEPGPTLSITPGEASGSAGETIGEFLVETSD
FT                   ADGIEVSVQAPEGVEVELVDLETGQPVTTVNNGDTVGLAVPEGAAEGTASFSLETTATV
FT                   RSGRLFKGEEEYQPTQTLITAQDSEVTVSASASVSWTGGGETPPPTEEPSEEPSEEPSE
FT                   PESPEPTPSDEPSEPVDKPSEPADDQNEPSLPVTGGALVGLVAAGVAALGAGGGALYLS
FT                   RRRKAAGSQDLEG"
FT   sig_peptide     complement(207108..207206)
FT                   /locus_tag="Ndas_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(207628..208566)
FT                   /locus_tag="Ndas_0165"
FT   CDS_pept        complement(207628..208566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0165"
FT                   /product="Clp domain protein"
FT                   /note="InterPro IPR004176; KEGG: kra:Krad_2787 Clp domain
FT                   protein; PFAM: Clp domain protein; SPTR: C1YHG6 Clp amino
FT                   terminal domain-containing protein; PFAM: Polyketide
FT                   cyclase / dehydrase and lipid transport; Clp amino terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65615"
FT                   /db_xref="GOA:D7AU57"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU57"
FT                   /protein_id="ADH65615.1"
FT                   /translation="MTKPSARRSILNRGFDRIAISGAASREAARAGRTEVGFEHLFLGV
FT                   LVTGGPGARLLMDSGVGLAEARAAIDGLLREDLALLGVDVTVPVPSDEEEKGWLRFTPR
FT                   LEEIEYDVPLAGGDAALLTALIDDEGGRVRRVLDRLGADTDRIRRDLGALAESPQAPEP
FT                   SPADGDATAEQPPEGWEYTNYDLEVPVAAGRVWELVSDPERRGEWDPASGSSRQLGDGV
FT                   VELTNRLTEDAVRESITHSVPGREVTWTQEGSERALRILIEPLGERSRLRLRWSWRNGL
FT                   KHRAVANRVVKWIAWQNVRGRAQSIAQAAAS"
FT   gene            complement(208563..208808)
FT                   /locus_tag="Ndas_0166"
FT   CDS_pept        complement(208563..208808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kra:Krad_2786 hypothetical protein; SPTR:
FT                   C1YHW3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65616"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU58"
FT                   /protein_id="ADH65616.1"
FT                   /translation="MDAVQLAATASDTSTPVQGLRAVASLRAVVDSLELRQVEQALRSG
FT                   ESWSSIAAALGVTRQAVHKKYGKRLSHIEAAKRGQR"
FT   gene            complement(209058..210284)
FT                   /locus_tag="Ndas_0167"
FT   CDS_pept        complement(209058..210284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0167"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="InterPro IPR019948:IPR019931; KEGG: tfu:Tfu_0607
FT                   surface protein; PFAM: Gram-positive anchor; SPTR: C1YHW2
FT                   Putative uncharacterized protein; TIGRFAM: LPXTG-motif cell
FT                   wall anchor domain protein; TIGRFAM: LPXTG-motif cell wall
FT                   anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65617"
FT                   /db_xref="GOA:D7AU59"
FT                   /db_xref="InterPro:IPR013552"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR023849"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU59"
FT                   /protein_id="ADH65617.1"
FT                   /translation="MSISSLPRTVGRTGLAATAAAFLAFGLAAPAAADPAETYDGAVRG
FT                   KYIGNAENGADVRMTGETIGTRLFNLELEDGTVLTTYCIDFETQIRGGAFYNEDDWANY
FT                   PGKGEFAAPAKVHWILQNAYPALSAEELGAAAGVEGLSQRDALGATQAAIWHFSNGVDL
FT                   EDEGNSQAVRTVYTYLIENAEELPQTAEPAPALSITPGTASGTAGETVGEFLIQTNASS
FT                   IPVDLQAPEGVQLVDLETGETVTEVGNGDTVGFAVPADAEAGQASFSLEASATVATGRL
FT                   FKGDEESQPTQTLITAEGGETSVSASASADWTVGGGETPPESPEPSEPESPEPSEPESP
FT                   EPTPSDKPSEPADKPSEPADDQNEPTLPVTGGALAGLVAAGVAALGAGGGAIYLSRKRK
FT                   AANSQDLEG"
FT   sig_peptide     complement(210186..210284)
FT                   /locus_tag="Ndas_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(210696..211865)
FT                   /locus_tag="Ndas_0168"
FT   CDS_pept        complement(210696..211865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0168"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="InterPro IPR019931; KEGG: tfu:Tfu_0608 surface
FT                   protein; SPTR: C1YHW1 Putative uncharacterized protein;
FT                   TIGRFAM: LPXTG-motif cell wall anchor domain protein;
FT                   TIGRFAM: LPXTG-motif cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65618"
FT                   /db_xref="GOA:D7AU60"
FT                   /db_xref="InterPro:IPR013552"
FT                   /db_xref="InterPro:IPR023849"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU60"
FT                   /protein_id="ADH65618.1"
FT                   /translation="MSGILRRYAALLSTSALIGTLLGAPAASADDFSRVDRDPVEGAPL
FT                   VLADGREADTALFSLRVAEHASVRAYTVTADEEVHPYAAYVESAWSDVPEWTETPQETD
FT                   PADRADWIVSHSYPTVGLESLLEGSDLPRLDEARAIAGTQAALWHVLEGVRPDPGANDP
FT                   GVMALYDHLVEGSASAPDNTVSRSLAVSPSHVEAVAPEEPLGPLTVHSSGAEPVSVSVR
FT                   GAPASWLVDADGEQVTQLGDGERVFLDVDPSVPAGVATLHLHGRDFPLPQGRLFTGRDG
FT                   VRTRSLVTAEAGSATSSATATFTWHPEQTEEPVAAASPEPVPEEEPPATEEAVEEEVPA
FT                   EEVSPTAEDRIPEDDLALTGTWLSGLLVIAGALVVSGLIILVVGRKRRD"
FT   sig_peptide     complement(211779..211865)
FT                   /locus_tag="Ndas_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            212164..213660
FT                   /locus_tag="Ndas_0169"
FT   CDS_pept        212164..213660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0169"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="COGs: COG0064 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase B subunit (PET112 homolog);
FT                   InterProIPR003789:IPR017958:IPR006075:IPR006107:IPR
FT                   018027:IPR004413; KEGG: tfu:Tfu_0609 aspartyl/glutamyl-tRNA
FT                   amidotransferase subunit B; PFAM: GatB region; GatB central
FT                   domain protein; Asn/Gln amidotransferase; SPTR: C1YHW0
FT                   Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B;
FT                   TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B subunit;
FT                   PFAM: GatB/GatE catalytic domain; GatB domain; TIGRFAM:
FT                   glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)
FT                   amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65619"
FT                   /db_xref="GOA:D7AU61"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU61"
FT                   /protein_id="ADH65619.1"
FT                   /translation="MAYEQALARYEPVLGLETHIELGTASKMFCSCPTAFGAAPNTQVC
FT                   PVCLALPGSLPVVNEKAVEGAIRLGLALNCSIAPWGRFARKNYFYPDMPKNYQISQYDE
FT                   PICVDGHLDVTVDTPDGPRVFRVDIERVHMEEDTGKTSHVGGATGRIHGADYSIVDYNR
FT                   AGIPLLEIVTRPVTGTGDLAPLVARAYAAELRDLVRSLGISDVRMEEGSMRCDVNVSIN
FT                   PRGASEWGTRSETKNVNSLRSVERAVRSEIERQAGVLDAGQKVVQETRHFQENTGRSIS
FT                   GRSKEEAQDYRYFPDPDLVPVAPSEEWVEELRATLPELPAAKRARIRAEWDLTDTELRD
FT                   LVNADAIDLVAATVAEGAPSAEARKLWLNELSRRATEQEVELAALPITPAQVARVIALV
FT                   AEGTLTNKLARQVVEGVLAGEGEPDAVVEARGLKVVSDDGALGAAVDEAIAANPDAADK
FT                   VRGGKVAAAGALVGAVMKATRGQADAGRARELILAKLGAS"
FT   sig_peptide     212164..212277
FT                   /locus_tag="Ndas_0169"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            214231..216936
FT                   /locus_tag="Ndas_0170"
FT   CDS_pept        214231..216936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0170"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="COGs: COG5001 signal transduction protein containing
FT                   a membrane domain an EAL and a GGDEF domain;
FT                   InterProIPR000160:IPR000014:IPR001633:IPR001610:IPR 013655;
FT                   KEGG: tfu:Tfu_0610 diguanylate cyclase/phosphodiesterase;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   PAS fold-3 domain protein; SMART: EAL domain protein; GGDEF
FT                   domain containing protein; PAS domain containing protein;
FT                   PAC repeat-containing protein; SPTR: C1YHV9 PAS domain
FT                   S-box/diguanylate cyclase (GGDEF) domain-containing
FT                   protein; TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: EAL domain; GGDEF domain; PAS fold; TIGRFAM: PAS
FT                   domain S-box; cation diffusion facilitator family
FT                   transporter; diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65620"
FT                   /db_xref="GOA:D7AU62"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU62"
FT                   /protein_id="ADH65620.1"
FT                   /translation="MGTRARRLWIVALVALFLLYLVGTLVPSAQDSVTAALGEWPTSVA
FT                   AGAAGLSLLYASRRWAATGADRDAHADGADGPSALRHLGFAALAWCAGGVTHGLIRLFS
FT                   SATALSLTLGDLFALAALPLFVIGFTKFAPWPGGLRTAVRHVTDSYVCAAAVFSVVWLL
FT                   LFSPLYQELGEGAGFLGFALVYPVADIVVLCLLVPLVFMSPHSTRRAVLVAIGALIVIA
FT                   GADILGALTRLTGPPFLGGVEHPVRFLGFALLGALPWLVEHRPGTDPRRITGRGLYRFA
FT                   PELAAIGAVFAAAVVLTVAGVRLVGVAPVLPLAAGTAVVVLLVRMVGMLEENATLSRMV
FT                   RNREVHFHELARNSGDVILVLDRDGGVNYVSPGTAEAFGYRLDDVLAAPVTALIHPEDL
FT                   GRTKAVTDLFSERGAQGVHMRLRVRAADGTWRHTESTMSLYEQPGEPDRLLVTTRDISA
FT                   QVALQDEVEHLTFHDGVTGLPNRAYLEERASDVLAHRVINEEPAGEVAVIFLDLDGFTA
FT                   VNDSAGHVRGDHLLGQAARRLRGEVDSDATLARWGGDEFAVLVENVPRVQRVVDLAERL
FT                   GRVIASEPFPVADRDIMLTASIGVAFAEQVTDSGELLRNADVAMTRAKERGAGHVEVYA
FT                   AHMHDTVVSRLELQIRLREALAKDEFFLEYQPVVDLGSSQVTSVEALVRWDRDGERVGP
FT                   EDFIGAAEESGLIVPLGERILREACEKVAVWRLSDWDIGLSVNLSVKQVLSPRFVESVA
FT                   GILAESGLPAEVLTLEVDEEVLLDDGGEAVQRLGELRELGVRLAIDDYGMGYASLAHLR
FT                   RLSVDAIKIDPSFVADLGRDDTVTLLTHTIIQLGRDLGVQVVAEGIERSEQLEQLRAMG
FT                   CDHGQGFLVARPMPASGVESLVGGEAGVSL"
FT   sig_peptide     214231..214317
FT                   /locus_tag="Ndas_0170"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            217429..219189
FT                   /locus_tag="Ndas_0171"
FT   CDS_pept        217429..219189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0171"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number="2.2.1.6"
FT                   /note="COGs: COG0028 Thiamine pyrophosphate-requiring
FT                   protein;
FT                   InterProIPR012846:IPR011766:IPR012000:IPR000399:IPR 012001;
FT                   KEGG: tfu:Tfu_0611 acetolactate synthase 1 catalytic
FT                   subunit; PFAM: thiamine pyrophosphate protein TPP binding
FT                   domain protein; thiamine pyrophosphate protein domain
FT                   protein TPP-binding; thiamine pyrophosphate protein central
FT                   region; SPTR: C1YHV8 Acetolactate synthase; TIGRFAM:
FT                   acetolactate synthase, large subunit, biosynthetic type;
FT                   PFAM: Thiamine pyrophosphate enzyme, central domain;
FT                   Thiamine pyrophosphate enzyme, N-terminal TPP binding
FT                   domain; Thiamine pyrophosphate enzyme, C-terminal TPP
FT                   binding domain; TIGRFAM: acetolactate synthase, large
FT                   subunit, biosynthetic type"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65621"
FT                   /db_xref="GOA:D7AU63"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU63"
FT                   /protein_id="ADH65621.1"
FT                   /translation="MTEQMTGAQSLIRSLEQVGVDTVFGIPGGAILPAYDPLYDSAKVR
FT                   HILMRHEQGAGHAAEGYAYATGRPGVCMATSGPGATNLVTPLADAHMDSVPMVAITGQV
FT                   ASPMIGTDAFQEADICGITMPITKHNFLVKDVREIPRIVAEAFHIASSGRPGPVLVDIS
FT                   KDALQNSAEFVWPERLELPGYRPVTKPHGKQVREAARMIAEARRPVFYVGGGVLRAGAS
FT                   AELRVLAELTGAPVVSTLMARGVFPDSHPQSVGMPGMHGDVAAVGALQKADLIVALGAR
FT                   FDDRVTGRLDSFAPDAKIVHADIDPAEISKNRHADVPIVGDCREVLADLVVAVRADQEK
FT                   GRQGDYEAWWQQLNRLRNTYPKGYEAPEDGSLSPQAVIERLGKVVGPEATYVAGVGQHQ
FT                   MWAAQFIDYERPGSFVNSGGLGTMGFSVPAALGAKVGDPDRTVWSVDGDGCFQMTNQEL
FT                   ATCAIEGIPVKVAVVNNGNLGMVRQWQTLFYEGRYSNTDLQTSPRDEKVRIPDFVRLAE
FT                   AYGCVGLRCERAEDIDATIEKAMAIDDAPVVVDFTVNHDAMVWPMVGPGVSNDNIQYAR
FT                   DMAPNWEHED"
FT   gene            219210..219734
FT                   /locus_tag="Ndas_0172"
FT   CDS_pept        219210..219734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0172"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="COGs: COG0440 Acetolactate synthase small
FT                   (regulatory) subunit; InterPro
FT                   IPR002912:IPR004789:IPR019455; KEGG: tfu:Tfu_0612
FT                   acetolactate synthase 3 regulatory subunit; PFAM:
FT                   Acetolactate synthase, small subunit-like; amino
FT                   acid-binding ACT domain protein; SPTR: C1YHV7 Acetolactate
FT                   synthase, small subunit; TIGRFAM: acetolactate synthase,
FT                   small subunit; PFAM: Small subunit of acetolactate
FT                   synthase; ACT domain; TIGRFAM: acetolactate synthase, small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65622"
FT                   /db_xref="GOA:D7AU64"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU64"
FT                   /protein_id="ADH65622.1"
FT                   /translation="MSSHTLSVLVEDTPGILARASALFSRRGFNIDSLSVSNTEYPGLS
FT                   RMTIVVNCDLHPLEQVTKQLNKLVNVVKIVEMDTTASVRRELLLVKVKADASSRTHVLQ
FT                   TAELFRAHVVDVSPDVVVIEATGDPEKLDALVRNLEPFGIRELVKSGLVALGRGPRSIT
FT                   DRSLRTVERSA"
FT   gene            219836..220831
FT                   /locus_tag="Ndas_0173"
FT   CDS_pept        219836..220831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0173"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="COGs: COG0059 Ketol-acid reductoisomerase;
FT                   InterProIPR008927:IPR016040:IPR013116:IPR000506:IPR 013023;
FT                   KEGG: tfu:Tfu_0613 ketol-acid reductoisomerase; PFAM:
FT                   Acetohydroxy acid isomeroreductase catalytic domain
FT                   protein; acetohydroxy acid isomeroreductase; PRIAM:
FT                   Ketol-acid reductoisomerase; SPTR: C1YHV6 Ketol-acid
FT                   reductoisomerase; TIGRFAM: ketol-acid reductoisomerase;
FT                   PFAM: Acetohydroxy acid isomeroreductase, catalytic domain;
FT                   TIGRFAM: ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65623"
FT                   /db_xref="GOA:D7AU65"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU65"
FT                   /protein_id="ADH65623.1"
FT                   /translation="MAAQMYYDDAADLSLIQSKKVAVIGYGSQGHAHALSLRDSGVDVR
FT                   IGLAEGSKSRAKAEEEGLRVLTPAEATREADVIMILVPDHIHRDLYAAEIAPNLEAGNA
FT                   LFFGHGFSIRYGLITPPEGVDVAMVAPKGPGHLVRRQYEAGRGVPCLVAVEKDASGQAW
FT                   DLALSWAKGIGGTKAGVIKTTFTEETETDLFGEQAVLCGGTEELVKAGFATLVEAGYQP
FT                   EIAYFECLHELKLIVDLMYEGGISKMNWSVSDNAEYGGYTRGPRLITEQTRQEMRKILG
FT                   EIQDGSYAKELMEEFDAGQPTFTKRREAEQNEQIEKVGAELRPLMSWLKA"
FT   gene            221030..222619
FT                   /locus_tag="Ndas_0174"
FT   CDS_pept        221030..222619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0174"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /note="COGs: COG0111 Phosphoglycerate dehydrogenase and
FT                   related dehydrogenase;
FT                   InterProIPR016040:IPR006140:IPR006139:IPR002912:IPR 006236;
FT                   KEGG: tfu:Tfu_0614 D-3-phosphoglycerate dehydrogenase;
FT                   PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; amino acid-binding ACT domain protein;
FT                   SPTR: C1YHV5 D-3-phosphoglycerate dehydrogenase; TIGRFAM:
FT                   D-3-phosphoglycerate dehydrogenase; PFAM: D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD binding domain; ACT
FT                   domain; D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic domain; TIGRFAM: D-3-phosphoglycerate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65624"
FT                   /db_xref="GOA:D7AU66"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU66"
FT                   /protein_id="ADH65624.1"
FT                   /translation="MPKPAVLVAEKLSPAGIALLEEDFEVRHVDGADRSQLLPALADVD
FT                   ALIVRSATQVDAEAIAAASRLQVVARAGVGLDNVDVEAATKAGVLVVNAPTSNIISAAE
FT                   QAINLLLASARNTAPAHNALVNGEWKRSKYTGVELYEKTVGIVGLGRIGALVAQRLSAF
FT                   GTQVIAYDPFVQPARAAQIGVEMTTLDELLERSDFITIHLPKNKDTLGLIGDEALSKVK
FT                   PTVRVINAARGGILDEDALYRALKDGRVAGAGIDVFAKEPCTDSPLFEFENVVVAPHLG
FT                   ASTAEAQEKAGTQVARSVKLALSGEFVPDAVNVQGTGVAEDVKPGLPLTEKLGRVFTSL
FT                   AGTIASRIDVEVRGEIASHDVKVLELAALKGVFADVVEDTVTFVNAPLLAKERGVEVNL
FT                   VTSDDNTDWRNLITVRGVLADGTRVSASGTLTGPRQVEKLVEINNYTMEIGLAEHMVFL
FT                   SYEDRPGVVGTVGALLGDAGVNIAGMQVIRDQEGGKALIALTVDSAVPDETLASISAEI
FT                   DADISRQVDLED"
FT   gene            223333..224397
FT                   /locus_tag="Ndas_0175"
FT   CDS_pept        223333..224397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0175"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="COGs: COG0473 Isocitrate/isopropylmalate
FT                   dehydrogenase; InterPro IPR001804:IPR019818; KEGG:
FT                   tfu:Tfu_0615 3-isopropylmalate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase; PRIAM:
FT                   3-isopropylmalate dehydrogenase; SPTR: C1YHV3
FT                   3-isopropylmalate dehydrogenase; PFAM:
FT                   Isocitrate/isopropylmalate dehydrogenase; TIGRFAM:
FT                   3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65625"
FT                   /db_xref="GOA:D7AU67"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU67"
FT                   /protein_id="ADH65625.1"
FT                   /translation="MAARTVKLAVIPGDGIGPEVIAEGLKVLEVAASQHDLAVETTEYE
FT                   LGARLWHRTGETLPDSVEAELAGHEAIYLGAVGDPSVPSGVLERGLLLRLRFDFDHYVN
FT                   LRPVRLYPGVDSPLAGVGPEDIDMLVVREGTEGPYAGAGGVLRKGTPHEIATQDSVNTR
FT                   FGVERVVRYAFDKAASRPRRKLTLVHKDNVLTFAGELWQRVVREVGAEYPQVSVDYCHV
FT                   DAASMFFVNQPARFDVVVTDNLFGDIITDIGAAITGGIGLAASGNINPDNTFPSMFEPV
FT                   HGSAPDIAGQGKADPTATVLSAATMLEHLGVPEAARRIEAAVATDLKTRAQNGAVRSTS
FT                   QIGDDLAARVAEQG"
FT   gene            224648..225763
FT                   /locus_tag="Ndas_0176"
FT   CDS_pept        224648..225763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0176"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /note="COGs: COG0115 Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase; InterPro
FT                   IPR001544:IPR005786; KEGG: tfu:Tfu_0616 branched-chain
FT                   amino acid aminotransferase; PFAM: aminotransferase class
FT                   IV; SPTR: C1YHV2 Branched chain amino acid
FT                   aminotransferase; TIGRFAM: branched-chain amino acid
FT                   aminotransferase; PFAM: Aminotransferase class IV; TIGRFAM:
FT                   branched-chain amino acid aminotransferase, group II"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65626"
FT                   /db_xref="GOA:D7AU68"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU68"
FT                   /protein_id="ADH65626.1"
FT                   /translation="MNNDTTTSGLTFDIQLSDRRKTPQEREALLESPGFGKVFTDHMVS
FT                   IHYTEGKGWHDAKLEPYGPLSLDPATAALHYAQEIFEGLKAYRHPDGSLASFRPESNAA
FT                   RFNRSAARMAMPELPEELFLKSIELLLEHDGDWVPTKEDFSLYLRPFMVATDVGLGVNH
FT                   PSRSYVYLLIASPVGSYFSGGVQPVTVWLSRDYTRAAPGGTGAAKFAGNYAASFLAQAQ
FT                   AVEQGCDQVVWLDAREHRWVEEMGGMNLWFVFGSGENARLRTPPLTGTLLPGITRESLL
FT                   TLAPDLGIPAEEAPISTDEWREAAESGELTEVFACGTAAVITPVGRVKGDDGEFTVGDG
FT                   TPGPVTMRLREELVGIQTGLRADKHDWITRF"
FT   gene            226317..227927
FT                   /locus_tag="Ndas_0177"
FT   CDS_pept        226317..227927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0177"
FT                   /product="2-isopropylmalate synthase/homocitrate synthase
FT                   family protein"
FT                   /EC_number="2.3.1.182"
FT                   /note="COGs: COG0119
FT                   Isopropylmalate/homocitrate/citramalate synthase;
FT                   InterProIPR000891:IPR002034:IPR013709:IPR005675:IPR 013785;
FT                   KEGG: tfu:Tfu_0617 putative
FT                   alpha-isopropylmalate/homocitrate synthase family
FT                   transferase; PFAM: LeuA allosteric (dimerisation) domain;
FT                   pyruvate carboxyltransferase; PRIAM: (R)-citramalate
FT                   synthase; SPTR: C1YHV1 2-isopropylmalate synthase; TIGRFAM:
FT                   2-isopropylmalate synthase/homocitrate synthase family
FT                   protein; PFAM: HMGL-like; LeuA allosteric (dimerisation)
FT                   domain; TIGRFAM: 2-isopropylmalate synthase/homocitrate
FT                   synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65627"
FT                   /db_xref="GOA:D7AU69"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU69"
FT                   /protein_id="ADH65627.1"
FT                   /translation="MRDDSFHVFDTTLRDGAQREGINLRVSDKLAIAKLLDDFGVAFIE
FT                   GGWPGANPKDTEFFQRASRELTLEHAQLTAFGATRRAGVRAADDPQVAALRDSGAPVVT
FT                   LVAKSDDRHVERALRTTLDENLAMIADTVSHLSEHGQRVFVDCEHFFDGYLHNPDHALD
FT                   VVRAAAGAGADVVVLCDTNGGMLPTDVTRIVTEVREATGARLGIHAQDDTGCAVANTLA
FT                   AVDAGATHVQCTANGYGERVGNANLFSVVGALTLKRGQEVLPEGCLAEMTRVATAIAEI
FT                   VNLTPDTHQPYVGVSAFAHKAGLHASAIKVDPDLYQHTDPALVGNAMRMLVSDMAGRAS
FT                   IELKAKELGLDLSGDRALSGRAVERVKGLELSGYSFEAADASLDLLLREELGQPVRYFD
FT                   TESWRVITERRPRAGSSPLASDYESLTEATVKLRVKGERVIATAEGNGPVNALDRALRS
FT                   AMEGVYTALAGLELTDYKVRILEGSSGTNAITRILITFSDGVGEWTTVGVGPNVVDASW
FT                   VALEQAVTYGLLRQGYPQG"
FT   gene            complement(228119..228931)
FT                   /locus_tag="Ndas_0178"
FT   CDS_pept        complement(228119..228931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0178"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0618 hypothetical protein; SPTR:
FT                   C1YHV0 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF3152)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65628"
FT                   /db_xref="InterPro:IPR022603"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU70"
FT                   /protein_id="ADH65628.1"
FT                   /translation="MGLALGLCLVSGASTVLMVSVPGSGPDFGEPAETSATGPVGDGVP
FT                   EEGGDRRTSAEDRDSAGGAAAPEAGSSAERAGEEEAPLLLRSVEEEVESADGEFSVLEG
FT                   ESDVMGDGPVTTFAVEVEKGLPGESEDFAAAVEEILGDPRSWGDDGERAMQRVDGDDAD
FT                   VRVLLAAPDTVDRLCAPLNTDGYVSCANGNRAIINQNRWVSGVPHFEDDLETYRIYLIN
FT                   HEVGHTLGHGHVDCPGEGEPAPVMQQQTLGLQGCEPNGWVHPENGSGD"
FT   sig_peptide     complement(228830..228931)
FT                   /locus_tag="Ndas_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            229268..230068
FT                   /locus_tag="Ndas_0179"
FT   CDS_pept        229268..230068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0179"
FT                   /product="5-carboxymethyl-2-hydroxymuconateDelta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="COGs: COG0179 2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1 7-dioic acid hydratase
FT                   (catechol pathway); InterPro IPR011234:IPR018833:IPR002529;
FT                   KEGG: tfu:Tfu_0621 5-carboxymethyl-2-hydroxymuconate
FT                   delta-isomerase; PFAM: fumarylacetoacetate (FAA) hydrolase;
FT                   Domain of unknown function DUF2437; PRIAM:
FT                   5-carboxymethyl-2-hydroxymuconate Delta-isomerase; SPTR:
FT                   C1YHU9 2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase; PFAM:
FT                   Domain of unknown function (DUF2437); Fumarylacetoacetate
FT                   (FAA) hydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65629"
FT                   /db_xref="GOA:D7AU71"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR018833"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU71"
FT                   /protein_id="ADH65629.1"
FT                   /translation="MRIARFASGDEVGFGLVEKDSDTGEEFVARLSGHPLIGDIQLTGE
FT                   RAKLSDVRLLSPVLPTKVVCIGKNYADHVAEMKDVTGESTDEPVVFLKPSTAVTGPRDP
FT                   IFRPAVSERVDYEGELAIVISRPCREVPRERAKDVIFGYTVANDVTARDLQKKDKQWTR
FT                   AKGFDSFCPIGPWITTGMSIEEAQDLAVTTTVDGQTRQDGRTSQFIHDIPDIIAYVTSF
FT                   MTLLPGDVVLTGTPAGVGPVEVGQEVAVTVERLGTITNRVVARD"
FT   gene            230157..231176
FT                   /locus_tag="Ndas_0180"
FT   CDS_pept        230157..231176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0180"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="InterPro IPR013830:IPR013831:IPR001087; KEGG:
FT                   tfu:Tfu_2470 fibronectin, type III; PFAM: lipolytic protein
FT                   G-D-S-L family; SPTR: C1YHU8 Lysophospholipase L1-like
FT                   esterase; PFAM: GDSL-like Lipase/Acylhydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65630"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU72"
FT                   /protein_id="ADH65630.1"
FT                   /translation="MTIPRRRRTGALVLAGALALVLLAGGTAYWTAARTDDGGTGTPTG
FT                   GPVSEPHRIMLAGDSMTQGANGDRTWRYHLWNHLSPHVEELDFVGPYSDPASRDMILPV
FT                   PTAEDEATPSPDGDPAGDYREDGADGTAPEPGPSAPGERIPQDGAVWPGADGDPDTAEY
FT                   RDPDFDQDHNALWGRTLRDASSSIREDVRVHRPDVLCVMLGVNDLLWPVTMEEMEYRLR
FT                   GYVEAAREANPHLRVVLAETVPIALAESDEGFALRVYAYNVLIREVAADMSTERSPVIS
FT                   LDVAGGEDWDPAADTYDGTHPNARGEVKIAAAFADALAEGYGIGRPYPRPLPTASAGE"
FT   sig_peptide     230157..230255
FT                   /locus_tag="Ndas_0180"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            231290..232735
FT                   /locus_tag="Ndas_0181"
FT   CDS_pept        231290..232735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0181"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="COGs: COG0008 Glutamyl- and glutaminyl-tRNA
FT                   synthetase;
FT                   InterProIPR008925:IPR014729:IPR020061:IPR020751:IPR
FT                   001412:IPR020058:IPR004527:IPR020060; KEGG: tfu:Tfu_0623
FT                   glutamyl-tRNA synthetase; PFAM: Glutamyl/glutaminyl-tRNA
FT                   synthetase, class Ic, catalytic domain; SPTR: C1YHU7
FT                   Glutamyl-tRNA synthetase; TIGRFAM: glutamyl-tRNA
FT                   synthetase; PFAM: tRNA synthetases class I (E and Q),
FT                   catalytic domain; TIGRFAM: glutamyl-tRNA synthetase,
FT                   bacterial family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65631"
FT                   /db_xref="GOA:D7AU73"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU73"
FT                   /protein_id="ADH65631.1"
FT                   /translation="MTETSIRTRFAPSPTGMFHVGGARSALFNWALAQQRPEGRMVLRV
FT                   EDTDAARNRPEWTEGIIRALAWLGIGEEDPHFEGPYFQSEYADKHRETAQELYKNGRAY
FT                   YCDCTREQVQERRDNPNLGYDGFCRDRNLAPGPGRALRFRVPEGGPTVVDDRIRGRVEF
FT                   EHSAIEDFVIARADGSPLFVLANVVDDVEMRITHVVRGEEHLSNTPKQQLLWEALGLTP
FT                   PVWAHLPVIVNEQRKKLSKRRDKVALESYQEEGYLPEAMVNYLMLLGWAPGDDREIMPW
FT                   SQMQPLFRVEDVNSSSAFFDEKKLRAFNGEYIRELSAEEFVERCQPWLTGDAAPWDPAD
FT                   YDPAVFAAVAPLAQSRVAVLSEIVPNVDFLFLREPVEDEKSWAKAMKPGVGREMLQAAL
FT                   ARFADPELPWAAEDLKAATEEVGASLGLKLGKAQAPVRVAVTGRTVGLPLFESLELLGR
FT                   ERVQERLTAALAKLDAQDGPAGS"
FT   gene            232871..232942
FT                   /locus_tag="Ndas_R0006"
FT   tRNA            232871..232942
FT                   /locus_tag="Ndas_R0006"
FT                   /product="tRNA-Gln"
FT   gene            232994..233066
FT                   /locus_tag="Ndas_R0007"
FT   tRNA            232994..233066
FT                   /locus_tag="Ndas_R0007"
FT                   /product="tRNA-Glu"
FT   gene            233176..233251
FT                   /locus_tag="Ndas_R0008"
FT   tRNA            233176..233251
FT                   /locus_tag="Ndas_R0008"
FT                   /product="tRNA-Glu"
FT   gene            233484..233747
FT                   /locus_tag="Ndas_0182"
FT   CDS_pept        233484..233747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smt:Smal_1703 hypothetical protein; SPTR:
FT                   C1YHU6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65632"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU74"
FT                   /protein_id="ADH65632.1"
FT                   /translation="MTGRELGPGNHQDKELREVLKDLCEQGWVLRQEGHWGRLYCDCGC
FT                   TRIQVPGTPRNSGRAARRIRQEARRCPMPPDDPRRGAGGPRE"
FT   gene            233947..234864
FT                   /locus_tag="Ndas_0183"
FT   CDS_pept        233947..234864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0183"
FT                   /product="Prophage CP4-57 regulatory"
FT                   /note="InterPro IPR010260; KEGG: tfu:Tfu_0699 hypothetical
FT                   protein; PFAM: Prophage CP4-57 regulatory; SPTR: C1YHU5
FT                   Prophage CP4-57 regulatory protein (AlpA); PFAM: Prophage
FT                   CP4-57 regulatory protein (AlpA)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65633"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU75"
FT                   /protein_id="ADH65633.1"
FT                   /translation="MAEYEFVFVVDGFDLDDHDTVQALSESFDALVSSWHGSLRLSVAA
FT                   LGPDAVTAARSLVERVHVTVPGVRIVRLDRELVGISDIAEITGRSRQNVDQWVRGQRHD
FT                   GVPFPAPEAAVGRSLVWLWSEVNAWLRGIGLDDGQLRPTRTEMSEIDWLLQTSRKVELA
FT                   LVRHANSPDARRVARLLAAHARTTREFIHYLVKNPRVRDARGRYTVLVCSPRDEAVDVF
FT                   RRLEAFEHPVVLATVTNRIHALVMVDGEGERGDATELVPGMTVRDWLGMIALSPESEFT
FT                   VASEGASTKTAPITARSPMDLVGA"
FT   gene            complement(234943..235677)
FT                   /locus_tag="Ndas_0184"
FT   CDS_pept        complement(234943..235677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0184"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="COGs: COG1414 Transcriptional regulator; InterPro
FT                   IPR005471:IPR014757; KEGG: tfu:Tfu_0625 regulatory
FT                   proteins, IclR; PFAM: Transcriptional regulator IclR ;
FT                   regulatory protein IclR; SMART: regulatory protein IclR;
FT                   SPTR: C1YHU4 Transcriptional regulator, IclR family; PFAM:
FT                   IclR helix-turn-helix domain; Bacterial transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65634"
FT                   /db_xref="GOA:D7AU76"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU76"
FT                   /protein_id="ADH65634.1"
FT                   /translation="MDNSSSSSGVGVLDKTMSVLDALESGPASLAQLVQITGLARPTAH
FT                   RLAVALERHRMVTRDSQGRFVLGPRLGELSIATGEDRLLAVASPVLVQLRDLTGESAQL
FT                   YRRQGDLRVCVAASERSSGLRDTVPVGSELPMNAGSAAQVLLAWEDSDRIRRSLLGARF
FT                   TAASLAQVRRRRWAQSVAEREQGVASVSAPVSGPGGRVIAAVSVSGPIERLTRSPGRIH
FT                   SQAVLSAAEKISESLHSYEGAH"
FT   gene            235783..237189
FT                   /locus_tag="Ndas_0185"
FT   CDS_pept        235783..237189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0185"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="COGs: COG0065 3-isopropylmalate dehydratase large
FT                   subunit;
FT                   InterProIPR015931:IPR018136:IPR001030:IPR015932:IPR 004430;
FT                   KEGG: tfu:Tfu_0626 isopropylmalate isomerase large subunit;
FT                   PFAM: aconitate hydratase domain protein; SPTR: C1YHU3
FT                   3-isopropylmalate dehydratase, large subunit; TIGRFAM:
FT                   3-isopropylmalate dehydratase, large subunit; PFAM:
FT                   Aconitase family (aconitate hydratase); TIGRFAM:
FT                   3-isopropylmalate dehydratase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65635"
FT                   /db_xref="GOA:D7AU77"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU77"
FT                   /protein_id="ADH65635.1"
FT                   /translation="MARTMAEKVWEEHVVRRADGEPDLLYIDLHLVHEVTSPQAFEGLR
FT                   LAGRSVRRPDLTIATEDHNVPTQDLLAPIADPVSRKQVETLRKNCSDFGVRLHPMGDIE
FT                   QGVVHVVGPQLGLTQPGMTIVCGDSHTSTHGAFGALAFGIGTSQVEHVLATQTLPMAPF
FT                   KTMAVTVNGTLRPGVSAKDVILAVIAKIGTGGGQGYVIEYRGEAIEALSMEARMTVCNM
FT                   SIEAGARAGMIAPDQTTFDYIRGRAHAPQGEDFDAAVEHWKSLRTDEGAVFDAEVVLDA
FT                   DELSPFVTWGTNPGQGVPLDASVPDPASFEDPSARAAAEKALAYMDLAAGTPMREVSVD
FT                   TVFLGSCTNGRIEDLRAAAEIIRGRRVAEGVRMLVVPGSMRVKEQANEEGLGRVFEEAG
FT                   AEWREAGCSMCLGMNPDQLKPGERSASTSNRNFEGRQGRGGRTHLVSPQVAAATAVRGT
FT                   LSSPADLAAL"
FT   gene            237215..237811
FT                   /locus_tag="Ndas_0186"
FT   CDS_pept        237215..237811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0186"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="COGs: COG0066 3-isopropylmalate dehydratase small
FT                   subunit; InterPro IPR000573:IPR004431:IPR015928; KEGG:
FT                   tfu:Tfu_0627 isopropylmalate isomerase small subunit; PFAM:
FT                   aconitate hydratase domain protein; SPTR: C1YHU2
FT                   3-isopropylmalate dehydratase, small subunit; TIGRFAM:
FT                   3-isopropylmalate dehydratase, small subunit; PFAM:
FT                   Aconitase C-terminal domain; TIGRFAM: 3-isopropylmalate
FT                   dehydratase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65636"
FT                   /db_xref="GOA:D7AU78"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU78"
FT                   /protein_id="ADH65636.1"
FT                   /translation="MEKFDVHTGRAVPLRASNVDTDQIIPAVYLKRVSRTGFEDGLFAE
FT                   WRKSDPDFVLNRPEYQGASVLVAGPDFGTGSSREHAVWALQDYGFKTVLSSRFADIFRG
FT                   NSLKGGLLTVLLAQEVIDRVWAAVEADPATEVTVDLVEREVRVPAADVREPFELDDYTR
FT                   WRLLEGLDDIALTLRHTDEIGEFEGTRKPWLPVTL"
FT   gene            238161..238442
FT                   /locus_tag="Ndas_0187"
FT   CDS_pept        238161..238442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0187"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="COGs: COG0776 Bacterial nucleoid DNA-binding
FT                   protein; InterPro IPR000119:IPR010992:IPR020816; KEGG:
FT                   tfu:Tfu_0628 histone-like DNA-binding protein; PFAM:
FT                   histone family protein DNA-binding protein; SMART: histone
FT                   family protein DNA-binding protein; SPTR: C1YHU1 Bacterial
FT                   nucleoid DNA-binding protein; PFAM: Bacterial DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65637"
FT                   /db_xref="GOA:D7AU79"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU79"
FT                   /protein_id="ADH65637.1"
FT                   /translation="MNKRDLIDAISDRLGDKKTATEAVNAVLDTIQATVASGDKVAITG
FT                   FGVFEKSERAARTARNPATGATINVPASFVPKFRAGADFKALVNGDKK"
FT   gene            complement(238713..239405)
FT                   /locus_tag="Ndas_0188"
FT   CDS_pept        complement(238713..239405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0188"
FT                   /product="2-phospho-L-lactate guanylyltransferase CofC"
FT                   /note="COGs: COG1920 conserved hypothetical protein;
FT                   InterPro IPR002835; KEGG: tcu:Tcur_3458 protein of unknown
FT                   function DUF121; SPTR: C1YHU0 Uncharacterized conserved
FT                   protein; TIGRFAM: 2-phospho-L-lactate guanylyltransferase
FT                   CofC; PFAM: Guanylyl transferase CofC like; TIGRFAM:
FT                   2-phospho-L-lactate guanylyltransferase CofC"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65638"
FT                   /db_xref="GOA:D7AU80"
FT                   /db_xref="InterPro:IPR002835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU80"
FT                   /protein_id="ADH65638.1"
FT                   /translation="MTGCGEQGGAPRPGARWSLVVPVKRLGRAKTRLAPVAGGRREDLA
FT                   LAIACDTVAAARACPGVAAVFAVTEDARAGAELARLGAVVVGGEPGTGLNPALEHGAAF
FT                   ARRRLPGLGVCALSADLPALRPEELERVLAAAAGHGRSFLADAPGVGTTLFAAAPGHPF
FT                   TPAFEGPSRVRHLSGGVRELVVPDVASVRRDVDTFEDLRAAVALGVGPRTRGLWELVDG
FT                   GLCPQNAP"
FT   sig_peptide     complement(239319..239405)
FT                   /locus_tag="Ndas_0188"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            239574..240419
FT                   /locus_tag="Ndas_0189"
FT   CDS_pept        239574..240419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0189"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="COGs: COG0204 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; InterPro IPR002123; KEGG: tfu:Tfu_0630
FT                   phospholipid/glycerol acyltransferase; PFAM:
FT                   phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; SPTR: C1YHT9
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase; PFAM:
FT                   Acyltransferase; TIGRFAM: 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65639"
FT                   /db_xref="GOA:D7AU81"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU81"
FT                   /protein_id="ADH65639.1"
FT                   /translation="MAKQRESRWVKAVVSRIVRFVLWFVTKPDWRGTEHVPAKGGAIIA
FT                   LNHLSLADPLTVAHFLYIGARRWPTFTMKEGVMRIPVVSAVARSTGQIPVKRGSTDAVK
FT                   ALHEAELALTRDGASVIFYPEGTCTRDPNLWPMTAKTGVARLALTTGVPVVPVAHWGEQ
FT                   HIMPYGTKKVRLFPRKRVEFLAGPPVDLSRFRDQPLTGTVLREATEAIMADITALQARI
FT                   RGEEPPAVPYDPRKARAAAAGSEERPPVEGGTAAAADSTAPADDQAGAKSDNGGNSVGA
FT                   "
FT   gene            240416..241483
FT                   /locus_tag="Ndas_0190"
FT   CDS_pept        240416..241483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0190"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="COGs: COG0240 Glycerol-3-phosphate dehydrogenase;
FT                   InterProIPR006168:IPR016040:IPR011128:IPR013328:IPR
FT                   008927:IPR006109; KEGG: tfu:Tfu_0631 NAD(P)H-dependent
FT                   glycerol-3-phosphate dehydrogenase; PFAM: NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein; PRIAM:
FT                   Glycerol-3-phosphate dehydrogenase (NAD(P)(+)); SPTR:
FT                   C1YHT8 Glycerol-3-phosphate dehydrogenase; PFAM:
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase
FT                   C-terminus; NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65640"
FT                   /db_xref="GOA:D7AU82"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU82"
FT                   /protein_id="ADH65640.1"
FT                   /translation="MTEPMGSDDVRIAVLGAGSWGTVFANIIADAADLTRERRPDGPAA
FT                   EVVLWGRRSSVVDAVNETSQNPDYFPGIALNPRLRATTDAPKALAEADVVVLAVPSQTL
FT                   RANLVDWRPHLREDAVVVSLMKGVELGTRMRVSQIIAEVLEYSEERIAVVSGPNLAREI
FT                   AERQPATAVVACPHEPTAVRLQSLFRSAYFRPYTSTDLVGVEIGGAMKNVIGLAVGVAE
FT                   GMGFGDNTKASLITRGLAETTRLAVALGADEHTLSGLAGMGDLVATCSSPLSRNRTFGE
FT                   KLGAGKTLEQVVAETKQTAEGVKSSESVLELGWAHGVDMPITEAVVKMMHHDLSPAEAL
FT                   AAFMARSAKPERYGV"
FT   sig_peptide     240416..240490
FT                   /locus_tag="Ndas_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            241495..242724
FT                   /locus_tag="Ndas_0191"
FT   CDS_pept        241495..242724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0191"
FT                   /product="Cystathionine gamma-lyase"
FT                   /EC_number="4.4.1.1"
FT                   /note="COGs: COG0626 Cystathionine beta-lyase/cystathionine
FT                   gamma-synthase; InterPro
FT                   IPR000277:IPR015424:IPR015422:IPR015421; KEGG: tfu:Tfu_0632
FT                   cystathionine gamma-synthase; PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; PRIAM: Cystathionine
FT                   gamma-lyase; SPTR: C1YHT7 Cystathionine
FT                   beta-lyase/cystathionine gamma-synthase; PFAM: Cys/Met
FT                   metabolism PLP-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65641"
FT                   /db_xref="GOA:D7AU83"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU83"
FT                   /protein_id="ADH65641.1"
FT                   /translation="MSHTPGSAAGAGAEGEYTRAVSLPQAPVPAERPMRMPVHRATTYA
FT                   FDTSQEYADVLAGTRPGYSYARIDSPTVDAFADAVAALEGAGVPGPVRGQAFSSGMGAL
FT                   STVFMALTEAGSHVVASQSIYGNTHSLLDRLLRRFGVRTDFVDITDLDAVRAAVGPDTR
FT                   MVFTETLSNPTMTVSDLPELARISHEVGAALVVDSTFASPAVCRPLEHGADVVVHSATK
FT                   YIGGHSDTTGGVAVASPDLIGRIRSARVDLGPCLAPDEAYLLHRGLETLPLRVQRQCES
FT                   AAALAAALEGHPLVERVDHPSLASHPQSALADKLFDRGRYGAVVTVHPRGGREAGMAFA
FT                   DRLRVATIAASLGGTHTLAGHVASTSHRSMSERELAAAGISPGAVRFSVGLEDPRDLVE
FT                   DALAALGGDS"
FT   gene            242784..243908
FT                   /locus_tag="Ndas_0192"
FT   CDS_pept        242784..243908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0192"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="COGs: COG1181 D-alanine-D-alanine ligase and related
FT                   ATP-grasp protein;
FT                   InterProIPR005905:IPR013816:IPR013817:IPR011095:IPR
FT                   011127:IPR016185:IPR000291:IPR011761; KEGG: tfu:Tfu_0633
FT                   D-alanyl-alanine synthetase A; PFAM: D-alanine--D-alanine
FT                   ligase domain protein; PRIAM: D-alanine--D-alanine ligase;
FT                   SPTR: C1YHT6 D-alanine--D-alanine ligase; TIGRFAM:
FT                   D-alanine/D-alanine ligase; PFAM: D-ala D-ala ligase
FT                   C-terminus; D-ala D-ala ligase N-terminus; TIGRFAM:
FT                   D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65642"
FT                   /db_xref="GOA:D7AU84"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU84"
FT                   /protein_id="ADH65642.1"
FT                   /translation="MSSEQRKIRVAVVFGGRSSEHEISCVTAGSVLSVVDHDRYEIVPV
FT                   GITRTGNWVLTSGDPESLRIDAGTRALPSVSEDGVDLALPFDSAGQLMVVDPVKGPERL
FT                   AGVDVVLPLLHGPFGEDGTIQGLFEMMGVRYAGAGVFSSSASMDKVFMKAMLRGNGIPT
FT                   SDFVAITDRQWRTERKRVLDDVAELGATVFVKPARAGSSVGISKVEDSSDADAVVAAVE
FT                   AAREHDPKVLVEAQVVGREVECGVLESEDGGTPDVSLPAEVHVADGFDFYDFEAKYLST
FT                   SSLTIPAELPEEATARLRALAAEVFEAMGCEGLARVDFFYTEDGDILVNELNTMPGFTP
FT                   ASAFPQMWAATGVDYAALVERMISTALRRAPGLR"
FT   gene            244069..244629
FT                   /locus_tag="Ndas_0193"
FT   CDS_pept        244069..244629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0193"
FT                   /product="protein of unknown function DUF820"
FT                   /note="COGs: COG4636 conserved hypothetical protein;
FT                   InterPro IPR012296:IPR008538; KEGG: sgr:SGR_3203
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF820; SPTR: C1YHT5 Uncharacterized conserved protein;
FT                   PFAM: Protein of unknown function (DUF820)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65643"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU85"
FT                   /protein_id="ADH65643.1"
FT                   /translation="MEETKMDLPTLAESLELPDGYRTEIINGSIIVSPTPTYRHARAVR
FT                   KLERVLSHVEEEGLDMLQTATVEVSGTGDRYVPDLLVIPTALAEGEGWDGPEWIRPAEA
FT                   LELAVEVVSPSSALHDWQAKARGYARAGVPLYLVVDPRRSEVALFSDPKGDEYQEVARA
FT                   VRGGSVNLPKPFDVEIEASALLT"
FT   gene            complement(244886..245737)
FT                   /locus_tag="Ndas_0194"
FT   CDS_pept        complement(244886..245737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0194"
FT                   /product="protein of unknown function DUF540"
FT                   /note="COGs: COG2981 Uncharacterized protein involved in
FT                   cysteine biosynthesis; InterPro IPR007496; KEGG:
FT                   tfu:Tfu_0634 putative integral membrane protein; PFAM:
FT                   protein of unknown function DUF540; SPTR: C1YHT4
FT                   Uncharacterized protein involved in cysteine biosynthesis;
FT                   PFAM: Protein of unknown function (DUF540)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65644"
FT                   /db_xref="GOA:D7AU86"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU86"
FT                   /protein_id="ADH65644.1"
FT                   /translation="MANPVREFLGGVGALLRGFTLLLRKPRLFLLGALPALITSLVFLA
FT                   LFVLLVVNLTDLADWATPFADGWDPLWQGLLRGAVSVAVLAGSLLLMVVLFTTVTLTLG
FT                   GPIYDKVTELVEKELGNDPGELDEPLMASMWRAVRQSLAIVAVSLLVTVFVFAIGFIPL
FT                   VGQVVGPVLAAVLGGWLLAVELLASAFDRRGLTTIRERRRHMGTRRARVLGYAVPTYFL
FT                   LAIPFLAVVVFPAATAGAVLLTRELVPTPPYRPDPKGPLPGPGAPDGQLPGGPFPGGHG
FT                   QG"
FT   gene            complement(245797..246576)
FT                   /locus_tag="Ndas_0195"
FT   CDS_pept        complement(245797..246576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0195"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_3372 TPR repeat-containing
FT                   protein; SPTR: C1YHT3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65645"
FT                   /db_xref="InterPro:IPR021122"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU87"
FT                   /protein_id="ADH65645.1"
FT                   /translation="MTAPDLRALDLSVLNSATKYPSIPTYHTLDPKNGGLLEEATAFTG
FT                   DVVLTEKVDGANARIVSFPSGDYVLGSREELLYARGDLIGNPALGIVEALRALADRITP
FT                   PMTGIAVHYLEVYGGKVTAASREYTGDRAVGYRMFDSAAVTAEVLSRQRQEISAWREGG
FT                   GQGFLPEDALSLLAEREGIELTPRLATVPADKLPQGVAETSEFIAEHLPGTRVALDGGA
FT                   GGRAEGIVLRTTDRSVIAKARFQDYRRTLKRRSQRGG"
FT   gene            complement(246914..248680)
FT                   /locus_tag="Ndas_0196"
FT   CDS_pept        complement(246914..248680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0196"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydC"
FT                   /note="COGs: COG4987 ABC-type transport system involved in
FT                   cytochrome bd biosynthesis fused ATPase and permease
FT                   components;
FT                   InterProIPR003593:IPR017940:IPR011527:IPR003439:IPR 014223;
FT                   KEGG: tfu:Tfu_0635 ABC transporter, ATP-binding protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; SPTR:
FT                   C1YHT2 Cysteine export CydDC family ABC transporter
FT                   permease subunit/ATP-binding protein CydC; TIGRFAM: ABC
FT                   transporter, CydDC cysteine exporter (CydDC-E) family,
FT                   permease/ATP-binding protein CydC; PFAM: ABC transporter;
FT                   ABC transporter transmembrane region; TIGRFAM: ABC
FT                   transporter, CydDC cysteine exporter (CydDC-E) family,
FT                   permease/ATP-binding protein CydC"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65646"
FT                   /db_xref="GOA:D7AU88"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU88"
FT                   /protein_id="ADH65646.1"
FT                   /translation="MSADTAAPDTLRVPGRERRRDPLLRMTALARPRGGRFALGVLLGA
FT                   AATGAAVALLGVAAWMLATAADHPPITALGVAVVATRALGVGRGVARYLERLVTHDAAF
FT                   RTLAEVRVRVYERLARTEPFGRFRSGDLVSRLVNDTEATLDLLVRGLTPPLVSVVTGGV
FT                   TVLVLTALYVPGGLLLAAGLLLAGLAVPLAAAALGREPGRRQARARGELSTTLVDTLHG
FT                   APDLVAYGAMDQQVARVYAADEELTRLARRDSAILGLGAGASALITGLTVWGALFLGVA
FT                   AVAGGTLDAVSLAVLVLVTLAAFEIVAPLPAVAARLGAIRASGARLFGVLDTPPAVAAP
FT                   TRTGLDPHGDATVRVRDLRVRYGPGEPWALDGVDLEIPAGWTVAVIGPSGAGKSTLASV
FT                   LLRFRDPDGGLVEIGGEDVTSYPADEVRGVVSGVPQDPHVFASTLRENLRLARPGAEDE
FT                   ELWEALRRARLADEVTAMPEGLDTRVGTHGLGLSGGMVQRLALARALLAAPRVLVLDEP
FT                   TAHLDPDTRDAVVEDLLAAAEGYSTLLVTHDLTGLDRVDQIYVVRDGRVIQQGTHEELS
FT                   RQEGWYRDVSTD"
FT   gene            complement(248677..250464)
FT                   /locus_tag="Ndas_0197"
FT   CDS_pept        complement(248677..250464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0197"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD"
FT                   /note="COGs: COG4988 ABC-type transport system involved in
FT                   cytochrome bd biosynthesis ATPase and permease components;
FT                   InterProIPR017940:IPR003439:IPR017871:IPR014216:IPR
FT                   003593:IPR011527:IPR001140; KEGG: tfu:Tfu_0636 ABC
FT                   transporter, ATP-binding protein; PFAM: ABC transporter
FT                   related; ABC transporter transmembrane region; SMART: AAA
FT                   ATPase; SPTR: C1YHT1 Cysteine export CydDC family ABC
FT                   transporter permease subunit/ATP-binding protein CydD;
FT                   TIGRFAM: ABC transporter, CydDC cysteine exporter (CydDC-E)
FT                   family, permease/ATP-binding protein CydD; PFAM: ABC
FT                   transporter; ABC transporter transmembrane region; TIGRFAM:
FT                   ABC transporter, CydDC cysteine exporter (CydDC-E) family,
FT                   permease/ATP-binding protein CydD"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65647"
FT                   /db_xref="GOA:D7AU89"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU89"
FT                   /protein_id="ADH65647.1"
FT                   /translation="MKPLDPRLVRTASAVRAHLAVSVASGVLITGLILVQAWLLARAVT
FT                   GAWRGEGLDTLGWVVGAVAAVAVVRALLSYVAETSALHSAARTKSQLRRRLVAHVTGSG
FT                   RVWAAEPGGEQGSPKAGELVTLATRGLDALDDYFARYLPQLVLAAIVPLAVLGVVFWAD
FT                   WISGIVILVTVPLIPVFMALIGMHTQQRTDRQWKLLSRLGGHFLDVVEGLPTLAVFRRA
FT                   KAQAEILRRVGEDHRRATMGTLRIAFLSAFALELLSTLAVALVAVEVGLRLLGGHMDYQ
FT                   TALLVLILAPEAYLPLREVGARFHASMEGVSAAEQVFTELERGRGTARTGAAASDDTAE
FT                   GPAAGSGRPSSPAPATGRPAPAAGGDIRFEDVELLYPGRDVPALSGLDLEVAAGEHLLL
FT                   TGPSGAGKSTLLSLLLRLNEPTRGRVSVRAPGGRWEPLGGIDADDWRLGTAWVPQNPYL
FT                   FDVSVADNIRLGSPDASLERVREAARLAEADAFVRALPDGYDTRLGERGARLSAGQRQR
FT                   IALARALCRDAPLVLLDEPTAHLDPESAAAVRTAVARLLEGRTAVIVAHDTGWARGVLG
FT                   DTLRTASLPLPTQEGNVSR"
FT   sig_peptide     complement(250354..250464)
FT                   /locus_tag="Ndas_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(250692..251744)
FT                   /locus_tag="Ndas_0198"
FT   CDS_pept        complement(250692..251744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0198"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /note="COGs: COG1294 Cytochrome bd-type quinol oxidase
FT                   subunit 2; InterPro IPR003317; KEGG: tfu:Tfu_0637
FT                   cytochrome bd ubiquinol oxidase, subunit II; PFAM:
FT                   cytochrome bd ubiquinol oxidase subunit II; SPTR: C1YHT0
FT                   Cytochrome d oxidase cyd, subunit II; TIGRFAM: cytochrome d
FT                   ubiquinol oxidase, subunit II; PFAM: Cytochrome oxidase
FT                   subunit II; TIGRFAM: cytochrome d oxidase, subunit II
FT                   (cydB)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65648"
FT                   /db_xref="GOA:D7AU90"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU90"
FT                   /protein_id="ADH65648.1"
FT                   /translation="MELAVIWFTAISVLWIGYFVLEGFDFGVGTLMPFMGRRDSVDRRV
FT                   AINAIGPVWDANEVWLITAVGATFAAFPAWYASLLSGFYAPVFLILVALILRGVAFEYR
FT                   GKRDSSVWRAWWDRAIFAGSTAPAFLWGVIFANVVRGVAMGSDQVVTSSVADLLNPYAL
FT                   LGGLTTLSLFTLHGAIFLTLKTDGPVRTRARRAALWSACAAVPLGSVFLAWTQLAHGDG
FT                   TTTLPLVALSAAALAGGVAAAWRRREGWSFACTAVTILTAFAALFTALFPNVLPSTTDP
FT                   AFSLTVANASSAEYTLTVMSWVAVVFLPLVLLYQGWSYWVFRRRVTGETVTGATVTRTD
FT                   HGDRNPEPAA"
FT   gene            complement(251757..253202)
FT                   /locus_tag="Ndas_0199"
FT   CDS_pept        complement(251757..253202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0199"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="COGs: COG1271 Cytochrome bd-type quinol oxidase
FT                   subunit 1; InterPro IPR002585; KEGG: tfu:Tfu_0638 putative
FT                   cytochrome oxidase subunit I; PFAM: cytochrome bd ubiquinol
FT                   oxidase subunit I; SPTR: C1YHS9 Cytochrome bd-type quinol
FT                   oxidase, subunit 1; PFAM: Bacterial Cytochrome Ubiquinol
FT                   Oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65649"
FT                   /db_xref="GOA:D7AU91"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU91"
FT                   /protein_id="ADH65649.1"
FT                   /translation="MEALELARWQFGVTTIYHFLFVPLTIGLSFIVAVLQTLWYRTGRH
FT                   EYLQATQFFGKLFLINFAMGVVTGIVQEFQFGMNWSEYSRFVGDVFGAPLAMEALLAFF
FT                   LESTFIGLWIFGWHRLPRGVHLACIWAVAIGTNLSAYFILAANAWMRHPVGYTVNEENG
FT                   RAELTDIWAVLSNDQAWSTYLHTVSAAFVTAGLFVVAVSAYKLWRNSHHNDTGVPGVVP
FT                   PRKDFALFRGTLKVGLVFTLVAGALVVFSGDHQAKLAAEYEPMKLAAAEALWETEEGAA
FT                   FSALAVGDTEERYNPIDITIPNVLSFLATGQFDGEVHGMNNLEEAYDEYYGPGDYTPNV
FT                   FVVYWSFRLMMGLGMFGVAVAALGLLLTWGRERTPTGKWFYYAAMLALPSALAANIFGW
FT                   VLTEMGRQPWTVHGELLTAASVSPGVSLGAVAASLAGFTAVYGVLFVVEVGLLLKYVKA
FT                   GPSHLVPDLEDDEDESKIPHFSY"
FT   gene            complement(253603..254334)
FT                   /locus_tag="Ndas_0200"
FT   CDS_pept        complement(253603..254334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0200"
FT                   /product="protein of unknown function DUF305"
FT                   /note="COGs: COG3544 conserved hypothetical protein;
FT                   InterPro IPR005183; KEGG: tfu:Tfu_0639 putative secreted
FT                   protein; PFAM: protein of unknown function DUF305; SPTR:
FT                   C1YHS8 Uncharacterized conserved protein; PFAM: Domain of
FT                   unknown function (DUF305)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65650"
FT                   /db_xref="GOA:D7AU92"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU92"
FT                   /protein_id="ADH65650.1"
FT                   /translation="MEQKNGPAAGTADHVGDVPDDDGPPWEDGAADEETPSRVSWRSVP
FT                   MWITVILVVLALGGGYLLGRPSYPLDTGADAGFLRDMSAHHAQAVDMSMLILERTEDPE
FT                   LRTVATDIARTQQAQIGIMQGWLMAWDLNARGVREPMAWMEGHDHGGGGGEVPDTMPGL
FT                   ASSEEMVSLEEATGEEAELLFLELMIAHHKGGIEMAEAEVELGQEDLVTDFAQGMADSQ
FT                   LKEIDLMEGMIDQRRDGASGD"
FT   gene            254424..255218
FT                   /locus_tag="Ndas_0201"
FT   CDS_pept        254424..255218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0640 hypothetical protein; SPTR:
FT                   C1YHS7 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF3105)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65651"
FT                   /db_xref="GOA:D7AU93"
FT                   /db_xref="InterPro:IPR021454"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU93"
FT                   /protein_id="ADH65651.1"
FT                   /translation="MAKKKTAEERRRRAAELKAQRLKEERRRKILTTTGITTAVVLVVG
FT                   LIGFLVFMEFRSRTISGVEEYEVGSYVHVDTGQRVNYEQSPPVGGDHWNAWQNCGVYTE
FT                   PVTHEFAVHSLEHGAVWINYRPDLPEDQVQTLTDMYSSGDYLVISPYAGELDAPIVASS
FT                   WGRQITAESADDENLQRFVRLYERGTDVPEPGAACSGGVAENAEEVDAMLGSGAGVDAE
FT                   TMEGPEGGDAGAEEGTGDEASDAPSDAAEDEPSAEESAGAEN"
FT   gene            complement(255595..256062)
FT                   /locus_tag="Ndas_0202"
FT   CDS_pept        complement(255595..256062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0641 hypothetical protein; SPTR:
FT                   C1YHS6 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF3515)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65652"
FT                   /db_xref="InterPro:IPR021903"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU94"
FT                   /protein_id="ADH65652.1"
FT                   /translation="MLSRFACAGVVAALALVATGCGAQTVRMQPPEADAATAEVCADLV
FT                   AALPDTLLGAERAQVRPDSELTAAWGDPPIGLRCGVERPVTLTSTSYLQEVNGVPWLPQ
FT                   PEDAPTMYTAIGHEAYVELSIPAAHGVPAAALSTVSDLIVEHVPALPEGEL"
FT   sig_peptide     complement(255958..256062)
FT                   /locus_tag="Ndas_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(256093..256326)
FT                   /locus_tag="Ndas_0203"
FT   CDS_pept        complement(256093..256326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0203"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="InterPro IPR019887:IPR011008; KEGG: tfu:Tfu_0642
FT                   AsnC family transcriptional regulator; PFAM: Transcription
FT                   regulator, AsnC-type-like; SPTR: C1YHS5 Transcriptional
FT                   regulator, AsnC family; PFAM: AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65653"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU95"
FT                   /protein_id="ADH65653.1"
FT                   /translation="MVQAYILIQTEVGQAAEVAGRIRGIEGVEKAHDVTGPYDVIVQAS
FT                   AEDIDSLGTLVVARIQRLDGIARTLTCPIVNI"
FT   gene            256457..257449
FT                   /locus_tag="Ndas_0204"
FT   CDS_pept        256457..257449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0204"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="COGs: COG0611 Thiamine monophosphate kinase;
FT                   InterPro IPR016188:IPR010918:IPR000728:IPR006283; KEGG:
FT                   tfu:Tfu_0643 thiamine monophosphate kinase; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein; PRIAM: Thiamine-phosphate kinase; SPTR:
FT                   C1YHS4 Thiamine-phosphate kinase; TIGRFAM:
FT                   thiamine-monophosphate kinase; PFAM: AIR synthase related
FT                   protein, N-terminal domain; AIR synthase related protein,
FT                   C-terminal domain; TIGRFAM: thiamine-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65654"
FT                   /db_xref="GOA:D7AU96"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU96"
FT                   /protein_id="ADH65654.1"
FT                   /translation="MRNTIGGLGEFALIARVTSQFPTTDDVILGPGDDAAVVASPDGRT
FT                   VATTDLLVEGRHFRREWSTARDVGHRAVAQNFADVAAMGARPTGLLIGFAAPADLPVPW
FT                   AEEFTAGVRDECAVAGGAVVGGDMVGSDTLTIAVTALGDLQGRAPVRRDGARPGDVVAY
FT                   TGHLGLSAAGLALLEQGIDGPAECLSEHRRPSPPYARGAEAARLGATAMLDVSDGLAQD
FT                   LGHVCRASGVRIDLEGEALRPEPALVEAVRVLGAGADTAERAARDLMVAGGEDHALAAV
FT                   FPPHTVLPAHWSRVGTVARTTGENAEENTIPVTVDGRVPPRGGWDHFRR"
FT   gene            257706..258371
FT                   /locus_tag="Ndas_0205"
FT   CDS_pept        257706..258371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0205"
FT                   /product="cellulose-binding family II"
FT                   /note="InterPro IPR008965:IPR012291:IPR001919; KEGG:
FT                   tfu:Tfu_0644 cellulose-binding family II protein; PFAM:
FT                   cellulose-binding family II; SMART: cellulose-binding
FT                   family II; SPTR: C1YHS3 Putative cellulose binding protein;
FT                   PFAM: Cellulose binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65655"
FT                   /db_xref="GOA:D7AU97"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU97"
FT                   /protein_id="ADH65655.1"
FT                   /translation="MGRHGWRNGNRRGVHRSEPEDVGVLRRLGGLIESTVPKRVEPPRL
FT                   LNVLVVSGVILGLLLFGYSTTQIYLQFGGTPGATEAPGTQDGVQPTHDASPGTDTEEPA
FT                   AQGEGEQGPQTQAGSEPTTVVYRVTESTAVGFSGHVTVTNTSHASLDGWELALAFDSAE
FT                   ITHVNGADWAEIENGILARQPADQNSLEPGDSVALTFEAVGVPQSPIRCSLNGHVCEL"
FT   gene            complement(258528..258713)
FT                   /locus_tag="Ndas_0206"
FT   CDS_pept        complement(258528..258713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0206"
FT                   /product="ribosomal protein L28"
FT                   /note="COGs: COG0227 Ribosomal protein L28; InterPro
FT                   IPR001383; KEGG: tfu:Tfu_0645 50S ribosomal protein L28;
FT                   PFAM: ribosomal protein L28; SPTR: Q47S84 50S ribosomal
FT                   protein L28; TIGRFAM: ribosomal protein L28; PFAM:
FT                   Ribosomal L28 family; TIGRFAM: ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65656"
FT                   /db_xref="GOA:D7AU98"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU98"
FT                   /protein_id="ADH65656.1"
FT                   /translation="MASVCDVCGKGPGFGNSVSHSHRRTRRRWNPNIQTVRTRVGGTPK
FT                   RVNACTSCIKAGKVTR"
FT   gene            259227..261470
FT                   /locus_tag="Ndas_0207"
FT   CDS_pept        259227..261470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0207"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="COGs: COG1200 RecG-like helicase;
FT                   InterProIPR016027:IPR004365:IPR011545:IPR001650:IPR
FT                   014001:IPR014021; KEGG: tfu:Tfu_0646 ATP-dependent DNA
FT                   helicase RecG; PFAM: DEAD/DEAH box helicase domain protein;
FT                   nucleic acid binding OB-fold tRNA/helicase-type; helicase
FT                   domain protein; SMART: DEAD-like helicase ; helicase domain
FT                   protein; SPTR: C1YHS2 ATP-dependent DNA helicase RecG;
FT                   PFAM: Helicase conserved C-terminal domain; OB-fold nucleic
FT                   acid binding domain; DEAD/DEAH box helicase; TIGRFAM:
FT                   ATP-dependent DNA helicase RecG"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65657"
FT                   /db_xref="GOA:D7AU99"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:D7AU99"
FT                   /protein_id="ADH65657.1"
FT                   /translation="MAVTGDPRREAHVSTWDEPLSRGPLRGKTAKALAEKLDLHTLGDL
FT                   LRYYPRRYDRRGDLTDLAALREGEEVTVQARVLDAKRRTVPARQGRRRMDMMEATVTDG
FT                   TGRLHLTFFNRGSYHQGALVPGRLAMFSGRVSTFKGRRQLDHPQYELLDEDGHEGERAR
FT                   AYAEELIPVYPAVKGLDSTTIARTVDIVLADVDSLPDPLPPELRERRGLLGVADALRRI
FT                   HRPAEWSDVGAARRRLKWDEAFVLQLALAQRRHRAEDLPAKPRPGAVGGLLDAFDAQLP
FT                   FTLTEGQREVGERLAERLDAAHPMHCLLQGDVGAGKTLVALRAMLRVVDSGGQAVMLAP
FT                   TEVLAQQHHRSISAMLGALGRAGQIDGAENATRVALLTGSMNAAARREALLDAASGAAG
FT                   IVVGTHALLQEHVSFADLGLVVVDEQHRFGVEQRDALREKAVDGRPHVLVMTATPIPRT
FT                   VAMTVYGDLDVVALTQLPTGRAPVSTHVVPASEKPHFLARAWERIREEAGGGHQAFVVC
FT                   PRIGDDAKEEAEEEVGAGDGEEAAGARPPLAVLDVAARLREGPLSELRVEVLHGRMAPD
FT                   DKDAVMRRFSAGDTDAVVSTTVIEVGVDVPNATVMVIMDADRFGVSQLHQLRGRVGRGQ
FT                   LPGLCLLVTDAEEGSPARERLAAVAATTDGFELSRVDLEMRREGDVLGDSQSGARSSLR
FT                   MLTLLKDEELIGEAREEATAYVAADPGLTGHPPLAQALETLLPEERAEYLDKA"
FT   gene            261645..262226
FT                   /locus_tag="Ndas_0208"
FT   CDS_pept        261645..262226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0208"
FT                   /product="methyltransferase"
FT                   /note="COGs: COG0742 N6-adenine-specific methylase;
FT                   InterPro IPR016065:IPR004398:IPR002052; KEGG: sro:Sros_7999
FT                   hypothetical protein; PFAM: Protein of unknown function
FT                   methylase putative; SPTR: C1YHS1 Putative
FT                   methyltransferase; TIGRFAM: methyltransferase; PFAM:
FT                   Conserved hypothetical protein 95; TIGRFAM: RNA
FT                   methyltransferase, RsmD family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65658"
FT                   /db_xref="GOA:D7AUA0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUA0"
FT                   /protein_id="ADH65658.1"
FT                   /translation="MTRIIAGTAGGRRISVPEGRNTRPTSDRAREALFSSVQSDLGSLD
FT                   GARVMDLYAGSGAIGLEALSRGAAHALLVEADRRAAQVLRDNIQTLGLPGARLVADRVE
FT                   RVVGADNTGDPYDVVVADPPYAVTDAEVAGVLADLVGRGWLAEDAVVVVERSKRGAEPS
FT                   WPEGLERDRSRGYGEAVLWYARPSPTTTLT"
FT   gene            262639..263133
FT                   /locus_tag="Ndas_0209"
FT   CDS_pept        262639..263133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0209"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="COGs: COG0669 Phosphopantetheine
FT                   adenylyltransferase; InterPro
FT                   IPR014729:IPR004820:IPR004821:IPR001980; KEGG: tfu:Tfu_0648
FT                   phosphopantetheine adenylyltransferase; PFAM:
FT                   cytidylyltransferase; PRIAM: Pantetheine-phosphate
FT                   adenylyltransferase; SPTR: C1YHS0 Phosphopantetheine
FT                   adenylyltransferase; TIGRFAM: pantetheine-phosphate
FT                   adenylyltransferase; cytidyltransferase-related domain
FT                   protein; PFAM: Cytidylyltransferase; TIGRFAM:
FT                   pantetheine-phosphate adenylyltransferase, bacterial;
FT                   cytidyltransferase-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65659"
FT                   /db_xref="GOA:D7AUA1"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUA1"
FT                   /protein_id="ADH65659.1"
FT                   /translation="MRRVVCPGSFDPVTYGHIDIIGRAAKQYDEVVAAVLNNVNKRGLF
FT                   TVPEKLDMLREGASGFDNVRVSEFDGLLVDFCRSNGIETIVRSLRSVSDFDYELQIAQM
FT                   NYQLSGVETVFMTANPQYSFLSSSLVREIAQHRGDVSSLVTPYVQERLREKYEQKRSEG
FT                   L"
FT   gene            263339..263917
FT                   /locus_tag="Ndas_0210"
FT   CDS_pept        263339..263917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0210"
FT                   /product="protein of unknown function DUF177"
FT                   /note="COGs: COG1399 metal-binding possibly nucleic
FT                   acid-binding protein; InterPro IPR003772; KEGG:
FT                   tfu:Tfu_0649 hypothetical protein; PFAM: protein of unknown
FT                   function DUF177; SPTR: C1YHR9 Predicted metal-binding
FT                   protein, possibly nucleic-acid binding; PFAM:
FT                   Uncharacterized ACR, COG1399"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65660"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUA2"
FT                   /protein_id="ADH65660.1"
FT                   /translation="MTLSRLDPRDPFVVDTRQLGRQPGSMRTVNRIVTVPEAFATAMAA
FT                   VPEGSEVELDLRLEAVMEGVLVTGTARGQLTAECSRCLDPISEGVEAGFQELYRYSADD
FT                   EAAVTGEDADDEDEDYYLEGDLLDLGPVVRDAVVLALPLTPLCGPDCPGLCSECGAKIA
FT                   EAGPDHGHGDNIDPRWEALREIADDPGER"
FT   gene            264055..264231
FT                   /locus_tag="Ndas_0211"
FT   CDS_pept        264055..264231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0211"
FT                   /product="ribosomal protein L32"
FT                   /note="InterPro IPR002677; KEGG: tfu:Tfu_0650 50S ribosomal
FT                   protein L32; PFAM: ribosomal L32p protein; SPTR: C1YHR8 LSU
FT                   ribosomal protein L32P; TIGRFAM: ribosomal protein L32;
FT                   PFAM: Ribosomal L32p protein family; TIGRFAM: ribosomal
FT                   protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65661"
FT                   /db_xref="GOA:D7AUA3"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUA3"
FT                   /protein_id="ADH65661.1"
FT                   /translation="MAVPKRKMSRSNTRTRRSQWKASRPVLVNCPRCRDPKQPHIACPT
FT                   CGTYNNRQVTNPA"
FT   gene            264780..265526
FT                   /locus_tag="Ndas_0212"
FT   CDS_pept        264780..265526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0212"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="COGs: COG0571 dsRNA-specific ribonuclease; InterPro
FT                   IPR000999:IPR014720:IPR001159:IPR011907; KEGG: tfu:Tfu_0651
FT                   ribonuclease III; PFAM: ribonuclease III; double-stranded
FT                   RNA binding domain protein; PRIAM: Ribonuclease III; SMART:
FT                   ribonuclease III; double-stranded RNA binding domain
FT                   protein; SPTR: C1YHR7 RNAse III; TIGRFAM: ribonuclease III;
FT                   PFAM: RNase3 domain; Double-stranded RNA binding motif;
FT                   TIGRFAM: ribonuclease III, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65662"
FT                   /db_xref="GOA:D7AUA4"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUA4"
FT                   /protein_id="ADH65662.1"
FT                   /translation="MANQLPVSEAKAFHQAIGVEVDPKILLRALTHRSYAYEKGGLPTN
FT                   ERLEFLGDSVLGLVVTDTLFRKHPDLPEGQLAKLRAAVVNMRALADVARGLGVGAYIRL
FT                   GRGEEGTGGRDKSSILADTLEAVIGAVYLDRGLDVASEFVHRLFDPLIATASGLGAGLD
FT                   WKTSLQELTAAEMLGVPEYHVDESGPDHQKTFRATVRVAGESYGLGEGRSKKEAEQQAA
FT                   ESAWKAIKARSEAAGAAGAVSGDGQG"
FT   gene            265534..266388
FT                   /locus_tag="Ndas_0213"
FT   CDS_pept        265534..266388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0213"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="COGs: COG0266 Formamidopyrimidine-DNA glycosylase;
FT                   InterProIPR012319:IPR010979:IPR015886:IPR010663:IPR
FT                   000191:IPR000214; KEGG: ami:Amir_5962
FT                   formamidopyrimidine-DNA glycosylase; PFAM:
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; DNA glycosylase/AP lyase, H2TH DNA-binding; zinc
FT                   finger Fpg domain protein; PRIAM: DNA-formamidopyrimidine
FT                   glycosylase; SPTR: C1YHR6 DNA glycosylase; TIGRFAM:
FT                   formamidopyrimidine-DNA glycosylase; PFAM:
FT                   Formamidopyrimidine-DNA glycosylase H2TH domain;
FT                   Formamidopyrimidine-DNA glycosylase N-terminal domain; Zinc
FT                   finger found in FPG and IleRS; TIGRFAM:
FT                   formamidopyrimidine-DNA glycosylase (fpg)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65663"
FT                   /db_xref="GOA:D7AUA5"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUA5"
FT                   /protein_id="ADH65663.1"
FT                   /translation="MPELPEVEVVRRGLAEHALGRTVGAVEVLHPRAVRRYLPGPADFA
FT                   ARLSGRVPTAARRRGKYLWLVLDNGEMLLTHLGMSGQMLVQPEGKPDERHLRVRLPLSD
FT                   GTELRFVDQRTFGHLMVDVPGVREDVPSSVDHIALDPLDPDFVAEDFVRALRARRTEVK
FT                   RALLDQSLISGVGNIYADEALWRSRLHWARSTRELSDAEAVELLGHVGQVMNEALEVGG
FT                   TTFDGLYVNVNGESGYFERGLNAYGRRDRPCGRCGALIVREAFMNRSSYSCPTCQRAPR
FT                   GRA"
FT   gene            266448..266735
FT                   /locus_tag="Ndas_0214"
FT   CDS_pept        266448..266735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0214"
FT                   /product="acylphosphatase"
FT                   /note="COGs: COG1254 Acylphosphatase; InterPro
FT                   IPR001792:IPR017968; KEGG: tfu:Tfu_0653 acylphosphatase;
FT                   PFAM: acylphosphatase; SPTR: C1YHR5 Acylphosphatase; PFAM:
FT                   Acylphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65664"
FT                   /db_xref="GOA:D7AUA6"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUA6"
FT                   /protein_id="ADH65664.1"
FT                   /translation="MGDEVEAVRVTAWVRGHVQGVGFRWWTRSKALELGLVGAATNLRD
FT                   GRVEVVAEGPRDACERLLGHLRGGATPGRVDSVVERWSSSGGTFTGFDER"
FT   gene            267092..267283
FT                   /locus_tag="Ndas_0215"
FT   CDS_pept        267092..267283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sro:Sros_7992 hypothetical protein; SPTR:
FT                   C1YHR4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65665"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUA7"
FT                   /protein_id="ADH65665.1"
FT                   /translation="MAKALFGHVGVSDPRMVSEVRRLRNRVRDLEDEISRLQAQNDQLS
FT                   MAVTDAASGATDREPALA"
FT   gene            267652..271197
FT                   /locus_tag="Ndas_0216"
FT   CDS_pept        267652..271197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0216"
FT                   /product="chromosome segregation protein SMC"
FT                   /note="COGs: COG1196 Chromosome segregation ATPase;
FT                   InterPro IPR010935:IPR003395:IPR011890; KEGG: tfu:Tfu_0655
FT                   condensin subunit Smc; PFAM: SMC domain protein; SMCs
FT                   flexible hinge domain protein; SPTR: C1YHR3 Condensin
FT                   subunit Smc; TIGRFAM: chromosome segregation protein SMC;
FT                   PFAM: RecF/RecN/SMC N terminal domain; SMC proteins
FT                   Flexible Hinge Domain; TIGRFAM: chromosome segregation
FT                   protein SMC, common bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65666"
FT                   /db_xref="GOA:D7AUA8"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUA8"
FT                   /protein_id="ADH65666.1"
FT                   /translation="MYLKNLTLRGFKSFASATTLRFEPGITCVVGPNGSGKSNVVDALS
FT                   WVMGEQGAKSLRGGKMEDVIFAGTSTRQALGRAEVSLTIDNTDGALPIDYTEVTIRRTM
FT                   FRNGGSEYAINGDTCRLLDIQDLLSDSGIGREMHVIVGQGQLDTVLHAGPEERRALIEE
FT                   AAGILKHRKRKEKAIRKLNAMQGNLDRVTDLTAELRRQLKPLGRQAELARRAAVIQADL
FT                   RDARLRLLADDIVTLTGQLAKEEADEKEVLARRGAAEAALTQTQERETELEAQAAEAAP
FT                   ALARALETYHALSRLTERLDAVRGLANERHRNLASVSDEPVHRRDPEELEMEAEEAAAQ
FT                   EEELLTRLEEAREALEATVIERSAAEDALHREEKRLEAANRASAERREGLVRLSARVES
FT                   LRGRLASNGDEITRLEESARQAAERAERAQAEYEMAAEEAAGLDEGDAELDAAQEEAAR
FT                   RLSEADAGINRLRDAERTAEGERAALAARKEALELGLAHKDGAGTLLGADLPGMLGSLA
FT                   ALVQVESGQETAVAAAFGTAAGAVAVSDPDTAVAALDLLRSEDAGRAGIVIAQAVPAVP
FT                   RGEWPVLPSGVRYALDAVVAPEHLAGAVTALLDRTALAADAHAARDLVRKVPGVRAVTP
FT                   EGDVFSAALVHGGSAAAPSLLEVQAAVDEAAGRLETATEAAGRIAAELEERRRERADLA
FT                   AEVEELTARRRQGDRRRNESAQRLGKLGGQARSAEAESERCAAAAAKAAAARGEEAAKL
FT                   ERLEEELAEAEEVAASIEEDAPDPETRDELAAQASRARATEMERRLSVRTAEERARSIE
FT                   GRAERLRAQAFEERRAMERAAERRRTRAAQATIAEAAAEGARLALERIAVSLAAAEAER
FT                   TAAEADKEARDAELRTVRARVRELSVDLEKLTSSAHSGEVARAERRLRLEQLEVRASEE
FT                   MGVDVPTLVAEYGPNVPVPPPGDAEEDAVPLPYVREVQAKRAKAAERQLNQLGKINPLA
FT                   LEEFAALEERHAFLNAQLEDLKKTRRDLMDIVQEVDARVQEVFSSAYLDVEREFAAIFG
FT                   RLFPGGEGRLLLTSPEDMLTTGVEVEARPPGKKVKRLSLLSGGERSLTAVAFLAAIFKA
FT                   RPSPFYVMDEVEAALDDTNLQRLLVIFEELRAASQLIVITHQKRTMEAADALYGVTMQG
FT                   DGISQVISQKLERPA"
FT   gene            complement(271508..274159)
FT                   /locus_tag="Ndas_0217"
FT   CDS_pept        complement(271508..274159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0217"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="InterPro IPR000209:IPR003137; KEGG: scl:sce3689
FT                   subtilisin like protease; PFAM: peptidase S8 and S53
FT                   subtilisin kexin sedolisin; protease-associated PA domain
FT                   protein; SPTR: C1YHR1 Subtilisin-like serine protease;
FT                   PFAM: PA domain; Fn3-like domain (DUF1034); Peptidase
FT                   inhibitor I9; Subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65667"
FT                   /db_xref="GOA:D7AUA9"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR010435"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034187"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUA9"
FT                   /protein_id="ADH65667.1"
FT                   /translation="MVPHRTRLASLAGLTLVAGLVAAAPASADDASELAPLHPAPSAEN
FT                   GELTHQADGLWFIELESPPTTAGTSSAQVENEHEAFRAEAEESGLEYTERHSFGDLWNG
FT                   FSVEMDDAQVGTAREIPGVSAIYPVVTYEVPEGDTSVPDLDTALPMTGSDIAQNELGLT
FT                   GEGLRVAVMDTGVDYTHPDLGGGGFPNDRVVTGYDFVGDDFNAGDPTTVPAPDDDPQDC
FT                   HGHGTHVAGIVGARGEVTGVAPGVDFGAYKVFGCEGSTTSDIMIAAMERALADDMDVLN
FT                   MSIGSAHSWPQYPTAVASDNLVDEGMVVVASIGNEGDTGLYSAGAPGLGEDVIGVASYD
FT                   NTHIRSASATANPSGETLAYMEMGEASPPPASGETDELVHVGRGCPSLGDELEADPEGR
FT                   TALMVRGACTFAEKYDAAVAAGATGVVMYNNVPGMFAGGGIVDQGAFSIGISDTSGAHL
FT                   LELLEGDEPVTLSWTGESTTIPNPTGGLISSFSSFGLSPDLALKPDIGAPGGLINSTYP
FT                   MAKGGYATISGTSMSSPHVAGGVALLLEARPDLGAHEVRDVLQNSADPKAWWGDPDAGY
FT                   TDNVHRQGAGMMDVPGAVLATTAVTPGKLSLGATEGEVTETITIANDGDEEATYTLDHE
FT                   SALGTHGNTFTPGYNDASAEVAFDRDEVTVAPGGTAEVQVTFTPPAQDFQQMIYGGYVS
FT                   VAETGGETYRVPYAAYNGDYQQIEAMTPITDGSGNVLELPWLTRITECGAFSGLECVGE
FT                   GGGTFENQPEGAAYTLEWVDGLPDVPYVIAHFDHHVTLLEMTVVDERTGRPVHPDRNVG
FT                   VSVDHVNRSATGTSFFSYAWDGTVLDRHDRITPVRDGQYRLEARALKALGDPDNPDHWE
FT                   TWTSPVITIDRG"
FT   sig_peptide     complement(274076..274159)
FT                   /locus_tag="Ndas_0217"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            274799..275800
FT                   /locus_tag="Ndas_0218"
FT   CDS_pept        274799..275800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0218"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG0614 ABC-type Fe3+-hydroxamate transport
FT                   system periplasmic component; InterPro IPR002491; KEGG:
FT                   tfu:Tfu_0656 ABC Fe3+-hydroxamate transporter
FT                   substrate-binding protein; PFAM: periplasmic binding
FT                   protein; SPTR: C1YHR0 ABC-type Fe3+-hydroxamate transport
FT                   system, periplasmic component; PFAM: Periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65668"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUB0"
FT                   /protein_id="ADH65668.1"
FT                   /translation="MRTARHLSPVLLGAVLALTACGAPDGGEPEAEPATEAASVPCGPP
FT                   EPDPERLSVGDGTFPVTVTDATGEVTVEEAPERIVSLSASHTEMLFAIGAGDRVEAADE
FT                   YSDYPEEAPTTSLSGFEPSVEAITEYDPDLVLLARSAEATVAQLEDVGIPSLVLDAAQD
FT                   LEDTYAQIRMLGDVTGHTEEADAEAARVEDEFNAIVEGVCEETGDAGLSFYQELDETSY
FT                   SATSDTFVGQIYASFGLVNIADEADADGASGGYPQLSQEYVVEQNPDLIFLSYGDESTV
FT                   ADVAGRPAFDTVTAVRNDAVYLLDADIASRWGPRVVEFAELVGRAVTENAAD"
FT   sig_peptide     274799..274909
FT                   /locus_tag="Ndas_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            275802..276836
FT                   /locus_tag="Ndas_0219"
FT   CDS_pept        275802..276836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0219"
FT                   /product="transport system permease protein"
FT                   /note="COGs: COG0609 ABC-type Fe3+-siderophore transport
FT                   system permease component; InterPro IPR000522; KEGG:
FT                   tfu:Tfu_0657 ABC-type transporter, permease component;
FT                   PFAM: transport system permease protein; SPTR: C1YHQ9
FT                   ABC-type Fe3+-siderophore transport system, permease
FT                   component; PFAM: FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65669"
FT                   /db_xref="GOA:D7AUB1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUB1"
FT                   /protein_id="ADH65669.1"
FT                   /translation="MRGGAGFPLGWVAGGSVALLAAALLGVSAGAASLSAADIARHLLS
FT                   LLPFGAQSPLTEREAAVLVELRLPRVVMGALVGALLATAGGAYQGVFRNPLADPYLLGA
FT                   AAGAGLGATTVIVFGAQFSDSPRALVPVAAFAGALLGVAAAYLLGSTAGGGGTAALVLA
FT                   GVAVSSFLSAAQTLVQQMGVDELQRIFAWLLGGLGRGGWDDVRLVAPYAVVGLAVLLAS
FT                   GYLLDMLALGDDKAVSLGLNPAAVRIVVIGAASLATAAAVSVSGLIGFVGIVVPHVVRR
FT                   LVGSNYRAILPVTVLLGGAFLVLVDIVARTLIAPAELPIGVVTAFLGAPFFVLILRTTR
FT                   HRGT"
FT   sig_peptide     275802..275894
FT                   /locus_tag="Ndas_0219"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            276967..278151
FT                   /locus_tag="Ndas_0220"
FT   CDS_pept        276967..278151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0220"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="COGs: COG0552 Signal recognition particle GTPase;
FT                   InterPro IPR013822:IPR004390:IPR000897:IPR003593; KEGG:
FT                   tfu:Tfu_0658 signal recognition particle-docking protein
FT                   FtsY; PFAM: GTP-binding signal recognition particle SRP54
FT                   G- domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; SMART: AAA ATPase; SPTR: C1YHQ8 Signal
FT                   recognition particle-docking protein FtsY; TIGRFAM: signal
FT                   recognition particle-docking protein FtsY; PFAM: SRP54-type
FT                   protein, GTPase domain; SRP54-type protein, helical bundle
FT                   domain; TIGRFAM: signal recognition particle-docking
FT                   protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65670"
FT                   /db_xref="GOA:D7AUB2"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUB2"
FT                   /protein_id="ADH65670.1"
FT                   /translation="MDITLLVAIIIAVVLLAAGGFFLVTTRRSVEPGKDETEPEPTGAA
FT                   AGATAVEDRERDPGTVSTPPAQAPPPVRETVEPAPPELETPPPSAGRMVRLRARLARSQ
FT                   NAFGKGLLNLLSSDSLDEDTWEEIEDTLITADIGVASAAQIVENLRTRVKVLGTRGTEE
FT                   VRTLLREELLAQITTGADRAVRTGPHDGRPGVVMVVGVNGTGKTTTTGKLARVLVGDGR
FT                   SVVLGAADTFRAAATEQLETWGSRVGAPVVRKEEGADPASVAFDAVARGVEEGADTVII
FT                   DTAGRLHTKTGLMDELGKVKRVVEKKSQVDEVLLVLDATTGQNGLRQARVFGEVVNVTG
FT                   IALTKLDGTAKGGIIVQVQRELGVPVKLVGLGEGPDDLAPFDPEVFVDAILSTE"
FT   sig_peptide     276967..277053
FT                   /locus_tag="Ndas_0220"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            278655..279995
FT                   /locus_tag="Ndas_0221"
FT   CDS_pept        278655..279995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0221"
FT                   /product="ammonium transporter"
FT                   /note="COGs: COG0004 Ammonia permease; InterPro
FT                   IPR001905:IPR018047; KEGG: tfu:Tfu_0659 ammonium
FT                   transporter; PFAM: ammonium transporter; SPTR: C1YHQ7
FT                   Ammonium transporter; TIGRFAM: ammonium transporter; PFAM:
FT                   Ammonium Transporter Family; TIGRFAM: ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65671"
FT                   /db_xref="GOA:D7AUB3"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUB3"
FT                   /protein_id="ADH65671.1"
FT                   /translation="MIDSGNTAWLLISAALVMLMTPGLAFFYGGMSRAKSVLNMMLMSF
FT                   ASIAVVSVLWVVIGHSLTYSDGPGALDTFIGGLDYVGLSNLIGEIEPAAEDGTGGYPLL
FT                   VDAGFQMMFAVITVALISGAIADRAKFGAWLLFVPVWALLVYFPVAHWVWGEGWIEQLE
FT                   IGGYTVIDFAGGTAVHINAGAAALALTFVLGRRKGFGSESMRPHNLPFVLLGTALLWFG
FT                   WFGFNAGSAYAADGTAALALVNTQVATAAATGAWMLVERFRYGKVSALGFASGAVAGLV
FT                   AITPAAANVTPLGAIAVGLLSGAVCAYAISWKFKFKYDDALDVVGIHMVGGIVGSLILG
FT                   LVAAGVAGGSDGLLYGGGIGLLAVQTIAVIGVMLYSFAVTWVIAKVIHLVIGFRIPEEV
FT                   ETNGLDHELHAESAYAFDELDELEDATEAVSLPTPPGGETASPKAKA"
FT   sig_peptide     278655..278756
FT                   /locus_tag="Ndas_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            280395..281609
FT                   /locus_tag="Ndas_0222"
FT   CDS_pept        280395..281609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0660 hypothetical protein; SPTR:
FT                   C1YHQ6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65672"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUB4"
FT                   /protein_id="ADH65672.1"
FT                   /translation="MAPVSHITGRRGGRVALAAAGAVVALGLSGCSIDLSHLRPGGGGE
FT                   EEPSPEAAEPVAAAPLMEQALADLAAYPALTATGQVAESVGSADVRDASLTVADGGTAS
FT                   GTIRANGIEAELISADGRMFLRAAEDFWLDQGVFSPDFDDFDGNWVRASSAQAGFNPSV
FT                   SLAPPELSAILGGIELDSEEAVEENLDGTLTYRIDLAGERNQVWINAETSQIQRIAIEE
FT                   LVPEEAETGPQVRLDLAEAETAAVEELYDGVTAATEEELTSSRDARIEVGWEGSPSMTC
FT                   EDGPNCTWTGTVRDAGGDGSGEVAVSMAVTFSNADIGEQTCEDSGTLEAGGTLELSCSA
FT                   DYNIVSSVQQTYPIDGEAQLSTRGLTGGQQEEMLAALSEQREATLSGGASPSEEASETA
FT                   EEEGN"
FT   sig_peptide     280395..280568
FT                   /locus_tag="Ndas_0222"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            281771..283366
FT                   /locus_tag="Ndas_0223"
FT   CDS_pept        281771..283366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0223"
FT                   /product="signal recognition particle protein"
FT                   /note="COGs: COG0541 Signal recognition particle GTPase;
FT                   InterProIPR004125:IPR013822:IPR000897:IPR003593:IPR 004780;
FT                   KEGG: tfu:Tfu_0661 signal recognition particle subunit
FT                   FFH/SRP54 (SRP54); PFAM: GTP-binding signal recognition
FT                   particle SRP54 G- domain; GTP-binding signal recognition
FT                   particle SRP54 helical bundle; Signal peptide binding
FT                   (SRP54) M- domain protein; SMART: AAA ATPase; SPTR: C1YHQ5
FT                   Signal recognition particle subunit FFH/SRP54 (Srp54);
FT                   TIGRFAM: signal recognition particle protein; PFAM:
FT                   SRP54-type protein, GTPase domain; SRP54-type protein,
FT                   helical bundle domain; Signal peptide binding domain;
FT                   TIGRFAM: signal recognition particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65673"
FT                   /db_xref="GOA:D7AUB5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUB5"
FT                   /protein_id="ADH65673.1"
FT                   /translation="MFETLSDRLTSVFSSLRGKGRLSEEDINATAREIRLALLEADVAL
FT                   PVVREFIARIKERARGEEVSKALNPAQQVIKIVNEELVGILGGETRQIRFAKNPPTVIM
FT                   LAGLQGAGKTTLAGKLARWLAADRNTPLLVAADLQRPNAVTQLQVVGERAGTPVFAPEP
FT                   GNGVGDPVQVARQSVEHARRNNHNVVIIDTAGRLGVDSEMMQQAADIRDAVNPDEILFV
FT                   VDAMIGQDAVNTAQAFLDGVGYDAVALTKLDGDARGGAALSIRHITGRPIMFASTGEKL
FT                   EDFDLFHPDRMASRILDMGDVLTLIEQAQRTFDEAEVEKMASTMASDEDFTLDDFLQQM
FT                   QMVRKLGPIGNLLGMMPGMGQMREQIDSIDDKDLDRIQAVIQSMTPGERANPKMINGSR
FT                   RLRIANGSGTQVSDVNGLVTRFFEAQKMMRKMKSGGMPGMPGMPGMGGGANRKKAKAQA
FT                   KKAKKGKQRSGNPMKARQQEADRAAERQRRQEEGGQQPPQLPPGLGGGGQPTLPPGFGG
FT                   PNMPDLSNFKLPKQ"
FT   gene            283769..284233
FT                   /locus_tag="Ndas_0224"
FT   CDS_pept        283769..284233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0224"
FT                   /product="ribosomal protein S16"
FT                   /note="COGs: COG0228 Ribosomal protein S16; InterPro
FT                   IPR000307:IPR020592; KEGG: tfu:Tfu_0662 SSU ribosomal
FT                   protein S16P; PFAM: ribosomal protein S16; SPTR: C1YHQ4 SSU
FT                   ribosomal protein S16P; TIGRFAM: ribosomal protein S16;
FT                   PFAM: Ribosomal protein S16; TIGRFAM: ribosomal protein
FT                   S16"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65674"
FT                   /db_xref="GOA:D7AUB6"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUB6"
FT                   /protein_id="ADH65674.1"
FT                   /translation="MAVKLKLKRMGKIRTPQYRIIVADARTKRDGKAIEEIGKYHPKEH
FT                   PSLIEVDSERVQYWLSVGAQPSDAVKVLLRKSGDWQKFKGLPAPAPLQVAEAKDPEAKE
FT                   AAFQAALKELVLPGAEGKGKGRKSEKKADKADKPAETAETTETEKSEGEA"
FT   sig_peptide     283769..283843
FT                   /locus_tag="Ndas_0224"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            284235..284477
FT                   /locus_tag="Ndas_0225"
FT   CDS_pept        284235..284477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1837 RNA-binding protein (contains KH
FT                   domain); InterPro IPR009019:IPR004088; KEGG: tfu:Tfu_0663
FT                   hypothetical protein; SPTR: C1YHQ3 RNA-binding protein (KH
FT                   domain); PFAM: KH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65675"
FT                   /db_xref="GOA:D7AUB7"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUB7"
FT                   /protein_id="ADH65675.1"
FT                   /translation="MLEEALEHLVKGIVANSDDVQVRAKRLRKGKVLEVRVHPDDLGKV
FT                   IGRNGRTAKSLRTVIGALAGGRYVRVDLLDLHEVR"
FT   gene            284615..285127
FT                   /locus_tag="Ndas_0226"
FT   CDS_pept        284615..285127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0226"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="COGs: COG0806 RimM protein required for 16S rRNA
FT                   processing; InterPro
FT                   IPR011033:IPR011961:IPR002676:IPR007903; KEGG:
FT                   tcu:Tcur_3421 16S rRNA processing protein RimM; PFAM: RimM
FT                   protein; PRC-barrel domain protein; SPTR: C1YHQ2 16S rRNA
FT                   processing protein RimM; TIGRFAM: 16S rRNA processing
FT                   protein RimM; PFAM: PRC-barrel domain; RimM N-terminal
FT                   domain; TIGRFAM: 16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65676"
FT                   /db_xref="GOA:D7AUB8"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUB8"
FT                   /protein_id="ADH65676.1"
FT                   /translation="MRLVVGRIGRAHGVRGDVAVDVRTDDPAARFADGSVLATDPAEAG
FT                   PLTVVSTRRHSGRLLVRFEGVADRDAAEGLRGTALLVDSEDIPPLEDPDEFHDHELIGL
FT                   AAVTTGAEPVGTVADVLHHAQDLLVVTTPDGAEVYVPFVAALVPEVDVAGGRIVIDPPP
FT                   GLLDLAD"
FT   gene            285139..285903
FT                   /locus_tag="Ndas_0227"
FT   CDS_pept        285139..285903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0227"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="COGs: COG0336 tRNA-(guanine-N1)-methyltransferase;
FT                   InterPro IPR016009:IPR002649; KEGG: tfu:Tfu_0665 tRNA
FT                   (guanine37-N(1)-) methyltransferase; PFAM: tRNA
FT                   (guanine-N1-)-methyltransferase; PRIAM: tRNA
FT                   (guanine-N(1)-)-methyltransferase; SPTR: C1YHQ1 tRNA
FT                   (guanine-N(1)-)-methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N1)-methyltransferase; PFAM: tRNA
FT                   (Guanine-1)-methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65677"
FT                   /db_xref="GOA:D7AUB9"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUB9"
FT                   /protein_id="ADH65677.1"
FT                   /translation="MRIDIISIFPEYFGPLDLSLIGRARVSGLLDVRVHDLRSWTHDRH
FT                   NTVDDTPYGGGPGMVMKPEPWGEALDEVVGEGPARLILPTPSGRPFRQADAERLAKEER
FT                   LVFGCGRYEGIDSRVAADAAERMPVEEVSIGDYVLNGGESATLVMVEAITRLLPGVLGN
FT                   TESAVQDSFASGGMENLVEGAVYTKPATWRGREVPPVLLSGNHGAVDRWRRDQALRKTA
FT                   RNRPDLVEALPEEALDRRDREVLAEEAVRDAT"
FT   gene            286075..286434
FT                   /locus_tag="Ndas_0228"
FT   CDS_pept        286075..286434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0228"
FT                   /product="ribosomal protein L19"
FT                   /note="COGs: COG0335 Ribosomal protein L19; InterPro
FT                   IPR001857; KEGG: tfu:Tfu_0666 50S ribosomal protein L19;
FT                   PFAM: ribosomal protein L19; SPTR: C1YHQ0 50S ribosomal
FT                   protein L19; TIGRFAM: ribosomal protein L19; PFAM:
FT                   Ribosomal protein L19; TIGRFAM: ribosomal protein L19,
FT                   bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65678"
FT                   /db_xref="GOA:D7AUC0"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUC0"
FT                   /protein_id="ADH65678.1"
FT                   /translation="MRIREMHTAIQELEKAQLRSDVPEFRPGDTLNVHVRVTEGNRTRV
FT                   QVFKGVVIRRQGSGNRETFTIRKVSYGVGVERTFPIHTPAIEKYEVAARGRVRRAKLYY
FT                   LRDLRGKAARIRERR"
FT   gene            286527..287402
FT                   /locus_tag="Ndas_0229"
FT   CDS_pept        286527..287402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0229"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="COGs: COG0681 Signal peptidase I; InterPro
FT                   IPR015927:IPR000223:IPR019759:IPR011056; KEGG: tfu:Tfu_0667
FT                   signal peptidase I; PFAM: Peptidase S24/S26A/S26B,
FT                   conserved region; PRIAM: Signal peptidase I; SPTR: C1YHP9
FT                   Signal peptidase I; TIGRFAM: signal peptidase I; PFAM:
FT                   Peptidase S26; Peptidase S24-like; TIGRFAM: signal
FT                   peptidase I, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65679"
FT                   /db_xref="GOA:D7AUC1"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUC1"
FT                   /protein_id="ADH65679.1"
FT                   /translation="MSKDEKDLGSDGVQDEESAQPGPEEHDSATGSRAHESSGASAVSG
FT                   TDGEEPDEGADDEMSKSQSTEKKGSFWKELPVLIVIAVVLAFVIRTWLVQAFYIPSTSM
FT                   ENTLLVGDRVLVNKVVYELRDIERGEVVVFDGNGSWDDPNTVSVPEPTNPVSAAFTWVQ
FT                   QQLGAAPTGKEYIKRVIGLPGDTVECCDEQNRVLVNGVPLEEEAYLYPGSVATHTEFGP
FT                   IEVPEGHLWLMGDHRAISSDSRLNQNNPGGGAVPIDHVVGRAFVIIWPAGQIGPLSIPD
FT                   SFEELNAADE"
FT   gene            287609..287938
FT                   /locus_tag="Ndas_0230"
FT   CDS_pept        287609..287938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0230"
FT                   /product="Protein of unknown function DUF2469"
FT                   /note="InterPro IPR019592; KEGG: tfu:Tfu_0668 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2469; SPTR:
FT                   C1YHP8 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF2469)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65680"
FT                   /db_xref="InterPro:IPR019592"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUC2"
FT                   /protein_id="ADH65680.1"
FT                   /translation="MSSEDLEKYEAEMELQLYREYRDVVGLFSYVVETERRFYLTNHVD
FT                   LQPRSTENGEMYFEVVMEDAWVWDMYRPARFVRNVRVVTFKDVNVEEITKADLEMPPAE
FT                   GSGQS"
FT   gene            288091..288456
FT                   /locus_tag="Ndas_0231"
FT   CDS_pept        288091..288456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0231"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="COGs: COG0792 endonuclease distantly related to
FT                   Holliday junction resolvase; InterPro IPR011335:IPR003509;
FT                   KEGG: tfu:Tfu_0669 hypothetical protein; PFAM: protein of
FT                   unknown function UPF0102; SPTR: C1YHP7 Predicted
FT                   endonuclease related to Holliday junction resolvase; PFAM:
FT                   Uncharacterised protein family UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65681"
FT                   /db_xref="GOA:D7AUC3"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUC3"
FT                   /protein_id="ADH65681.1"
FT                   /translation="MDRWAEYRRTLGGRGEDLAAAFLRRAGMRVVARNWRIPDGEIDIV
FT                   ARDGPVLVVAEVKTRTSVRHGHPVEAITPDKRRRLRRLGHAWAVRHRVPAHPLRVDGVC
FT                   VLISGGRVFVSHERGMA"
FT   gene            288456..289979
FT                   /locus_tag="Ndas_0232"
FT   CDS_pept        288456..289979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0232"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="COGs: COG0606 ATPase with chaperone activity;
FT                   InterPro IPR020568:IPR004482:IPR003593:IPR000523; KEGG:
FT                   tfu:Tfu_0670 Mg chelatase-related protein; PFAM: magnesium
FT                   chelatase ChlI subunit; SMART: AAA ATPase; SPTR: C1YHP6 Mg
FT                   chelatase-related protein; TIGRFAM: Mg chelatase, subunit
FT                   ChlI; PFAM: Magnesium chelatase, subunit ChlI; TIGRFAM: Mg
FT                   chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65682"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUC4"
FT                   /protein_id="ADH65682.1"
FT                   /translation="MTLARTRCIALLGVQGHIVEVEVHLGGGDFGVTLVGLPDAALREA
FT                   RDRIRAAVVNSGEEWPSGQIVISLSPASLPKSGSLFDLAIAAAVLAAAGSVPVERLEDS
FT                   VLIAELGLDGRARPVLGVLPAVVSAAEQGYRRFVVARGNAAEARLVPGAEVTAVDSLMD
FT                   LCQWLRGEYFPEAHEAEAVPRPREPRGQGPDLSDVLGQPVARRAVEIAAAGGHNLMMLG
FT                   PPGTGKSLLAERLPTVLPPLSPAEALEATAIHSVAGMLPPGAPLVTAPPFAAPHHTSTR
FT                   ASIIGGGSGYPTPGWVSKAHRGVLFVDEAPQFGRGVLDSLREPLERGEVVLARASSTVT
FT                   FPARFQLVMAANPCPCAKPGALCTCPAGERRRYFSRLSGPLLDRIDLKVELQPVSRAEL
FT                   LADRAFAESSEVVAARVEKARARAAERLAHTPWTTNAAIPGAQLRREFPVETAALRVLG
FT                   RAMDLGQISARGVDRALRVAWTLADLADRDRPGEEEAAYAFALWAGRAW"
FT   gene            289976..291178
FT                   /locus_tag="Ndas_0233"
FT   CDS_pept        289976..291178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0233"
FT                   /product="DNA protecting protein DprA"
FT                   /note="COGs: COG0758 Rossmann fold nucleotide-binding
FT                   protein involved in DNA uptake; InterPro IPR003488; KEGG:
FT                   tfu:Tfu_0671 smf protein; PFAM: SMF family protein; SPTR:
FT                   C1YHP5 DNA protecting protein DprA; TIGRFAM: DNA protecting
FT                   protein DprA; PFAM: DNA recombination-mediator protein A;
FT                   TIGRFAM: DNA protecting protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65683"
FT                   /db_xref="GOA:D7AUC5"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUC5"
FT                   /protein_id="ADH65683.1"
FT                   /translation="MNTDTTEESGGTVRDAEDEADARARACLTAVAPPGDLWLGAMLAE
FT                   HGAERVWALLAAGAHPPPVPVEAGEDGPGPEAQTLLERRWARWGAAARAVDPDGLLGDS
FT                   AAAGIRFVAPRDPEWPGRLDELDLPGGRRSHGLWVRGAGDLRHLCLRSVAVVGARSATP
FT                   YGEHVAAEMAYELAERAVVVVSGGAYGIDGAAHRAAQAHGGTVVVLACGLDVDYPRGHA
FT                   GLFADVARTGVLVSERPVGATPRAPDFLVRNRLIAALTPGTVVVEAGRRSGALNTASHA
FT                   AELNRALMAVPGPVTSAMSVGCHLLLRDWNASCVTCADDVVAQVSALGELPPESGPLRV
FT                   SAELDQDSARVLAAVPRSGAGPAVIAVASGTRLERTLRSLGMLAAAGLVERCPSGWRLP
FT                   Q"
FT   gene            291485..291841
FT                   /locus_tag="Ndas_0234"
FT   CDS_pept        291485..291841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0234"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="COGs: COG0251 Putative translation initiation
FT                   inhibitor yjgF family; InterPro IPR013813:IPR006175; KEGG:
FT                   tfu:Tfu_0673 hypothetical protein; PFAM: Endoribonuclease
FT                   L-PSP; SPTR: C1YHP4 Putative translation initiation
FT                   inhibitor, yjgF family; PFAM: Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65684"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUC6"
FT                   /protein_id="ADH65684.1"
FT                   /translation="MTKPYSDALVADGPLLFVSGQTPEGPGGEVAGDIGGQTRQIFRNL
FT                   EAVLSRHGADLGHLVKLTYYLRHISDLEEFRSALLECLPDGHLPAASLVEVSGLVDPTH
FT                   LVEVEGVACLPSGR"
FT   gene            291844..292713
FT                   /locus_tag="Ndas_0235"
FT   CDS_pept        291844..292713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0235"
FT                   /product="integrase family protein"
FT                   /note="COGs: COG4974 Site-specific recombinase XerD;
FT                   InterProIPR011010:IPR010998:IPR013762:IPR004107:IPR 002104;
FT                   KEGG: tfu:Tfu_0674 site-specific tyrosine recombinase XerC;
FT                   PFAM: integrase family protein; integrase domain protein
FT                   SAM domain protein; SPTR: C1YHP3 Tyrosine recombinase XerC
FT                   subunit; PFAM: Phage integrase, N-terminal SAM-like domain;
FT                   Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65685"
FT                   /db_xref="GOA:D7AUC7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUC7"
FT                   /protein_id="ADH65685.1"
FT                   /translation="MLESFAAHLSGELGRSPHTVRGYLADLRSLLAHLEERGRSVRDLD
FT                   VDLVRGWLSRARDAGASRATVARRVAAVRAFTRFLHREGVLAADPGPRLASPAQQRSLP
FT                   TVLDERQAAAALAGETEGTPTGLRRRAVVETLYATGVRVAELCALDLADVDRERDTVRV
FT                   LGKGAKERTVPVGGPALDALDAWLSGGRPEMAGATSGSALFLGARGGRLGVRQAREDVH
FT                   AHLRAVGADSAPHGLRHSAATHLLNGGADLRSVQEFLGHASPRSTQIYTHVSVERLRDT
FT                   YRRAHPRA"
FT   gene            complement(292820..293395)
FT                   /pseudo
FT                   /locus_tag="Ndas_0236"
FT   gene            293687..294631
FT                   /locus_tag="Ndas_0237"
FT   CDS_pept        293687..294631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0237"
FT                   /product="ribosomal protein S2"
FT                   /note="COGs: COG0052 Ribosomal protein S2; InterPro
FT                   IPR018130:IPR001865:IPR005706; KEGG: tfu:Tfu_0676 30S
FT                   ribosomal protein S2; PFAM: ribosomal protein S2; SPTR:
FT                   C1YHP1 SSU ribosomal protein S2P; TIGRFAM: ribosomal
FT                   protein S2; PFAM: Ribosomal protein S2; TIGRFAM: ribosomal
FT                   protein S2, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65686"
FT                   /db_xref="GOA:D7AUC8"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUC8"
FT                   /protein_id="ADH65686.1"
FT                   /translation="MATVVTIRQLLESGVHFGHQTRRWNPKMKRFIFTERNGIYIIDLQ
FT                   KSLAYIDRAYEFVKQTVAHGGTVLFVGTKKQAQEAIDEQARRVGMPYVNQRWLGGMLTN
FT                   FSTVHKRLQRLKELEEIDFDDVAGSSLTKKELLNLRREKEKLERTLGGIRDMSRVPSAV
FT                   WIVDTKKEHIAISEARKLNIPVVAILDTNCDPDEVDYPIPGNDDAIRSVSLLTRVVADA
FT                   VADGLMARSGASEASGERKSAEEPLAEWERELLEGKADSAEAPVEAAEAAAEQAPVETA
FT                   AVAPADEVAAEAPAEATSEDSPVDAPAKAPDAE"
FT   gene            294756..295592
FT                   /locus_tag="Ndas_0238"
FT   CDS_pept        294756..295592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0238"
FT                   /product="translation elongation factor Ts"
FT                   /note="COGs: COG0264 Translation elongation factor Ts;
FT                   InterProIPR014039:IPR018101:IPR001816:IPR000449:IPR 009060;
FT                   KEGG: tfu:Tfu_0677 elongation factor Ts; PFAM: Translation
FT                   elongation factor EFTs/EF1B dimerisation;
FT                   ubiquitin-associated- domain-containing protein; SPTR:
FT                   C1YHP0 Elongation factor Ts; TIGRFAM: translation
FT                   elongation factor Ts; PFAM: Elongation factor TS; UBA/TS-N
FT                   domain; TIGRFAM: translation elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65687"
FT                   /db_xref="GOA:D7AUC9"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUC9"
FT                   /protein_id="ADH65687.1"
FT                   /translation="MANFTAADVKKLRDMTGAGMMACKKALTEADGDFDKAVEALRVKG
FT                   AKDVGKRAERTAAQGMVVLKQESEGKATLVELNCETDFVAKNDQFIALADQVADFVAAQ
FT                   DSDDLATVAAAEIEPGKTLQSFIEAKSAVIGEKLEFRRFAKFEGAYVASYLHKSDPDLP
FT                   PTMGVLVELDKADEEVGKDLAQQIAALAPQYIGRDDVPAEVVENERRIAEQTTREEGKP
FT                   EQAIPKIVEGRLNGYFKDVTLLGQPFVKENKKTVQKVVDEAGVTVKRFVRFKVGQA"
FT   gene            295603..295749
FT                   /locus_tag="Ndas_0239"
FT   CDS_pept        295603..295749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0239"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: C1YHN9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65688"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUD0"
FT                   /protein_id="ADH65688.1"
FT                   /translation="MMEVPGRLLPGTFGGYGRVAGRVSPADRIEDHSGDPVPLGDDKGG
FT                   HRL"
FT   gene            295746..296501
FT                   /locus_tag="Ndas_0240"
FT   CDS_pept        295746..296501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0240"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.22"
FT                   /note="COGs: COG0528 Uridylate kinase; InterPro
FT                   IPR001048:IPR015963:IPR011817; KEGG: tfu:Tfu_0678 uridylate
FT                   kinase; PFAM: aspartate/glutamate/uridylate kinase; PRIAM:
FT                   UMP kinase; SPTR: C1YHN8 Uridylate kinase; TIGRFAM:
FT                   uridylate kinase; PFAM: Amino acid kinase family; TIGRFAM:
FT                   uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65689"
FT                   /db_xref="GOA:D7AUD1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUD1"
FT                   /protein_id="ADH65689.1"
FT                   /translation="MNEATSTEPAMHGSGWKRVMLKLSGEAFAGGGGLGIDPEVVQYVA
FT                   ESIAEAVSEGIQVAVVVGGGNMFRGAQLTEGGIERGRADYMGMLGTVINCLALQDFLER
FT                   LGVDTRVQTAIHMSQVAEAYIPRRAVRHLEKGRVVIFGAGLGAPFFSTDTTAAQRALEI
FT                   GAQAVLKGTQVDGVYDSDPQRNPDAVKFDKLNYNEVLTRGLKVMDATAVSLCMDNGLPI
FT                   VVFDLMSQGNILRAVRGEKIGTIVGPTPV"
FT   gene            296548..297105
FT                   /locus_tag="Ndas_0241"
FT   CDS_pept        296548..297105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0241"
FT                   /product="ribosome recycling factor"
FT                   /note="COGs: COG0233 Ribosome recycling factor; InterPro
FT                   IPR002661; KEGG: tfu:Tfu_0679 ribosome recycling factor;
FT                   PFAM: ribosome recycling factor; SPTR: C1YHN7 Ribosome
FT                   recycling factor; TIGRFAM: ribosome recycling factor; PFAM:
FT                   Ribosome recycling factor; TIGRFAM: ribosome recycling
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65690"
FT                   /db_xref="GOA:D7AUD2"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUD2"
FT                   /protein_id="ADH65690.1"
FT                   /translation="MIEETLLEAEEKMEKAVTVAKEDFATIRTGRPTPATFNKITVDYY
FT                   GARTPINQLASFSVPEPRMVVISPFDVNSRTDIINAIRNSDLGVNPSDDGQVIRVVFPE
FT                   LSEERRKEYVKVARTKAEDSKVSIRNVRRRAKDTFEKAVKSGDIGEDEAHRAQAELDEL
FT                   SSKYVASVDELLKHKESELLEV"
FT   gene            297109..298044
FT                   /locus_tag="Ndas_0242"
FT   CDS_pept        297109..298044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0242"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="COGs: COG0575 CDP-diglyceride synthetase; InterPro
FT                   IPR000374; KEGG: tfu:Tfu_0680 phosphatidate
FT                   cytidylyltransferase; PFAM: phosphatidate
FT                   cytidylyltransferase; SPTR: C1YHG5 CDP-diglyceride
FT                   synthetase; PFAM: Cytidylyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65691"
FT                   /db_xref="GOA:D7AUD3"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUD3"
FT                   /protein_id="ADH65691.1"
FT                   /translation="MTLPSSSDSGGDDRSPEHRPGGGPRGGPDPDGQRFVLHKPGGEPV
FT                   RTGRNLPVAIASGCALGALVFFSIFPLPQLFTIITSLGVLIGLREVNRAFAGKGMGLAL
FT                   VPLAVGGVAMQVAAYFGGTDWLVGTTALTAIVALVWRLRGGTEGFVADVAANLFTLVYL
FT                   PFLFGTWLLLISHPEDGQYRLVTFIVVTISSDIGGYFAGILLGRHKMAPVISPNKTWEG
FT                   FGGSVVGCAVAGALCVTLMLDGPWWVGVVLGLAVVLAATVGDLIESLFKRDLGVKDMGR
FT                   FMPGHGGLMDRLDSLLIAGPVTWMVLSLLL"
FT   gene            298138..299319
FT                   /locus_tag="Ndas_0243"
FT   CDS_pept        298138..299319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0243"
FT                   /product="aminotransferase class I and II"
FT                   /note="COGs: COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase; InterPro
FT                   IPR015424:IPR015421:IPR004839:IPR001176; KEGG: tfu:Tfu_0568
FT                   aminotransferase; PFAM: aminotransferase class I and II;
FT                   SPTR: C1YHG4 Succinyldiaminopimelate aminotransferase;
FT                   PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65692"
FT                   /db_xref="GOA:D7AUD4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUD4"
FT                   /protein_id="ADH65692.1"
FT                   /translation="MEEPLIERMRVYGETVFAEMTRLAVETGSVNLGQGFPDTDGPRSL
FT                   LEAASGHILEGVNQYPPGPGRPELRRAVSRYRARHYGIELDPDTEVYVTVGATAGIAAA
FT                   VLALVERGDEVIVFEPMYDSYAAMITLAGGVRRPVTLRPDPVSGRFTFDPAELRAAVGP
FT                   RTRMVLVNTPHNPTGTVFTAEELEEVARVCREHDLIAFTDEVYEFLTFDGRPHVPLATL
FT                   PGMRERTLSVSSVGKMFAVTGWKTGWVMGPEPLVSAVRTVNQFLTFSANGALQLATADA
FT                   IDQEEEWVAAQRTALQGKRDRLVEGLTGAGFEVDACEGTYFVMADIRPLGYADGVEVAR
FT                   ALPREAGVAAVPAQVFYDHREEGAHLLRFAFCKRDEVLDEAVARLSGWHARGR"
FT   gene            complement(299364..300791)
FT                   /locus_tag="Ndas_0244"
FT   CDS_pept        complement(299364..300791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0244"
FT                   /product="amino acid permease-associated region"
FT                   /note="COGs: COG0531 Amino acid transporter; InterPro
FT                   IPR004841:IPR002293; KEGG: svi:Svir_20300 amino acid
FT                   transporter; PFAM: amino acid permease-associated region;
FT                   SPTR: C1YHG3 Amino acid transporter; PFAM: Amino acid
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65693"
FT                   /db_xref="GOA:D7AUD5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUD5"
FT                   /protein_id="ADH65693.1"
FT                   /translation="MSDNSQSFVRVLGRGDVLALGFGAMIGFGWIVLVGDFVSAAGSAG
FT                   AALAFVIGGVIMAFVGLAYAELVAAMPHAGGEHHYAMRAIGPKGAFTASWAMILGYVSV
FT                   VAFEAVAVPQTLVYLFPDMAVGRLWTVAGYDVHAGLVAVGVAAAVLMTAVNYVGIKPAS
FT                   VFQTIAVLFLLLTGAAMVTGAFVGGSVDNMRPLFTGGAPGMFVVLVAVPFLFVGFDVIP
FT                   QSASEIRLPYRVVGTLLVLSVFCATAWYVMVMLTAGSGLGPAELADSELASADAVAAMW
FT                   DSATMGNLLVLGGVAGLLTSWNAFLIGGSRLIYAMAASRMLPAWFGRLHPRFRTPSNAV
FT                   LFVGALSLVSPFFGEPMLGWLVNAGGLNIVVGFVTVVVSFLVLRRREPAMERPFTVPAG
FT                   VPVGVVALVLSVGLLLLYLPGMPAALSWPNEWLMVLVWWVAGAALMWRLPRITAGPDAE
FT                   RRLVEVMDARSRPDPRA"
FT   sig_peptide     complement(300672..300791)
FT                   /locus_tag="Ndas_0244"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(301042..301704)
FT                   /locus_tag="Ndas_0245"
FT   CDS_pept        complement(301042..301704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0245"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="InterPro IPR016181:IPR000182; KEGG: sro:Sros_7218
FT                   GCN5-related N-acetyltransferase; PFAM: GCN5-related
FT                   N-acetyltransferase; SPTR: C1YHG2 Acetyltransferase (GNAT)
FT                   family protein; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65694"
FT                   /db_xref="GOA:D7AUD6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUD6"
FT                   /protein_id="ADH65694.1"
FT                   /translation="MASTEIRTFREDDRAELRALFARAGEGSPSGTLWGHLPSEAAIYL
FT                   DPYMDHVPESLLVALVDGRMAGYLTGCPDPSAMPGESELMDRAIREHRLALRRGPAAFF
FT                   ARALLDTAVSALRRRPAAGELSDPRWPAHLHVNVESRARGTGVGAALVREWQDRLREQG
FT                   SRGCHLQTLVENTGAVRFFARAGFEPHGPAPVVPGVRFEGGHVHQRTMVWSPSASRS"
FT   gene            complement(301922..304441)
FT                   /locus_tag="Ndas_0246"
FT   CDS_pept        complement(301922..304441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0246"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /note="COGs: COG0296 1 4-alpha-glucan branching enzyme;
FT                   InterProIPR017853:IPR014756:IPR013783:IPR013781:IPR
FT                   013780:IPR004193:IPR006047:IPR006048:IPR006589:IPR006407;
FT                   KEGG: tfu:Tfu_0582 glycogen branching enzyme; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; alpha amylase all-beta; SMART: alpha
FT                   amylase catalytic sub domain; SPTR: C1YHG1
FT                   Alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase;
FT                   TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM: Alpha
FT                   amylase, C-terminal all-beta domain; Carbohydrate-binding
FT                   module 48 (Isoamylase N-terminal domain); Alpha amylase,
FT                   catalytic domain; TIGRFAM:
FT                   alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65695"
FT                   /db_xref="GOA:D7AUD7"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUD7"
FT                   /protein_id="ADH65695.1"
FT                   /translation="MTSPRSEQRPRASAAKTATNGKNPKKKAVESIPVVEEVSVAETAA
FT                   AVEPAAGKPAGGKAAKAVRKAATAGTGEKAPAASKGRASANGRAAAKGRAATNGRAATA
FT                   KPPAASRRKGPDPELVAALDRLVDGHHHDPHALLGVHAEGRGTVVRALRPGAVEVHAVL
FT                   ADGSRLRLDHLHRGVFSAKVSRSRLGSVPDYRISARYEDGAEHVAADPYRFAPTLGELD
FT                   LHLIGEGRHEELWNALGAHVRVEDTAMGEVAGTRFAVWAPDARGVRMIGDFNHWSGVGH
FT                   PMRSLGSSGVWELFVPGIGEGGLYKFQVLGADGHWRDKADPMARCTQMPPATASVVTSS
FT                   THVWSDQEWMAERKGVEQHRAPMSVYEVHLGSWRPGLGYAELAEELVAYVTDMGFTHVE
FT                   FLPVAGHPYDGSWGYQVTSYYAPTPRFGTPDEFRHLVDALHRAGVGVLLDWVPAHFPKD
FT                   EWALARFDGSALYEHPDPRRGEHPDWGTLIFNYGRTEVRNFLVANALYWLEEFHVDGLR
FT                   VDAVASMIYLDYSRDSGAWEPNVFGGRENLEAIDFLKELNTTVYRRNPHVAMIAEESTA
FT                   YTGVTTPVDHGGLGFGFKWNMGWMHDTLEYVKKEPVHRQYHHDDVTFSMVYAYSENYVL
FT                   PLSHDEVVHGKQSLFNKPPGDEWQRSATLRALLAFMWSHPGKQLLFMGGEIAQGDEWSH
FT                   REGVPWWLLQFEHHAGVQRLVRTLNEAYRPRAALWSQDTEPAGFTWLDGGDREGNTLSY
FT                   LRHGDDGSVLACAVNFSPVPRTGRRMGLPSGGRWNAVLNTDEARFGGSDHPAPARVDAE
FT                   PVPWDGQPFSAEVVLPPLGAVWFEPGS"
FT   gene            complement(304532..305920)
FT                   /locus_tag="Ndas_0247"
FT   CDS_pept        complement(304532..305920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0247"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="COGs: COG3281 Uncharacterized protein probably
FT                   involved in trehalose biosynthesis; InterPro IPR002575;
FT                   KEGG: tfu:Tfu_0583 putative pep2 protein; PFAM:
FT                   aminoglycoside phosphotransferase; SPTR: C1YHG0
FT                   Uncharacterized protein, probably involved in trehalose
FT                   biosynthesis; PFAM: Phosphotransferase enzyme family;
FT                   TIGRFAM: trehalose synthase-fused probable maltokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65696"
FT                   /db_xref="GOA:D7AUD8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR040999"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUD8"
FT                   /protein_id="ADH65696.1"
FT                   /translation="MSQLEELLAVWLPRQRWFSGKGIPIRQIRVESRYTLVTSGPDGPD
FT                   LNVLVLQAGQRGRSSRYQVLLGSRPPRSLPPDLARVAIGVCQVAGGRPRVVYDAAHDEE
FT                   LTRMLLERFAAPTGAEPSGKVRFRSLPGDSVRTGSSGRLLTGEQSNTSLVFGEDYILKT
FT                   FRRLWPGPNPDLELNMALSGTPYVARPCGWIEADLAGHSTPTTLAMLQTYIPHATDGWV
FT                   LATANVRALLEGPGDGRESAFTDEAAQLGRTTAEVHRSLARTLPTDVLTPTGAAEMADA
FT                   MVERLAMASAEVPELAEHAPRVMEAYADFSEVDEPLPIQRIHGDYHLGQAIRTASGWVL
FT                   LDFEGEPTVPVRDRQRLSSPLRDVAGMLRSFDYAAGYLLIGHPGDPGLEWAARSWARHN
FT                   REAFCRGYADGGGADPEKHLAVLRAFEFDKAVYEVLYEARNRPNWLRVPLESIATAAAP
FT                   PVPG"
FT   gene            complement(305922..307970)
FT                   /locus_tag="Ndas_0248"
FT   CDS_pept        complement(305922..307970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0248"
FT                   /product="trehalose synthase"
FT                   /EC_number="5.4.99.16"
FT                   /note="COGs: COG0366 Glycosidase;
FT                   InterProIPR006589:IPR012810:IPR006047:IPR013781:IPR 017853;
FT                   KEGG: tfu:Tfu_0584 trehalose synthase; PFAM: alpha amylase
FT                   catalytic region; SMART: alpha amylase catalytic sub
FT                   domain; SPTR: C1YHF9 Trehalose synthase; TIGRFAM: trehalose
FT                   synthase; PFAM: Alpha amylase, catalytic domain; TIGRFAM:
FT                   trehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65697"
FT                   /db_xref="GOA:D7AUD9"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUD9"
FT                   /protein_id="ADH65697.1"
FT                   /translation="MSKDEPGPGGHGHAEHGPLAPATGAATGPLMSSGGTSDPHWYKHA
FT                   VFYEVLARGFFDSNGDGTGDLAGLVQKLDYLQWLGIDCVWLLPMYESPLRDGGYDISDY
FT                   FKILPEFGRTADFVELLDEAHRRGIRVITDLVMNHTSDQHPWFKASREDPDGPYGDFYV
FT                   WSDTDDRYDEARIIFVDTETSNWTYDEVRGQYYWHRFFSHQPDLNFENPAVQEAILEVL
FT                   RYWLDLGIDGFRLDAVPYLYEREGTNCENLKETHEFLKRVRAEVDRLYPDRVLLSEANQ
FT                   WPSDVVDYFGDFESGGDECHMNFHFPLMPRMFMAVRQEQRFPISEILAQTPPIPRNCQW
FT                   AIFLRNHDELTLEMVTDEERDYMYSEYAKEPRMRANVGIRRRLAPLLDNDRNQIELFTA
FT                   LLLSLPGSPVLYYGDEIGMGDNIWLGDRDAVRTPMQWSSDRNAGFSKGDPARLYLPLIM
FT                   DPVYGYQALNVESQRDNPGSLLHWTRRMIQIRKRHPVFGTGAFTELNATNPSVLAFIRE
FT                   HGDDRMLCVNNLSRYPQPVELDLGRYAGVAPVECVGGVRFPEIGELPYLLTLPGHGFYW
FT                   FQLPTTADRESAGTNRDGMPSYGLPEAGARVHAAFETSPVSAAAARTHAPDHPVSTTSS
FT                   IPAGFSPAFGDGARTPSHGSAVRASGLSGPAAERTGRGGGEKGNGSL"
FT   gene            complement(308080..310050)
FT                   /locus_tag="Ndas_0249"
FT   CDS_pept        complement(308080..310050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0249"
FT                   /product="alpha amylase catalytic region"
FT                   /note="COGs: COG0366 Glycosidase; InterPro
FT                   IPR017853:IPR013781:IPR006047:IPR006589; KEGG: tfu:Tfu_0585
FT                   alpha amylase domain-containing protein; PFAM: alpha
FT                   amylase catalytic region; SMART: alpha amylase catalytic
FT                   sub domain; SPTR: C1YHF8 Glycosidase; PFAM: Alpha amylase,
FT                   catalytic domain; Domain of unknown function (DUF3416)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65698"
FT                   /db_xref="GOA:D7AUE0"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUE0"
FT                   /protein_id="ADH65698.1"
FT                   /translation="MIGRLPILDISPENDLGPVKAVPGERFTVGATVIREGHDSLAAGV
FT                   VVYSPEGRREQLVPMREHAPGTDRYEACVSLPTEGTWSFAVESWTDPFATWHHVAGVKL
FT                   PLGQDTELVLEEGARLLARAGRRVPRRPFLNAAAKALRDTSMTPVERFEAALTPEVLAE
FT                   MERAPLRELVTRSKRTSVVVHRERALFGSWYEFFPRSEGAQVDTAPGQELSGTLATAAK
FT                   RLPAIADMGFDVVYLPPIHPVGTTHRKGANNALTAGPGDPGSVWAIGSADGGHDAVHPD
FT                   LGTLADFDAFVAEAREHGMEIALDLALQCSPDHPWVTEHPEWFTARADGSIAYAENPPK
FT                   KYQDIYPLNFDRDFEGLYAEVLRVVEHWIAHGVRVFRVDNPHTKPVAFWQKLLADVADR
FT                   HPDVLFLAEAFTRPAMMRTLAKVGFHQSYTYFTWRNGKDELTDYLTELSRESAHYLRPN
FT                   LFANTPDILHAYLQHGGRPAFAVRAVLAALLSPTWGVYSGFELCENTPAGPGSEEYLDS
FT                   EKYQYRPRDWAAAEASGETLTGLITLLNRLRREHPALRELRNLRFHHVDRPEIVCFSKH
FT                   RPGTGPKDPDDAVIAVVNLDPHHAREATVHLDLPSIGLTREEEFRVTDELTGRSYTWGA
FT                   DNYVRLDPAAGPAHVFTVSGR"
FT   gene            310786..313464
FT                   /locus_tag="Ndas_0250"
FT   CDS_pept        310786..313464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0250"
FT                   /product="glycosyl transferase family 51"
FT                   /note="COGs: COG0744 Membrane carboxypeptidase
FT                   (penicillin-binding protein); InterPro
FT                   IPR012338:IPR001264:IPR001460; KEGG: tfu:Tfu_0109 PASTA;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase; SPTR: C1YHF7 Membrane
FT                   carboxypeptidase (Penicillin-binding protein); PFAM:
FT                   Penicillin binding protein transpeptidase domain;
FT                   Transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65699"
FT                   /db_xref="GOA:D7AUE1"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUE1"
FT                   /protein_id="ADH65699.1"
FT                   /translation="MTESNQRPPRGRRHEAPRRNWRGALSRAVPAAAGPRVRRWAEALR
FT                   RKVSEPTPAGDRRETVQRLAGTGAVAGLLTAALVMPWVGGLGLAARDSAAAFMALPSDL
FT                   AVPHPAERVLLTDVDGEPIAEVAERERDVVPLDEISPWVPAALMAIEDDRFYEHAGLDL
FT                   RGTLRAAVRTVLGNTQGGSTITQQYVKNLLMEQADTEEELASANARTLTRKVLELRYAI
FT                   ELEEKLTKDEIMEGYLNLAYFGQNAYGIEVAAERYFSVPASELDPAQAATIVALVRAPS
FT                   YYDPLTNPEASVERRNLVLDRMVATGHLESAQAQEYKSRGLEVDETPRAGSCFSSEQPF
FT                   FCDYVMRWLGGSDALAGTQEERDRILERGGITVRTTLDLDMQEAAEQAIERYVPAGDSH
FT                   KFAAEVLVEPGTGRVRVMAQNMRYGFDDEPGTTSINLSVDHEDGGSLGYQAGSTFKPFT
FT                   LAAALDAGLKYDTSFSSPESTTVSGLENCEGGRMAPWDVRNAGESDGGRHNMISGTKGS
FT                   VNTYFAQLQERVGLCETAEMAQSLGIHRADGEDLQVWSSFTLGDQEVSPLTMASAYAVF
FT                   ASRGTYCEPVPVASVLFEGEDGEEVEMGTECEEGALDTEVADGVNHLLQQTFEGGTANG
FT                   LEIGRPVAGKTGTTDSAAYAWFAGYTPNLAGTVVVGDIRGGEQHTLQGVTIGDRYYGIV
FT                   YGATLPGPIWQATMREAVADLPEEEFAPSPKVYGKASDKPSGGGGDNGDSDDSDAGGGD
FT                   GGTAGGDGGVAAGGGGGGTGGGGGAGGDDGSTGGGGTGDGGGGATGGGGGGSTGGGGGT
FT                   GGGGGSTDGGGGTGDGDGGGSTGGGGGTGGGGGGGGDGSGTGGGGGGTGGGESPGGDGG
FT                   APWGGATPGPQAPEGGASPGG"
FT   gene            313743..314360
FT                   /locus_tag="Ndas_0251"
FT   CDS_pept        313743..314360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0251"
FT                   /product="ABC-type thiamin-related transport system,
FT                   permease component 1, predicted"
FT                   /note="COGs: COG4721 membrane protein; InterPro IPR017195;
FT                   KEGG: tfu:Tfu_0587 ABC transporter, permease protein; PFAM:
FT                   ABC-type thiamin-related transport system, permease
FT                   component 1, predicted; SPTR: C1YHF6 Predicted membrane
FT                   protein, COG4721; PFAM: ABC-type cobalt transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65700"
FT                   /db_xref="GOA:D7AUE2"
FT                   /db_xref="InterPro:IPR017195"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUE2"
FT                   /protein_id="ADH65700.1"
FT                   /translation="MKRDTTPQGAGFRRDLLGRLRSWRTVDIVVASVIGVAVGVVFWLW
FT                   NIVWSVTTPLFVGFPPAQAVVYGMWLISGVLGGLIIRKPGAALLTAIAAASVSALLGTQ
FT                   WGIMVILDGALQGILPELVFLAFGYRRWGMGVAVLAAAVAGVSPAIRDNLAYNVTWPLS
FT                   YQVTYGVIVVVSAALIAGVGSRLLTTALARSGALAPFPSARG"
FT   gene            314363..315988
FT                   /locus_tag="Ndas_0252"
FT   CDS_pept        314363..315988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0252"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1123 ATPase components of various ABC-type
FT                   transport systems contain duplicated ATPase; InterPro
FT                   IPR017871:IPR003439:IPR003593; KEGG: tfu:Tfu_0588 ATPase;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; SPTR:
FT                   C1YHF5 Cobalt transport protein ATP-binding subunit; PFAM:
FT                   ABC transporter; TIGRFAM: cobalt transport protein
FT                   ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65701"
FT                   /db_xref="GOA:D7AUE3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUE3"
FT                   /protein_id="ADH65701.1"
FT                   /translation="MASANGRRTAAGGPGARVELSGWGWRHSGRGSHALRGVDLVIEPG
FT                   ERVLLLGASGAGKSTLLHSLAGLTGEDAAISGDHEGTLLVDGEPADRSRGSVGLVSQDP
FT                   ETQLVMARAGDDVAFGPENLGVAPDLIWPRVHEALEAVGFPYGPRHPTGALSGGEKQRL
FT                   VIAGALAMRPRLLLLDEPTANLDPAGAALVRGVLARLLAETEATLVLVEHRVADVVDLV
FT                   DRVVVVAPGGGVVADGPPGTVFAEHGRSLAAQGVWVPGHEPAPVLAPAPGGEPLLEAVG
FT                   VTARTPSQLGVRAAPRRTVFEGVDATVRAGTATALTGPNGAGKSTLLTLLAGLSRPHRG
FT                   AVLPRGPLAGADPRPLVRWPARRLARHVGTVFQHAEDQFVTATVRDELRFAPLRAGMGE
FT                   AETEAWVGELMERLRLSALADVHPYTLSGGEKRRLSVATALSSGPAHAPDALVLDEPTF
FT                   GQDTRTWTELVELLATLRSAGRAVVMATHDDLLLRSLADARVRVAGGRAVQEAAAPGAG
FT                   AEPPGPPEPTGPAGHAAAGRGSRG"
FT   gene            315981..316922
FT                   /locus_tag="Ndas_0253"
FT   CDS_pept        315981..316922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0253"
FT                   /product="cobalt transport protein"
FT                   /note="COGs: COG0619 ABC-type cobalt transport system
FT                   permease component CbiQ and related transporter; InterPro
FT                   IPR003339; KEGG: tfu:Tfu_0589 ABC-type cobalt transport
FT                   system; PFAM: cobalt transport protein; SPTR: C1YHF4
FT                   ABC-type cobalt transport system, permease component CbiQ;
FT                   PFAM: Cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65702"
FT                   /db_xref="GOA:D7AUE4"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUE4"
FT                   /protein_id="ADH65702.1"
FT                   /translation="MADRRPSDTPGKGTRTPDGIREADEVPRAPDELREPEGVHGPDEV
FT                   GASAEARGSGGVSAPAGDALTLEAPEDGGARFWLVGLNPAAKLLAALLLGVGLVPAVDA
FT                   VTGGTVLAGVLLLLPFSGTDRRTLLVLGGPFLLMGLSSGLVNYLYGEHGAEGALGAAVR
FT                   LLAIALPGLLAAVSSDPTETADGLVQRLRVPERPAMGVLAALRLVPMLADQWRTITLAR
FT                   RARGLEAGRNPVRAVTLFFGRLFALLVRSIRTGTLLAAAMDARAFGTGPRTRARESRWR
FT                   TADTLLLAGAALLLAAAYTLSARLGTLVLLFS"
FT   gene            316980..317768
FT                   /locus_tag="Ndas_0254"
FT   CDS_pept        316980..317768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0254"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /EC_number="4.2.1.17"
FT                   /note="COGs: COG1024 Enoyl-CoA hydratase/carnithine
FT                   racemase; InterPro IPR018376:IPR001753; KEGG: tfu:Tfu_0590
FT                   short chain enoyl-CoA hydratase; PFAM: Enoyl-CoA
FT                   hydratase/isomerase; SPTR: C1YHF3 Short chain enoyl-CoA
FT                   hydratase; PFAM: Enoyl-CoA hydratase/isomerase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65703"
FT                   /db_xref="GOA:D7AUE5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUE5"
FT                   /protein_id="ADH65703.1"
FT                   /translation="MGEFVRVETDPDHPAVAVIRLDRPKVNALNAALTAEIAEAATRVA
FT                   KDPDVRAVVVYGGERVFVAGADIKEMADLTAAQMLGYARDLQNALNLVARIPKPVVAAV
FT                   TGYALGGGLELALAADFRVAGAGARLGVPEIQLGVIPGAGGTQRLPRLIGPSRAKEMIF
FT                   SGRHVKADEAREIGLVDQVVPDEEVYRAAVALVARYAGGPAVALAAAKEAVDRGLETDL
FT                   DTGLEIERLHFAGLFSTEDQKDGMRSFVEQGPGKAAFKGR"
FT   sig_peptide     316980..317099
FT                   /locus_tag="Ndas_0254"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            318177..320441
FT                   /locus_tag="Ndas_0255"
FT   CDS_pept        318177..320441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0255"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterProIPR008271:IPR011009:IPR017442:IPR017441:IPR 000719;
FT                   KEGG: tfu:Tfu_0592 tyrosine protein kinase:serine/threonine
FT                   protein kinase; PFAM: Serine/threonine-protein kinase-like
FT                   domain; SPTR: C1YHF2 Protein kinase family protein; PFAM:
FT                   Protein kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65704"
FT                   /db_xref="GOA:D7AUE6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUE6"
FT                   /protein_id="ADH65704.1"
FT                   /translation="MGEELPERIGHYVIRRRIGQGGMGVVYQAEDPRTEQFVAVKVLKP
FT                   EVAGDQIARARLAREVETMRRVHSPNVAEVIEADTQAELPWVVTEHIPGPTLDATVTNH
FT                   GPLRGRALTRFVTGMARAIRDIHAVDVIHRDLKPGNVIISNGEPIVIDFGIAHAVDGAK
FT                   LTQTGTFVGTPSYLSPEVIEGTDLGPATDIHAWGGTVAFASTGRPPYGAGTFEVIFFRI
FT                   LNGEIDMDGMHEALRPLVNRAVSRDMRSRPTAEELLEEASRLNLDLPWTEDAGGRPSGL
FT                   TGSHTVYHPTTAGGTGEEPGSGGPGGAAAAGAAGAALGGAAGYLAGRAAQGDQGWGPPH
FT                   TGGGPASSAWSPSGDPARPTSAAHSGGLLDDPGSTDDLSGAANGRRVDDPESTDDLSGA
FT                   RRGWGDEDDGLPGTERIAPRDAGDPDDPQGTMRISPVRDEPDDALGTRHIQPDEFSRED
FT                   PQGTMMMDPVDRDGYARRPVDEREDEGYQAPHTQFFNTPLHKGDFADILTPVDDGRGSN
FT                   QTQEFDEDGYEERRGGLLGRFRRGGNDRVSDYFQDDSDEEGEEYEERSWRMHPLTILPM
FT                   LVSVAGVSLLFPWFGLILGVVLIAALGALDVVKAEHARRLQTRGPRSSDNMVVALSFPW
FT                   AFGRMALRTLGFGLVYLLAGILVGMIYARIADVPGQGANYTGAFAIFVMILLSYVMPSG
FT                   REARHQAVWLVRRVHYRNLYVYIGVCIGLVLLTMLILSFGLSAAPDWVPIGGPSDWFDG
FT                   Q"
FT   gene            320902..321681
FT                   /locus_tag="Ndas_0256"
FT   CDS_pept        320902..321681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0256"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="COGs: COG2086 Electron transfer flavoprotein beta
FT                   subunit; InterPro IPR014729:IPR014730:IPR012255; KEGG:
FT                   tfu:Tfu_0593 electron transfer flavoprotein, beta subunit;
FT                   PFAM: Electron transfer flavoprotein alpha/beta-subunit;
FT                   SPTR: C1YHF1 Electron transfer flavoprotein, beta subunit;
FT                   PFAM: Electron transfer flavoprotein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65705"
FT                   /db_xref="GOA:D7AUE7"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUE7"
FT                   /protein_id="ADH65705.1"
FT                   /translation="MNIVVLVKQVPDTATERKLNPDDKTLDRAASDGVINELDEYAIEE
FT                   ALQLKEKHGGEVTILTMGPDQATDSIRKALSMGADKAVFVNDAALHGSDSLQTAYALAQ
FT                   ALGTIEFDVVVLGSESTDARTGVVGAALAEYLGLPQLTFARKVDIDGSTIRIQRQTDYG
FT                   YDLVEAQLPAVVSVVEKINEPRYPSFKLIMQAKKKPVDKKSAADAGIDTARVGLANATT
FT                   ETVDFDAAPPRAAGTVVKDEGDGAAKIAEFLVEKKFV"
FT   gene            321716..322660
FT                   /locus_tag="Ndas_0257"
FT   CDS_pept        321716..322660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0257"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="COGs: COG2025 Electron transfer flavoprotein alpha
FT                   subunit;
FT                   InterProIPR018206:IPR014729:IPR001308:IPR014730:IPR 014731;
FT                   KEGG: tfu:Tfu_0594 electron transfer flavoprotein, alpha
FT                   subunit; PFAM: Electron transfer flavoprotein alpha subunit
FT                   ; Electron transfer flavoprotein alpha/beta-subunit; SMART:
FT                   Electron transfer flavoprotein alpha/beta-subunit; SPTR:
FT                   C1YHF0 Electron transfer flavoprotein, alpha subunit; PFAM:
FT                   Electron transfer flavoprotein domain; Electron transfer
FT                   flavoprotein FAD-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65706"
FT                   /db_xref="GOA:D7AUE8"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUE8"
FT                   /protein_id="ADH65706.1"
FT                   /translation="MAEVLVLVDHVDGQVKKVTTELLTAARRIGEPAAVWIGDGAETGR
FT                   GTLAEYGAEKVYVASAELNDHVVAPKAELLAKLAQDKGAAAVLVSATAENKEIAGRTAV
FT                   KLGSGVLTDVVDVNAEVVAEHSIFGGTTITHARVRTGVPVVAVRPNSVPAEAASGAAAE
FT                   EQVSVEVSDAAKTAKVVERVHEEQGERPELTEAAIVVSGGRGVGSDDFSVVENLADSLG
FT                   AAVGASRAAVDSGWYPNQFQVGQTGKTVSPNLYVALGISGAIQHRAGMQTAKNIVAINK
FT                   DPEAPIFELADFGVVGDLHAVTPQLTEEINKRK"
FT   gene            322784..323662
FT                   /locus_tag="Ndas_0258"
FT   CDS_pept        322784..323662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0258"
FT                   /product="DNA polymerase LigD, polymerase domain protein"
FT                   /note="COGs: COG3285 eukaryotic-type DNA primase; InterPro
FT                   IPR014145:IPR002755; KEGG: sco:SCO6498 hypothetical
FT                   protein; PFAM: DNA primase small subunit; SPTR: C1YHE9 DNA
FT                   polymerase LigD, polymerase domain; TIGRFAM: DNA polymerase
FT                   LigD, polymerase domain protein; TIGRFAM: DNA ligase D; DNA
FT                   polymerase LigD, polymerase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65707"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUE9"
FT                   /protein_id="ADH65707.1"
FT                   /translation="MATETAKVRAGRRVVEVRRPGKPLFGEGGATKEDLARYHARIAPL
FT                   MLPHVRDRPVALARFPDGIDAQGFFVKHPSVPDWVATVETSGGRMMLCQDAAALVWCAD
FT                   QAAVTLHAWQSREPRLGLPDRMVIDLDPAGDGPEAFAACRAAARDVREVLDDLGLAAYV
FT                   MTSGSRGLHVRSPLRPEADDQEVRVLAEAVADRVAARRPEELTTEVRKAARGDRLFVDY
FT                   LRNGREQLAVVPYSVRARPGAPIAAPLTWEDLEKVETARDLTIDLEREKCPFAGMGRHA
FT                   RSPRRALERLG"
FT   gene            complement(323678..324079)
FT                   /locus_tag="Ndas_0259"
FT   CDS_pept        complement(323678..324079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: svi:Svir_19520 hypothetical protein; SPTR:
FT                   C1YHE8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65708"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUF0"
FT                   /protein_id="ADH65708.1"
FT                   /translation="MNQDEAAENVQEHIDKAVTVLPETLELQPVGGVNVAACDDPTDGG
FT                   SGDRVTVGRSYWLDGLPVEDNEANIDLLTEYWTANGYRVLTDSRPDDVFVSVENEEDAF
FT                   RMSVQASVEGHLSIGASSPCVWPEGTPDS"
FT   gene            complement(324192..325856)
FT                   /locus_tag="Ndas_0260"
FT   CDS_pept        complement(324192..325856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0260"
FT                   /product="protein of unknown function DUF1023"
FT                   /note="InterPro IPR010427; KEGG: svi:Svir_19530 alpha/beta
FT                   hydrolase of unknown function (DUF1023); PFAM: protein of
FT                   unknown function DUF1023; SPTR: C1YHE7 Putative
FT                   uncharacterized protein; PFAM: Alpha/beta hydrolase of
FT                   unknown function (DUF1023)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65709"
FT                   /db_xref="InterPro:IPR010427"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUF1"
FT                   /protein_id="ADH65709.1"
FT                   /translation="MSDLSSMSLGLPEDIAADVGAIETGADQLDAVRQNMLGQSEGTHS
FT                   RFRSSAGEFTDLVAWNIVSSSSQELSSWQEAAASLTYGAAVLRQWGLDIETYRAERAKL
FT                   ETRWEEEKADAEAAVGASEGSGSILGEGTREGMKVAQLETLRAELLSEHSGHWETLMEQ
FT                   AEQTERDLRDGPSQDSLERLIESSLLTGGQLSYFGDAVPSMVPDELSGDEHPSVVNLWW
FT                   TSMTEEEQDQAVRDHPELLRELDGIPAAVRDRLNRDHLDDEIERFEEEIAERDEEIGEA
FT                   AARGSNGSDAIALAMANDDTLDNQLQELKELRESLEDESADRYLLALDTGGDGRAIVAN
FT                   GNPDTADNVATLVPGTTTTWESINDQMGRADALADSANRVSRDQDHSVISWIGYDAPNV
FT                   PEAAFEGRAEDAVSELSSFQDGLRSTHQGPPSHNTVIGHSYGSTVVGHTAQSDAGLDTD
FT                   EVILVGSPGTNADHVTDLNLPAENVHVSTAENDGITNLTGLTHGMDPTDPEFGANVFES
FT                   DPGSEGGTWPLGDAHSEYFDENTSSLRHMGSVIAGQE"
FT   gene            complement(325897..326223)
FT                   /locus_tag="Ndas_0261"
FT   CDS_pept        complement(325897..326223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0261"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lca:LSEI_1094 Zn-dependent protease; SPTR:
FT                   C1YHE6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65710"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUF2"
FT                   /protein_id="ADH65710.1"
FT                   /translation="MSGSTGVNPVDAMSEAQEAEALAEAMVFLGTDFEAAVEGLTGAVS
FT                   EHVTGGLDDYGLDTMEHIRRVAQNGINLAQNVQGADLAITDTDHENAEEYQEGLESLDI
FT                   QINF"
FT   gene            326518..327783
FT                   /locus_tag="Ndas_0262"
FT   CDS_pept        326518..327783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0262"
FT                   /product="protein of unknown function DUF21"
FT                   /note="COGs: COG1253 Hemolysins and related protein
FT                   containing CBS domains; InterPro
FT                   IPR000644:IPR002550:IPR005170; KEGG: tfu:Tfu_1263 CBS;
FT                   PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; SMART:
FT                   CBS domain containing protein; SPTR: C1YHE5 CBS
FT                   domain-containing protein; PFAM: CBS domain; Domain of
FT                   unknown function DUF21; Transporter associated domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65711"
FT                   /db_xref="GOA:D7AUF3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUF3"
FT                   /protein_id="ADH65711.1"
FT                   /translation="MEGIGAQIGLVLVLVVVNAVFAGSEIALITLREGQIRRLEERGPG
FT                   GRAVARLARDPNRFLATIQIGITLAGFLASATAAVSLARPLVEPLGFLGSYAAPVSVVL
FT                   VTVVLTFVTLVLGELAPKRIAMQRAEPWALLVARPLNALALLSRPAIWLLSASTDLVVR
FT                   LGGLDPHGAREEATEEELRDMIEAQGHMTPEQRTILSGAFDITGRTLRQVLVPRPDVDT
FT                   VPADLPACETALLLAEHGHSRAPVVGRDDVDDVVGVVHWSDLLRGEGAARELAREPLLL
FT                   PDSLTVSAALHRLTVERQQLAVVIGESGEVSGIVSLEDLLEEVVGEIYDETDTDERAPA
FT                   RLDGGALRLPGVYPVHELEDLGVVLTDRPRGSYVTVAGMVLVLLGHIPDEPGESVDLGG
FT                   WTATVTEADGRVVSELLLTPAR"
FT   sig_peptide     326518..326583
FT                   /locus_tag="Ndas_0262"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            327910..329394
FT                   /locus_tag="Ndas_0263"
FT   CDS_pept        327910..329394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0263"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterPro IPR016161:IPR015590:IPR016160:IPR016162; KEGG:
FT                   art:Arth_1894 betaine-aldehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase; SPTR: C1YHE4 4-hydroxybenzaldehyde
FT                   dehydrogenase; PFAM: Aldehyde dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65712"
FT                   /db_xref="GOA:D7AUF4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUF4"
FT                   /protein_id="ADH65712.1"
FT                   /translation="MHADRRPDAYTGLDRMPIGDQWRHGSSGSVVQDVDPYDDTVLTEF
FT                   RLADEGDVDLAYREAQRAWPGWAATPAAERAEVFVRALRVLDARREEIVDWLVHEAGAI
FT                   RERAEFEWGLVRSGMVEVTSYPTRVMGRILPGITPGKENRVYREPLGVVTVISPWNFPF
FT                   QLSHRSLAPAVALGNTVVLKPAENTPVTGGLLLARIYEEAGLPPGVVNVVVGRGGEIGD
FT                   ALATHELCRMISFTGSTEVGRHIARQAPLTRRALELGGNGPLVVLEDADLDLAADAAVF
FT                   GSYYHQGQICMATNRVVATAAVHDELVERMLVRARALRVGDPSDPATRIGPVIDDEHCA
FT                   GVRDVVERSVEQGARLLLSGEPTGPAGRVLPPHLLLADNSAPSAAEEVFGPVATVIRAE
FT                   GEEDALRIANDTEYGLSSAVHTRDAERGVRFARRLRAGMTHVNDSTLNDEANTAFGGEN
FT                   HSGIGRFGGEWAMEEFTADHWVSLQHTRRRMPFGPE"
FT   gene            complement(329533..330291)
FT                   /locus_tag="Ndas_0264"
FT   CDS_pept        complement(329533..330291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0264"
FT                   /product="Methyltransferase type 11"
FT                   /note="InterPro IPR013216; KEGG: tfu:Tfu_2465 hypothetical
FT                   protein; PFAM: Methyltransferase type 11; SPTR: C1YHE3
FT                   Methylase involved in ubiquinone/menaquinone biosynthesis;
FT                   PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65713"
FT                   /db_xref="GOA:D7AUF5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUF5"
FT                   /protein_id="ADH65713.1"
FT                   /translation="MTANAAEEGTVPFRATLGRSVRLFTAFRVEQTDPAFFYGTLARDT
FT                   VAQLRSYTPLDGRLVVDVGGGPGYFADELRAAGARCLCVDADAHEMTLHGRDADAYGVQ
FT                   GSALDLPLRSGSVDVCFSSNVLEHVPDRTRMADEMVRVTRPGGLVYLSYTLWLSPWGGH
FT                   ETSPWHYLGGAYAAERFARRHGRRPKNDFGRTMYAAHAGEMLRWTRGRTDVDVVDVRPR
FT                   YLPGWARPVVRVPLLREVVTWNLLLVLRRR"
FT   gene            complement(330288..331061)
FT                   /locus_tag="Ndas_0265"
FT   CDS_pept        complement(330288..331061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0265"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013216;
FT                   KEGG: tfu:Tfu_2464 methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; PFAM:
FT                   Methyltransferase type 11; SPTR: C1YHE2 Methylase involved
FT                   in ubiquinone/menaquinone biosynthesis; PFAM:
FT                   Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65714"
FT                   /db_xref="GOA:D7AUF6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUF6"
FT                   /protein_id="ADH65714.1"
FT                   /translation="MFRRVASTVEVMRVGLEQVRRDWTRLGSTEPLWAVCVDPAKRGGG
FT                   WDDDEFLASGRADIDPSVARLEELGIRPEGGRVLDFGCGAGRLSNALAAHFPEVVGVDI
FT                   SAPMLEEARRLDRSGGRIEFVLNERPDLSVFGDASFDLVYTDLVLQHLPPVLAEGYVRE
FT                   FARVLRPGGAMVLGVPESERRTFKGLVFRYAPWPLVALAQRVLLRYPAPMRMHTLRTER
FT                   IAELVPGGRIAASDEYWGGDHWRHLRHFVVSEAGT"
FT   gene            331196..333256
FT                   /locus_tag="Ndas_0266"
FT   CDS_pept        331196..333256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0266"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2463 hypothetical protein; SPTR:
FT                   C1YHE1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65715"
FT                   /db_xref="GOA:D7AUF7"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUF7"
FT                   /protein_id="ADH65715.1"
FT                   /translation="MPPVPPTARGHDGPGAEAARPGPVGAPRVRRPSEEPPGKGPGPGG
FT                   TVRAAWAAARRLARDRLALVGLAVVLGAVGLRAYVLGESYFVEDDYLFFANAHASDLGP
FT                   DYLLTLHKGHLMPGALFLVYLQTALWPYEWWVSAGTMLALQAAALVGFLRLVWELFGRR
FT                   WALLVPLTVYALAPLTVPVLGWWSAALNAVPLQLALVLAVLWTVRYLRTDDHRLAWRAG
FT                   GAVVFGMLFTVKAMFLPPVLFAVAVAHLYPGGLVAGARRAWALHRPFWTAMGALLAAYA
FT                   VFYLVRMRAAGGGEGAGVPQSEPALTMLRGLLTEVFPVGALGGPLEWGPVTPTGGLVDV
FT                   PGVTVLAAWAVFAVIVLVSLRMRRGAWRAWALLLAYLVVVDVIPTIIARGRFQDVAAAD
FT                   PRYVADAALVFALCLALAYLPTREERARALVGGASSAPVGGEPYRVRPRRAARVAAALA
FT                   TAVYAVAAGYSTHAYAQTLSGDRLQWYLDTVRTALADVPEEGGLYARPVPEDVVLEWNG
FT                   QRRLSSWVLPPLASDDVAERMAAPEEAATAYVFNDAGFLVPARPSDDSDMFAPGPADEC
FT                   LEPWEGLVSWPVQAHGGVAQVVTLGYTAEEDVGVVVALGDDWIEVELPAAEENGTWYVP
FT                   AGAPGEQLSVFVPEDPEDRGGLCLNWVSVGGMAPTVEGNPWAPEEDDRAGS"
FT   gene            complement(333253..334572)
FT                   /locus_tag="Ndas_0267"
FT   CDS_pept        complement(333253..334572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0267"
FT                   /product="acyltransferase 3"
FT                   /note="COGs: COG1835 acyltransferase; InterPro IPR002656;
FT                   KEGG: tfu:Tfu_2458 putative acyltransferase; PFAM:
FT                   acyltransferase 3; SPTR: C1YHE0 Predicted acyltransferase;
FT                   PFAM: Acyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65716"
FT                   /db_xref="GOA:D7AUF8"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUF8"
FT                   /protein_id="ADH65716.1"
FT                   /translation="MAPTSSSAPGDPAAGAHFASARTPDPSLVLPQVDGRHESLDGVRA
FT                   VAALMVLVFHVATETGDSLAPGVLGGLLSAFDVAVPLFFALSGVLLYRPWARAALDGTR
FT                   GPRARPYLWRRAVRVLPAYWLVAVTALLVYSRDELGSLRYWWEVLTLTFPFNTDPPWVG
FT                   TGPYGLGQMWSLSVEVSFYLLLPLFGLVLALWARGGRSVDARGRRLLAGLGVMALLGLA
FT                   ALVPQFYPEPREYMHAWLPRAAGLFAVGMALAVLSEWAWREPGADGPVRRLCRTLGSSP
FT                   GVCWLVAGGFFALKATEASGGRFIGSGDIWTSAVDSLAGIGFAFFLIAPCALAPRPAGP
FT                   ALPLREARAWRGGRWLDSLLRHRVCQFLGRISYGVFLWQFMVLYLWRDFTGQEIFTGSF
FT                   WLDAVPVTIGTVLLAAASHRWVEEPSRRWSQRLSRGRSSA"
FT   gene            334745..335668
FT                   /locus_tag="Ndas_0268"
FT   CDS_pept        334745..335668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2459 hypothetical protein; SPTR:
FT                   C1YHD9 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF3068)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65717"
FT                   /db_xref="GOA:D7AUF9"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUF9"
FT                   /protein_id="ADH65717.1"
FT                   /translation="MRRTVAVVLVAFGVFFLAFAPMMRTWLSSSLMKTPLDYYSETVLE
FT                   ADGATYFNIEDVELVEDAALEARSTIRADVASSTDETVVWDQFTWVRDAETDFGITSSS
FT                   RRAGHDRVTGEAVDCCDSMVNDESVAQSGQAWKFPFFTEQRDYDFYETTAREVVPMEFQ
FT                   GIEEVGGVEAYRFVQEVEDEVIGERTLPRSVAGMEGEGDVTGDEVFSITRTYWIEPVTG
FT                   SPLKIGEDQNRVVVVDGEEVLTLFDAELVSNDESVQNAVANSEQGRTVLPLLQTTLPVV
FT                   CLVVGVGFIGVAVVLFVTGRRRDHHH"
FT   sig_peptide     334745..334804
FT                   /locus_tag="Ndas_0268"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            335741..336709
FT                   /locus_tag="Ndas_0269"
FT   CDS_pept        335741..336709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0269"
FT                   /product="UbiA prenyltransferase"
FT                   /note="COGs: COG0382 4-hydroxybenzoate
FT                   polyprenyltransferase and related prenyltransferase;
FT                   InterPro IPR000537; KEGG: tfu:Tfu_2460 phosphoribose
FT                   diphosphate:decaprenyl-phosphate phosphoribosyltransferase;
FT                   PFAM: UbiA prenyltransferase; SPTR: C1YHD8
FT                   4-hydroxybenzoate polyprenyltransferase-like
FT                   prenyltransferase; PFAM: UbiA prenyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65718"
FT                   /db_xref="GOA:D7AUG0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUG0"
FT                   /protein_id="ADH65718.1"
FT                   /translation="MTERTRATGPSAAGAPRGDGGTVGALVRACRPRQWLKNLLVLAAP
FT                   AAAGALTQTGALLTSAAVFALFCAAASGTYLLNDVHDARRDRAHPRKRHRPVASGALPV
FT                   PVAVAAGTALSAAAPLASLALGDPVLSALVAGYVLLTLVYTRYLRDLVVCDLVAVAACH
FT                   VLRAVAGGVAVGVPLTSWFVIVVSLAALLVVVGKREAELRASGAAIAGNGDAPAGAVAA
FT                   AAAVRPALRGYSTAYLSQTRTMASGAMIVTYCLWALEPGDGPRTVFHALSIVPFIMFVL
FT                   RYNLLVDRGVGEEPEEIALRDRPLQLILCGLAALVAAGIHL"
FT   gene            336706..338073
FT                   /locus_tag="Ndas_0270"
FT   CDS_pept        336706..338073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0270"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="COGs: COG0277 FAD/FMN-containing dehydrogenase;
FT                   InterPro IPR016166:IPR016168:IPR006094; KEGG: tfu:Tfu_2461
FT                   putative oxidoreductase; PFAM: FAD linked oxidase domain
FT                   protein; SPTR: C1YHD7 FAD/FMN-dependent dehydrogenase;
FT                   PFAM: D-arabinono-1,4-lactone oxidase; FAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65719"
FT                   /db_xref="GOA:D7AUG1"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUG1"
FT                   /protein_id="ADH65719.1"
FT                   /translation="MNPPPDRPVLLRGWGRTAPTAARVVRPRTPAQVAEALARAGERGA
FT                   LPRGLGRSYGDAAQDAGGLVLDCTGLTGPVRVDAERGEVTAPAGTSVDALLAHLLPRGL
FT                   FVPVTPGTRRVTLGGAVAADVHGKNHHTDSSLGAHLRSLTLVTPDGRTRRLGPEPGGDP
FT                   DLFWATVGGMGLTGVVTEATLGVLPVRTAYMRVDTDRTPDLEATLELMARPGHRYSVAW
FT                   LDLFARGDGLGRGVVTRAHHAETGDLPEPLRRDPLRYRNTSLPVPPLTPPAATLNRWTV
FT                   GAFNALEHGRAPRRRRGRIQPVGGYFHPLDALDGWNRLYGRHGAVQYQFVVPFGAQDVL
FT                   EWIAGELSRTRAPSFLAVLKRMGRPTPGPLSFPRSGWSLAVDLPADLPGLGPLLHRFDE
FT                   RVAGAGGRLYLAKDSRASPEAVHAMYPGLPAWRRVRGRADPDGVLVSDLARRLRLL"
FT   sig_peptide     336706..336804
FT                   /locus_tag="Ndas_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            338152..338904
FT                   /locus_tag="Ndas_0271"
FT   CDS_pept        338152..338904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0271"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG4221 Short-chain alcohol dehydrogenase of
FT                   unknown specificity; InterPro
FT                   IPR016040:IPR002198:IPR002347; KEGG: tfu:Tfu_2462 putative
FT                   short chain dehydrogenase; PFAM: short-chain
FT                   dehydrogenase/reductase SDR; SPTR: C1YHD6 Short-chain
FT                   alcohol dehydrogenase; PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65720"
FT                   /db_xref="GOA:D7AUG2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUG2"
FT                   /protein_id="ADH65720.1"
FT                   /translation="MRDSVGAVRSVLLLGGRSEIGLAIVERLVREGAREVVLAARGGVS
FT                   SPPGALTALGARTHSVDFDAGLPDTHTGTVAAAVELVGDLDVVVDAFGVLGEQSGYEAD
FT                   PAAAARAAAVNYTGHVSADLAVAARLREQGHGTLVVLSSVAGVRVRRFNFVYGSAKAGL
FT                   DGFAQGLADSLHGSGARVLVVRPGYVPTRMSAHVAPAPFPATPGQVADAVSAGLRSGAT
FT                   TVWAPRVLQPIFAGMRLLPRPLWRRLGR"
FT   gene            complement(338942..340366)
FT                   /locus_tag="Ndas_0272"
FT   CDS_pept        complement(338942..340366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0272"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COGs: COG2211 Na+/melibiose symporter and related
FT                   transporter; InterPro IPR016196:IPR011701; KEGG:
FT                   sro:Sros_8054 Na+/melibiose symporter and related
FT                   transporter-like protein; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: C1YHD5 Na+/melibiose
FT                   symporter-like transporter; PFAM: Major Facilitator
FT                   Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65721"
FT                   /db_xref="GOA:D7AUG3"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUG3"
FT                   /protein_id="ADH65721.1"
FT                   /translation="MTAAADSAASGGTGPGGAAVGGAAPEAAARSTVGGPGAPLPRSVH
FT                   AWYGSGAVATGIFNTVPGLLLLIYLTDTLAVSPALAGAVVLLPKVVDLLVSPYIGIWSD
FT                   RTRSPWGPRRPWMLAGALTLPVLFAAMFAGPPLKGGSAAVYVAAVFVAAALASSVFQVP
FT                   HTAMPGEITSDYHERSTFNTWRTAFVGLALMLGGALAPVVQSAPADPVAGYRLMGLLMG
FT                   CVVLVSMLGSVVGTRRAPRPVFAHRTEGLAAQLRVAFAHRHFRVLFPANLLMATAGGTM
FT                   VAGVPYVTANVMGEPGYTSVLMVCVLVPLIASAPLWRWLSLRVDKRRAAGYAAAVFALG
FT                   GLGLLLIPIWGLPGAVLSSVLVGVGLSGTTLLPWSMLADCLATADASGRRQGGVLSGVW
FT                   TAGEAMAQSVGTGLLSLALAVSGYVESGAGEAVRQSDEALRGMLVGSTLVPAAVMLCCL
FT                   VPLAFYRLTAEEAGPR"
FT   sig_peptide     complement(340280..340366)
FT                   /locus_tag="Ndas_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(340363..341373)
FT                   /locus_tag="Ndas_0273"
FT   CDS_pept        complement(340363..341373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2448 hypothetical protein; SPTR:
FT                   C1YHD4 Putative uncharacterized protein; PFAM:
FT                   Uncharacterized protein conserved in bacteria (DUF2236)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65722"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUG4"
FT                   /protein_id="ADH65722.1"
FT                   /translation="MKRFDLRDEIHHLDHEADCVRIMQILNSQEFPWDMGRALGIALYR
FT                   TYAVPSIGELLGRTDEFTGSTQKRYDDTALILNNMMRYGFEPGQGRDALRRMNQMHRSY
FT                   DISNDDYRYVLSTFVVMPVRWINDRGYGWRRLSQHEISAITHYYRRLGRYMGIKDIPET
FT                   YEQFRELLDSYEREHFAYTEGGRAVSDATLDLMVSFYPRRVSGLARKFSMAILDESLIE
FT                   TFRYEPPSRAWRRAADLALRLRALVVRRMKPREEPLWAEDNPNIRSYPKGYDVNRIGTF
FT                   PAGCPVAHDVDPVGHEELYGDGGGEGGAAPEGREAPRTARSAAAPEATTSADGRV"
FT   gene            complement(341462..342448)
FT                   /locus_tag="Ndas_0274"
FT   CDS_pept        complement(341462..342448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2448 hypothetical protein; SPTR:
FT                   C1YHD3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65723"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:D7AUG5"
FT                   /protein_id="ADH65723.1"
FT                   /translation="MKRFEWRDRIHALDAEDDCEQIVRILGSHEFPWDIEQALGLALYR
FT                   TYAVPSIGELLAHTREFTERTQHRYDDTALILNDIMEHGFGPGRGRDALRRMNQMHRSY
FT                   DISNDDYRYVLSTFVVMPVRWINDHGYGWRRLSDHEIAASTNYYRKLGRHMGIKDIPET
FT                   YAGFLELFDSYEREHFAYTEGGRAVSDATLGLMVDLYPAWQRPVVRPFTKALLDDRLIR
FT                   AFGYPEPSAAWRRLSAGALRLRARVVRLMPPRREPRWARMSPNIRSYPQGYDPSRIGTF
FT                   PQGCPVPHGMVTREVAATGARVPAPDQAVAPAGGEAPAGSAGEDAER"
FT   gene            complement(342686..343267)
FT                   /locus_tag="Ndas_0275"
FT   CDS_pept        complement(342686..343267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0275"
FT                   /product="protein of unknown function ATP binding protein"
FT                   /note="COGs: COG2229 GTPase; InterPro IPR004130; KEGG:
FT                   tfu:Tfu_2447 putative ATP/GTP-binding protein; PFAM:
FT                   protein of unknown function ATP binding; SPTR: C1YHD2
FT                   Predicted GTPase, COG2229; PFAM: Conserved hypothetical ATP
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65724"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV63"
FT                   /protein_id="ADH65724.1"
FT                   /translation="MASSDSDDTQAPVPAALKILVAGGFGAGKTTMVGSVSEIAPLSTE
FT                   EVMTEASYGIDDLSGVEAKTTTTVALDFGRITINDHLVLYLFGTPGQERFWFMWEELSE
FT                   GALGAVVIADTRRLETCFAAVDFFERRGVPFVVAVNCFEGAHRYEPEEVRTALSLDPAI
FT                   PVVLCDARERESAKAVLVTLVNRVAERMAA"
FT   gene            complement(343248..343691)
FT                   /locus_tag="Ndas_0276"
FT   CDS_pept        complement(343248..343691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0276"
FT                   /product="protein of unknown function DUF742"
FT                   /note="InterPro IPR007995; KEGG: tfu:Tfu_2446 hypothetical
FT                   protein; PFAM: protein of unknown function DUF742; SPTR:
FT                   C1YHD1 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF742)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65725"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV64"
FT                   /protein_id="ADH65725.1"
FT                   /translation="MQAHNELPPEEDPHGLPQRDAVGGFDEGAAVGQQDAGPLVRPYVI
FT                   AQGREHADTVQLDMISVVIAAKRAEVDEMALEPEQIRILELCRRPQSVAEVSAHLDIPV
FT                   AVVKVLLSDLLNRGLALARAPYTAKSPVSRDVLQAVLDGIQRL"
FT   gene            complement(343700..344155)
FT                   /locus_tag="Ndas_0277"
FT   CDS_pept        complement(343700..344155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0277"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="COGs: COG2018 Uncharacterized distant relative of
FT                   homeotic protein bithoraxoid; InterPro IPR004942; KEGG:
FT                   tfu:Tfu_2445 hypothetical protein; PFAM: Roadblock/LC7
FT                   family protein; SPTR: C1YHD0 Uncharacterized conserved
FT                   protein; PFAM: Roadblock/LC7 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65726"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV65"
FT                   /protein_id="ADH65726.1"
FT                   /translation="MTSTPESAQRDSGSGAGKKDIDWLLDELLDRAVGSRHAIVLSADG
FT                   LLIGRSRELVKEDAEHLSAVASAFQSLARGTGRHFGGGEVLQTVVEMESAYLFVTGAGR
FT                   GACLAVLAEESADVGLIAYEMNVLVEQVGRYLDAAPRREGASGEATR"
FT   gene            complement(344158..346722)
FT                   /locus_tag="Ndas_0278"
FT   CDS_pept        complement(344158..346722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0278"
FT                   /product="putative sensor with HAMP domain"
FT                   /note="InterPro IPR003594:IPR003660; KEGG: tfu:Tfu_2444
FT                   ATP-binding region, ATPase-like; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   SPTR: C1YHC9 HAMP domain-containing histidine kinase; PFAM:
FT                   HAMP domain; Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; Nitrate and nitrite sensing"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65727"
FT                   /db_xref="GOA:D7AV66"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV66"
FT                   /protein_id="ADH65727.1"
FT                   /translation="MQAVPERRGRSITSRIRAMVMIPTTALVVLWLVLTAALAGDAVIQ
FT                   ILRANATDELVTPAAVGLVDVMRERSQTIAHIENPGDAQIEGQLAEARESTDASLGEVV
FT                   GELIGFADIAPGESGHHIEMLHAQYGEIGAIRSAVDAGEASRADVLDYYNELILHGADS
FT                   FDSQAREGDLGNAVSSSFTATYMFRTVDLFAQSDAQVARAFATDELTLEDQRRFTELVG
FT                   SYESTLAANGHYLGGEGQEARLENLLASQEYADLQRMQDEIIDRQATTETVTDPVTLVP
FT                   SEVQDLSMPVDYAAWDESYDHVLSELTAIGADEALYAADVTRAQANQAVFLAVAGSLGV
FT                   GVVTVAAFLLARRSSHTLTERLLRLREDSNDMAEHRLPDLMRRLHAGEQVDTCTAVPQL
FT                   AADDDELGDVARAFNTAQRAAVNAAVQQIELRQGVNRVFLNIAHRSQTLVHRQLRLLDR
FT                   MEREQEDPEQLAQLFKLDHLATRSRRNAENLLILGGEAPGRTWHRPMPLIDVLRGAISE
FT                   SGDYTRVKRERIARVHLNGPAVADVIHLVAELVDNAAMFSPPHTHVRLSSEDVPNGVTV
FT                   EIEDRGLGMTESEFASANALLSSPPEFDVMRLNEKMRLGLFVVSHLAHRHGIRVHLRPS
FT                   PYGGVQAIVLLPHELISGDRSPLPSDESGEHVWDVREILDRTPGGELSSGRRVKPVLTS
FT                   VSAPKEEAPDREDEDSGDSAGGEGDDTVTAEAAEAPAGGADLLDADGDRPSLPTRTPLP
FT                   TRTPSVSAVPDPSAAEPPAMVEAGGGRPPLPKRRPQENLAPQLAADPQSGPATAGGSSS
FT                   NAAQDGQERLARLRRNMSAFQKGTDRGRREGKQQTNDTDKDA"
FT   sig_peptide     complement(346606..346722)
FT                   /locus_tag="Ndas_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            347193..348293
FT                   /locus_tag="Ndas_0279"
FT   CDS_pept        347193..348293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0279"
FT                   /product="putative glycopeptide antibiotics resistance
FT                   protein"
FT                   /note="KEGG: sen:SACE_2926 putative glycopeptide
FT                   antibiotics resistance protein; SPTR: C1YHC8 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65728"
FT                   /db_xref="GOA:D7AV67"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV67"
FT                   /protein_id="ADH65728.1"
FT                   /translation="MGQPTGGGALAVEAAVAGVPLLVACAAALYLSLQYRRYGRPHGWP
FT                   GLCTAAALATGAGLAAYAVWPLPASVDGLCADPLGGGRSDRELLPAPGEAGILALFLAV
FT                   GLLARHRFRRGAAFTVLLGAALAAAVVAVRATGLLGLYPCAYAEVPPGLVAWGAAATLL
FT                   GWLLARWALPAGYARGWPAAVADRAVPGPVRRLTGALLDLGLWWFGAAALAVSAHALGA
FT                   EGPGTGTRTTALLCLGGALALVPALTRRDRATPGAASVRLALRDRGYPAPAARWRVLTR
FT                   TCLLQGPVVVLLALGLPWYALAVAAVHVSSALVRPDGAGAADLLCGVRVCARATLDGAL
FT                   PSRLVRYSAPRGEPLSARPGSPAAAP"
FT   sig_peptide     347193..347270
FT                   /locus_tag="Ndas_0279"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(348256..348651)
FT                   /locus_tag="Ndas_0280"
FT   CDS_pept        complement(348256..348651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2443 hypothetical protein; SPTR:
FT                   C1YHC7 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF3592)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65729"
FT                   /db_xref="GOA:D7AV68"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV68"
FT                   /protein_id="ADH65729.1"
FT                   /translation="MATLYPLIPLLAGVVMLWAVTRDTRLELRLRRHGMRAKARVIGYH
FT                   ETSTASRMIVQFRTEDGHEVHAEHENTGWTASRAGEIVTVAYDPDTPERARIVSAPWLS
FT                   HYVRVLFGGLGAILVFTGLLLGYLAWR"
FT   gene            complement(348668..349324)
FT                   /locus_tag="Ndas_0281"
FT   CDS_pept        complement(348668..349324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0281"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="COGs: COG1309 Transcriptional regulator;
FT                   InterProIPR001647:IPR012287:IPR015893:IPR011075:IPR 009057;
FT                   KEGG: sco:SCO2100 transcriptional regulator; PFAM:
FT                   regulatory protein TetR; SPTR: C1YHC6 Transcriptional
FT                   regulator, TetR family; PFAM: Bacterial regulatory
FT                   proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65730"
FT                   /db_xref="GOA:D7AV69"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV69"
FT                   /protein_id="ADH65730.1"
FT                   /translation="MSASTSDHPVSGRREATRRRLFEAAVTLISEQGYGATTVDEIAER
FT                   AGVAKGTVYYNFGGKGELYAALMEWGVTRLADTLKDAVPPPGAGAAPRDALAAVLRAGV
FT                   VFIGEHESLARLLMAEAWRTNRAWYATILQIRNKAIGVITGLLDDLAAEGSLRPDLDTG
FT                   LAGSALFGMVVTVALDWRTLQPGRPVEEVHATLARMVGGLVGPSGSPDRTSTPDT"
FT   gene            complement(349384..351492)
FT                   /locus_tag="Ndas_0282"
FT   CDS_pept        complement(349384..351492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0282"
FT                   /product="YhgE/Pip C-terminal domain protein"
FT                   /note="COGs: COG1511 membrane protein; InterPro
FT                   IPR017500:IPR017501; KEGG: sma:SAV_6105 hypothetical
FT                   protein; SPTR: C1YHC5 YhgE/Pip-like protein; TIGRFAM:
FT                   YhgE/Pip C-terminal domain protein; YhgE/Pip N-terminal
FT                   domain protein; TIGRFAM: X-X-X-Leu-X-X-Gly heptad repeats;
FT                   YhgE/Pip C-terminal domain; YhgE/Pip N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65731"
FT                   /db_xref="GOA:D7AV70"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV70"
FT                   /protein_id="ADH65731.1"
FT                   /translation="MAGRRRSRPLVRPLAVPRLGLLTVRSFLRSPLPAAALAALLLIPL
FT                   LYSGMYLWSFWDPFGRMERLPVALVNEDEPVEVGDREVDAGGELADTLLERGDLDWHLV
FT                   SAREAARGVADGTYYVSLTIPSDFSADLTSPSRDRESPSPATLEAHYNDSNSFIVRQLA
FT                   GSAFREIQEAAAASAINGYLDQIFLGFNEIHGRTEEAAEGADELSGGAGEAEEGSSELS
FT                   GGVGEAHTGAGELSGGLDQLYAGSQDLASGAATASEEVSAQVDKLDALADEWLPQLEED
FT                   IPSLQEHAGNAAEVTAALSAALEELPEVDTGALEEVDGRLAAYLEEHPELETEDPDLYT
FT                   LLCDLQEALDVAGSAAGFVEDNRDAITATAEDAAALSAEAAALSEDLPAMVERAEDARE
FT                   RADELDEGLAELAEGSAQLRDGLAESADGAGDLDEGLGELSGGADELHSGLEELASGSD
FT                   ELAEGLDEGADQVPTYSEQGRDDASSTMSRPVRLDSAVSNEAPDYGTGFTPFFVPLSLW
FT                   VGAMVVFMVLPALSSRALASSAPSWRVALAGRVAPLLLGVGQVLVMMAALHLLLGLEAG
FT                   NWPLLIAFLVLTAAAFAATVQYLNVAFGAAGRVVALALLVLQLTSAGGTYPIETSPAFF
FT                   QAVGPFLPLHWGVTALRHMIGGGDPDLVRAAFGVMALWLVVPLLLTWWTVERKRVWTMG
FT                   ALHPALKL"
FT   sig_peptide     complement(351379..351492)
FT                   /locus_tag="Ndas_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(351479..352333)
FT                   /locus_tag="Ndas_0283"
FT   CDS_pept        complement(351479..352333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0283"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439; KEGG: sro:Sros_1517
FT                   ABC-type multidrug transport system ATPase component-like
FT                   protein; PFAM: ABC transporter related; SPTR: C1YHC4
FT                   ABC-type multidrug transport system, ATPase component;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65732"
FT                   /db_xref="GOA:D7AV71"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV71"
FT                   /protein_id="ADH65732.1"
FT                   /translation="MRRATGARVQAEGVGLATREGPVYTDVGFTARPGTLTVFRADSGG
FT                   GRSALLLTLTGRMRPSEGTLYVDGHALPRHARRVRRISSLGLMDEVNPLDERLRVREHL
FT                   SEGLLLRMRPAARSLADEAMEAAGLGGLDRRSLVRELSMVERRRLGLALALLAEPRLLA
FT                   VDDVDGGLEPGHQADLWRTLKALSDEGLTVVATCADSGELAEVAGPDTQGPIPLRQDAG
FT                   DPSGSGAGSPSASATGTGGAGSPGGASAAGPGTGGRRGRHRRHVGLDILRGGREEGGDR
FT                   GRA"
FT   gene            352535..353311
FT                   /locus_tag="Ndas_0284"
FT   CDS_pept        352535..353311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0284"
FT                   /product="Deoxyribonuclease V"
FT                   /EC_number="3.1.21.7"
FT                   /note="COGs: COG1515 Deoxyinosine 3'endonuclease
FT                   (endonuclease V); InterPro IPR007581; KEGG: tfu:Tfu_1400
FT                   endonuclease V; PFAM: Endonuclease V; PRIAM:
FT                   Deoxyribonuclease V; SPTR: C1YHC3 Endonuclease V; PFAM:
FT                   Endonuclease V"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65733"
FT                   /db_xref="GOA:D7AV72"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV72"
FT                   /protein_id="ADH65733.1"
FT                   /translation="MSEISERVARVLDDPENWPRDPKEAVALQRRLADRVRVEPLDVDA
FT                   VRLVAGLDVSYSTDNTALSAAAVVMDVRTLEVVESVAISSEPSFPYISGLFGFRESPPV
FT                   LEALGQLKVTPDVYLCDGFGLAHPRRFGVACHLGVLLDLPVVGSAKSVLFGRHSVPGEE
FT                   RGSWTPMVAGRSEVVPDSFALADQGKEVLGRVLRTRRGVKPVYVSVGHRVDLEGAAELV
FT                   LRLSPKYRVPEPVRHADKLCGEHRKAVLAAKEGRTD"
FT   gene            complement(353524..354963)
FT                   /locus_tag="Ndas_0285"
FT   CDS_pept        complement(353524..354963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0285"
FT                   /product="IMP dehydrogenase family protein"
FT                   /EC_number="1.1.1.205"
FT                   /note="COGs: COG0516 IMP dehydrogenase/GMP reductase;
FT                   InterProIPR013785:IPR001093:IPR000644:IPR005991:IPR 018529;
FT                   KEGG: tfu:Tfu_2440 inosine 5-monophosphate dehydrogenase;
FT                   PFAM: IMP dehydrogenase/GMP reductase; CBS domain
FT                   containing protein; PRIAM: IMP dehydrogenase; SMART: CBS
FT                   domain containing protein; SPTR: C1YHC2 IMP dehydrogenase
FT                   family protein; TIGRFAM: IMP dehydrogenase family protein;
FT                   PFAM: CBS domain; IMP dehydrogenase / GMP reductase domain;
FT                   TIGRFAM: inosine-5'-monophosphate dehydrogenase; IMP
FT                   dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65734"
FT                   /db_xref="GOA:D7AV73"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR005991"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV73"
FT                   /protein_id="ADH65734.1"
FT                   /translation="MRFLNDKAPQQDLTYSDVFMVPNRSSVGSRLSVDLSSPDGTGTTI
FT                   PLVVANMTAVAGRRMAETVARRGGVAVIPQDIPLDVVSDVVSWTKKRHLVYDTAITLNP
FT                   SSTVGEALNLLPKRAHNAVIVVDGDRRPVGVVTEADCAGTDRFAQLRDVMSAELMTIPA
FT                   GTEPREAFGMLHDFRHRLAPVVDGNGALVGVLTRTGALRSTLYTPAVDADGRLRVAAAV
FT                   GINGDVTGKAAELLEAGVDTLVIDTAHGHQEKMLTAVSKVRALSPRVPIVAGNIVTAQG
FT                   TRELIEAGADIVKVGVGPGAMCTTRMMTAVGRPQFSAVLECAEAARELGGHVWADGGVR
FT                   HPRDVALALAAGASNVMVGSWFAGTYESPGDVMRDAEGRQYKESFGMASARAVRLRTAE
FT                   DSPFERARKALFEEGISTGRMYLDPERPGVEDLIDQIVAGVRSSMTYAGASSLAEFHER
FT                   AVVGVQSAAGYNEGRPVPTSW"
FT   gene            355189..356139
FT                   /locus_tag="Ndas_0286"
FT   CDS_pept        355189..356139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0286"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="InterPro IPR000462; KEGG: tfu:Tfu_2439 hypothetical
FT                   protein; PFAM: CDP-alcohol phosphatidyltransferase; SPTR:
FT                   C1YHC1 Phosphatidylglycerophosphate synthase; PFAM:
FT                   CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65735"
FT                   /db_xref="GOA:D7AV74"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV74"
FT                   /protein_id="ADH65735.1"
FT                   /translation="MPRFTFAQVKEETYKAKDAWWTVFLVDPLAGRLVVWTANRTDITP
FT                   NQLTLGAGVFGLLSMLCFVAPVLVPGGEGWNWAWLLAGGLLFHLSFVLDCMDGKIARLK
FT                   GTGTVFGSWVDFVFDRIRFFGCVMALLIGQWLLTGHEIYLIAAPVVVFFDLLRYLNGPQ
FT                   VAKTRRTMNQNLAELTGDTDRLAAAQREADPEDEDMGEAPARPGAPAPTGLYPRVRDRL
FT                   LRHRVRPHLFSGIEFEMFLCVVAPVTALVSLFTPLDSLIIPVAVFSVLALAFFEVILVL
FT                   RLWKDTNRFEARRRQLLASGAVPGTAAAPHPTSGS"
FT   gene            complement(356244..357419)
FT                   /locus_tag="Ndas_0287"
FT   CDS_pept        complement(356244..357419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0287"
FT                   /product="acyltransferase 3"
FT                   /note="COGs: COG3594 Fucose 4-O-acetylase and related
FT                   acetyltransferase; InterPro IPR002656; KEGG: sro:Sros_0364
FT                   hypothetical protein; PFAM: acyltransferase 3; SPTR: C1YHC0
FT                   Acetyltransferase, fucose-4-O-acetylase; PFAM:
FT                   Acyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65736"
FT                   /db_xref="GOA:D7AV75"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV75"
FT                   /protein_id="ADH65736.1"
FT                   /translation="MASSMTSPASQRQEPGHGAVAPTTAAPGPGRDARLDNAKFVLIAL
FT                   VVVGHAIGPLREYGPASALYYWIYFFHMPAFIMISGYLSRSFDASSNRVEKLVVSLAVP
FT                   YLIFWTIHQSIYAVERGGLPETMSVLQPTYALWFLVALFVWRLSVPVWKRLRWPVLVAV
FT                   LISVFGATASLGETLSLGRVVSFLPFFVLGLSLRREHFAYLDRLWVRIASVLVLGVTAA
FT                   LAVPISEQMSRSWLFWTNSLTDREIDPILPSLGVRVGFMALALVMSFAVLALMPKQRTW
FT                   FTSLGAYTLYVYLGHSVVIVLLQASPWYSLMSGATEMVVTVLLGVALTLLLCTPWVRAG
FT                   LRWAVEPQLTWFLRQDSALRAPSGAGGTDADGNTGSGGNGDGGREKEKAGV"
FT   gene            357907..359634
FT                   /locus_tag="Ndas_0288"
FT   CDS_pept        357907..359634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0288"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="COGs: COG1473 Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase; InterPro
FT                   IPR011650:IPR002933:IPR010168; KEGG: tfu:Tfu_2437 peptidase
FT                   M20D, amidohydrolase; PFAM: peptidase M20; peptidase
FT                   dimerisation domain protein; PRIAM: Hippurate hydrolase;
FT                   SPTR: C1YHB9 Amidohydrolase; TIGRFAM: amidohydrolase; PFAM:
FT                   Peptidase family M20/M25/M40; Peptidase dimerisation
FT                   domain; TIGRFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65737"
FT                   /db_xref="GOA:D7AV76"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV76"
FT                   /protein_id="ADH65737.1"
FT                   /translation="MPHAVDPNRAAQHGNVVMRLLDELFPLVEGFYVDLHKNPELSHAE
FT                   HRTASGVAEWLTRTGYEVHKGVGGTGVVGILRNGPGPTVMLRADMDALPLEERTGLPYA
FT                   STARAVNDEGAEVPVMHACGHDAHTACLVGAADLLSETRDEWAGTVMVVAQPGEETLDG
FT                   AQAMLEDGLFDRFGRPDVILGQHLGPQPAGLISHRAGVILGASNSYRVRVYGEGGHASQ
FT                   PNTTVDPVLIAASIVTRLQGVVSREVSPSEMAVLTVGRIQAGTKANIIPDEAYLEINTR
FT                   ALNDNVSAQLEAAIERIVRAEAAASGAAREPEIERFQGAGVTRNDPQSTADVAAAHHAY
FT                   FGDEYVIHLPDPFPATEDFSYFGLPGDPQPIPYVFWFVGATPHDVWEAAPGDTPYEKMG
FT                   NVPSTHSPFFAPAREPTLRAGLAAITVAALSYLGDDSPKASAEDTPNDAYDSAYLASSW
FT                   PAPEEDRAQTAWPAPEEDRPQTAWPAPDEDRAQTAWPAPDDDRAKSTHEADMDSVMEAQ
FT                   DEEHRQEWRDGKTEESTLSADMAALLEDDDRPRPPSGPSYGGPPPPPDDDRPGSEYRL"
FT   gene            359641..360411
FT                   /locus_tag="Ndas_0289"
FT   CDS_pept        359641..360411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0289"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="InterPro IPR001915; KEGG: tfu:Tfu_2436 hypothetical
FT                   protein; PFAM: peptidase M48 Ste24p; SPTR: C1YHB8
FT                   Zn-dependent protease with chaperone function; PFAM:
FT                   Peptidase family M48"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65738"
FT                   /db_xref="GOA:D7AV77"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV77"
FT                   /protein_id="ADH65738.1"
FT                   /translation="MAERRLRHPREIPLLVVCVGVTLLAVVGAVSRAYSGEPNQPLLLL
FT                   SIPALVYFVRGQQYARQRVNGVRITENQFPEAHRMVTEAAAAFRMKKVPEAYVVLGNGE
FT                   LNAFASGHGFRRYVAVTSDLFEVGDRLADADTLRFVIGHEVGHIAAGHTSFWRQFGISV
FT                   ANVIPGVGTSLNRAQEYTADNHAHAFCPEGMQGLRVLAAGKYLYPAVDFHDIAARARTD
FT                   TGFFVLLVNLLSSHPVNTFRFAALADRTRPGRVF"
FT   sig_peptide     359641..359745
FT                   /locus_tag="Ndas_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(360517..362829)
FT                   /locus_tag="Ndas_0290"
FT   CDS_pept        complement(360517..362829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0290"
FT                   /product="small GTP-binding protein"
FT                   /note="COGs: COG0480 Translation elongation factors
FT                   (GTPase);
FT                   InterProIPR020568:IPR005517:IPR000640:IPR005225:IPR
FT                   009000:IPR014721:IPR009022:IPR000795; KEGG: tcu:Tcur_2099
FT                   small GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor G domain IV; elongation
FT                   factor G domain protein; SMART: elongation factor G domain
FT                   IV; elongation factor G domain protein; SPTR: C1YHB7
FT                   Translation elongation factor 2 (EF-2/EF-G); TIGRFAM: small
FT                   GTP-binding protein; PFAM: Elongation factor Tu domain 2;
FT                   Elongation factor G C-terminus; Elongation factor Tu GTP
FT                   binding domain; Elongation factor G, domain IV; TIGRFAM:
FT                   translation elongation factor EF-G; small GTP-binding
FT                   protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65739"
FT                   /db_xref="GOA:D7AV78"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV78"
FT                   /protein_id="ADH65739.1"
FT                   /translation="MADRNVNGTGASAGAVPRADGPRDIRNIALVGPSGAGKTSLVEAL
FT                   LAAAGEVGRPGSVEEGTTVSDHDEVEIRQGRSVNLTVNPVMVGDVKVNLLDTPGYADFI
FT                   GAMRAGLRGADAALFVVSALEGVDGRTRVLWEECAAVGMPRAVAVTRIDHPRADYDEVV
FT                   AQCREAFGPGVHPAYVPAVEGTGDDRRVVGVWGLVSERYYDYSGASAGVGGSDGSERAK
FT                   RSGRAGGGGPGSAPSARPVPDWLREAAGPLRETLVEEVITESEDEALMERYMEGGELDP
FT                   DLLIDDLQKAVAAGGFHPVLAISTTTGVGVRELLRELPLSCPDPTRRPFPETSTPEGEP
FT                   VAGLSCDPDGPLVAQVLSTAGDPYVGRVSLVRVFSGTLRPDTRVHLHGHGVPCGLTGQD
FT                   ELDRTGNDERTGPLSVPLGRENRPVGQVVAGDLCLVARLPDARTGDTLSEPERPVRVAP
FT                   WRFPRPLLPVAVGAESSGDEDKLSQAVARLVAEDPSLRVEVNAETHQMVLWSLGEAHLD
FT                   AALDRLEHRHGVRVGTGEVRVPLRETFAVPAQGTGRNVKQSGGHGEFGVCRIRVEPLES
FT                   GAGLEFVDEIVGGVVPRQFVLSVEKGVRAQMADGVGTGTGAKGGAGSGDGAGSGAGYPL
FT                   VDIRVTLYDGKAHSVDSSDMAFQKAGRLALRDAAAAARLAVLEPVDEVSVEVDDAYLGA
FT                   VLSDLSARRGRVVGTESVRGGRAVVRAEVPELEIVRYAVDLRSISHGTGVFSREYARHE
FT                   PLPAQAAARLAGRVGQG"
FT   gene            363023..364726
FT                   /locus_tag="Ndas_0291"
FT   CDS_pept        363023..364726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0291"
FT                   /product="Abortive infection protein"
FT                   /note="COGs: COG1266 metal-dependent membrane protease;
FT                   InterPro IPR003675; KEGG: sro:Sros_4587 protease, CAAX
FT                   amino terminal family; PFAM: Abortive infection protein;
FT                   SPTR: C1YHB6 Predicted metal-dependent membrane protease;
FT                   PFAM: CAAX amino terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65740"
FT                   /db_xref="GOA:D7AV79"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV79"
FT                   /protein_id="ADH65740.1"
FT                   /translation="MPWSESLPQFSLAGTVLTVLLLLFAAFGEPLLGRKAFTWLSRRRD
FT                   GDARALTLLHAVTMGIHVLWGLVVFGVLLLSPNLVAADLGLRLPDAWGPIAGGAVGGLL
FT                   ALTVFWLLVNGLPRGPGRSGRGGRPARGRRAQGASARGRRSSAPLSLPQPERDRGLLAP
FT                   RTTAERAMAAGVAVTGGVFGELLYRGLFILLVASMGVPLWIAAALSVLLFSVAHLYQGW
FT                   WGLVSAGASGTLFTVLYLGTGSVWVPVLVHVALNLRSLVFPPADVREAGEREHREDEGD
FT                   PEAYEEYDEYGEYDEYEHHGHGYEDGSSTGEQPLTDAEEGGSADTAVAPAPPGTGTPAH
FT                   GTPSHGAVPGYGGTPGHGGPSVYGDLPDQGRNLGHGDPYGHGGNPGHGGHSAYGDLPAR
FT                   SGDFGPGAPHTDSGPHTHGGAFQQDLYSGLSTSGPASGHGDPLGDGGPPGHGDRFGGGD
FT                   QGGHVGQPGYGYQPGYGGHRSDGTPRPAPPRPGPSHGGPPPNAPLYPGASRPDPLPPHG
FT                   APADPSHDGLLGGGRRDEGRGERRLYPDEWIDRRYGDANTTPGPEPDRWS"
FT   sig_peptide     363023..363106
FT                   /locus_tag="Ndas_0291"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            364744..365535
FT                   /locus_tag="Ndas_0292"
FT   CDS_pept        364744..365535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0292"
FT                   /product="putative hydrolase"
FT                   /note="KEGG: tfu:Tfu_2435 putative hydrolase; SPTR: C1YHB5
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65741"
FT                   /db_xref="GOA:D7AV80"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV80"
FT                   /protein_id="ADH65741.1"
FT                   /translation="MSDAIDHPRAQPREHRYRLTTSDGVGIDAVLLRGAGSRTTAVILA
FT                   NGFTGTHRNPSTRAVAEALLPFGDVMTFDFRGHHGSGGLSTVGNAEIHDLEAVAVRLRE
FT                   LGYTSLSTVGFSMGAAVAIRHAAIYGGMDAVVSVSGPSRWYYRGTRAMRLLHLGIGRRA
FT                   GRLFLRGFRKVRVIDKEWDPVPAEPREIAGEVSPTPLLVVHGDSDAYFPVSHASAIHDA
FT                   AREPRDLWIIPGMGHAERAVTPELTARIRDWLVGKVGGENA"
FT   gene            365604..366935
FT                   /locus_tag="Ndas_0293"
FT   CDS_pept        365604..366935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0293"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COGs: COG2814 Arabinose efflux permease; InterPro
FT                   IPR011701:IPR016196; KEGG: sen:SACE_6356 putative transport
FT                   protein; PFAM: major facilitator superfamily MFS_1; SPTR:
FT                   C1YHB4 Arabinose efflux permease family protein; PFAM:
FT                   Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65742"
FT                   /db_xref="GOA:D7AV81"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV81"
FT                   /protein_id="ADH65742.1"
FT                   /translation="MIRSRSSPSGNGTPSEAAPTGAADDSGTTDTTPPALPGLRGRGFA
FT                   LLIAATAVGLCGFAAVLPLVPLWASRGGAGEFGAGSTTAVFMLTTVLTQLAMPWLLERG
FT                   GYRWAFPVGALVMGLPTPLFALTADLGPLLAVSAVRGVGFGMVSVAGTVLAARLVPHHQ
FT                   VGRATGYYGLAVGLPQVLILPGGVALALNIGFDTAFWLTGLCSVLGGVLAWGIWYADGG
FT                   RNRAALRSTVRAAPEPGPAPDASAGRPLLRALAAPLVLMLLTASSAGAIITFLAIPLEQ
FT                   AAWLVGGALAAYALAVVAGRWTAGMLHDRHRRALLLLPGMVGAVAGMALVTAALWSVGD
FT                   APGTGTALLVLLGSAVFGLGFGAVQNETVTLMLNRAGPAGYGRASAVWNIGYDAGSGAG
FT                   AMVLGLLIQLTGYGPAFAVTAVALLASVPLALGGRAGRGARARG"
FT   gene            complement(366989..367957)
FT                   /locus_tag="Ndas_0294"
FT   CDS_pept        complement(366989..367957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0294"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR017909; KEGG: tfu:Tfu_2434 hypothetical
FT                   protein; SPTR: C1YHB3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65743"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV82"
FT                   /protein_id="ADH65743.1"
FT                   /translation="MTPTPPSFARGRRAALSLSALAAALLVALPGTALAEPDNDEVDID
FT                   ELNRRAEELEESYDGELLQFNEIKDRVEKAEEDLEEVEGRLEASRTGVSTIASTQYKSG
FT                   GGLDPAFQVIFSSDPESMFADAATLNYLGQSQSEQIYDLIQTRDEAALVNEELQTELAE
FT                   AEELVETLEEEREEVEARIEEYEAEQIPETPGDGSIPASARGWGWDGATPRMAAIRDEI
FT                   VQTFGAPYPVGCLRSSADDHGTGQACDFMMSAGGALPSAANQSLGSQISQFGIDNADRL
FT                   GIKYIIWEQQIWHSASRQWKWMEDRGDNTQNHYDHVHISSY"
FT   sig_peptide     complement(367853..367957)
FT                   /locus_tag="Ndas_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(368198..368752)
FT                   /locus_tag="Ndas_0295"
FT   CDS_pept        complement(368198..368752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0295"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="COGs: COG0242 N-formylmethionyl-tRNA deformylase;
FT                   InterPro IPR000181; KEGG: tfu:Tfu_2433 peptide deformylase;
FT                   PFAM: formylmethionine deformylase; PRIAM: Peptide
FT                   deformylase; SPTR: C1YHB2 Peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: Polypeptide deformylase;
FT                   TIGRFAM: peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65744"
FT                   /db_xref="GOA:D7AV83"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV83"
FT                   /protein_id="ADH65744.1"
FT                   /translation="MTMRPIVRFGDPVLVTPTTPVTRFDKHTRALVDDLLETVEAPGRA
FT                   GLAANQIGVGLRVFSYNVEGRIGYVINPRIAELSEEVQEGDEGCLSVPRLWYPATRAEY
FT                   AVVTGVDLRNEPVTVEGTGLMARCLQHETDHLDGMVYIERLDPQTRKRALRDIRRSDWF
FT                   MPAEPPEPAGVQLPSAFGGAS"
FT   gene            complement(368838..369653)
FT                   /locus_tag="Ndas_0296"
FT   CDS_pept        complement(368838..369653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0296"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="InterPro IPR002934; KEGG: tfu:Tfu_2432 hypothetical
FT                   protein; PFAM: DNA polymerase beta domain protein region;
FT                   SPTR: C1YHB1 Nucleotidyltransferase family protein; PFAM:
FT                   Nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65745"
FT                   /db_xref="GOA:D7AV84"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR025184"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV84"
FT                   /protein_id="ADH65745.1"
FT                   /translation="MAVHPRVQTLAQTFLAYADQEAPGLVEGLYLTGSVALGDFRPHTS
FT                   DVDFVIVTGHTPGRRELELLRRVHARTRAAATGPQFNGVHVTWDDLTRDPAACGPVASV
FT                   IGGRFRNRASADVNPVTWHILAEHGVTVRGPHPLELDVWDEPESLRAWSLGSLDEQWRR
FT                   WREKAGRLVTPRGLAALGSLAPSWSVLSVSRLHFTLKTGEITSKSGAGAYALHAFPDRW
FT                   QRIVNECLRVRRNVSAPSLYESALARRRAALDYIEMVLDDSLRPGLAAA"
FT   gene            370532..371209
FT                   /locus_tag="Ndas_0297"
FT   CDS_pept        370532..371209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2430 hypothetical protein; SPTR:
FT                   C1YHB0 Putative uncharacterized protein; PFAM: CbiX"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65746"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV85"
FT                   /protein_id="ADH65746.1"
FT                   /translation="MVPTMVLVADDSRDTHRRDALWGLAEAVASRGEVPVTPAFGSPDD
FT                   VAATVHSVRGPKVVVPAFVAGGDVASAHLLSRLGLGRMSDSCQTPPLGAVPSIVADLAG
FT                   RLADSGWGPSDGVVLAADGTTGTEEHQVVMDVARMLSRRLDSPVQVGYLRTWAPSVVDA
FT                   VDRLRRHGQDNVAVAAWRLVDGPDFDLLRGLDVTAITEPLWPSELVVDTLLAQHRAVRG
FT                   RLA"
FT   gene            371577..372506
FT                   /locus_tag="Ndas_0298"
FT   CDS_pept        371577..372506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0298"
FT                   /product="aminoglycoside/hydroxyurea antibiotic resistance
FT                   kinase"
FT                   /note="COGs: COG3570 Streptomycin 6-kinase; InterPro
FT                   IPR006748:IPR011009; KEGG: tfu:Tfu_2429 streptomycin
FT                   6-kinase; PFAM: aminoglycoside/hydroxyurea antibiotic
FT                   resistance kinase; SPTR: C1YHA9 Streptomycin 6-kinase;
FT                   PFAM: Aminoglycoside/hydroxyurea antibiotic resistance
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65747"
FT                   /db_xref="GOA:D7AV86"
FT                   /db_xref="InterPro:IPR006748"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV86"
FT                   /protein_id="ADH65747.1"
FT                   /translation="MNDVTAQFVDDRQRRRLERRFGSHVGEWLTELPGIVSGIASDWGL
FT                   TVEGPAPHGRTSVVVCVVRPDGDRAVLKLSPDTGLAASEARVLRMWESSGRVPRVWEVD
FT                   NARGAILMEWIGGETVAAGGRVPPMETVGALISQLHSVEVPRRELLELRPLTSRVQFIF
FT                   DLWNRERAEGPAAEVVSASAMHQGFCRARDLANGTVDVVPVHGDLHPGNVIDGGRRGLV
FT                   AVDPRACLGDAAVDAVDWALWKATSLPEVVQRVDVLSRVLGVDGDRLMAWARAFAPCLA
FT                   VAKANRGHGGTDEFDMLVELSEGEAFVL"
FT   gene            complement(372558..373253)
FT                   /locus_tag="Ndas_0299"
FT   CDS_pept        complement(372558..373253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0299"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789:IPR001867:IPR011006; KEGG:
FT                   sco:SCO5872 turgor pressure regulator; PFAM: response
FT                   regulator receiver; transcriptional regulator domain
FT                   protein; SMART: response regulator receiver;
FT                   transcriptional regulator domain protein; SPTR: C1YHA8
FT                   Response regulator with CheY-like receiver domain and
FT                   winged-helix DNA-binding domain; PFAM: Response regulator
FT                   receiver domain; Transcriptional regulatory protein, C
FT                   terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65748"
FT                   /db_xref="GOA:D7AV87"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV87"
FT                   /protein_id="ADH65748.1"
FT                   /translation="MRVLVVDDDMQIIRAMRINLRARGHDVDTAADGASALRLAADNHP
FT                   DVVLLDLGLPDMEGMEVIQRLRGWSQVPIIVLSARHSAGEKVRCLDSGADDYVTKPFGM
FT                   DELLARMRAAERRSVRVDEAPVVRTPSFTVDLGAKRVLREGEEVRLTPTEWHILEILAR
FT                   HAGQLVSQRQLLHDVWGPAYQSETNYLRVYMAQLRRKLEPDPACPRYLITEAGRGYRFE
FT                   RAGSAQPGD"
FT   gene            complement(373234..375786)
FT                   /locus_tag="Ndas_0300"
FT   CDS_pept        complement(373234..375786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0300"
FT                   /product="Osmosensitive K channel His kinase sensor"
FT                   /note="COGs: COG2205 Osmosensitive K+ channel histidine
FT                   kinase; InterProIPR003594:IPR009082:IPR014729:IPR003852:IPR
FT                   006016:IPR003661:IPR005467:IPR004358; KEGG: sgr:SGR_1661
FT                   putative two-component system sensor kinase; PFAM:
FT                   Osmosensitive K channel His kinase sensor; UspA domain
FT                   protein; histidine kinase A domain protein; ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   SPTR: C1YHA7 Sensor protein; PFAM: Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase; His Kinase A
FT                   (phosphoacceptor) domain; Osmosensitive K+ channel His
FT                   kinase sensor domain; Universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65749"
FT                   /db_xref="GOA:D7AV88"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV88"
FT                   /protein_id="ADH65749.1"
FT                   /translation="MDPVARGKLRIYLGSAPGVGTTHNALAEARSRAERGTDVVVAAAH
FT                   THRRARTSALLEGLERIPPLPSGSVDTAAVIARAPGTALVDDLARANPPGSPNATRWQD
FT                   VEELLEAGVDVLSTVGIHHLESLNDVVHQITGVRPRQTVPDHVVRRAAEVELVDVTPQE
FT                   LRRRMARGDIHPAESVDAALADYYREGNLAALRELALLWTADRVEESLARYRGEHEIRR
FT                   TWEARERVVVALTGGPEGETLIRRAARVAARSRGGHPQPSHLLAVHVVPPNGMAQAPTD
FT                   DLLRQRRLLVELGGTYHQVVGNDVPTGLLEFARGVQATQIVLGSSRRRTWQYVFGPGVG
FT                   AIVARDSGDIDVHIVTHERVGSGRWPLPPPGRGLGEHRRVTGWSLALLAPTLLSLVMAL
FT                   PLFEDVGAASDAMLLLLATVATAAVGGLRPALVSALWSAVLLTVLLSPLHGRPSVSLDN
FT                   ILALTAFALVGALVAIVVEMAARRSAQAARARAEADAVTLLASSVLAGKEPLQALLRRI
FT                   RETFGQRSATLLERLDDERWRAAHSVGAPACESPEEADVLVSISDNLALALRGRVLPAA
FT                   DRGVLRAFAAHIGIALEHQRLEWDAAEARGQVAGNRIRTALLAAVSHDLRTPLTSIKAS
FT                   LSSLRATDITLTEEDREDLLETVEESTDRLNRLIDNLLDMSRVHTDNVRPKLRAVGLEE
FT                   VVPVTLLGLPHEAVVVDVPDRLPRVRADAGLLERAVANVVSNAVRYNPDPRLPVLVSAS
FT                   AHGDSVQLRVVDRGPGVSDEGKQRMFEAFQRLGDAPQGTGVGLGLAVARGFVEAMHGRL
FT                   DPEDTPGGGLTMVFTLRAVEKSETDTGDGEGTDACPGR"
FT   gene            376015..376980
FT                   /locus_tag="Ndas_0301"
FT   CDS_pept        376015..376980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0301"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_7287 serine/threonine protein
FT                   kinase; SPTR: C1YHN6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65750"
FT                   /db_xref="GOA:D7AV89"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV89"
FT                   /protein_id="ADH65750.1"
FT                   /translation="MTYPPDDGSFPGPPGGGPFPGRPGQPHPGPRPQPGSPGRPHPGPE
FT                   PAGGFPGQPGQPPGGRPPHGPGHPRVPPAQPGYGAHGGTPPLPPVAGHPAQPGPRRRPR
FT                   RGLVVGGAAAAVLLAASLGVVVWNIADGRPYAGLPDCGRLLPAEVVDSVPGTESPRAEG
FT                   EYTTVEDDGTAYLAEAGVLGYLNCSVGNVDGFPLHVTASLFEYEDGGEAVERFHGELED
FT                   QLRDRELGHHEEEQDQTAVLLDWRPVSAGDTGYAVLFEGDGHTDGDAYGSAVFVTVNVG
FT                   VTVSYTVGGGDGVGEAEALDFLADFAGRVERQLSREGERA"
FT   gene            complement(377032..378606)
FT                   /locus_tag="Ndas_0302"
FT   CDS_pept        complement(377032..378606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0302"
FT                   /product="Alkylglycerone-phosphate synthase"
FT                   /EC_number="2.5.1.26"
FT                   /note="COGs: COG0277 FAD/FMN-containing dehydrogenase;
FT                   InterProIPR016166:IPR016164:IPR016167:IPR006094:IPR 004113;
FT                   KEGG: mpa:MAP2004 hypothetical protein; PFAM: FAD linked
FT                   oxidase domain protein; PRIAM: Alkylglycerone-phosphate
FT                   synthase; SPTR: C1YHN5 FAD/FMN-dependent dehydrogenase;
FT                   PFAM: FAD binding domain; FAD linked oxidases, C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65751"
FT                   /db_xref="GOA:D7AV90"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV90"
FT                   /protein_id="ADH65751.1"
FT                   /translation="MSWFGWGDPARARALDPGLRDLVSQVLRAPLADLPPVPEERVELP
FT                   PSRLDERLRGLLAGVVGPGHVDDGDAARLRHSGGKSTPDLLLRRAGRADPAPDAVLYPA
FT                   DHDQVRRVLEVCSAERVAVVPFGGGTSVVGGVAPLRGGLRAVVCLDLRRLDRLVSVDTA
FT                   SMTAVLGAGVRTPRAEALLAEHGCTLGHLPQSYEYASLGGYAATRSSGQASSGYGRFED
FT                   MVVSLRAATPRGTLDTGGPPASAAGPDLGRLLLGSEGTLGVITEVGLRIRRRPERVLDE
FT                   AWSFPDFAAGVDALRTLAQSGIRPTMARVLDEAETFVGAAVGGRESAPGCQAVLGFEGT
FT                   GAEVEVRAAAAREAMAGAGGTPLGPGPVAHWRGNRFSAPYLRDSLLSAGVLAETLETAA
FT                   PWSGLLPLYAAVSGALTGALEDGEGGAVVMCHVSHTYPTGASLYFTVVTAAGAAPLERW
FT                   GRAKRAASEAIAANGGTITHHHAVGTDHLPWMAAEIGPLGGEVLRAVKAALDPEGVLNP
FT                   GKLIPAP"
FT   gene            378660..379262
FT                   /locus_tag="Ndas_0303"
FT   CDS_pept        378660..379262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0303"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR011075:IPR009057:IPR012287:IPR001647;
FT                   KEGG: mab:MAB_3883c TetR family transcriptional regulator;
FT                   PFAM: regulatory protein TetR; SPTR: C1YHN4 Transcriptional
FT                   regulator, tetR family; PFAM: Bacterial regulatory
FT                   proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65752"
FT                   /db_xref="GOA:D7AV91"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV91"
FT                   /protein_id="ADH65752.1"
FT                   /translation="MASIRNVEDRILDAARACVEAFGVRRTTLTDVARRAGVSRPTVYR
FT                   RWPDATALVADLLTRELRRILADQGDGPGGPAGEDVRARLVRHAAGVARALLAHPLFVR
FT                   IVDTEPELLATYTFQRLGTSHRAALELVEPVVAEGQRDGSVRAGDPAVLARLVLVTVQG
FT                   TVTSRRLFADVTDESGLVDELAALLDGYLRPPNQESP"
FT   gene            379259..380794
FT                   /locus_tag="Ndas_0304"
FT   CDS_pept        379259..380794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0304"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG0578 Glycerol-3-phosphate dehydrogenase;
FT                   InterPro IPR000447:IPR006076; KEGG: rop:ROP_67480 putative
FT                   glycerol-3-phosphate dehydrogenase; PFAM: FAD dependent
FT                   oxidoreductase; SPTR: C1YHA6 Glycerol-3-phosphate
FT                   dehydrogenase; PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65753"
FT                   /db_xref="GOA:D7AV92"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV92"
FT                   /protein_id="ADH65753.1"
FT                   /translation="MSPAVPASSSLNTARRAADLAALEHDPRIDLLVVGGGVTGAGVAL
FT                   DAAARGLSTALVERHDLAFGTSRWSSKLVHGGLRYLAGGQVAIAYESARERDVLMRVTA
FT                   PHLVRPLPMVVPVHRGSGLARALFVRAGAGAGDLLRIMAGTPGGVLPRPRVVGPRQTLR
FT                   LLPGVARRGLLGGVVSFDGQLVDDARLVVALARTAAREGARILTRCSAESLAADGAVLR
FT                   DGVTGRIVPVRPRAIVNATGVHADRLDPHVRLSPSRGSHLVLDGAALGRPRAALTVPVD
FT                   GSASRFVFALPQPDGRILAGLTDEPVDGTVPDVPEVPDSDVDFLLDQFNRALETRLERS
FT                   DVLGAFAGLRPLVHGVGDSADLSREHAVTVAPNGTVTVVGGKLTTYRAMAEQAVDTAVR
FT                   SRGLSAGPCRTRALPLVGAAPREELDAVAAPRRLVARYGTEAVAVLAEADADPELLAPL
FT                   VRGVTGAELRFGVRHEGAMDAADLLDRRTRVGLVPAERSAAEAAAEEALGAVD"
FT   gene            381010..381564
FT                   /locus_tag="Ndas_0305"
FT   CDS_pept        381010..381564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0305"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="InterPro IPR003594; KEGG: tcu:Tcur_4370 putative
FT                   signal transduction histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; SPTR: C1YHA5 Histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65754"
FT                   /db_xref="GOA:D7AV93"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV93"
FT                   /protein_id="ADH65754.1"
FT                   /translation="MPTLVSVPALAKAEDTVLTGVPDEYRHYFSGRPPVPFTKRHWEFP
FT                   GEPASVPLARAFLDTCAAARDSDYRYVFSLLGTELATNAIRHSRSGEEGQTFVLRVTRA
FT                   PNGLTLVCRDNGRPTRSQPGEDRPLSAGPLEGDRLTAENGRGLALVDSFATAWGDNGHP
FT                   SIRKVWFHLAYDLTGSSWPAA"
FT   gene            381946..382833
FT                   /locus_tag="Ndas_0306"
FT   CDS_pept        381946..382833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0306"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="COGs: COG0385 Na+-dependent transporter; InterPro
FT                   IPR002657; KEGG: stp:Strop_2582 bile acid:sodium symporter;
FT                   PFAM: Bile acid:sodium symporter; SPTR: C1YHA4 Predicted
FT                   Na+-dependent transporter; PFAM: Sodium Bile acid symporter
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65755"
FT                   /db_xref="GOA:D7AV94"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV94"
FT                   /protein_id="ADH65755.1"
FT                   /translation="MDSTIATIALPAALAVIMLGLGLSLTVGDFVRLTSMPGTVALILG
FT                   CQILVLPLVCLALVLLFDPPPALAVGMMLLAASPGGTTASLYSYLFRGNVALNISLTAL
FT                   NSLTAMVTLPLITNLAIARFMGDGDTLGLQVGKVLQVFAVILVPVAVGMLVRARADAFA
FT                   RRMERPVKIASVAVLFGVIAVALYQELDNIGDYIVSVGLMVLLFNIASLTIGYWAPRVL
FT                   GTGRPEAIASCMEIGLHNTTLSLAIALSPALLGSTEMAVPSAVYGVLMFFTAAATGLLV
FT                   TRGGTREEAPASGR"
FT   gene            complement(382879..383523)
FT                   /locus_tag="Ndas_0307"
FT   CDS_pept        complement(382879..383523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0307"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="COGs: COG2197 Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain;
FT                   InterProIPR000792:IPR001789:IPR011991:IPR011006:IPR 016032;
FT                   KEGG: sro:Sros_4416 response regulator receiver protein;
FT                   PFAM: response regulator receiver; regulatory protein LuxR;
FT                   SMART: regulatory protein LuxR; response regulator
FT                   receiver; SPTR: C1YHA3 Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain;
FT                   PFAM: Response regulator receiver domain; Bacterial
FT                   regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65756"
FT                   /db_xref="GOA:D7AV95"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV95"
FT                   /protein_id="ADH65756.1"
FT                   /translation="MRIVIAEDNVLLSAGLELLLSTRGFEVAEVAADAAAFADAVDRHR
FT                   PDLAIVDVRLPPNFRDEGIHAAIGARRRHEALPVLVLSQYVERDYAGELLADGRGGVGY
FT                   LLKDRVGRVSEFVDALRRVAGGGTVMDPAVVQQLLARRVRDPLESLTRRENEVLALMAE
FT                   GLDNGEIAERIVVTENAVHKHVGNIFAKLGLSPSDSGHRRVRAVLAYLDSR"
FT   gene            complement(383511..384728)
FT                   /locus_tag="Ndas_0308"
FT   CDS_pept        complement(383511..384728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0308"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG4585 Signal transduction histidine kinase;
FT                   InterPro IPR003594:IPR011712; KEGG: sen:SACE_6703
FT                   two-component system sensor kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase dimerisation
FT                   and phosphoacceptor region; SMART: ATP-binding region
FT                   ATPase domain protein; SPTR: C1YHA2 Signal transduction
FT                   histidine kinase, COG4585; PFAM: Histidine kinase;
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65757"
FT                   /db_xref="GOA:D7AV96"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV96"
FT                   /protein_id="ADH65757.1"
FT                   /translation="MGAVWRRALRASTYLLVVLGSGLVTLAMLPLTLAVALTIPIGGLG
FT                   FVLLPRWVGLLGRWASWHQGWASRFLGVPVPRVGGREASGFRELWGRPSTRRVLLWLPV
FT                   FAPASIVLGLVGLLALAMPLSAPQYLFWWAVPGEEPLQLLWLPVLDWGTALVTGAAYAV
FT                   IGCALGLGAAVPAARAHARMTLALLAPTEAELLAARVDELSRTRADVVDAHGAELRRIE
FT                   RDLHDGTQARLVAIAMQLGVAREAVENPAVAALLRNAHEGAEEAMAELREVIQGIYPPI
FT                   LADRGLSGALTALAARTTVPTRLDVGELGALPVAVETAAYFVVTESVTNAVKHSGAEEI
FT                   SVRLGREDGVLRVTVRDDGSGGVDEERGSGVRGLRRRVAALDGTVRVDSPAGGPTVIDV
FT                   EMPCGS"
FT   sig_peptide     complement(384621..384728)
FT                   /locus_tag="Ndas_0308"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            384919..386121
FT                   /locus_tag="Ndas_0309"
FT   CDS_pept        384919..386121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0309"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="COGs: COG4585 Signal transduction histidine kinase;
FT                   InterPro IPR003594:IPR011712; KEGG: ami:Amir_2410 histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   PRIAM: Histidine kinase; SMART: ATP-binding region ATPase
FT                   domain protein; SPTR: C1YHA1 Signal transduction histidine
FT                   kinase, COG4585; PFAM: Histidine kinase; Histidine kinase-,
FT                   DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65758"
FT                   /db_xref="GOA:D7AV97"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV97"
FT                   /protein_id="ADH65758.1"
FT                   /translation="MTTATDPPPTGASAPAPSRHWTALDARPGPTRRRFAVDTAVALLH
FT                   LLLSGGLPDPHTLGAQPLDWVRPVLCAVVAAGIVLRWRWPAASFGAVLAAGLAATVAGW
FT                   GQMPLAAAAWALYPLALTAERGPTRPRHGLYLLAGVLAIVAFGTNGAALDGVLRDLGVG
FT                   SVLLGLSWLLGRSVRERSVQEARAVAAVAREARVRERLRVAREVHDVVSHTLGAVGMRA
FT                   GVARYTGGDAEDLRAALADIEAASRQASDELRRVLVSLRGDHDAPLGPRPGPADLEALV
FT                   ATAESTGITCRLRTEGAGALPPAVADSVHRVVQEALTNAIRHAPGSACEVTVLGGAAAV
FT                   EVEVIDTGPAPGRVPVPGSGTGLAGMAERVAAHGGTLSAGPLPGGGHRLRAHIPFGPGP
FT                   G"
FT   sig_peptide     384919..385026
FT                   /locus_tag="Ndas_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            386456..387128
FT                   /pseudo
FT                   /locus_tag="Ndas_0310"
FT   gene            387242..387976
FT                   /locus_tag="Ndas_0311"
FT   CDS_pept        387242..387976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0311"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439:IPR003593; KEGG:
FT                   xce:Xcel_0096 ABC transporter related protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: C1YH99
FT                   ABC-type multidrug transport system, ATPase component;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65759"
FT                   /db_xref="GOA:D7AV98"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV98"
FT                   /protein_id="ADH65759.1"
FT                   /translation="MVAMIEIRGLTRRFGAHTAVDGLTFTARPGQVTGFLGPNGAGKST
FT                   TLRTLLGLERPDGGRALVNGVPYTSLRRPAATVGAQLDVGGAHPSRTARAHLGWIARAN
FT                   GLPASRAEEVLEWVGLAHAARSRVRTFSLGMGQRLNLAAALLGDPEVLVLDEPVNGLDP
FT                   EGIRWIRGFTRGLADRGRTVLLSSHLMGEVARIADHLVVIDRGRLVAEGGPAELTAGHD
FT                   SLEEAFFALVGRGHEEWTGGQR"
FT   gene            387973..388731
FT                   /locus_tag="Ndas_0312"
FT   CDS_pept        387973..388731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gym:GYMC10_3229 hypothetical protein; SPTR:
FT                   C1YH98 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65760"
FT                   /db_xref="GOA:D7AV99"
FT                   /db_xref="UniProtKB/TrEMBL:D7AV99"
FT                   /protein_id="ADH65760.1"
FT                   /translation="MNGVLRAEADKLRTLVSVWITCLATPLLTVGLAWLSGWSVGRALE
FT                   NDPGMLVREVVPEQSGFDAIMYGQAGMVVLGVLAVSGEYTGGQLRTSLLAVPDRPRLLL
FT                   AKATAVVLAALPVAAVTVTAAFAATQFGLGEHGYPLADVVGGPVPGALAGAVLYWVLLA
FT                   LLAAGLTVVARNAIVPLTVLISTVLALSFFLSMLTDAADYLPDRAGVQMFLLGGPNRTD
FT                   LSALQGGAVMAAWVVLVWAAAVWLFRRRDA"
FT   sig_peptide     387973..388044
FT                   /locus_tag="Ndas_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(388772..389287)
FT                   /locus_tag="Ndas_0313"
FT   CDS_pept        complement(388772..389287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0313"
FT                   /product="protein of unknown function DUF567"
FT                   /note="COGs: COG4894 conserved hypothetical protein;
FT                   InterPro IPR007612; KEGG: sma:SAV_4384 hypothetical
FT                   protein; PFAM: protein of unknown function DUF567; SPTR:
FT                   C1YH97 Uncharacterized conserved protein; PFAM: Protein of
FT                   unknown function (DUF567)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65761"
FT                   /db_xref="InterPro:IPR007612"
FT                   /db_xref="InterPro:IPR025659"
FT                   /db_xref="InterPro:IPR038595"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVA0"
FT                   /protein_id="ADH65761.1"
FT                   /translation="MKFLVRERVFDIGDDYWVTDEAGEKVFLVDGKALRLRTTFELKDT
FT                   DGTVLAVIRKKLFRLRDQMRVEREGGATATVRKRLVNPLRDKLVVEVEGAPDWEVTGDF
FT                   LGKEYVISDEHGTVAHVSRKWFRVLDTYAVDVNTHRTDLAGDPALVISVAVAVDTLTRD
FT                   EDEEGPGD"
FT   gene            389487..390218
FT                   /locus_tag="Ndas_0314"
FT   CDS_pept        389487..390218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0314"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="COGs: COG0847 DNA polymerase III epsilon subunit and
FT                   related 3'-5' exonuclease; InterPro
FT                   IPR012337:IPR006055:IPR013520; KEGG: sgr:SGR_1422 DNA
FT                   polymerase III subunit epsilon; PFAM: Exonuclease RNase T
FT                   and DNA polymerase III; SMART: Exonuclease; SPTR: C1YH96
FT                   DNA polymerase III epsilon subunit-like 3'-5' exonuclease;
FT                   PFAM: Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65762"
FT                   /db_xref="GOA:D7AVA1"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVA1"
FT                   /protein_id="ADH65762.1"
FT                   /translation="MGTSRPGKVPMTWHTRPMAAFDTESTGLDLANDRIVTAALWRIDP
FT                   AARTKEVTTWLIDPGIDIPQEATDIHHITTEHAREHGRPAAEAVPEIGAALEKAAADGV
FT                   PVVVYNAPYDLGLLSAELRRHDAGARFDGTLRVLDPLVIDKRFDTFRRGSRKLVDVCAH
FT                   HGVRLDAEQAHGAAADALAAARLAWKLAAAHPELAAMDIDDLHAAQAVWKAEQAASFQD
FT                   YLRRRDPEAVVDGSWPLPGPA"
FT   gene            complement(390475..390546)
FT                   /locus_tag="Ndas_R0009"
FT   tRNA            complement(390475..390546)
FT                   /locus_tag="Ndas_R0009"
FT                   /product="tRNA-Arg"
FT   gene            390647..391063
FT                   /locus_tag="Ndas_0315"
FT   CDS_pept        390647..391063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0315"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789:IPR011006; KEGG: tcu:Tcur_3942
FT                   response regulator receiver protein; PFAM: response
FT                   regulator receiver; SMART: response regulator receiver;
FT                   SPTR: C1YH95 Response regulator with CheY-like receiver
FT                   domain and winged-helix DNA-binding domain; PFAM: Response
FT                   regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65763"
FT                   /db_xref="GOA:D7AVA2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVA2"
FT                   /protein_id="ADH65763.1"
FT                   /translation="MSPGGGSVAPVNALPTRVLVVEDDDVIRELIRLNLELEGFEVFTA
FT                   VDGQDCLDRAAHIDPHVVTMDVMMPRVDGWTAVERLRADARTRDRPIIMVTARTQETDH
FT                   QRGRRVGMDAYLTKPFDPDVLIDIIRSLVDRGLE"
FT   gene            391060..392145
FT                   /locus_tag="Ndas_0316"
FT   CDS_pept        391060..392145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0316"
FT                   /product="DALR anticodon binding domain protein"
FT                   /note="COGs: COG0018 Arginyl-tRNA synthetase; InterPro
FT                   IPR009080:IPR008909; KEGG: tfu:Tfu_2426 arginyl-tRNA
FT                   synthetase; PFAM: DALR anticodon binding domain protein;
FT                   SPTR: C1YH94 Arginyl-tRNA synthetase; PFAM: DALR anticodon
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65764"
FT                   /db_xref="GOA:D7AVA3"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVA3"
FT                   /protein_id="ADH65764.1"
FT                   /translation="MTPGHLEAAVRAAAARALDLAPDAIPFVWPRNDHADGGADAATAL
FT                   PPRLAGVSGGRETDRRGDRRAEVRDRVAAELSAMRDEGLVDFDRVTGDGRGFLNVTFTG
FT                   RQRDALLAAAADGPRFLTGRDWDGEGEWPASALHEAGPVAQARRLARADARARVALAVG
FT                   PQAPPPAPGEASWRDPYLDGGHRELLTPAARALGAVGEDSARVAFCRSVPEHPRGTETT
FT                   GRDLPVLPSAEYPGAWARLTDANPAFRMRYAHAHATSLVRWSAEGAPPPAASPDRTAAV
FT                   RGLLFDGPSALDTAARREEPHILVRYLEALTSAYDEWRTCSAAVPEASERTAADPALPA
FT                   AVAGVLRTGLLLLGVSAPTRL"
FT   gene            392260..393645
FT                   /locus_tag="Ndas_0317"
FT   CDS_pept        392260..393645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0317"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="COGs: COG0019 Diaminopimelate decarboxylase;
FT                   InterPro IPR000183:IPR002986:IPR009006; KEGG: tfu:Tfu_2425
FT                   diaminopimelate decarboxylase; PFAM: Orn/DAP/Arg
FT                   decarboxylase 2; SPTR: C1YH93 Diaminopimelate
FT                   decarboxylase; TIGRFAM: diaminopimelate decarboxylase;
FT                   PFAM: Pyridoxal-dependent decarboxylase, C-terminal sheet
FT                   domain; Pyridoxal-dependent decarboxylase, pyridoxal
FT                   binding domain; TIGRFAM: diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65765"
FT                   /db_xref="GOA:D7AVA4"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVA4"
FT                   /protein_id="ADH65765.1"
FT                   /translation="MSRYAHPAGSRHAEILPEDNPPLPPEDLNALDPRVWPATARRTGG
FT                   ELTVGGVGVRELAATHGTPLFVMDEEDFRGRARDYRTAFSDADVYYAGKALLTKAVARW
FT                   VNEEGLKLDVCSGGELTVALAAGVPAERIGMHGNNKSAAELRRAVEAGVGRVIIDSLDE
FT                   IERLGAIAAELGARPKVLIRVTTGVEAHTHEFVATAHDDQKFGFAMSTGAAAEAVRRVL
FT                   AAPHLELVGLHSHIGSQIFDTSGFEVAARRVTRFLTGVHEELGVTLAELDLGGGLGIAY
FT                   TSGDDPLDPKTIAGSLTSIVRRECEEAGLPVPRIAVEPGRAIAGPAGITVYEVGTVKDV
FT                   EGIRTYVSVDGGMSDNIRTALYGSEYTSQLVSRESDAEPMLSRLVGKHCESGDIIVHDL
FT                   YLPADLRPGDLVAVAATGAYCYSMASNYNHLPRPAMVAVRGGSSRVIVRRENEEDLLRL
FT                   DVG"
FT   gene            393714..395000
FT                   /locus_tag="Ndas_0318"
FT   CDS_pept        393714..395000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0318"
FT                   /product="Homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="COGs: COG0460 Homoserine dehydrogenase;
FT                   InterProIPR001342:IPR016040:IPR002912:IPR019811:IPR
FT                   016204:IPR005106; KEGG: tfu:Tfu_2424 homoserine
FT                   dehydrogenase; PFAM: homoserine dehydrogenase; amino
FT                   acid-binding ACT domain protein; homoserine dehydrogenase
FT                   NAD-binding; PRIAM: Homoserine dehydrogenase; SPTR: C1YH92
FT                   Homoserine dehydrogenase; PFAM: Homoserine dehydrogenase;
FT                   Homoserine dehydrogenase, NAD binding domain; ACT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65766"
FT                   /db_xref="GOA:D7AVA5"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVA5"
FT                   /protein_id="ADH65766.1"
FT                   /translation="MAMKVALLGCGVVGSEVVRLVNEQSEELAARVGTPIEIGGIAVRR
FT                   LGRDRGVDPALLTTDATALATRPDIDLVVEVIGGIEPARSLILAAIKSGKSVVTANKAL
FT                   LAEDGQTLHAAARDAGVDLYYEASVAGAIPLLRPLRDSLAGDRVNRVLGIVNGTTNYIL
FT                   DRMDSLGAGFTESLEQAQALGYAEADPTADVEGFDAAAKAAILARLAFHTQRVTAADVH
FT                   REGITGVSAGDIASARAMGCVVKLLAICQRSQDGGSVGVRVHPVMLPVEHPLASVKEAY
FT                   NAVFVEAESAGRLMFYGAGAGGTPTASAVLGDLVAVARNRLADTSVAEGGHDTGLPVHD
FT                   MGETITSYHVALDVADRPGVLSKVAEIFADHGVSIKNVRQEGSGDDAQLVLVSHPAPDA
FT                   ALSATVEDLRVHDMVREVASVMRVETFAD"
FT   gene            395244..396302
FT                   /locus_tag="Ndas_0319"
FT   CDS_pept        395244..396302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0319"
FT                   /product="threonine synthase"
FT                   /note="COGs: COG0498 Threonine synthase; InterPro
FT                   IPR000634:IPR001926:IPR004450; KEGG: tfu:Tfu_2423 threonine
FT                   synthase; PFAM: Pyridoxal-5'-phosphate-dependent protein
FT                   beta subunit; SPTR: C1YH91 L-threonine synthase; TIGRFAM:
FT                   threonine synthase; PFAM: Pyridoxal-phosphate dependent
FT                   enzyme; TIGRFAM: threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65767"
FT                   /db_xref="GOA:D7AVA6"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVA6"
FT                   /protein_id="ADH65767.1"
FT                   /translation="MARAWRGIVEEYRDRLPVNESTPVVTLQEGGTPLLPATRVSELTG
FT                   CEVFLKVEGLNPTGSFKDRGMTMAITKAAEDGAKAVICASTGNTSASAAAYAIRAGMTC
FT                   AVLVPQGKIAMGKLAQALVHGARLLQVDGNFDDCLELARKLSVDYPVALVNSVNPYRLQ
FT                   GQKTAAFEIVDALGDAPDVHCIPVGNAGNITAYWMGYTEYSRDGISTRNPRMLGFQASG
FT                   SAPIVNGAPVTSPSTIATAIRIGNPASWKLAEQARDESGGLIDKVTDRQIMAAYKLLAA
FT                   EEGVFVELASAASVAGLLQSVQAGLVEPGSRVVCTVTGNGLKDPDWALAGASSATTVPV
FT                   DALAAAQALDLA"
FT   gene            396519..397481
FT                   /locus_tag="Ndas_0320"
FT   CDS_pept        396519..397481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0320"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="COGs: COG0083 Homoserine kinase;
FT                   InterProIPR006203:IPR014721:IPR020568:IPR000870:IPR
FT                   006204:IPR013750; KEGG: tfu:Tfu_2422 homoserine kinase;
FT                   PFAM: GHMP kinase; GHMP kinase domain protein; PRIAM:
FT                   Homoserine kinase; SPTR: C1YH90 Homoserine kinase; TIGRFAM:
FT                   homoserine kinase; PFAM: GHMP kinases C terminal; GHMP
FT                   kinases N terminal domain; TIGRFAM: homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65768"
FT                   /db_xref="GOA:D7AVA7"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVA7"
FT                   /protein_id="ADH65768.1"
FT                   /translation="MSPSRPTRVSVQAPATSANLGPGFDALGLALRLYNTFEASPREDG
FT                   ELRVRVEGEGADEVPLDERHLVVRAMRETFERAGEQLPGLDLTCVNGVPHARGLGSSSS
FT                   AIVGGVAAASALLGRTGPDGGPDRDGIYQIAADIEGHPDNVAPCVYGGYTVAYRDGDRW
FT                   GAVSLAPDPRVLPVLCVPEWRLSTERARGLLPERVPHGDAAFNAGRAALMTAAVCGHPE
FT                   ALYAATRDRLHESYRAPAMPDTLDLIRDLRQHEKLPAVVSGAGPTVLVLCSTGAGEASA
FT                   DSPEIADQIDSIRRRAGKNWDIRPLLVELAGVRSPSPHP"
FT   gene            397922..399910
FT                   /locus_tag="Ndas_0321"
FT   CDS_pept        397922..399910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0321"
FT                   /product="transcription termination factor Rho"
FT                   /note="COGs: COG1158 Transcription termination factor;
FT                   InterProIPR018260:IPR011129:IPR003593:IPR004665:IPR
FT                   011112:IPR011113:IPR000194; KEGG: tfu:Tfu_2421
FT                   transcription termination factor Rho; PFAM: H+transporting
FT                   two-sector ATPase alpha/beta subunit central region; Rho
FT                   termination factor RNA-binding; Rho termination factor
FT                   domain protein; SMART: Cold shock protein; AAA ATPase;
FT                   SPTR: C1YH89 Transcription termination factor Rho; TIGRFAM:
FT                   transcription termination factor Rho; PFAM: Rho termination
FT                   factor, N-terminal domain; Rho termination factor,
FT                   RNA-binding domain; ATP synthase alpha/beta family,
FT                   nucleotide-binding domain; TIGRFAM: transcription
FT                   termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65769"
FT                   /db_xref="GOA:D7AVA8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVA8"
FT                   /protein_id="ADH65769.1"
FT                   /translation="MSDTTELRTDAAVEDKATTGVSVTEAGDGAPTATPSRSRTASRGT
FT                   GLAALKLPELQKLASSLGITGTGRMRKSDVIAAIEAKQGGPVGGPTKAKTAKSAETASK
FT                   AGKVEATDGRAEAPETPGTDEAPRKRADKQPSDQAVTDPQGGRGDKPSRGRRSSRRRGD
FT                   EPGDQPRAVDGAESSTSASSVTKTSSTPQKNGPDSAEDRDNRSGQGRERQRNRRNRNRG
FT                   GDDQNANSNAQQGGGGQNQGRGSGGGGGDDDDFGGRRRGRRRDRRDRRGRGGGQEPEPV
FT                   IGEDDVLLPVAGILDILDNYAFVRTTGYLPGQSDVYVSLAQVRKHGLRKGDHIIGAVRQ
FT                   PKDGERREKFNALVRLDSVNGMSPDQARGRQEFSKLVPLYPQERLRLETEPQILTTRII
FT                   DLVAPIGKGQRGLIVSPPKAGKTMVVQAIANAITENNPECYLMVILVDERPEEVTDMQR
FT                   TVKGEVIHSTFDRPAEDHTVVADLAIERAKRLVEMGMDVVVLLDSITRLGRAYNLAAPA
FT                   SGRIMSGGVDSTALYPPKRFFGAARNIEGGGSLTILATALVETGSRADEVIFEEFKGTG
FT                   NMELKLNRSLADKRIFPAVDVDASSTRKEEILMSSEELGVVWKLRRVLHALDTQQAIEL
FT                   LLDKMKESKSNAEFLLQIQKTTVGPER"
FT   gene            400172..402004
FT                   /locus_tag="Ndas_0322"
FT   CDS_pept        400172..402004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0322"
FT                   /product="L-lactate transport"
FT                   /note="COGs: COG1620 L-lactate permease; InterPro
FT                   IPR003804; KEGG: svi:Svir_33840 L-lactate transport; PFAM:
FT                   L-lactate permease; SPTR: C1YH88 L-lactate transport;
FT                   TIGRFAM: L-lactate transport; PFAM: L-lactate permease;
FT                   TIGRFAM: L-lactate transport"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65770"
FT                   /db_xref="GOA:D7AVA9"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVA9"
FT                   /protein_id="ADH65770.1"
FT                   /translation="MDNLAPLSLLALAPIVLVGVLLVGFRLPAMYAMPAGYVVVVAVAV
FT                   LFWQTDWVAIAASTVQGLILAIGLLYIIFGALLLLSTLTKSGAIATIRTTFTDISPDRR
FT                   VQAIIIGWLFGSFIEGASGFGTPAAVVAPLLLALGFPAMAAVMVGLVIQSTPVSFGAVG
FT                   TPILVGVSGGLEGSSAVAARAAELGLDMPGFVSLIGFQTVLLHAVAGTLVPLFICCMLC
FT                   GFYGGNRRFSDGLGVWRFALFAAFAMTVPSVLYNHFLGVEFTSLLGGLTGLVIVVLAAR
FT                   RGFLMPKRTWDFPPREDWLARWSGTLSPGDGETARADGGRVGFLAAWAPYLMVAALLVA
FT                   TRTITPLEDWLTGVAVGATDIFGTPVSQLVEPLYSPGATFILVCLLTYGLHRMTRRQIA
FT                   DSWRMAGSQLAGAAVALLFAVPLVRVFINTGGDFGDTAMESMPLTLAAGAAELGGTAWP
FT                   LYAPWIGALGAFVAGSNTVSNLMFSLFQFSTAERIGIPPETVVATQAVGGAAGNMITVH
FT                   NVVAASAVVGLAGREGDLIRQSLLPMTYYVLLAGSVSYVLVYGFGPGAGTVMLLLLLAV
FT                   LAALVLLMRRADADKPPSRTAGTAPGGGRGKGEE"
FT   sig_peptide     400172..400339
FT                   /locus_tag="Ndas_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            402200..402409
FT                   /locus_tag="Ndas_0323"
FT   CDS_pept        402200..402409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0323"
FT                   /product="ribosomal protein L31"
FT                   /note="COGs: COG0254 Ribosomal protein L31; InterPro
FT                   IPR002150; KEGG: sma:SAV_2913 50S ribosomal protein L31;
FT                   PFAM: ribosomal protein L31; SPTR: C1YH87 50S ribosomal
FT                   protein L31; TIGRFAM: ribosomal protein L31; PFAM:
FT                   Ribosomal protein L31; TIGRFAM: ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65771"
FT                   /db_xref="GOA:D7AVB0"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVB0"
FT                   /protein_id="ADH65771.1"
FT                   /translation="MKADIHPEYVATEVTCTCGAHFTTRSTVTEGKIRAEVCSECHPFY
FT                   TGKQKILDTGGRVARFEKRFGKRK"
FT   gene            402521..403591
FT                   /locus_tag="Ndas_0324"
FT   CDS_pept        402521..403591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0324"
FT                   /product="peptide chain release factor 1"
FT                   /note="COGs: COG0216 Protein chain release factor A;
FT                   InterPro IPR000352:IPR004373:IPR005139; KEGG: tfu:Tfu_2419
FT                   peptide chain release factor 1; PFAM: Class I peptide chain
FT                   release factor; PCRF domain protein; SPTR: C1YH86 Bacterial
FT                   peptide chain release factor 1 (BRF-1); TIGRFAM: peptide
FT                   chain release factor 1; PFAM: PCRF domain; RF-1 domain;
FT                   TIGRFAM: peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65772"
FT                   /db_xref="GOA:D7AVB1"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVB1"
FT                   /protein_id="ADH65772.1"
FT                   /translation="MKLDDLLGEYYELEQQLADPEVHADQARARTLGKRYAQLTPIIET
FT                   YRALKEVESDIDTARELAAEDSSFAEEADRLTEEAERLTERLRVLLIPRDPADDKNLIM
FT                   EVKAGEGGEESALFAGDLVRMYLRYAERQGWKTEVIDSTHSDLGGYKDITIAFKNKGTP
FT                   EPGSGVWPMLKFEGGVHRVQRVPVTESQGRIHTSAAGVLVVPEAEDIEVEIHEKDLRVD
FT                   VYRSSGPGGQSVNTTDSAVRITHLPTGIVASCQNEKSQLQNKEQAMRILRARIYAEAQA
FT                   SADAEAAAERKSQVRTVDRSERVRTYNFPENRISDHRVGYKAYNLDQVLDGELGGVVKA
FT                   LVDADTKERLEAAQSS"
FT   gene            403588..404451
FT                   /locus_tag="Ndas_0325"
FT   CDS_pept        403588..404451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0325"
FT                   /product="protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /note="COGs: COG2890 Methylase of polypeptide chain release
FT                   factors; InterPro IPR019874:IPR004556:IPR007848:IPR002052;
FT                   KEGG: tfu:Tfu_2418 modification methylase HemK; PFAM:
FT                   methyltransferase small; SPTR: C1YH85
FT                   Protein-(Glutamine-N5) methyltransferase, release
FT                   factor-specific; TIGRFAM: protein-(glutamine-N5)
FT                   methyltransferase, release factor-specific; modification
FT                   methylase, HemK family; PFAM: Methyltransferase small
FT                   domain; TIGRFAM: HemK family putative methylases;
FT                   protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65773"
FT                   /db_xref="GOA:D7AVB2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVB2"
FT                   /protein_id="ADH65773.1"
FT                   /translation="MNVLLDEVARATRRLAEAGVASPRADAEELAAFVHGVRRGELHTV
FT                   ADSDFDARYWECVSRREAREPLQHITGRAYFRYLELRVGPGVFVPRPETEIMVDWAIQT
FT                   LRAMDVADPLVVDLGTGSGAIAISIAQEVPRSRVHTVEVDPDALAWARRNIDASGHADR
FT                   VTSHHGDMRTALPQLNGRVDLLISNPPYVPTREAGAIPPEVRDYDPAPALWSGEDGLDM
FT                   IRALEAVGRRLLRPGGAMAVEHHDGQGIDIPWLFPEDRGWRDVLNRKDLARRDRFVVMR
FT                   RADEDG"
FT   gene            404529..405314
FT                   /locus_tag="Ndas_0326"
FT   CDS_pept        404529..405314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0326"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="COGs: COG0009 Putative translation factor (SUA5);
FT                   InterPro IPR006070:IPR017945:IPR004388; KEGG: tfu:Tfu_2417
FT                   translation factor SUA5; PFAM: SUA5/yciO/yrdC domain; SPTR:
FT                   C1YH84 Translation factor SUA5; TIGRFAM:
FT                   Sua5/YciO/YrdC/YwlC family protein; PFAM: yrdC domain;
FT                   TIGRFAM: Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65774"
FT                   /db_xref="GOA:D7AVB3"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVB3"
FT                   /protein_id="ADH65774.1"
FT                   /translation="MSRIYDCADETARKDGIADAASAVRRGDLVVLPTDTVYGIGTDAF
FT                   SPTAVARLLATKGRGREMPPPVLVGSMRAANALVDDLGNHGRDLMEEFWPGPLTLVCTA
FT                   TPSLSWDLGDTKGTVGVRMPMDPVALDLLKEVGPMAVSSANKSGQPSATRVEEAIEQLG
FT                   DEDVAVYLDGGETESRVSSTIVDLTYAVPRVLRAGAISIEQLRAVCGTVIGELRKGPRK
FT                   PVRPEGGEAGDAQAPAPEPQTPRDEDESAPGTAPDGDKN"
FT   gene            405327..406490
FT                   /locus_tag="Ndas_0327"
FT   CDS_pept        405327..406490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0327"
FT                   /product="Glycosyl transferase, family 4, conserved region"
FT                   /note="COGs: COG0472 UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N- acetylglucosamine-1-phosphate
FT                   transferase; InterPro IPR018480:IPR018481; KEGG:
FT                   tfu:Tfu_2416 putative teichoic acid linkage unit synthesis
FT                   (synthesis of undecaprenylpyrophosphate-N-aetylglucosamine
FT                   ); PFAM: Glycosyl transferase, family 4, conserved region;
FT                   SPTR: C1YH83 UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
FT                   transferase; PFAM: Glycosyl transferase family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65775"
FT                   /db_xref="GOA:D7AVB4"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVB4"
FT                   /protein_id="ADH65775.1"
FT                   /translation="MREYALTFVIAAAVTYLLVPLVRRFAIAFGATPPVRDRDVHTEPI
FT                   PRLGGLAIYGGFAAALLISAQLPHLQDVFLADTWMGLLLAGGLITIVGVIDDRWGMDAL
FT                   SKLAGQTAAAGILVWQGVQLLWLPLPGTQLSLGPWLGAMVSILLIVVTINAVNFADGLD
FT                   GLAAGIVAISSLAFFAYYYVVAVEQGFVRQSYPAMIAIILAGTCAGFLCHNFHPAKVFM
FT                   GDTGAMLLGLLLTSITITVTGQFDANTAREGFNSGLVVFLPIALPLLVIALPLADLVLA
FT                   VVRRTLAGKSPFAPDRGHLHHRLLDMGHSHVRAVLLMYLWAGIVAFAAVALSVFDSWVI
FT                   VLAVTALVATCAVGLIALPRLRRRGLLFPRRKESVKTAPDHDSPTDG"
FT   sig_peptide     405327..405416
FT                   /locus_tag="Ndas_0327"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            406715..407140
FT                   /locus_tag="Ndas_0328"
FT   CDS_pept        406715..407140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2415 hypothetical protein; SPTR:
FT                   C1YH82 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65776"
FT                   /db_xref="GOA:D7AVB5"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVB5"
FT                   /protein_id="ADH65776.1"
FT                   /translation="MQENDAWRAFRGAALPGVACALLALAVSALLAGAPGLAGSALASV
FT                   VVLGCFGLGQAGVILVTRRNKDLFLAANLVGFVIKMAVLGVVLVTLGNSSFVASLNSPA
FT                   FVYSALAVVLAWLGGQTWTISRTKTLHVDPVESAENG"
FT   sig_peptide     406715..406843
FT                   /locus_tag="Ndas_0328"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            407246..407476
FT                   /locus_tag="Ndas_0329"
FT   CDS_pept        407246..407476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0329"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fra:Francci3_3714 hypothetical protein; SPTR:
FT                   C1YH81 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65777"
FT                   /db_xref="GOA:D7AVB6"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVB6"
FT                   /protein_id="ADH65777.1"
FT                   /translation="MSSEPTRRTDAHEDSVPRQSDGWALFSTLLSGVLVWSAIGWAADE
FT                   LLGFQALFLPIGAVLGMAGAIYLIVAKSRRS"
FT   gene            407570..408412
FT                   /locus_tag="Ndas_0330"
FT   CDS_pept        407570..408412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0330"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="COGs: COG0356 F0F1-type ATP synthase subunit a;
FT                   InterPro IPR000568; KEGG: tfu:Tfu_2413 H+-transporting
FT                   two-sector ATPase, A subunit; PFAM: H+transporting
FT                   two-sector ATPase A subunit; SPTR: C1YH80 ATP synthase
FT                   subunit a; TIGRFAM: ATP synthase F0, A subunit; PFAM: ATP
FT                   synthase A chain; TIGRFAM: ATP synthase subunit 6
FT                   (eukaryotes),also subunit A (prokaryotes)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65778"
FT                   /db_xref="GOA:D7AVB7"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVB7"
FT                   /protein_id="ADH65778.1"
FT                   /translation="MSADVRILAAEPNCHLFGDNGCGFTPPTIGMFFPEPWYTNIPGSA
FT                   GIDLYLVLLLVAVGAVLLLWSWFSRKLSLVPGRRQSVGEMLVLFVRDQITRPTMGAKGD
FT                   RFLPFMTAVFTLILAMNFTGLIPGMLPVNSNLAFTAMLAAVIYVMTIVIGIRNQGGWGY
FT                   FRNQIFPPGMPKVIYILVTPIEILSVFLIRPVTHALRLFATMFAGSLLLAVFAYGGWYM
FT                   LNLTAGPVLSTVSVLFSGAALLGYLAFFLFEILIMAVQAFIFTLLASLYINQSLEAAH"
FT   gene            408537..408767
FT                   /locus_tag="Ndas_0331"
FT   CDS_pept        408537..408767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0331"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="InterPro IPR002379:IPR000454:IPR005953:IPR020537;
FT                   KEGG: tfu:Tfu_2412 ATP synthase F0, C subunit; PFAM:
FT                   H+transporting two-sector ATPase C subunit; SPTR: C1YH79
FT                   ATP synthase subunit c; TIGRFAM: ATP synthase F0, C
FT                   subunit; PFAM: ATP synthase subunit C; TIGRFAM: ATP
FT                   synthase, F0 subunit c"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65779"
FT                   /db_xref="GOA:D7AVB8"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVB8"
FT                   /protein_id="ADH65779.1"
FT                   /translation="MDIAAITGNINTIGYGISVIGAGIGVGIVFGLGMQAIARQPEARG
FT                   PLQTNIYLGFALIEALAILGFVLAFAAPTGS"
FT   sig_peptide     408537..408650
FT                   /locus_tag="Ndas_0331"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            408820..409365
FT                   /locus_tag="Ndas_0332"
FT   CDS_pept        408820..409365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0332"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="COGs: COG0711 F0F1-type ATP synthase subunit b;
FT                   InterPro IPR005864:IPR002146; KEGG: tfu:Tfu_2411 ATP
FT                   synthase F0, subunit B; PFAM: H+transporting two-sector
FT                   ATPase B/B' subunit; SPTR: C1YH78 ATP synthase subunit b;
FT                   TIGRFAM: ATP synthase F0, B subunit; PFAM: ATP synthase
FT                   B/B' CF(0); TIGRFAM: ATP synthase, F0 subunit b"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65780"
FT                   /db_xref="GOA:D7AVB9"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVB9"
FT                   /protein_id="ADH65780.1"
FT                   /translation="MLVELAADYNILRIDWVKFTFGAIALAVVYFFVARKAVPKVMAVL
FT                   DERHDAIEGGIERAKKAEAEAEVIRQQYREKLEESHREYAQELEKAKEQRAAIIAEARE
FT                   EAQAEARRIVEAAHAQIEADRQQALVQLRNEVGALSTELASRIVGETLSDSAAQNRVID
FT                   RFLDELEQTDSTQQAEVR"
FT   gene            409365..410189
FT                   /locus_tag="Ndas_0333"
FT   CDS_pept        409365..410189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0333"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="COGs: COG0712 F0F1-type ATP synthase delta subunit
FT                   (mitochondrial oligomycin sensitivity protein); InterPro
FT                   IPR000711; KEGG: tfu:Tfu_2410 F0F1 ATP synthase subunit
FT                   delta; PFAM: H+transporting two-sector ATPase delta (OSCP)
FT                   subunit; SPTR: C1YH77 ATP synthase; TIGRFAM: ATP synthase
FT                   F1, delta subunit; PFAM: ATP synthase delta (OSCP) subunit;
FT                   TIGRFAM: ATP synthase, F1 delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65781"
FT                   /db_xref="GOA:D7AVC0"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVC0"
FT                   /protein_id="ADH65781.1"
FT                   /translation="MRGISRTSLAEVTRRLDENVLASAGTPQSGVSLGSELFEVVALLG
FT                   NEHSLRRWLADQANPAEAKSGLIGQLLESRVSPSAVLVAGDVVSARWSGPRDLVDAMER
FT                   MAVYATVAQLQTASGLDELEDELFRFQRIVIAQPALRDALTRDGAAPELRLSLVENLLS
FT                   GKVHPATLVLVGEAVARPRGRTLEQALDNFGQLVAERAKRYVAVVRSAVALSEQQQSRL
FT                   GAALSRAYGRDIHLNIEVAPEIVGGLSIQVGDEVIDGTIAGRIAEAQRRLAG"
FT   gene            410255..411895
FT                   /locus_tag="Ndas_0334"
FT   CDS_pept        410255..411895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0334"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="COGs: COG0056 F0F1-type ATP synthase alpha subunit;
FT                   InterProIPR018118:IPR004100:IPR000793:IPR000194:IPR
FT                   005294:IPR020003; KEGG: tfu:Tfu_2409 F0F1 ATP synthase
FT                   subunit alpha; PFAM: H+transporting two-sector ATPase
FT                   alpha/beta subunit central region; H+transporting
FT                   two-sector ATPase alpha/beta subunit domain protein; PRIAM:
FT                   H(+)-transporting two-sector ATPase; SPTR: C1YH76 ATP
FT                   synthase subunit alpha; TIGRFAM: ATP synthase F1, alpha
FT                   subunit; PFAM: ATP synthase alpha/beta family, beta-barrel
FT                   domain; ATP synthase alpha/beta chain, C terminal domain;
FT                   ATP synthase alpha/beta family, nucleotide-binding domain;
FT                   TIGRFAM: proton translocating ATP synthase, F1 alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65782"
FT                   /db_xref="GOA:D7AVC1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVC1"
FT                   /protein_id="ADH65782.1"
FT                   /translation="MAELTIRPDEIRDALQRFVQSYEPEATRAEEVGTVTYSGDGIARV
FT                   GGLPSAMANELLQFEDGTLGLAQNLEIGEIGVVVLGDFTSIEEGQKVRRTGQLLSVPVG
FT                   DNFLGRVVDPLGAPIDGKGEIESTERRELELQAATVMERKPVHEPLQTGIKAIDSMTPV
FT                   GRGQRQLVIGDRQTGKTAVCIDAIINQKANWESGDPDKQVRCIYVAIGQKGSTIAGVRG
FT                   ALEEAGAMEYTTIVAAPASEAAGFKYLAPYTGSALGQHWMYEGKHVLIVFDDLTKQAEA
FT                   YRAVSLLLRRPPGREAYPGDVFYLHSRLLERCAKLSDEMGKGSMTALPIIETKAGDVSA
FT                   YIPTNVISITDGQVFLESDLFNQGQRPAINVGVSVSRVGGAAQTKAMKKVSGTLRLGLA
FT                   QYRELEAFSAFGSDLDAVSKQQLERGARLMELLKQGQYSPFSMEKQVVSIWAGTTGRVD
FT                   DVPVEDVRRFEEDFLDHLSREHQGILDTIRESGKFEDETEKSLDSALEKFKQGFQTSAG
FT                   TLLGTEAEAEALDEEKVGQETIKVAKGGK"
FT   gene            411899..412819
FT                   /locus_tag="Ndas_0335"
FT   CDS_pept        411899..412819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0335"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /note="COGs: COG0224 F0F1-type ATP synthase gamma subunit;
FT                   InterPro IPR000131; KEGG: tfu:Tfu_2408 H+-transporting
FT                   two-sector ATPase, gamma subunit; PFAM: H+transporting
FT                   two-sector ATPase gamma subunit; SPTR: C1YH75 ATP synthase
FT                   gamma chain; TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   ATP synthase; TIGRFAM: ATP synthase, F1 gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65783"
FT                   /db_xref="GOA:D7AVC2"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVC2"
FT                   /protein_id="ADH65783.1"
FT                   /translation="MGAQLRVYRRRIRSTKSMAKITRAMELIATTRITKAQRAAEAAGP
FT                   YAREITRAVSALASRVTDHPLLTEAENPTRAAVLVITSDKGLAGAFSTNVLKEADSLTQ
FT                   LLREQGKEVLTYMVGRKGVGFYKFRDRPLEAQWEGFTERPTYAHAQEIGSALMEKFSAD
FT                   AADGGVDEIHVVSTEFVSMLTQRAGAVRALPLEVEEVDSSELEAVHGSEPLPLYEFEPS
FT                   AEEVLDQLLPQYVVNRIYFSLLESSASQQASRRAAMKAATDNAEELAKNLTRLANQARQ
FT                   AEITNELSEIVGGADALAAASAGSE"
FT   gene            412825..414267
FT                   /locus_tag="Ndas_0336"
FT   CDS_pept        412825..414267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0336"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="COGs: COG0055 F0F1-type ATP synthase beta subunit;
FT                   InterProIPR020003:IPR000793:IPR018118:IPR003593:IPR
FT                   005722:IPR004100:IPR000194; KEGG: tfu:Tfu_2407 F0F1 ATP
FT                   synthase subunit beta; PFAM: H+transporting two-sector
FT                   ATPase alpha/beta subunit central region; H+transporting
FT                   two-sector ATPase alpha/beta subunit domain protein; PRIAM:
FT                   H(+)-transporting two-sector ATPase; SMART: AAA ATPase;
FT                   SPTR: C1YH74 ATP synthase F1 subcomplex beta subunit;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM: ATP synthase
FT                   alpha/beta family, beta-barrel domain; ATP synthase
FT                   alpha/beta chain, C terminal domain; ATP synthase
FT                   alpha/beta family, nucleotide-binding domain; TIGRFAM: ATP
FT                   synthase, F1 beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65784"
FT                   /db_xref="GOA:D7AVC3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVC3"
FT                   /protein_id="ADH65784.1"
FT                   /translation="MTATVEGTAGAGTATGRISRVTGPVVDVEFPVGSLPAIYNALHTD
FT                   VTIGGKAKTITMEVAQHLGDNLVRTVSLAPQDGLVRGAEVRDTGAPISVPVGDVVKGHV
FT                   FNTLGESLDVPTAELGVTERWPIHRKAPAFDQLESKTEMMVTGIKVIDLLTPYVRGGKI
FT                   GLFGGAGVGKTVLIQEMITRIARNFGGVSVFAGVGERTREGTDLFLEMDEMEVLQDTAL
FT                   VFGQMDEPPGTRLRVALSALTMAEYFRDVQKQDVLLFIDNIFRFTQAGSEVSTLLGRMP
FT                   SAVGYQPNLADEMGQLQERITSTRGHSITSMQAIYVPADDYTDPAPATTFAHLDATTEL
FT                   SRPISQKGIYPAVDPLTSTSRILDPQYVGEEHYQVAQRVKEILQRNNDLQDQIAILGMD
FT                   ELSEEDKIVVNRARRIERFLSQNMFVAEKFTGTPGVFVPLEETIASFKGLCDGEYDHLP
FT                   EQAFLDVGNIDMAVEKAKKLQG"
FT   gene            414347..414736
FT                   /locus_tag="Ndas_0337"
FT   CDS_pept        414347..414736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0337"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="COGs: COG0355 F0F1-type ATP synthase epsilon subunit
FT                   (mitochondrial delta subunit); InterPro
FT                   IPR020546:IPR001469; KEGG: tfu:Tfu_2406 H+-transporting
FT                   two-sector ATPase, delta/epsilon subunit; PFAM: ATPase, F1
FT                   complex, delta/epsilon subunit-like; SPTR: C1YH73 ATP
FT                   synthase F1 subcomplex epsilon subunit; TIGRFAM: ATP
FT                   synthase F1, epsilon subunit; PFAM: ATP synthase,
FT                   Delta/Epsilon chain, beta-sandwich domain; TIGRFAM: ATP
FT                   synthase, F1 epsilon subunit (delta in mitochondria)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65785"
FT                   /db_xref="GOA:D7AVC4"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVC4"
FT                   /protein_id="ADH65785.1"
FT                   /translation="MSKKLFVEIVSPEREIWAGEGDMVIAKTVEGEMGVQPGHVPVLSL
FT                   LAHDAVVRVLGARETGEVRAAAHGGFVSVSGEGRVSILAETAELAEDIDVDRARTALKG
FT                   AAESGDNVALGRARSRLRAAGEEVA"
FT   gene            414764..415246
FT                   /locus_tag="Ndas_0338"
FT   CDS_pept        414764..415246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0338"
FT                   /product="Protein of unknown function DUF2550"
FT                   /note="InterPro IPR019675; KEGG: tfu:Tfu_2405 putative
FT                   secreted/membrane protein; PFAM: Protein of unknown
FT                   function DUF2550; SPTR: C1YH72 Putative uncharacterized
FT                   protein; PFAM: Protein of unknown function (DUF2550)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65786"
FT                   /db_xref="GOA:D7AVC5"
FT                   /db_xref="InterPro:IPR019675"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVC5"
FT                   /protein_id="ADH65786.1"
FT                   /translation="MQRLRPGAPWWESALWVFLALLVVLLALALAVTLRRWILVRRGGA
FT                   VECYLRAVGARGRRGSWRIGFGRYGTENLGWFPIFSLRPRPTARLSRRGLVVVGRRAPA
FT                   GDEGLPADLTVLQVGWLLADGSDPREAAYEIAMGEGTQTGFLSWLESMPPGTHWES"
FT   sig_peptide     414764..414856
FT                   /locus_tag="Ndas_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            415291..415602
FT                   /locus_tag="Ndas_0339"
FT   CDS_pept        415291..415602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0339"
FT                   /product="protein of unknown function DUF77"
FT                   /note="COGs: COG0011 conserved hypothetical protein;
FT                   InterPro IPR002767:IPR016198; KEGG: sgr:SGR_2128
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF77; SPTR: C1YH71 Putative uncharacterized protein; PFAM:
FT                   Domain of unknown function DUF77; TIGRFAM: conserved
FT                   hypothetical protein TIGR00106"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65787"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVC6"
FT                   /protein_id="ADH65787.1"
FT                   /translation="MADMSTIVAFSVAPLGTGESVAPAVARAVRVVRESGLPNETSAMF
FT                   TSVEGEWDEVMDVVKRAVQAAGEGASRVSLTLKADVREGVTDGLRSKVEAVERELGDA"
FT   gene            415686..416201
FT                   /locus_tag="Ndas_0340"
FT   CDS_pept        415686..416201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0340"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_1843 SpoIID/LytB domain protein;
FT                   SPTR: C1YH70 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65788"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVC7"
FT                   /protein_id="ADH65788.1"
FT                   /translation="MLASRLPRLLGPALLVPLLAACQPSGGHVGAVATGHFSAAHVFPV
FT                   LVVAWCGDASPRQIDLTGGGQRIHLIATRDFDGNRTEVDLAAPGDAWRITDGDGRQVYR
FT                   LVPESEGEEYTVGIGSREAPPGEETEHDIGTVAFTTGVLAEEQGVYAAAGGSAEAEFVP
FT                   EEEFPPEC"
FT   sig_peptide     415686..415778
FT                   /locus_tag="Ndas_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            416375..417580
FT                   /locus_tag="Ndas_0341"
FT   CDS_pept        416375..417580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0341"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="COGs: COG0475 Kef-type K+ transport systems membrane
FT                   components; InterPro IPR006153; KEGG: nml:Namu_3791
FT                   sodium/hydrogen exchanger; PFAM: sodium/hydrogen exchanger;
FT                   SPTR: C1YH69 Kef-type K+ transport system, membrane
FT                   component; PFAM: Sodium/hydrogen exchanger family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65789"
FT                   /db_xref="GOA:D7AVC8"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVC8"
FT                   /protein_id="ADH65789.1"
FT                   /translation="MEGDAAQTLGMLLLILMAAFLAPLVTDRLAAFVVVPSVVLEIVFG
FT                   IVLGPSLLGLVRETETVAMLADLGLALLMFMAGYEVDFARIRGRPLRRAALAWLCSVAL
FT                   GMGTGWALFGASQTALIIGLALITTALGTVLPILRDSGGLEGAFGARFMASGTMGEFGP
FT                   IVLITLLLSGYRPLEATLLLVGFFVLAGLSAWRATRPPSERLTRLIRATLGSSTQVAVR
FT                   LCILVIVLFVWLAASLRLDALLGAFAAGIIVRLMFTTHHPGSVERVESKMDAVGFGFLI
FT                   PVFFVVTGVRFDLSALLADPVALLLVPLLLAAFLVVRGGPEYLLSRGDVPGRQRLPLAL
FT                   FSATALPLIAVLATIGTDTGALDGATAAALLGAGVLSVLVLPQVGGALLRRSRTAAGEA
FT                   ER"
FT   sig_peptide     416375..416467
FT                   /locus_tag="Ndas_0341"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(417668..418117)
FT                   /locus_tag="Ndas_0342"
FT   CDS_pept        complement(417668..418117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0342"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: svi:Svir_02890 hypothetical protein; SPTR:
FT                   C1YH68 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65790"
FT                   /db_xref="GOA:D7AVC9"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVC9"
FT                   /protein_id="ADH65790.1"
FT                   /translation="MTTGARPATVTAVFVLLVLIAVYQIIMSLMALVGATAMATVPMIA
FT                   EGAQVPVWAVLTGAAVGLVYGALSAVLAVMVNRNRGGVRTSVTAVNAVYAVVILALLLT
FT                   QVSGVPEIVAALFAVTVAVLANTATAREYFSGAAVPSGHAHPQVG"
FT   sig_peptide     complement(418001..418117)
FT                   /locus_tag="Ndas_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(418365..418961)
FT                   /locus_tag="Ndas_0343"
FT   CDS_pept        complement(418365..418961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0343"
FT                   /product="ATP/cobalamin adenosyltransferase"
FT                   /note="COGs: COG2096 conserved hypothetical protein;
FT                   InterPro IPR017858:IPR016030:IPR002779; KEGG: tfu:Tfu_2404
FT                   ATP:cob(I)alamin adenosyltransferase; PFAM: cobalamin
FT                   adenosyltransferase; SPTR: C1YH67 ATP:cob(I)alamin
FT                   adenosyltransferase; TIGRFAM: ATP/cobalamin
FT                   adenosyltransferase; PFAM: Cobalamin adenosyltransferase;
FT                   TIGRFAM: ATP:cob(I)alamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65791"
FT                   /db_xref="GOA:D7AVD0"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVD0"
FT                   /protein_id="ADH65791.1"
FT                   /translation="MTKRDTDKPVVLSKIYTRTGDSGTTALGDMSRTGKNDTRLVGYAD
FT                   TEEANAAIGTALALGELPDDVRDLLGRIQNELFDLGADLSTPIVPDPEYPPLRVLPEYV
FT                   TRLEEACDAYNADLPTLRSFILPGGSPTVALMHTARIVVRRAERSVWAAVEEHGETVNP
FT                   LTAQYLNRLSDLLFILGRYVAREGDEVLWKPGGER"
FT   gene            complement(419270..420874)
FT                   /locus_tag="Ndas_0344"
FT   CDS_pept        complement(419270..420874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0344"
FT                   /product="Aminopeptidase Y"
FT                   /EC_number="3.4.11.15"
FT                   /note="COGs: COG2234 aminopeptidase; InterPro
FT                   IPR003137:IPR007484; KEGG: tfu:Tfu_2403 aminopeptidase Y;
FT                   PFAM: peptidase M28; protease-associated PA domain protein;
FT                   PRIAM: Aminopeptidase Y; SPTR: C1YH66 Predicted
FT                   aminopeptidase; PFAM: PA domain; Peptidase family M28"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65792"
FT                   /db_xref="GOA:D7AVD1"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR041756"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVD1"
FT                   /protein_id="ADH65792.1"
FT                   /translation="MRTSSEGKPPRGAAAPASRRRAATAGAAAVLMAVAALASSPAHAE
FT                   PGPPGHAGPPDHSGAPGHAGPPAHAGRPGEDPPLSERVSAEAIREHLENLDTIAEYNGG
FT                   NRATNTPGYDVAALYIEDQLERAGYEPYRHEYEYELWRENSPAVLAQTAPEQVAYEAET
FT                   DYATMSYSGSGDVTAPAVAVNADSAASGCSPDDFADFPEGAVAITVRGTCPFSDKVDNA
FT                   AAAGAAAALVVNNEDEVFLGTVGEHSAIPALGVSGTLGAELLAAEGLELRVSVDAEVSN
FT                   ETSYSVLAETPGGRDDNVVVVGGHLDSVEDGPGINDNGSGAAFLLETAIQLAEQEEPDN
FT                   KVRFAFWGTEEEGLVGSTRYVEDLTAQEVEDIALYLNFDMIGSHNYGRFVLDGRMELPG
FT                   SVAAPSGSGAIAKVFEDYFAAQDQVSEPGVLSGRSDYQAFMTAGIPSGGLFSGADGVKT
FT                   EEQVEWYGGTAGEQFDPYYHTADDTMEHINWDSVAELSAAGAHGVEFFAESTLPVNGVL
FT                   RTTAAPDFPRLGDGWLR"
FT   sig_peptide     complement(420743..420874)
FT                   /locus_tag="Ndas_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(421110..421769)
FT                   /locus_tag="Ndas_0345"
FT   CDS_pept        complement(421110..421769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0345"
FT                   /product="protein of unknown function DUF1707"
FT                   /note="InterPro IPR012551; KEGG: tfu:Tfu_2402 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1707; SPTR:
FT                   C1YH65 Putative uncharacterized protein; PFAM: Predicted
FT                   membrane protein (DUF2154); Domain of unknown function
FT                   (DUF1707)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65793"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVD2"
FT                   /protein_id="ADH65793.1"
FT                   /translation="MVEAMSEITPPERGRMRASDADRDSVAHRLREALAEGRLDPDEHS
FT                   ERLDAVYRAKTVGELVPLTEDLPAPNAPGASVAPTDFRSPRPLYGGGRVVDQEPTSRAA
FT                   VVVLGGAARSGNWVVPGAFTAFAALGGIDLDLREARFTQRETTIWVCAVMGGVGITVPD
FT                   DVQVRVHGLPLMGGFGVSENTPSVVDPDAPIVHVRGIAVMGGVGVEYKPRKHQDEE"
FT   gene            complement(421855..422487)
FT                   /locus_tag="Ndas_0346"
FT   CDS_pept        complement(421855..422487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0346"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="COGs: COG2197 Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain;
FT                   InterProIPR000792:IPR001789:IPR011991:IPR011006:IPR 016032;
FT                   KEGG: sro:Sros_1684 response regulator receiver protein;
FT                   PFAM: response regulator receiver; regulatory protein LuxR;
FT                   SMART: response regulator receiver; regulatory protein
FT                   LuxR; SPTR: C1YH64 Two component transcriptional regulator,
FT                   LuxR family; PFAM: Response regulator receiver domain;
FT                   Bacterial regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65794"
FT                   /db_xref="GOA:D7AVD3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVD3"
FT                   /protein_id="ADH65794.1"
FT                   /translation="MIRVLLVDDHPVVREGIRGMLAAEADLTVVGEAASGPEAVVRTAE
FT                   LEPDVVLMDLRMPGGDGVEATGRISAERPGAHVLVLTTYDTDADILRAVEAGATGYLLK
FT                   DTPRAELAEAVRAAARGETVLTGRLAGRLFTGMRRRGEPAAVLSPREVEVLRLASEGRT
FT                   NAAIGRALHISPTTVKTHLMRVYDKLGVGDRTSAVSQAIRRGLLPED"
FT   gene            complement(422484..423812)
FT                   /locus_tag="Ndas_0347"
FT   CDS_pept        complement(422484..423812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0347"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="COGs: COG4585 Signal transduction histidine kinase;
FT                   InterProIPR005467:IPR003594:IPR017205:IPR004358:IPR 011712;
FT                   KEGG: sro:Sros_1685 histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase dimerisation
FT                   and phosphoacceptor region; PRIAM: Histidine kinase; SMART:
FT                   ATP-binding region ATPase domain protein; SPTR: C1YH63
FT                   Signal transduction histidine kinase, COG4585; PFAM:
FT                   Histidine kinase; Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65795"
FT                   /db_xref="GOA:D7AVD4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017205"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVD4"
FT                   /protein_id="ADH65795.1"
FT                   /translation="MIAVAARAPGGGHATPAPSPGPGGAPSGEGAPAGEEGRDERHAWD
FT                   LGVWWDVYFTSVMAAMAAIALVTSDPFWRWPLVGLMAAVTAVYYLFARRLVMREERIRP
FT                   AVLMAVLLVLCLPAVTVNPALTFLVVAVAPLCFITSPVPAAVSTVGAILLVPMPLRGLL
FT                   GLSEWDDIAVNLLINGVMVGYTLWFGGWLGRIIEQSYERANLIRELRESRLEVVRLSEE
FT                   TGAMAERERLAREVHDTLAQGFTSIVALTQAVESEMDSDPELARRHLALMRETAAENLA
FT                   EARAMVAARQPVGLDSQTLEAALDRIASRLGGELGVPVDTEVLGAPTALSNDLQICLLR
FT                   TAQEALANVRRHARAGHVRVALEYTRAPDGSPGPVELTVADDGVGFDPGRTAPGNGLAN
FT                   MRRRADDAGGAVEVGSAPGRGTRVRMSLPLPPQTPRGDEECAP"
FT   gene            complement(423809..424663)
FT                   /locus_tag="Ndas_0348"
FT   CDS_pept        complement(423809..424663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0348"
FT                   /product="ABC-2 type transporter"
FT                   /note="COGs: COG0842 ABC-type multidrug transport system
FT                   permease component; InterPro IPR000412:IPR013525; KEGG:
FT                   saq:Sare_4005 ABC-2 type transporter; PFAM: ABC-2 type
FT                   transporter; SPTR: C1YH62 ABC-type multidrug transport
FT                   system, permease component; PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65796"
FT                   /db_xref="GOA:D7AVD5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVD5"
FT                   /protein_id="ADH65796.1"
FT                   /translation="MSTATDRTPTDPAVPAPSGRLPGALRVGLSRGWLEVREFTHEWES
FT                   VIFTFSLPALILVMFSSIFDGMFDMGMPAVDYYLPGLVAMGLMSVSFQQLGLGIANERE
FT                   RGGLRRLRGTPMPPTAYFVGKTVVVLFLALGQLVLLLGVAVLAFGARMPDGPAAWATLG
FT                   WVFVLGTVSCSLLGIAVSSLARNVRSASGIVVVPFLILQFISGIFVPVVALPDWVLDAA
FT                   ALFPLMWMAQGLRAAFFPAEMAALEPGGSWDLSGVALALGVWCVVGLALVLLTFRWKTR
FT                   KDG"
FT   gene            complement(424660..425565)
FT                   /locus_tag="Ndas_0349"
FT   CDS_pept        complement(424660..425565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0349"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR017871:IPR003593:IPR003439;
FT                   KEGG: sro:Sros_1687 ABC transporter, ATP-binding protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; SPTR:
FT                   C1YH61 ABC-type multidrug transport system, ATPase
FT                   component; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65797"
FT                   /db_xref="GOA:D7AVD6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVD6"
FT                   /protein_id="ADH65797.1"
FT                   /translation="MSETAIEVHGLRKKYGDDEAVAGVDLSVRRGEVFALLGPNGAGKS
FT                   TTVEILEGFRRRDDGTVRVLGEDPGAAGRRWRSRIGVVWQGETLIPQLSVREVVRHFAG
FT                   YYPAPRDPDAVVDLVGLGGKSRARVTSLSGGQRRRLDVALGIIGRPELLFLDEPTTGFD
FT                   PGARRDFWTLIGDLARGGTTIVLTTHYLEEAEALADRVCVVARGRVRAQGSPATLGGRA
FT                   SARATVGWTVDGQRRETRTDEPARVVGELSALFSGEVPGLSVHRPTLEDVYLGLIGEED
FT                   RNRGEGDGRDGRPAQRKVSA"
FT   gene            complement(425754..426431)
FT                   /locus_tag="Ndas_0350"
FT   CDS_pept        complement(425754..426431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0350"
FT                   /product="protein of unknown function DUF91"
FT                   /note="COGs: COG1637 nuclease of the RecB family; InterPro
FT                   IPR002793; KEGG: tfu:Tfu_2401 hypothetical protein; PFAM:
FT                   protein of unknown function DUF91; SPTR: C1YH60 Predicted
FT                   nuclease of the RecB family; PFAM: Protein of unknown
FT                   function DUF91"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65798"
FT                   /db_xref="GOA:D7AVD7"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVD7"
FT                   /protein_id="ADH65798.1"
FT                   /translation="MRLVIARCSVDYVGRLTAHLPMAPRLILIKADGSVSIHADDRAFK
FT                   PLNWMNPPCKLREETVADGPDVWTVTHGKSGEKLVLTVEEVMHDSSHELGKDPGLQKDG
FT                   VEAHLQELLAEHITTLGDGYTLIRREYPTAIGPVDILCRDGANATVAVELKRRGDIDGV
FT                   EQLTRYLELLNRDPQLAPVRGVFAAQEIKPQARVLAEDRGIACVVLDYDELRGIEPDVL
FT                   RLF"
FT   gene            426642..427028
FT                   /locus_tag="Ndas_0351"
FT   CDS_pept        426642..427028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2400 hypothetical protein; SPTR:
FT                   C1YH59 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65799"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVD8"
FT                   /protein_id="ADH65799.1"
FT                   /translation="MSLTVSPDLLEKAKHGPVEDADFIACIKDSLPYAWEVVSGLAEGA
FT                   RTAESGFETNEVPPPGEQERGQLLRLLASDAMRGAVERHFGLRLAFQNCHRVALFAPGA
FT                   EEARAEFTSPRAQLLNQSPELVDC"
FT   gene            427191..428402
FT                   /locus_tag="Ndas_0352"
FT   CDS_pept        427191..428402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0352"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="COGs: COG1250 3-hydroxyacyl-CoA dehydrogenase;
FT                   InterProIPR016040:IPR008927:IPR006108:IPR006176:IPR 013328;
FT                   KEGG: tfu:Tfu_2399 3-hydroxyacyl-CoA dehydrogenase; PFAM:
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein; PRIAM:
FT                   3-hydroxybutyryl-CoA dehydrogenase; SPTR: C1YH58
FT                   3-hydroxyacyl-CoA dehydrogenase; PFAM: 3-hydroxyacyl-CoA
FT                   dehydrogenase, C-terminal domain; 3-hydroxyacyl-CoA
FT                   dehydrogenase, NAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65800"
FT                   /db_xref="GOA:D7AVD9"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVD9"
FT                   /protein_id="ADH65800.1"
FT                   /translation="MVQEFDKVGVVGLGAMGAGIAEVFARAGFNVTGVEIDQAAVDRGR
FT                   AHVDRSLSKAVDKGKLTEDERTGIDARLTFTTSREDLADADFVVEAVPERMDIKKDVFA
FT                   DLDRICPPGTILATNTSSLSVTEIAALTGRADKVVGLHFFNPAPVMKLVEVITTVSTSA
FT                   ETVDVVCEVAKRIGKTPVAVGDRAGFVANALLVPYINDAIRLYERKVATREEIDASVQK
FT                   AAGLPMGPLALADLVGLDICLAVMDVLWEEYRDRRYAASPLLRRMVAAGRLGRKSGQGF
FT                   YAGTDDAPEPRPTGRYAQMIQEEETLDLGEVLLAPQIDDAMRMVGDGYASARDVDTAMR
FT                   FGCGYPKGPTELLEERGAEAVVTTLVAMGEYGLTDIPVPAPLLMDQLPDAPEGEGHGGC
FT                   ACHA"
FT   gene            428612..428944
FT                   /locus_tag="Ndas_0353"
FT   CDS_pept        428612..428944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0353"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /note="KEGG: tfu:Tfu_2398 putative ATP/GTP-binding protein,
FT                   doubtful CDS; SPTR: C1YH57 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65801"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVE0"
FT                   /protein_id="ADH65801.1"
FT                   /translation="MSPRRNSPRRTSARGRKAPGGAPDDEDALMLRVTGGQRRETGPDG
FT                   EWVTRRIPGAAATKVYRCPGCAQEIPTGMAHVVAWRPYGDGDDRRHWHSSCWDRRSHRA
FT                   PRSPRR"
FT   gene            428977..429717
FT                   /locus_tag="Ndas_0354"
FT   CDS_pept        428977..429717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG2945 hydrolase of the alpha/beta
FT                   superfamily; KEGG: tfu:Tfu_2397 hypothetical protein; SPTR:
FT                   C1YH56 Predicted hydrolase of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65802"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVE1"
FT                   /protein_id="ADH65802.1"
FT                   /translation="MEIRATTVLPAVRRPVTLHTADGLELVGELALPEGRDPKATLVCL
FT                   HPLPTAEGMMDSHVLRKASFRLPALADIAVLRFNTRGTGSRHGTSQGEFGEGETEKHDV
FT                   LAAIEFTEFEGLPEPWLLGWSFGTELALKWGADPQVKGAILLSPPLHRAGEADMEVWAR
FT                   TGKPVVALVPEHDDYLRPDEARKRFEPLSQCEVVGVEGAKHLWVGEPYVRRVLDEIVKR
FT                   VNPEAYPLPVEWDGPYEKDVQTLG"
FT   gene            complement(429931..431226)
FT                   /locus_tag="Ndas_0355"
FT   CDS_pept        complement(429931..431226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0355"
FT                   /product="putative cellulose-binding protein"
FT                   /note="KEGG: tfu:Tfu_2396 putative cellulose-binding
FT                   protein; SPTR: C1YH55 Putative uncharacterized protein;
FT                   PFAM: DivIVA protein; TIGRFAM: DivIVA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65803"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVE2"
FT                   /protein_id="ADH65803.1"
FT                   /translation="MPSNNIDTQLNNIFDEDNTPHEFDVVLRGYDRTQVDDYAASLRNE
FT                   LKQYSKQVEKFKAELNAKNRQLQERERPSYSGLGSRIEELLRLAEEQANELVQSAQIDA
FT                   NDIRSAAKIEAADMRAAAESEATEVRALAQREADETRQTAESEAEEISTTARREADELT
FT                   STTEREVQKKRSAVDHEIAEKRATFEGEIAKLRTTTERECAQARAAAKRERDETIQSAK
FT                   SQAEELRKNAERAYAESEARRTEAEDQFELQLADRRAEAERQDAERLAAAQAATQKMVN
FT                   EAEERAASAEQRATKASQQAEQTRRDAENHAKQLVGNAKKNAAQIEAEAKSKAEHQLGD
FT                   AKSEANRIMTAAKKEVDELNRQRDSIQSHLQQLRQLLGGGGPAAPAPVPAAPVAPAPAP
FT                   AAIPQEPAPAAEETRQPVHSGKGADDEDWWQE"
FT   gene            complement(431605..432183)
FT                   /locus_tag="Ndas_0356"
FT   CDS_pept        complement(431605..432183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0356"
FT                   /product="methylmalonyl-CoA epimerase"
FT                   /note="COGs: COG3185 4-hydroxyphenylpyruvate dioxygenase
FT                   and related hemolysins; InterPro IPR004360:IPR017515; KEGG:
FT                   tfu:Tfu_2395 methylmalonyl-CoA epimerase; PFAM:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase; SPTR:
FT                   C1YH54 Methylmalonyl-CoA epimerase; TIGRFAM:
FT                   methylmalonyl-CoA epimerase; PFAM: Glyoxalase/Bleomycin
FT                   resistance protein/Dioxygenase superfamily; TIGRFAM:
FT                   methylmalonyl-CoA epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65804"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVE3"
FT                   /protein_id="ADH65804.1"
FT                   /translation="MSDAPHSASEFITPPSSSTPSSPSAPAAPSSPAVPFSGLTRLDHV
FT                   GIACRDLDASVAFYRSTYGFEVEHEEVNEEQGVREAMLRVNGTDDGGATYLQLLEPTRA
FT                   DSPVAKFLERNGEGVHHVAFGTADVAATAAGVGESGVRVLDARPRRGTAGSRIVFLHPK
FT                   DCGGVLTELVQSADGAHEERDDNRPGISG"
FT   sig_peptide     complement(432109..432183)
FT                   /locus_tag="Ndas_0356"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            432271..433458
FT                   /locus_tag="Ndas_0357"
FT   CDS_pept        432271..433458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0357"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="COGs: COG0183 Acetyl-CoA acetyltransferase; InterPro
FT                   IPR016039:IPR016038:IPR002155; KEGG: tfu:Tfu_2394
FT                   acetyl-CoA acetyltransferase; PRIAM: Acetyl-CoA
FT                   C-acetyltransferase; SPTR: C1YH53 Acetyl-CoA
FT                   acetyltransferase; TIGRFAM: acetyl-CoA acetyltransferase;
FT                   PFAM: Thiolase, C-terminal domain; Thiolase, N-terminal
FT                   domain; TIGRFAM: acetyl-CoA acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65805"
FT                   /db_xref="GOA:D7AVE4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVE4"
FT                   /protein_id="ADH65805.1"
FT                   /translation="MPGSVIVGGARTPTGRLLGSLAGFSAADLGGFAIKAALERAGITG
FT                   EQVGYVVMGQVLQAGAGQIPSRQAAVKAGIPMNVPSVTINKVCLSGLDAIALADQLISA
FT                   GEFDVVVAGGMESMTNAPHLLPKSRKGYKYGSVEVLDATAHDGLTDAFEGDSMGASTER
FT                   HNGKLGIGREEQDAFAARSHQRAAAAAAAGYFDAEIVPVQIPQRKGDPVVFFADEGVRA
FT                   DTTAESLARLRPAFDSEGTITAGSSSQISDGAAAVVVMSRAKAEELGATVLAEIGAHGN
FT                   VAGPDNSLHSQPSNAIRHALGKAGRSVEDLDLIEINEAFAAVGLQSTRDLGVSEDIVNV
FT                   NGGAIALGHPIGASGARIALHLVHELRRRGGGFGAAALCGGGGQGDALLFTVPAE"
FT   sig_peptide     432271..432348
FT                   /locus_tag="Ndas_0357"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            433805..434761
FT                   /locus_tag="Ndas_0358"
FT   CDS_pept        433805..434761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0358"
FT                   /product="LAO/AO transport system ATPase"
FT                   /note="COGs: COG1703 Putative periplasmic protein kinase
FT                   ArgK and related GTPase of G3E family; InterPro
FT                   IPR005129:IPR003593; KEGG: sro:Sros_1698 LAO/AO transport
FT                   system ATPase; PFAM: ArgK protein; SMART: AAA ATPase; SPTR:
FT                   C1YH52 LAO/AO transport system ATPase; TIGRFAM: LAO/AO
FT                   transport system ATPase; PFAM: ArgK protein; TIGRFAM:
FT                   LAO/AO transport system ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65806"
FT                   /db_xref="GOA:D7AVE5"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVE5"
FT                   /protein_id="ADH65806.1"
FT                   /translation="MDTPRLVERVREGDRRALARAITLVENGAAALREIMAGLAPHTGR
FT                   ARVVGFTGSPGVGKSTTTNAVVRAARAKGLTVAVLAVDPSSPFTGGALLGDRVRMQEHA
FT                   TDPGVFIRSMANRGHLGGLSWATPHALRVLDAAGFDVILVETVGVGQAEVEIAGQADTT
FT                   VVLCAPGMGDSVQAAKAGVLEVADVFAINKADREGAKSTLRELRQMIAMKDRTDQEWKP
FT                   PIVMTVASRDEGVDELWERMDQHFAHLEASGDLARRRRARARDEVQAIVLDLLRSRMGG
FT                   AGDDTGLDALAEDVAEGRRDPYAAADVVLKELGTDLG"
FT   gene            435460..436761
FT                   /locus_tag="Ndas_0359"
FT   CDS_pept        435460..436761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0359"
FT                   /product="HNH endonuclease"
FT                   /note="InterPro IPR002711; KEGG: fal:FRAAL4530 hypothetical
FT                   protein; PFAM: HNH endonuclease; SPTR: C1YH50 HNH
FT                   endonuclease; PFAM: HNH endonuclease; Domain of unknown
FT                   function DUF222"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65807"
FT                   /db_xref="GOA:D7AVE6"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVE6"
FT                   /protein_id="ADH65807.1"
FT                   /translation="MIAAPKVAPGECSPAVAALAGAHKIIDQALNAEVPPGADETAAEE
FT                   IAALWAQLDQIRYQALTRMARLYARGEVARYSGYSTLDKWITHHCKVPTAQAKDLARLA
FT                   QHVQEETLPATAQAVAEGRVVLGEAVAIAKATDKAVQTRDEDHFPDEGEYRQGFEAALV
FT                   AAKAERPALSVNQLQSVARQVAYRLDPHRLDRDHETAHAARGLTVHDTFQGSYQLQAWG
FT                   GSGDALIVRAAIDTFTTPPGEGDTRSRSQREHDALIAALRFATTHTGCDNAPAPLAQIR
FT                   IVVPVQTYLDAQGQEVPALDEHGRVIPVGLVHELAADSEVVRMLTAPPTGQVLDVGHSR
FT                   RLASTRQRTAAFHGHATCAHPGGCEVPVALCQADHVQSFSRGGRTVVANLQPLCGPHNR
FT                   AKYQRELRTHHQGRRRGRGGDHPPGGEPDPPPRE"
FT   gene            complement(437530..439488)
FT                   /locus_tag="Ndas_0360"
FT   CDS_pept        complement(437530..439488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0360"
FT                   /product="glycoside hydrolase family 18"
FT                   /note="COGs: COG3325 Chitinase;
FT                   InterProIPR003961:IPR001919:IPR001579:IPR012291:IPR
FT                   008957:IPR013781:IPR017853:IPR008965:IPR011583:IPR001223;
FT                   KEGG: sro:Sros_7591 chitinase-like protein; PFAM: glycoside
FT                   hydrolase family 18; cellulose-binding family II;
FT                   Fibronectin type III domain protein; SMART: chitinase II;
FT                   cellulose-binding family II; Fibronectin type III domain
FT                   protein; SPTR: C1YH49 Chitinase; PFAM: Cellulose binding
FT                   domain; Glycosyl hydrolases family 18; Fibronectin type III
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65808"
FT                   /db_xref="GOA:D7AVE7"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVE7"
FT                   /protein_id="ADH65808.1"
FT                   /translation="MRARLRQRIAALAAAVVLPLALAPVPAASADTAGVTVTYVETSRW
FT                   ETGYGGQLTIANGSGSALTDWSIGFRLPSGTAITSLWNATLSRSGDAYTVTPPSWGASV
FT                   PAGGSYSIGFNGTHGGGDTAPVDCTVNGGGCSGEPGEEDTEPPTAPTGLTVTGTTSTTV
FT                   ALQWGPADDNAGVAGYEVLSGGEVVRAVTGTTATVTGLAPQTEHTFTVRAYDTSNNRGP
FT                   ESGAVTATTDADGGGPTDPPQERRVAYFTQWGIYGRDYLVNDLVTSGTAEKLTHINYAF
FT                   GNINANGECFMANQLGQGDAWADYGRSFGAADSVDGVGDTWDQDLRGNFNQLRELKEMY
FT                   PDLKVNISLGGWTWSEHFSDAALTAESRERMVSSCIDQFLRGNLPVFDGAGGPGSAYGV
FT                   FDGIDLDWEWPGSAGHEHNTVRPEDKENFTALVQEFRDQLDALEAETSRQYELTAFLPA
FT                   DPEKVELGFEMPQLMTDFDFITVQGYDYHGGWETTANHQSNLLLDPADPGPDLYSTETT
FT                   VQAYLDRGVDPADMVLGVPFYGRGWTGVEPGPNGDGLFQSATGPAPGSYEAGIDDWKVL
FT                   KDLVGTGGYELYRDDALGTAWLYNGSTFWTYDDEISMAQKTDWAQAQGLGGVMIWSVDG
FT                   DDANGSLMNAIDTALAG"
FT   sig_peptide     complement(439399..439488)
FT                   /locus_tag="Ndas_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(439912..441591)
FT                   /locus_tag="Ndas_0361"
FT   CDS_pept        complement(439912..441591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0361"
FT                   /product="glycoside hydrolase family 18"
FT                   /note="COGs: COG3325 Chitinase;
FT                   InterProIPR001919:IPR001579:IPR012291:IPR013781:IPR
FT                   017853:IPR008965:IPR011583:IPR001223; KEGG: sgr:SGR_2458
FT                   putative chitinase; PFAM: glycoside hydrolase family 18;
FT                   cellulose-binding family II; SMART: chitinase II;
FT                   cellulose-binding family II; SPTR: C1YH48 Chitinase; PFAM:
FT                   Cellulose binding domain; Glycosyl hydrolases family 18"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65809"
FT                   /db_xref="GOA:D7AVE8"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVE8"
FT                   /protein_id="ADH65809.1"
FT                   /translation="MRARRFSTRLAAAAAAVLLAPLAVTAVPAAAAEETGPADLTVTYT
FT                   ESARWNTGYTGQITVHNASDTPVEDWAVEFSLPDGSRIHELWNATLAGTPGGYTITPPH
FT                   WGASVPAGGSYSFGFNGLHSDGATDLVDCLVNGSPCAGDDGSGPSHDSYSVAYYTQWSA
FT                   GERDYHVRDLVDSDSAEKLTHINYAFGNVTAEGVCATGDGTSQEGAVADYAHPVPAAES
FT                   VDGTADDPDQELRGNFNQLRELKEMYPDLKVNISLGGWEWSRYFSDAALTEESRERLVS
FT                   SCVDLYLRGNLPEVDGAGGEGAAYGVFDGIDLDWEWPGSDGHPHNTVRPEDKENFTALV
FT                   QEFRDQLDAFGEETDRHYELTAFMPAGGWRLDAGYELDELMTDFDFVTVQGYDYHGTWE
FT                   STTNHQSNLVVDARDPQPVISTELIVQAYLDRGVDPGKLVLGVPFYGQGWTGVEPGPDG
FT                   DGLFQTATGPAQGAYAAGTEDWKVLEEKVESGEFEVFRNDGAGTAWIYDGQTLWNYDDE
FT                   TAMTQKTDWARDKGLGGVMIWSIDGDDAEGSLMAAIDTALSD"
FT   sig_peptide     complement(441499..441591)
FT                   /locus_tag="Ndas_0361"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            442270..442803
FT                   /locus_tag="Ndas_0362"
FT   CDS_pept        442270..442803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0362"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="COGs: COG1846 Transcriptional regulators; InterPro
FT                   IPR000835:IPR011991; KEGG: tfu:Tfu_2393 regulatory protein,
FT                   MarR; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; SPTR: C1YH47 Transcriptional regulator; PFAM:
FT                   MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65810"
FT                   /db_xref="GOA:D7AVE9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVE9"
FT                   /protein_id="ADH65810.1"
FT                   /translation="MGNPLNLPFDPIERAHDNWTRRWGPSPAMAAVTSVMRAQQILIGE
FT                   LDGALKPFGLTFARYEALVLLTFSGSGSLPLGKIGERLMVHPTSVTNTIDRLEGQGFVR
FT                   RRPNPSDGRGVLAEITDAGRRVTEEATGALLSMDFGLGCYSDEELWRMHEMFTRLRVDF
FT                   GDFPEPVAEAAEGR"
FT   sig_peptide     442270..442359
FT                   /locus_tag="Ndas_0362"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            442875..444602
FT                   /locus_tag="Ndas_0363"
FT   CDS_pept        442875..444602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0363"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="COGs: COG1884 Methylmalonyl-CoA mutase N-terminal
FT                   domain/subunit; InterPro
FT                   IPR014348:IPR006099:IPR006098:IPR016176; KEGG: sco:SCO5415
FT                   isobutyryl-CoA mutase A; PFAM: methylmalonyl-CoA mutase;
FT                   PRIAM: Methylmalonyl-CoA mutase; SPTR: C1YH46
FT                   Methylmalonyl-CoA mutase; TIGRFAM: methylmalonyl-CoA
FT                   mutase, large subunit; PFAM: Methylmalonyl-CoA mutase;
FT                   TIGRFAM: methylmalonyl-CoA mutase N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65811"
FT                   /db_xref="GOA:D7AVF0"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVF0"
FT                   /protein_id="ADH65811.1"
FT                   /translation="MANTTSGPSGGGAREIEAGRERWQRRYDSARTRDADFTSLSGRTL
FT                   EPVYGPRPGAEVPGFERIGWPGEYPYTRGLHATGYRGRAWTIRQFAGFGNARQTNERYK
FT                   MILASGGGGLSVAFDMPTLMGHDSDSPHALGEVGHCGVAIDSVADMDLLFDGIPLGETT
FT                   TSMTISGPAVPAFCMYLVAAERQGVDIRTLNGTLQTDIFKEYIAQKEWLYPPEPQLRLI
FT                   GDLMEYCAADIPAYKPLSVSGYHIREAGATAAQELAFTLADGFGYVELGLSRGLDVDTF
FT                   APGLSFFFDAHIDFFEEIAKFRAARRIWARWLRDVYGARTEKAQWLRFHTQTAGVSLTA
FT                   QQPYNNVVRTAVEALSAVLGGTNSLHTNALDETLALPTEQSAEIALRTQQVLMEETGIV
FT                   NVADPLGGSWYLESLTDELEAEAERIFAHILRMGGGEGAEHAIGPMTSGILAGIENGYF
FT                   SSEIAESAFQYQQALEKGDKKIVGVNCHTNTVSGELDILRISHEVEHEQKRALAERRAA
FT                   RDGAAVDRALAALLAGVRSGGGNLIPLIMDAARAEATLGEICATMGEEFGTYTEDPRF"
FT   gene            444785..445747
FT                   /locus_tag="Ndas_0364"
FT   CDS_pept        444785..445747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0364"
FT                   /product="putative thioredoxin"
FT                   /note="COGs: COG3118 Thioredoxin domain-containing protein;
FT                   InterPro IPR012335:IPR012336; KEGG: tfu:Tfu_2392 putative
FT                   thioredoxin; SPTR: C1YH45 Thioredoxin domain-containing
FT                   protein; PFAM: Thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65812"
FT                   /db_xref="GOA:D7AVF1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVF1"
FT                   /protein_id="ADH65812.1"
FT                   /translation="MQPSDFSPNSAVDLGARKAAMEREAKQRAAESAGRSNPYAVNVDE
FT                   ATFQAQVLERSMSTPVVLAVLAGWSEQSKQVEDALDKISAASGGTWFLAKVDSEASPQL
FT                   VQALRVPTTPMIVVVIQGQLLPGPAGPATEEQLTAWLVEAFAALKEQGALPPGHPGTIT
FT                   GEPGAEGAQGAQAAQPEEPQGRPVDIEAQEALDRGDFEAAAAVYAKAVEADSGDTESRA
FT                   KLAQVRLVGRLQEVDAGAALQAAADRPEDVAAQTTAADVEMYGGRFEDAFARLVDTVRI
FT                   TSDEDRDRARTHLLGLFELLPPGDPRVNAARRKLTSALF"
FT   gene            445899..446627
FT                   /locus_tag="Ndas_0365"
FT   CDS_pept        445899..446627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2391 hypothetical protein; SPTR:
FT                   C1YH43 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65813"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVF2"
FT                   /protein_id="ADH65813.1"
FT                   /translation="MATDDTTDRRGGPLVTISATYGAGGSAVGPAVAARLGVAFLDRAV
FT                   PSAVAARIGCSLDEALQRDDRAPGRLERLLSSAARLPTVTLGSVDTALIGSTDEEGRLL
FT                   YDHEFVEQTERVLGEVARQGGVVLGRAGAVVLRDRPGALHVRLDGDPDARLRRARGLWE
FT                   SGDHGEWTGTDSDEPPNARLLDDNDRARAAYVRRFYRADPADPRHYHLVLDAVSLSLEA
FT                   CVDLVVRAARDRATVPSGGA"
FT   gene            446930..448336
FT                   /locus_tag="Ndas_0366"
FT   CDS_pept        446930..448336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0366"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="COGs: COG0281 Malic enzyme; InterPro
FT                   IPR016040:IPR001891:IPR012301:IPR012302; KEGG: tfu:Tfu_2390
FT                   malate dehydrogenase (oxaloacetate decarboxylating); PFAM:
FT                   malic protein NAD-binding; malic protein domain protein;
FT                   PRIAM: Malate dehydrogenase (oxaloacetate-decarboxylating);
FT                   SPTR: C1YH42 Malic enzyme; PFAM: Malic enzyme, NAD binding
FT                   domain; Malic enzyme, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65814"
FT                   /db_xref="GOA:D7AVF3"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVF3"
FT                   /protein_id="ADH65814.1"
FT                   /translation="MATLPSVSYSITVRLELDAGGSAVGSLTNAVEQVGGMITALDVAA
FT                   AGHERIRIDVTCAARDTEHAQAIVDALGAVEGVVVHKVSDRTFLMHLGGKIEMKSKVPL
FT                   RNRDELSMAYTPGVARVSQAIAANKDDARRLTIKRNSVAVVTDGSAVLGLGNIGPEAAM
FT                   PVMEGKAALFKRFADIDAWPIALDTQDVDEIVRTVQVLAPGFGGINLEDISAPRCFEVE
FT                   ARLRELLDIPVFHDDQHGTAIVVLAALRNALRVVGKKLGEVRIAMSGAGAAGTAILKLL
FT                   MHAGARDVIVSDVHGAVHAGREDLDPNLRWIAEHTNPEGYSGDLRGAVAGADVFIGVSA
FT                   PNLLNGDDIAEMNEDAIIFALANPDPEVDPDVAHLHASVVATGRSDYPNQINNVLVFPG
FT                   FFRGLLDAQSHDVTSDMMVAAAEALADVVTEDELGPNYIIPSVFHSDLSTHVATAVREV
FT                   AQRGQAAAQA"
FT   gene            448389..448967
FT                   /locus_tag="Ndas_0367"
FT   CDS_pept        448389..448967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0367"
FT                   /product="protein of unknown function DUF179"
FT                   /note="COGs: COG1678 Putative transcriptional regulator
FT                   protein; InterPro IPR003774; KEGG: tfu:Tfu_2389
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF179; SPTR: C1YH41 Predicted transcriptional regulator,
FT                   COG1678; PFAM: Uncharacterized ACR, COG1678"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65815"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVF4"
FT                   /protein_id="ADH65815.1"
FT                   /translation="MDQPMTGRLLVAAPMLQEDSFRRSVVFVVDDAADGTLGVILNRPL
FT                   GMAVDEVVTDWGAYASEPAVMFSGGPVGLGSGIALGAAGPGEPPPGWSPLEGLDPHLGL
FT                   DGIGVVDLDGPAQVLGGALGAFRLFAGYAGWSAGQLAGEIEEGAWYVVDAVADDVFTTA
FT                   PEGLWSRVLRRQGGEMALLSTFPDDPAMN"
FT   gene            449037..449273
FT                   /locus_tag="Ndas_0368"
FT   CDS_pept        449037..449273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2388 hypothetical protein; SPTR:
FT                   C1YH40 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF3039)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65816"
FT                   /db_xref="InterPro:IPR021400"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVF5"
FT                   /protein_id="ADH65816.1"
FT                   /translation="MDILNKVLPDSETKPDISHDGGDRERFAHYVQKDKITASAVTGDP
FT                   VIALCGKVWVPNRDPKKFPVCPECKKVYEEMMK"
FT   gene            complement(449487..451379)
FT                   /locus_tag="Ndas_0369"
FT   CDS_pept        complement(449487..451379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0369"
FT                   /product="Htaa domain protein"
FT                   /note="InterPro IPR007331:IPR017909:IPR019948; KEGG:
FT                   cgt:cgR_0461 hypothetical protein; PFAM: Htaa domain
FT                   protein; Gram-positive anchor; SPTR: C1YH39 Htaa protein;
FT                   PFAM: Htaa; TIGRFAM: LPXTG-motif cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65817"
FT                   /db_xref="GOA:D7AVF6"
FT                   /db_xref="InterPro:IPR002186"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007331"
FT                   /db_xref="InterPro:IPR027273"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVF6"
FT                   /protein_id="ADH65817.1"
FT                   /translation="MTTTPTRGSTAPGGLRRTLRLLTAYAGAAALGGTFAVAAAPTASA
FT                   DEVLPLTGGSASWGVKESFRNYVGSPIAHGGYEASDGATLLADGTVDFPTAGGTVSKED
FT                   ASGDVSFSGTVVFSGHDYGQGPVLEVRVSDPRVVFEGDTATVFADVTSREFGGANPNLP
FT                   PGGLVEYGEVAVTELTGAEVAVEGEEITFTSTAGTLHADAVEPFAGFYAAGAPMDPLSF
FT                   TAGIDDVTDPGGPGEPVHDPRVTVAPASDLDPAGDTVTVEGTGFRPGQGVYAALTAVPQ
FT                   SADSYPAHHTGAVWLRGADAPGEDGSFSAELRVTGSYETDGTVHDCARTQCYVAVFNDH
FT                   TDIANRDQDVWTPVSFTAVEEPTEEPTDPTDPTGEPTDPAEGPLTVHNGRADWGVKESF
FT                   RDYITGSIARGEITPSDGASQNEDGTFAFTDGSGEVDLSASTADIAFEGTVLFEGHVHD
FT                   GADPLLSMTVSDPRVTVDGAAGVLYADVTSKPLSGQEPVTYEDVALADLDLTGVDYTLE
FT                   EGVLSWEPIPATLTAEGVPAFADFYAAGEQLDPVSLTVSVDEEVRVPGGGGDGGPTPGP
FT                   GDGDGGGTPGLPNTGVALAGLLTAAAVAVGAGGAAVYAARRRGPAPDGDGESAV"
FT   sig_peptide     complement(451245..451379)
FT                   /locus_tag="Ndas_0369"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(451807..453354)
FT                   /locus_tag="Ndas_0370"
FT   CDS_pept        complement(451807..453354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0370"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="InterPro IPR019931; KEGG: tfu:Tfu_2387 hypothetical
FT                   protein; SPTR: C1YH38 Putative uncharacterized protein;
FT                   TIGRFAM: LPXTG-motif cell wall anchor domain protein;
FT                   TIGRFAM: LPXTG-motif cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65818"
FT                   /db_xref="GOA:D7AVF7"
FT                   /db_xref="InterPro:IPR027273"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVF7"
FT                   /protein_id="ADH65818.1"
FT                   /translation="MQAALSLRPRNGRRRGLVPPLVLTAALVLSAPAAALAQSVPDPSP
FT                   DRSPGQDPARPRVTTVDRARGLDPGRDTVTVSGIGHDPGSLLEAATWAVPGAEDGGGEP
FT                   VADTANAVTVEVDARGTFSLSLATGTGFAADAGLDASVTPFEVRLVEVGAGPGGEDTAE
FT                   GAPPAPEADADAESSEEDRAAAETTDAADADPAGAADADPAGAAVGTRGGDTARRAPEV
FT                   LAGPGRSAPVTLFSAPAPDAVVGRVPVAFSAPAPRTEPGTSPQSRPQSAVPAAPVPREP
FT                   GDPTLSVSKTSGLDPEGETVTVTGSGYDTAKGIYVALCDTSGAGPDRAPSPCVGGVDME
FT                   GSSGASVWVSSNPPPYGEGLAVPYTGGGTDGGFSVELRVRASDENTDCADPATECAVVT
FT                   RNDHTRSSDRGQDVFVPVSFGGSGNGGDSGTGGGSGGSGDSGDSGGSGSGGGSGSGSGG
FT                   TGDAGTGGGSGSGSGPLPRTGSTLYGLVLAAAVAVLTGTAALVATRRRARGAPADTV"
FT   sig_peptide     complement(453244..453354)
FT                   /locus_tag="Ndas_0370"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            453603..454745
FT                   /locus_tag="Ndas_0371"
FT   CDS_pept        453603..454745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0371"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG4558 ABC-type hemin transport system
FT                   periplasmic component; InterPro IPR002491; KEGG:
FT                   tfu:Tfu_2386 binding-protein-dependent transport
FT                   lipoprotein; PFAM: periplasmic binding protein; SPTR:
FT                   C1YH37 ABC-type hemin transport system, periplasmic
FT                   component; PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65819"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVF8"
FT                   /protein_id="ADH65819.1"
FT                   /translation="MPHTVPRPLPRERSRPTGPRLAALRVRPAAPRALAAACALVLALT
FT                   GCTGGASGGADPAASGDAPGIPDLAENRLQILEEPAAPELPVTVDSVVLDPYRTSSDPL
FT                   EYEQVEVTDASRVLPLTGSLAEIVFTLGLGDNVVGRDVGATFEEAAHLPTVSEAHEVSA
FT                   ESVLSLEPTVVLADTQTGPPEAIEQIQSSGVPVVIVEEAWSIDDMYPRFERVAEALGVP
FT                   ASGTALAERTRGQMAEVRADSTAVSGDPLVAFLYLRGTAGVYLLGGPGSGADAMLAEIG
FT                   ARDAGVEMGLTTPFTPITTEALIAAQPDVLLVMTKGLESVGGIEGLVQIPGVAQTPAGA
FT                   ARAVVDFEDGVLLNFGPRTPQVVAALADELAAVSAGEGER"
FT   sig_peptide     453603..453764
FT                   /locus_tag="Ndas_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            454742..456031
FT                   /locus_tag="Ndas_0372"
FT   CDS_pept        454742..456031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0372"
FT                   /product="transport system permease protein"
FT                   /note="COGs: COG0609 ABC-type Fe3+-siderophore transport
FT                   system permease component; InterPro IPR000522; KEGG:
FT                   tfu:Tfu_2385 FecCD-family membrane transport protein; PFAM:
FT                   transport system permease protein; SPTR: C1YH36 ABC-type
FT                   Fe3+-siderophore transport system, permease component;
FT                   PFAM: FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65820"
FT                   /db_xref="GOA:D7AVF9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVF9"
FT                   /protein_id="ADH65820.1"
FT                   /translation="MTAPRRPADDDAQGLPEGSVRAATGTPSPEQGGTSTREPVPPAVP
FT                   SGTSFTPATPKVPSEAAVPTTAPAASKATTAPAAPRDRRALRRLRAALLLASLTGGLVA
FT                   VAVVAAGAGAYPIPPGQVAASLLHALGLEAGTPPDRIGHTVLWDVRLPRVVLAVMVGAA
FT                   LGAAGAMMQGVFGNPLAEPGVIGVSSGAAVGAIAVIFTGLTILGHWTIIASSFVFGLAT
FT                   TLFVYVFARSRGRTEVVTLLLTGIAVNAIAGAAIGLMTNFSQDAEIQTITFWQLGSVST
FT                   ATWAKVAAIAPCLLLGLSVIPFHARRLDLLALGEGPARHLGVDVERTRLVLICAMALLT
FT                   SAAVAFAGIVSFVGLVVPHIIRMVTGPGHRVLLPASALGGGLLLLAADLLARTVAAPAE
FT                   IPLGVVTAALGGPFFFYLLYRTRARQGGWS"
FT   gene            456028..456909
FT                   /locus_tag="Ndas_0373"
FT   CDS_pept        456028..456909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0373"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1120 ABC-type cobalamin/Fe3+-siderophores
FT                   transport systems ATPase components; InterPro
FT                   IPR003439:IPR015863:IPR017871:IPR003593; KEGG: sco:SCO2274
FT                   hemin importer ATP-binding subunit; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: C1YH35 ABC-type
FT                   cobalamin/Fe3+-siderophore transport system, ATPase
FT                   component; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65821"
FT                   /db_xref="GOA:D7AVG0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015863"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVG0"
FT                   /protein_id="ADH65821.1"
FT                   /translation="MSALVRLRRRVAAAASPLYRPPVRPAPVPPGEEILRAEGVTVRRG
FT                   GRALLDGVGLTVRAGELLALVGPNGAGKSTLLAALSGDVTGAPGRGEADTGTVRLHGRP
FT                   LADWTPPELALRRAVLPQEAAVSFPFPVADIVSMGRAPWAGLAAAAEDEALTAAAMEGT
FT                   GVSDLAERRFPTLSGGERARVMLARVLAQDTQLLLLDEPTAALDIRHQELVLDLASQLA
FT                   ERGGAVIVVLHDLGLAAAYAHRVAILSRGRVAAQGSPADVFTASLLSSVYQHEVEVLPH
FT                   PRTGVPLVVPLR"
FT   gene            456951..457757
FT                   /locus_tag="Ndas_0374"
FT   CDS_pept        456951..457757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0374"
FT                   /product="sortase family protein"
FT                   /note="COGs: COG3764 Sortase (surface protein
FT                   transpeptidase); InterPro IPR005754; KEGG: tfu:Tfu_2383
FT                   peptidase C60, sortase A and B; PFAM: peptidase C60 sortase
FT                   A and B; SPTR: C1YH34 Sortase family protein, LPXTG-site
FT                   transpeptidase; TIGRFAM: sortase family protein; PFAM:
FT                   Sortase family; TIGRFAM: LPXTG-site transpeptidase
FT                   (sortase) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65822"
FT                   /db_xref="GOA:D7AVG1"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVG1"
FT                   /protein_id="ADH65822.1"
FT                   /translation="MVSTTERQFHEGPRPGRGEGRGRRASGGRRRRRPRPRATPGDVVR
FT                   GIVRFFGEIMLTAGLLMLFYAGYEVYGSQWETDREQQDLAQGLEEAWSAEQAAAEAGPD
FT                   SEPLPGSADSRLYVPSLDLDWVVVNGTTQEDIRYSPGHYTEYPSSPGGEGNYAVAAHRT
FT                   PGLFWDLDLLRNGDVMVLEDGENFYTYEVFRDETVLPTDVWVIEPDPFDEATDEEPGRS
FT                   LLTLTTCAPKLNNTHRLIVWAELVETTPKSEGMPDSIAHMAPQASE"
FT   gene            457767..458003
FT                   /locus_tag="Ndas_0375"
FT   CDS_pept        457767..458003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2382 hypothetical protein; SPTR:
FT                   C1YH33 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65823"
FT                   /db_xref="GOA:D7AVG2"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVG2"
FT                   /protein_id="ADH65823.1"
FT                   /translation="MYGLIWRVLPGPWIAKLIMALGLVVGAALLLWFFAFPAISPHMPF
FT                   NDGAVDVGGAQTGSGAESGGGSGGEAGTDGASG"
FT   sig_peptide     457767..457928
FT                   /locus_tag="Ndas_0375"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            458162..459886
FT                   /locus_tag="Ndas_0376"
FT   CDS_pept        458162..459886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0376"
FT                   /product="type III restriction protein res subunit"
FT                   /note="COGs: COG1061 DNA or RNA helicase of superfamily II;
FT                   InterProIPR014021:IPR001650:IPR014001:IPR003593:IPR 006935;
FT                   KEGG: tfu:Tfu_2381 ATPase; PFAM: type III restriction
FT                   protein res subunit; SMART: DEAD-like helicase ; AAA
FT                   ATPase; SPTR: C1YH32 DNA/RNA helicase, superfamily II;
FT                   PFAM: Type III restriction enzyme, res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65824"
FT                   /db_xref="GOA:D7AVG3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVG3"
FT                   /protein_id="ADH65824.1"
FT                   /translation="MTVTQTTTEDRLRGLRAWQREAFEEYFRREPRDFLAVATPGAGKT
FT                   TFALTLASELLQRHTVRAITIVCPTDHLKKQWAEAAARFGIAIDPEFRNGQGALGRQYV
FT                   GVAVTYAQVAAHPMLHRNRTEARKTLVIFDEVHHAGDALSWGDAAREAFDPAARRLSLT
FT                   GTPFRSDINPIPFVDYVQDSAGVRRCSWDYSYGYGPALADGVVRPVIFMAYSGEMRWRT
FT                   RAGDELAARLGEPLTQDALSQAWRAALDPKGDWIKRVLQAADRRLTEVRKTHPDAGALV
FT                   IASDHENARAYSRILRQITGKGATVILSDDPGASKKISRFAAGDDRWMVAVRMVSEGVD
FT                   VPRLMVGVYATSTSTALFFAQAIGRFVRVRQRGEVASVFLPSVPTLLEYAGEMERERDH
FT                   VLDRTPGEGDEYPEEDLLREANKKRDTPDAGEELPFETMESAAEFDRALYDGAEYGGVP
FT                   GSTEEEDFLGLPGLLDPQQVSQLLRKRKADLKASEVKARKVEEPAEEDGPTHQVLADLR
FT                   RELSGLVGAWHHRTGKPHGVIHNELRRACGGPPVAQATPTQIRERIAKIRVWAVGGR"
FT   gene            460022..461005
FT                   /locus_tag="Ndas_0377"
FT   CDS_pept        460022..461005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0377"
FT                   /product="Peptidase M43B pregnancy-associated plasma-A"
FT                   /note="InterPro IPR008754; KEGG: kse:Ksed_17060
FT                   Pregnancy-associated plasma protein-A; PFAM: Peptidase M43B
FT                   pregnancy-associated plasma-A; SPTR: C1YH31
FT                   Pregnancy-associated plasma protein-A; PFAM:
FT                   Pregnancy-associated plasma protein-A"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65825"
FT                   /db_xref="GOA:D7AVG4"
FT                   /db_xref="InterPro:IPR008754"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVG4"
FT                   /protein_id="ADH65825.1"
FT                   /translation="MCGFALAGMVTVTAPGTVATDSPRAQLAPGESEALEPCLPGAARV
FT                   TDPDAAGRPPGGSEVTPRQAALYEQQLQEALVPLRGQDLQPPHTVPVVVHVISAEDGRG
FT                   EVSDERVQRQIDVLNAAYGGDTAADPARAAEAARAGGTSDAEPIDTGFRFELSEVTRTT
FT                   NDEWFTSFAEHRDTVHARLRQGDAATLNIYTSNLGTGLLGYSSFPQDYEDAPEQDGVVI
FT                   SHDTLPGGDRDRFNLGHTGTHEVGHWLGLFHTFQNGCSSPGDYVDDTAYEREAASGCPE
FT                   GRDTCPEQEGEDPVTNFMNYSDDACMTHFTKGQAERMVEHWAAFRA"
FT   sig_peptide     460022..460123
FT                   /locus_tag="Ndas_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            461073..462080
FT                   /locus_tag="Ndas_0378"
FT   CDS_pept        461073..462080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0378"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="COGs: COG0180 Tryptophanyl-tRNA synthetase; InterPro
FT                   IPR014729:IPR002306:IPR002305:IPR001412; KEGG: tfu:Tfu_2376
FT                   tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib; PRIAM: Tryptophan--tRNA ligase; SPTR:
FT                   C1YH30 Tryptophanyl-tRNA synthetase; TIGRFAM:
FT                   tryptophanyl-tRNA synthetase; PFAM: tRNA synthetases class
FT                   I (W and Y); TIGRFAM: tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65826"
FT                   /db_xref="GOA:D7AVG5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVG5"
FT                   /protein_id="ADH65826.1"
FT                   /translation="MAANTYLTGIKPTGDFHLGNYIGAIKPALSAATAYDTYYFIADYH
FT                   ALNTIKDADELRHSIRSGAATWLACGLDPERTIVYQQSRVPETFELTTILSALTPKGLM
FT                   NRAHAYKAARDRNNEAGITDLDAGINMGLYNYPILMAADILVMEGTHVPVGRDQSQHIE
FT                   YTADIAGYFNHRFGESYSFPVPKGVIDDSDASILPGVDGRKMSKSYDNHIPLFLPENKL
FT                   KKAVRRIPTDSTPVEDPKDPDSSVPFQLLTHFADAQKVSEVRKRLEAGGMGWGDLKNEL
FT                   FEAINAELGPKRERYEELMADPGRIDAVLAAGSERARERARATLERVRAAVGVA"
FT   gene            complement(462139..462693)
FT                   /locus_tag="Ndas_0379"
FT   CDS_pept        complement(462139..462693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0379"
FT                   /product="isochorismatase hydrolase"
FT                   /note="COGs: COG1335 Amidase related to nicotinamidase;
FT                   InterPro IPR000868; KEGG: ami:Amir_1003 isochorismatase
FT                   hydrolase; PFAM: isochorismatase hydrolase; SPTR: C1YH29
FT                   Nicotinamidase-like amidase; PFAM: Isochorismatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65827"
FT                   /db_xref="GOA:D7AVG6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVG6"
FT                   /protein_id="ADH65827.1"
FT                   /translation="MVDVQKDFCEGGNLGVAGGASTAAAVTEYARASDYDHVVATRDFH
FT                   IDPGEHFSEEPDFVDSWPRHCEAGTPGVEFHPGFDASLAEEVFDKGHYTAAYSGFEGVT
FT                   GEGGVTLGSWLRERGVDEVDVVGIAMDHCVKATALDAVAEGLRTRVLLGLTAGVSRPTV
FT                   DAALERLREAGVDLEGEPLVG"
FT   sig_peptide     complement(462598..462693)
FT                   /locus_tag="Ndas_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(462842..464143)
FT                   /locus_tag="Ndas_0380"
FT   CDS_pept        complement(462842..464143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0380"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /note="COGs: COG1488 Nicotinic acid
FT                   phosphoribosyltransferase; InterPro
FT                   IPR006405:IPR007229:IPR015977; KEGG: tfu:Tfu_2373
FT                   nicotinate phosphoribosyltransferase; PFAM: Nicotinate
FT                   phosphoribosyltransferase-like; PRIAM: Nicotinate
FT                   phosphoribosyltransferase; SPTR: C1YH28 Nicotinate
FT                   phosphoribosyltransferase; TIGRFAM: nicotinate
FT                   phosphoribosyltransferase; PFAM: Nicotinate
FT                   phosphoribosyltransferase (NAPRTase) family; TIGRFAM:
FT                   putative nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65828"
FT                   /db_xref="GOA:D7AVG7"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVG7"
FT                   /protein_id="ADH65828.1"
FT                   /translation="MSEDSSSALLTDHYELTMLQGALHSGAAARHSVFEMFARRLPEGR
FT                   RYGVVAGTGRFLELLERFRFGTEELDFLSDNGVVDERTVEWLADYRFSGNVWGYGEGEA
FT                   YFPGSPILVVEASFAEAVLLETLALSVYNHDSAIASAATRMAVAAGGRPLIEMGSRRTH
FT                   ERSAVAAARAAYVAGFSTSSNLEAGRSHGVPTGGTAAHAFTLLHDSERHAFKAQLESLG
FT                   EGTTLLVDTYDVERAVRTAVELAGPGLGAVRIDSGDLAAHAGRVRAQLDSLGATDTRIV
FT                   VTGDLDEHSIQALAVAPVDGYGVGTSLVTGSGAPTVSLVYKLVARARGLEADAPLEPVA
FT                   KRSVGKPSRGGRKWAVRRLDDKGTAVSEEIYPHPPSSQVGTRPLLRPLVADGVVVGHES
FT                   VHEARERHRAAVAELPEEALRMSRGEAALPTVFH"
FT   gene            464277..464711
FT                   /locus_tag="Ndas_0381"
FT   CDS_pept        464277..464711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0381"
FT                   /product="Mov34/MPN/PAD-1 family protein"
FT                   /note="COGs: COG1310 metal-dependent protease of the
FT                   PAD1/JAB1 superfamily; InterPro IPR000555; KEGG:
FT                   tfu:Tfu_2370 Mov34/MPN/PAD-1; PFAM: Mov34/MPN/PAD-1 family
FT                   protein; SMART: Mov34/MPN/PAD-1 family protein; SPTR:
FT                   C1YH27 Predicted metal-dependent protease of the PAD1/JAB1
FT                   superfamily; PFAM: Mov34/MPN/PAD-1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65829"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVG8"
FT                   /protein_id="ADH65829.1"
FT                   /translation="MLRIDRAIYDRIVAHARRDHPDEACGVVAGPEGSDSPERLVEMVN
FT                   AERSPTFYRFDSLEQLKVWREMDDRDEEPVVIYHSHTATEAYPSRTDVSYASEPGAHYV
FT                   LVSTREPDTVEFRSYRIIDGQVTEEPVEVTGPGDGAATAP"
FT   gene            464807..465085
FT                   /locus_tag="Ndas_0382"
FT   CDS_pept        464807..465085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0382"
FT                   /product="thiamineS protein"
FT                   /note="InterPro IPR012675:IPR003749:IPR016155; KEGG:
FT                   tcu:Tcur_3872 thiamineS protein; PFAM: thiamineS protein;
FT                   SPTR: C1YH26 Molybdopterin synthase subunit MoaD; PFAM:
FT                   ThiS family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65830"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVG9"
FT                   /protein_id="ADH65830.1"
FT                   /translation="MAIEVRIPTILRNLTGDAKVVEGSGDTLGELFADLDSRHPGIAGR
FT                   LVDDGKLRRFINVYLNDEDVRFVGGLEAKLSDGDNVTILPAVAGGSR"
FT   gene            465093..466040
FT                   /locus_tag="Ndas_0383"
FT   CDS_pept        465093..466040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0383"
FT                   /product="cysteine synthase"
FT                   /note="COGs: COG0031 Cysteine synthase; InterPro
FT                   IPR005856:IPR000634:IPR001926:IPR001216; KEGG: tfu:Tfu_2368
FT                   cysteine synthase; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit; SPTR: C1YH25 Cysteine synthase;
FT                   TIGRFAM: cysteine synthase; PFAM: Pyridoxal-phosphate
FT                   dependent enzyme; TIGRFAM: cysteine synthases"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65831"
FT                   /db_xref="GOA:D7AVH0"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVH0"
FT                   /protein_id="ADH65831.1"
FT                   /translation="MRYDSLLDSLGGTPLVGLPRLSPSPQVRLWAKLEDRNPTGSIKDR
FT                   AAFFMIEQAEKDGLLSPGCTILEPTSGNTGISLAMVAKLRGYRMVCVMPENTSAERKQL
FT                   LAMWGAEVHFSDAAGGSNEAVRVAKEMAAAHPDWVMLYQYGNPANARAHYETTGPEILA
FT                   DLPGITHFVAGLGTTGTLMGVGRYLREHRPGVQIVAAEPRYGELVYGLRNLDEGFVPEL
FT                   YDESVLTTRFSVPSEAALRRTRELLDKEGIFAGVSTGGALHAALGMARKAEKAGESADI
FT                   AFVIADAGWKYLSTGAYEGTLEEAEERLDGQLWA"
FT   sig_peptide     465093..465191
FT                   /locus_tag="Ndas_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            466388..467140
FT                   /locus_tag="Ndas_0384"
FT   CDS_pept        466388..467140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1234 Metal-dependent hydrolase of the
FT                   beta-lactamase superfamily III; KEGG: tfu:Tfu_2366
FT                   hypothetical protein; SPTR: C1YH24 Metal-dependent
FT                   hydrolase, beta-lactamase superfamily III; PFAM:
FT                   Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65832"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVH1"
FT                   /protein_id="ADH65832.1"
FT                   /translation="MRLTIIGSSGSFPGPDSPASSYMLEADGYRLLLDMGNGALGTLQR
FT                   HVDIYSVDAVYLSHLHADHCFDLCSYWVARAYHPGGAKPRIPVYGPGGVARRMAEAYGL
FT                   EPDPGMTEVFEFHELSPGPFRIGPFQARVDHVNHPVEAFGIRLEHGGASMAYSGDTGVC
FT                   DSLVDLAADTDLFLCEAAFQDHLDHPKDMHLTGSEAGEHASRARARSLLLTHLVPWNDD
FT                   DVTLTEARSTYDGPIGLARSGQVHEVGG"
FT   gene            467220..467939
FT                   /locus_tag="Ndas_0385"
FT   CDS_pept        467220..467939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0385"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="COGs: COG0689 RNase PH;
FT                   InterProIPR018336:IPR020568:IPR015847:IPR002381:IPR 001247;
FT                   KEGG: tfu:Tfu_2365 ribonuclease PH; PFAM: 3'
FT                   exoribonuclease; Exoribonuclease, phosphorolytic domain 2;
FT                   PRIAM: tRNA nucleotidyltransferase; SPTR: C1YH23 RNAse PH;
FT                   TIGRFAM: ribonuclease PH; PFAM: 3' exoribonuclease family,
FT                   domain 1; 3' exoribonuclease family, domain 2; TIGRFAM:
FT                   ribonuclease PH"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65833"
FT                   /db_xref="GOA:D7AVH2"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVH2"
FT                   /protein_id="ADH65833.1"
FT                   /translation="MARPDGRVPTQLRPVTITRNWLRHAEGSVLVEFGDTRVLCAASVE
FT                   DGVPRWRRGTGEGWVTAEYAMLPRSTDTRGSRESVRGKIGGRTHEISRLVGRSLRAVVD
FT                   FKAMGEHTITLDCDVLQADGGTRTAAITGAYVALADAMKWLRKRRKLKNNPLTGSLAAV
FT                   SVGVVQGQPRLDLNYLEDSVADTDMNVVITGDGKFIEVQGTAEGAPFDRDLLNQLLDLA
FT                   VSGCGELTAIQKKALSE"
FT   gene            467996..468601
FT                   /locus_tag="Ndas_0386"
FT   CDS_pept        467996..468601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0386"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="COGs: COG0127 Xanthosine triphosphate
FT                   pyrophosphatase; InterPro IPR002637; KEGG: tfu:Tfu_2364
FT                   Ham1-like protein; PFAM: Ham1 family protein; SPTR: C1YH22
FT                   Nucleoside-triphosphatase; TIGRFAM: non-canonical purine
FT                   NTP pyrophosphatase, rdgB/HAM1 family; PFAM: Ham1 family;
FT                   TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65834"
FT                   /db_xref="GOA:D7AVH3"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVH3"
FT                   /protein_id="ADH65834.1"
FT                   /translation="MKIVLATRNAKKVPEMRAILADAGVEAEVLSLDAFPDAPEVPETE
FT                   ASFLGNALLKARAIAAHTGLPAVADDSGIAVDELRGMPGVLSARWAGRFGAGDQDRANL
FT                   DLVLDQMADTPAERRGAAFVCAAVLVMPDGTEAVAEGVLRGRLVRERRGENGFGYDPVF
FT                   VPEGESRTTAELSPEEKNAISHRGTAFRKLARELADIL"
FT   gene            469303..470821
FT                   /locus_tag="Ndas_R0010"
FT   rRNA            469303..470821
FT                   /locus_tag="Ndas_R0010"
FT                   /product="16S ribosomal RNA"
FT   gene            471158..474249
FT                   /locus_tag="Ndas_R0011"
FT   rRNA            471158..474249
FT                   /locus_tag="Ndas_R0011"
FT                   /product="23S ribosomal RNA"
FT   gene            474356..474470
FT                   /locus_tag="Ndas_R0012"
FT   rRNA            474356..474470
FT                   /locus_tag="Ndas_R0012"
FT                   /product="5S ribosomal RNA"
FT   gene            474773..475411
FT                   /locus_tag="Ndas_0387"
FT   CDS_pept        474773..475411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0569 hypothetical protein; SPTR:
FT                   C1YWJ1 Predicted O-methyltransferase, COG4122"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65835"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVH4"
FT                   /protein_id="ADH65835.1"
FT                   /translation="MTKTIPSELLAAAEAAKGFMPTDEGAALFETAVAYAQVGPIVEIG
FT                   TYCGKSTIFLGAAARATGAKVLTVDHHRGSEEHQEGWEYHDASLVDEATGRFDTLPHFR
FT                   RTITEAGLDEEVIALVGRSTDVAAVWGTPLGMVFIDGGHSEEAAQNDYDGWSPHVAPGG
FT                   ALVIHDVFPNPEDGGRPPYNIYRKALDSGEFKEMRAVGSLRVLERIRGK"
FT   gene            475627..478980
FT                   /locus_tag="Ndas_0388"
FT   CDS_pept        475627..478980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0388"
FT                   /product="glycosyl transferase family 51"
FT                   /note="COGs: COG0744 Membrane carboxypeptidase
FT                   (penicillin-binding protein); InterPro
FT                   IPR012338:IPR001264:IPR001460; KEGG: tfu:Tfu_0570 membrane
FT                   carboxypeptidase (penicillin-binding protein); PFAM:
FT                   glycosyl transferase family 51; penicillin-binding protein
FT                   transpeptidase; SPTR: C1YWJ0 Membrane carboxypeptidase
FT                   (Penicillin-binding protein); PFAM: Penicillin binding
FT                   protein transpeptidase domain; Transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65836"
FT                   /db_xref="GOA:D7AVH5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVH5"
FT                   /protein_id="ADH65836.1"
FT                   /translation="MPDVICHGGGELSESTHGESGADGQRPGKDTPDTRNTSAEELSNK
FT                   HSPESGVPNIEGDQSTHDTPGGEESVGEQPEPEFINPVTFKTSGTFLRDKVAQNLAEQG
FT                   FGSDDTGDDAAEDSGVPADAHGTDAVHTSPAAGSPASAGSTGTEESDTREDGGRGDGRS
FT                   SQAAPPFAADDTSVDQDGTAGADEPPSPVSDRTEPISLDSVRAAASAEAAETSDDASGN
FT                   AGAEEGGTDLWSPRGQERTGVPKSPVAGTVTDVQDFEDGSAEAATSAVPAAPDAVAPDR
FT                   DGEQRIDEFSAAETASLWPEPRRLSSYVADSPSREQDRGARPGFAAAAAGAAGAAGAAA
FT                   AHSGAHGDPSGPGDTTSSSNSGGPSGPTGPGGPKGPAGPGGTGPGGPKGPGDPKARGKK
FT                   KGAGQKAKKPMWWRILRVFLIVTGVFFIIGCGVFAFFYSTVEVPDAAKADVLEEGSTFY
FT                   FADGETEFAYRGTHREILSYDEMTAGGDHVVEAVISAEDRGFWTEPGVSVSGTARAVWS
FT                   TVTGQQVQGGSTITQQMVRNYYEGISRDVSITRKVREIIIALKVDRSESKEWVMEQYLN
FT                   TIYFGRNAYGVQAASQAYYHKDVQDLEPAEAAFLAAAIQQPTPFGEADVETTPSMERRW
FT                   EYVVNGMVTTEAITQAEADAMEFPAPEPERPSEGTDLSGYKGYMLQEAMNELERLGYTE
FT                   DQINRQGYRIVTTFDQDMMDAAYAAVEEMVPLENRPEGVNVGLTTVDPATGEVLAFYGG
FT                   HDYWENQYDSSFLGAAQTGSAFKPYVLATALEQGYSLNSTVDGRGPRTIAGSRIQNAGN
FT                   SPGGIMTLTQATQVSNNLGFIELAQEVGFENVRDTVYAAGWPEGSVPDSQLVPVMPLGA
FT                   SSARTVDQASGYATFANGGVHVETHVVREIIDSEGENVRPEVESNRALEEETAADVTHA
FT                   LQQVVNGGTGTGARLANHPTAGKTGTTDGSVAAWFVGYTPQLSTAVGIYSGNNEGFSIP
FT                   GYGSLSGGTLPASLWNRYMSTAMEGYEPGSFPSPAFSGTTENWAPDVSTEQPQQPQQPE
FT                   APAEPETPVEPEVPTTPETPVEPEVPTTPEWPEIPGPGTDPGPGEGGGGEEGGGGGGGE
FT                   SPPARRDDLW"
FT   gene            complement(479333..480424)
FT                   /locus_tag="Ndas_0389"
FT   CDS_pept        complement(479333..480424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR008928; KEGG: tfu:Tfu_0571 hypothetical
FT                   protein; SPTR: C1YWI9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65837"
FT                   /db_xref="GOA:D7AVH6"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVH6"
FT                   /protein_id="ADH65837.1"
FT                   /translation="MSVTPAPAPTAGPAPHDALSLPGVLDAGQLHRSASYLARCQEDGG
FT                   AIPWFPGGHTDVWDHVECAMALTVTGRSAPGHAEAARRAYLWLADSRAPGGGWPAKFRQ
FT                   GVPVTRLREANHAAYPAVGLFHHLLVTGDTAFAERMWPVVEEGLEFVLALRGEHGEILW
FT                   ARSENGAPGDHALLTVCASVHHALRCGAALAARLGRSRPAWTAAADRLAVLINGHEDLF
FT                   ADRGRFSMDWFYPVLGGAVRGAAAKERIAERWDRFVVPGLGVRCVSDQPWVTAAETSEL
FT                   VLALAAVGDVDAGVRLLRDVQHLRDADDGAYWTGYQFAEQVRWPVERSTWTSAAVILAV
FT                   DALTGTTPGSRVFLHTWDGDPAD"
FT   gene            complement(480424..481143)
FT                   /locus_tag="Ndas_0390"
FT   CDS_pept        complement(480424..481143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0390"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013216;
FT                   KEGG: tfu:Tfu_0572 hypothetical protein; PFAM:
FT                   Methyltransferase type 11; SPTR: C1YWI8 Methylase involved
FT                   in ubiquinone/menaquinone biosynthesis; PFAM:
FT                   Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65838"
FT                   /db_xref="GOA:D7AVH7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVH7"
FT                   /protein_id="ADH65838.1"
FT                   /translation="MITVDFNLFPVGPGDRVLDLGCGGGRHAFEVYRRGADIVAFDQNV
FT                   ADLAEVETMFAAMRHEGEAPEEARAETVKGDALDMPFDDASFDRVVAAEIFEHLPHDTA
FT                   AMAELFRVLRPGGIAAVTVPSFLPERLCWALSEEYHTNEGGHIRIYTRAELEAKLKATG
FT                   FEIGPHHHAHALHAPYWWIKCAVGTDRDDHPLAKAYHDMLVWDMLKAPAVTRVAERLLN
FT                   PVIGKSVVVYVRKPHDA"
FT   gene            complement(481257..482630)
FT                   /locus_tag="Ndas_0391"
FT   CDS_pept        complement(481257..482630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0391"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: tfu:Tfu_0573 putative glycosyl
FT                   transferase; PFAM: glycosyl transferase group 1; SPTR:
FT                   C1YWI7 Glycosyltransferase; PFAM: Glycosyl transferases
FT                   group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65839"
FT                   /db_xref="GOA:D7AVH8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVH8"
FT                   /protein_id="ADH65839.1"
FT                   /translation="MTQSGTTPSPRPRAERPLRVALLSYRSKQHVGGQGVYVRHLSREL
FT                   AALGHEVTVLSGQPYPVLDEGVTLEKVPSLDLYNDAHPFKAPPVREWRDWIDALEVATM
FT                   WTAGFPEPLTFSLRANRELRRRLDDFDVVHDNQTLGWGLLGIRSAGLPLVTTIHHPISV
FT                   DRRIELAEARGLHRLTKRRWYGFVGMQARVARRLDPILVPSQSSADDIAREFGVAPSAM
FT                   EVTPLGVDTRHFHPRPALERVPGRIVCTASADSPLKGVAVLLRAAAKLATERDITLTVV
FT                   SRPKPGGPTDQLVDELSLRDRVEFVSGIDDTALAELIASAQVAVVPSFYEGFSLPAVEA
FT                   MACATPLVASHAGALPEVVGTDGDAGRLVPPGDPEVLAEALAALLDDDAERERMGAAAW
FT                   RRVQERFTWRAVAELTARRYASTIDAVRGNRPVDGDTRPGPAEPASPPAPERARANGA"
FT   gene            483117..483722
FT                   /locus_tag="Ndas_0392"
FT   CDS_pept        483117..483722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0392"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647:IPR012287:IPR009057; KEGG:
FT                   sro:Sros_8200 putative transcriptional regulator, TetR
FT                   family; PFAM: regulatory protein TetR; SPTR: C1YWI6
FT                   Transcriptional regulator, TetR family; PFAM: Bacterial
FT                   regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65840"
FT                   /db_xref="GOA:D7AVH9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041642"
FT                   /db_xref="UniProtKB/TrEMBL:D7AVH9"
FT                   /protein_id="ADH65840.1"
FT                   /translation="MRAASGTMSRSQTQRRRRIVQTAAALAVRGGVEAMQMRSVAERAG
FT                   VALGTLYRYFPSKMDLVVAVVTEELDLLEGGIVRRPPTADTPAERAVDVLLRATRGLMR
FT                   EPELADALVRSLIMAEVKIELDVRISDLVWRVATGNLEGAEEEGGAEVDRDSTGYVLAG
FT                   SLTSVWIFELVEVLKGRRDVDEVERRLQTAAERLLAPF"
FT   gene            complement(483761..485215)
FT                   /locus_tag="Ndas_0393"
FT   CDS_pept        complement(483761..485215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0393"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="InterPro IPR014284; KEGG: tfu:Tfu_0574 DNA-directed
FT                   RNA polymerase specialized sigma subunit sigma24 -like
FT                   protein; SPTR: C1YWI5 RNA polymerase sigma factor, sigma-70
FT                   family; TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65841"
FT                   /db_xref="GOA:D7AW75"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW75"
FT                   /protein_id="ADH65841.1"
FT                   /translation="MTRGSEPGEPSTVEALYDAFAPSLYRYAWSLLGEEDTGQAAEAVH
FT                   DGLVAGVVLDSRRADPADLGSWLYALVRSACQRRGLAHVSPYTRLATVPAEEPVARMFA
FT                   RLPASHRELVELNLRHALPTSAVARVLGLDPQICGELSRSAIRRAAENLDGRDGGRRVP
FT                   DPRPSREAGAPDGAGDTGGPGTAAWRAQVHDVSQALALLRPPGPPPGLREAVVRTCTDP
FT                   GLAAARERIAAQMHPLTGEGYPMHRSRAAGAVEEEAEAAEPGPEAPPRALPGDRLTTRD
FT                   HPVRDEAVTPLAGPRSPAGPDSGDDPDDHRTARRRWPLPAVSGLATVVLAVALWGWASA
FT                   VGGPSTMIGSGPDEAERGPLVPQVETDATSADTKPEAGPTVEPPAAPTESAEPGAGTEP
FT                   RQEDGGGSGHQAPDPAPERTTPAPPAQEPSPPPGGEGPDGGPDAPEGEEPGDDDAPGGP
FT                   PEEDGDDDGGGTGLLDGLLGLLFGGG"
FT   gene            complement(485349..486347)
FT                   /locus_tag="Ndas_0394"
FT   CDS_pept        complement(485349..486347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0394"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /note="COGs: COG0379 Quinolinate synthase; InterPro
FT                   IPR003473; KEGG: tfu:Tfu_0575 quinolinate synthetase; PFAM:
FT                   Quinolinate synthetase A; SPTR: C1YWI4 Quinolinate
FT                   synthetase A; TIGRFAM: quinolinate synthetase complex, A
FT                   subunit; PFAM: Quinolinate synthetase A protein; TIGRFAM:
FT                   quinolinate synthetase complex, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65842"
FT                   /db_xref="GOA:D7AW76"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW76"
FT                   /protein_id="ADH65842.1"
FT                   /translation="MAPVTATADTMTRQEWAAEVHRLAKERDAVILAHNYQRPEIQDVA
FT                   HHTGDSLALSRLAAGVDASTIVFCGVHFMAETAKILAPHKTVLLPDPNAGCSLADTITA
FT                   EDVRVWKAEHPDAVVVAYVNTTAAVKAETDICCTSSNAADVIRSIPEDREILFLPDQFL
FT                   GAHVKRVTGRDNIHVWMGECHVHAGIDGHTLRERVASEPDAEVYVHPECGCATSALYLV
FT                   GSGAVPQERVKVLSTGGMLTAAENTSAKKVLIATETGMLHQLRNANPNTEFEAVNSRAE
FT                   CHYMKMIDADKLLNALRFGTTEITVDADTSARARRSVERMIAIGSPSRGGE"
FT   gene            486487..487218
FT                   /locus_tag="Ndas_0395"
FT   CDS_pept        486487..487218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0395"
FT                   /product="NUDIX hydrolase"
FT                   /note="COGs: COG4111 conserved hypothetical protein;
FT                   InterPro IPR000086:IPR015797; KEGG: tfu:Tfu_0576
FT                   hypothetical protein; PFAM: NUDIX hydrolase; SPTR: C1YWI3
FT                   NUDIX family protein; PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65843"
FT                   /db_xref="GOA:D7AW77"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW77"
FT                   /protein_id="ADH65843.1"
FT                   /translation="MDIPQENGQVAASVCSASDHAELSVHEALAVVLQIRAGELCVLLW
FT                   RRALPPCEGAWALPGGRLGRGENLGASIRRQLAQKVDVRDLSHLEQLETRSDPDRVPRR
FT                   RTLATAYVGLVPADVDPVVPDDTGWHPAADLPTMAFDHASIVRSGRQRLRAKLSYTNVG
FT                   FALAPPEFTMSELSGYYRAALGHDVAATNLRRVLLRRGQIEETGRSVPSGRSGGRPAAL
FT                   FRFRDRSLQVTDAFAVLRPPS"
FT   gene            487386..488057
FT                   /locus_tag="Ndas_0396"
FT   CDS_pept        487386..488057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0396"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="COGs: COG0546 phosphatase; InterPro
FT                   IPR005833:IPR005834; KEGG: tfu:Tfu_0577 HAD family
FT                   hydrolase; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; SPTR: C1YM05 Predicted phosphatase; PFAM:
FT                   haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65844"
FT                   /db_xref="GOA:D7AW78"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW78"
FT                   /protein_id="ADH65844.1"
FT                   /translation="MAIRTAVFDVGETLVDETRIFARWADRFGIPHMAFFGTIGGVLAS
FT                   GGTLTDGFRLLVPGFDLAAESARWRAEDPDGEREHFGEADLYPDVRPAFAAMRASGISL
FT                   VIAGNQPPEAGPTLTAMDLGVDGIGISDVWGVKKPEPAFFDRVLSLVRAASPGTEPGEI
FT                   VYVGDRVDNDVLPARAAGMRTVLLRRGIYGYRHAAAEEAARADAVLDDLHQLADWIGRQ
FT                   N"
FT   gene            488252..489361
FT                   /locus_tag="Ndas_0397"
FT   CDS_pept        488252..489361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0397"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /note="COGs: COG1125 ABC-type proline/glycine betaine
FT                   transport systems ATPase components; InterPro
FT                   IPR017871:IPR003593:IPR005892:IPR003439; KEGG:
FT                   cai:Caci_3087 glycine betaine/L-proline ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: C1YM04 Glycine betaine/L-proline transport
FT                   ATP binding subunit; TIGRFAM: glycine betaine/L-proline ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter;
FT                   TIGRFAM: glycine betaine/L-proline transport ATP binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65845"
FT                   /db_xref="GOA:D7AW79"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW79"
FT                   /protein_id="ADH65845.1"
FT                   /translation="MIAFEGAAKLYPDGTVAVDQLDLTVETGQTTVFVGPSGSGKTTSL
FT                   RMINRMVEPTGGTVRIDGEDVRERDPAALRRSIGYVIQQAGLFPHRTVRDNIATVPLLL
FT                   GWGRARARARAAELMELVGLEPAQARRYPHQLSGGQQQRVGVARALAADPPILLMDEPF
FT                   SAVDPVVRASLQDELLRLQKELHKTIVFVTHDIDEAVRLGDRIAVFRPGGRLAQYDTPQ
FT                   NLLAAPQDAFVESFIGYDRGVRRLSFFPADRLSPRQDAVLEESVRAGAAVAPLGNEPWA
FT                   LVVSGDRMPLGWVSARQLADAPADTALGSLELAPFGHTFDVGTDSLRAALDAAVLSPAG
FT                   RAVGVDADGRVVGVVSQDDLGAALWSVTE"
FT   gene            489358..490260
FT                   /locus_tag="Ndas_0398"
FT   CDS_pept        489358..490260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0398"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1174 ABC-type proline/glycine betaine
FT                   transport systems permease component; InterPro IPR000515;
FT                   KEGG: tcu:Tcur_3635 binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: C1YM03 ABC-type proline/glycine betaine
FT                   transport system, permease component; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65846"
FT                   /db_xref="GOA:D7AW80"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW80"
FT                   /protein_id="ADH65846.1"
FT                   /translation="MIAEAVAGVWDAGSAAGSGTGALAGAWDWVVRVVDWGVGNWSHPG
FT                   DPDRGVLPRLTEHMRLSYLSILIGLAVALPLGLACARWKPLYPPVLTGVNVLYAVPSIA
FT                   LFFLMLPYTGFSDWTAVVPLALYTLVILLPNVVDGLRQVPDHVRQAAVAMGFGPLRRLL
FT                   YVEMPVAVPVVIAGLRVASVATISMVSVASLVGLGGLGRLILSEGFRRQFDAPIVVGIV
FT                   LTVALAFVTDAVLVLAQRLLTPWSRRDGAVPRRRRRAVAAEAAAADPAVGSAAEPQAAT
FT                   AAGGRSPADPGTGGTAGER"
FT   gene            490263..490940
FT                   /locus_tag="Ndas_0399"
FT   CDS_pept        490263..490940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0399"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1174 ABC-type proline/glycine betaine
FT                   transport systems permease component; InterPro IPR000515;
FT                   KEGG: tcu:Tcur_3634 binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: C1YM02 ABC-type proline/glycine betaine
FT                   transport system, permease component; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65847"
FT                   /db_xref="GOA:D7AW81"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW81"
FT                   /protein_id="ADH65847.1"
FT                   /translation="MDILNDLVAWFADPAQWTGGAGIPARLGEHVYYSLLGLLLSAAVA
FT                   VPLGLLTGHTGVGGFLTTSLANFARALPTIGVLFLIVLAAGIGIVPVLCALVALAVPPI
FT                   LVNTHEGVRGVEPRLRDAAVGMGMRGHQVLLRLELPVATPLILIGMRTAAVQVVATATI
FT                   AAYVGVGGLGRYIVDGQARQDLTMMLGGSVLVVLLAVLTTLVFAGLRRLLVAPGLRQAA
FT                   PQG"
FT   gene            491027..491929
FT                   /locus_tag="Ndas_0400"
FT   CDS_pept        491027..491929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0400"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="COGs: COG1732 Periplasmic glycine
FT                   betaine/choline-binding (lipo)protein of an ABC-type
FT                   transport system (osmoprotectant binding protein); InterPro
FT                   IPR007210; KEGG: tcu:Tcur_3633 substrate-binding region of
FT                   ABC-type glycine betaine transport system; PFAM:
FT                   Substrate-binding region of ABC-type glycine betaine
FT                   transport system; SPTR: C1YM01 Periplasmic glycine
FT                   betaine/choline-binding (Lipo)protein of an ABC-type
FT                   transport system (Osmoprotectant binding protein); PFAM:
FT                   Substrate binding domain of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65848"
FT                   /db_xref="GOA:D7AW82"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW82"
FT                   /protein_id="ADH65848.1"
FT                   /translation="MYKRIALPLAALLLTGCGASDPYAEEGGGGSGGGSGDAVVIGSAD
FT                   FPESTLLAEIYGRAMEAEGVEVDYQLGIGSREVYYSQIESGNLSVFPEYNGAILAYLDE
FT                   NAPTGSSEETNQRVTEALPEGLEILDSSSAENKDSVTVTSEVAEEHGLASLEDLAGAAG
FT                   ELTLGGPPEFETRQQGVVGLADVYGVEFGEFRSLEVALLTQALLDGDIQAANLFTTDPQ
FT                   ITANDFVVLEDPENLFGAQNITPLVNGEQVDETARGALNAVSAALTTEALTQLNERVVI
FT                   GNENAADVAQEWLEQEGLA"
FT   sig_peptide     491027..491098
FT                   /locus_tag="Ndas_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(492067..492555)
FT                   /locus_tag="Ndas_0401"
FT   CDS_pept        complement(492067..492555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0401"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="COGs: COG1853 Conserved protein/domain typically
FT                   associated with flavoprotein oxygenase DIM6/NTAB family;
FT                   InterPro IPR012349:IPR009002:IPR002563; KEGG: tfu:Tfu_0578
FT                   putative reductase; PFAM: flavin reductase domain protein
FT                   FMN-binding; SPTR: C1YM00 Conserved protein of DIM6/NTAB
FT                   family, COG1853; PFAM: Flavin reductase like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65849"
FT                   /db_xref="GOA:D7AW83"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW83"
FT                   /protein_id="ADH65849.1"
FT                   /translation="MGDPLTYLEAMALLPVGVTVVTVADGRDDVGATVSAFGSVSADPP
FT                   VVSVSVDASGYMAEVIEEVGAFAVNVLGGGQRAVAGRFSAEGRPSARLLVTDQPHHRGE
FT                   HTRAIVLDEALAALECSVRQQVAVGDHVVFFADVTNLPGVRGEGAALARRSGRYRLVE"
FT   sig_peptide     complement(492478..492555)
FT                   /locus_tag="Ndas_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(492540..494228)
FT                   /locus_tag="Ndas_0402"
FT   CDS_pept        complement(492540..494228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0402"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /note="COGs: COG0616 Periplasmic serine protease (ClpP
FT                   class); InterPro IPR002142:IPR004635:IPR004634; KEGG:
FT                   tfu:Tfu_0579 signal peptide peptidase A; PFAM: peptidase
FT                   S49; SPTR: C1YLZ9 Signal peptide peptidase SppA, 36K type;
FT                   TIGRFAM: signal peptide peptidase SppA, 36K type; PFAM:
FT                   Peptidase family S49; TIGRFAM: signal peptide peptidase
FT                   SppA, 36K type; signal peptide peptidase SppA, 67K type"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65850"
FT                   /db_xref="GOA:D7AW84"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004634"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW84"
FT                   /protein_id="ADH65850.1"
FT                   /translation="MVDLAKIMKTRQRPQGPLVLELDLTEGVADQAPGDPFSQIMNRRR
FT                   QQYLDVLEGIRRGARDPRVAALLVRVDARSLGFAKVQELRDTVADFRAAGKPAVAWADS
FT                   FGETGEGNLPYYLACAFSRVVMAPTGVLGLTGLMMRTTFVKGALDKLDVSYEVGARHEY
FT                   KNAMNSVTETGYTAAQREASDRIVTSLGDQIVEAVSLARGLPREEVRALVSKGPFLARE
FT                   AVEHKLVDGLAHRDEVYAQLFGELSGEPQLQFVTRYHRKHTAPQQLSRNTGGHIALISA
FT                   TGTISLGRTRRSPLGGGTVMGSDTVAAAFRAARKDPQVKAVVFRVDSRGGSPTASDAIR
FT                   RETELTSKAGIPVVAVMGDVAASGGYYVTLGSDAVVAQPGTLTGSIGVITGKPVLGALK
FT                   EQYGVTSDSVRTGEHAGMFDTDRPFTESEWERVNALLDEIYEDFTGKVAAARGMTREQV
FT                   HEVARGRVWTGRDAHERGLVDELGGLETAVRLAREKAGAGPLPVRPFPRPNPLDRIRQH
FT                   ESSEDVGASGPQTVVSAWGPLEHVAVAMGLPVGGPLMMPGLWEIR"
FT   gene            494354..495022
FT                   /locus_tag="Ndas_0403"
FT   CDS_pept        494354..495022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0403"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0581 hypothetical protein; SPTR:
FT                   C1YLZ8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65851"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW85"
FT                   /protein_id="ADH65851.1"
FT                   /translation="MAGIHGRGRRARAARVGTGTVAAAAALLLLSACSGGSEAELQLGE
FT                   SGPLPAAEPPAPEEFATESIEGVSLKVPEGWQTQNEGGVLCVSPPGQEPCGYGSVQLTP
FT                   HAAENHPQGWPGEGEAFSEEGGWAADTGSCRSLNTAASGGIGVEGAELAVSDFTDHADG
FT                   LTSHHSVWNVACVNGDTFEVRMWFLPVSDVLLYVWSADSQYSAVYDEIALSMDTSEYQS
FT                   "
FT   sig_peptide     494354..494449
FT                   /locus_tag="Ndas_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            495162..496490
FT                   /locus_tag="Ndas_0404"
FT   CDS_pept        495162..496490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0404"
FT                   /product="peptidase M16 domain protein"
FT                   /note="COGs: COG0612 Zn-dependent peptidase; InterPro
FT                   IPR011237:IPR011249:IPR011765:IPR007863; KEGG: tfu:Tfu_2363
FT                   putative zinc proteinase; PFAM: peptidase M16 domain
FT                   protein; SPTR: C1YLZ7 Predicted Zn-dependent peptidase;
FT                   PFAM: Peptidase M16 inactive domain; Insulinase (Peptidase
FT                   family M16)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65852"
FT                   /db_xref="GOA:D7AW86"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW86"
FT                   /protein_id="ADH65852.1"
FT                   /translation="MTTIGAAGRVVQYTLDNGLRLVTAAASTGQVASVNLWYGVGSRHE
FT                   VPGRTGFAHLFEHLMFQGSGGVAKGEHFEEVERLGGDINASTSTDRTNYYETVPEHALD
FT                   RILWLEADRLATLREGMTQEVLDNQRDVVKNERRQRYDNQPYGTALERILRLAYPEGHP
FT                   YHHPTIGSMADLDAADLDYVKSFHRAHYGPDNCVLTVVSDLDPEDVRGRVEKFFGPIPA
FT                   RESVPEAPDAALEAPLGGPVRDAVTETVPAAGVFLGFRVAPYGERGFDVMHLASAVLGQ
FT                   GQGSRLYRSLVVDRPIAADDGGGAADILPFRYTDSLMLVNMLAREGVSGDVLEEAMREE
FT                   IAKLAAGITEEELDRARAVLERDHLQSISSPSGLADSISSCTQLFDDPELAYTWPRRWD
FT                   DITAEEVRAAAERVLVDDNLLVVRFDPEESGAAEAAGADTVDA"
FT   sig_peptide     495162..495239
FT                   /locus_tag="Ndas_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            496533..497882
FT                   /locus_tag="Ndas_0405"
FT   CDS_pept        496533..497882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0405"
FT                   /product="peptidase M16 domain protein"
FT                   /note="COGs: COG0612 Zn-dependent peptidase; InterPro
FT                   IPR011249:IPR011765:IPR007863:IPR011237; KEGG: tfu:Tfu_2362
FT                   putative proteinase; PFAM: peptidase M16 domain protein;
FT                   SPTR: C1YLZ6 Predicted Zn-dependent peptidase; PFAM:
FT                   Peptidase M16 inactive domain; Insulinase (Peptidase family
FT                   M16)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65853"
FT                   /db_xref="GOA:D7AW87"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW87"
FT                   /protein_id="ADH65853.1"
FT                   /translation="MPHKSRPDLGAVASYTFPKPRRLTVGGGTVVAIDVPGQQLVSLRL
FT                   VHPHGGAAEPLDAMGVSALTSEVLEDGPNGNSSLAPALERHGAEWVSRVNWDAFITGLD
FT                   APAGRLPEAVRLFADAVRRPALNPDDVVRRRDQLLERFWLEAASASTLAMRSLGGQLFT
FT                   GRYATPLAGGPVKLADVTPETVAAFHADSVASVAGTLVVVGDLTGIDLEDLGKTVFGDA
FT                   AAVRAPEPTEPAPPPGELPRVLIVDRPGSVQSALVIAHRAPSRSQVDLPRAEGVSEVLG
FT                   GMFTSRLNLELRERLGYTYGAGSRFDLRRDSGVFFMSAQVEADTTAHSVTSSLEQVAKL
FT                   RESGVTEEELAAVRDSNTVGLPVTYATARAMAGALVDMVVHDLPEDHVDRVRAGYERLT
FT                   KESLDSAATEYLRPEESVVVVVGDAERLRQPLTDTGVGPVEVRTPDSLWT"
FT   gene            498135..499391
FT                   /locus_tag="Ndas_0406"
FT   CDS_pept        498135..499391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0406"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterProIPR000719:IPR008271:IPR011009:IPR020635:IPR
FT                   002290:IPR017442; KEGG: tfu:Tfu_2361 tyrosine protein
FT                   kinase:serine/threonine protein kinase; PFAM:
FT                   Serine/threonine-protein kinase-like domain; SMART:
FT                   serine/threonine protein kinase; Tyrosine-protein kinase,
FT                   subgroup, catalytic domain; SPTR: C1YLZ5 Serine/threonine
FT                   protein kinase; PFAM: Protein kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65854"
FT                   /db_xref="GOA:D7AW88"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW88"
FT                   /protein_id="ADH65854.1"
FT                   /translation="MDPWITVSSLENPHTQRPEASRSSARAEAADAAEPRPEGRLLKGR
FT                   YQLVSEIARGGVGTVWRATDLVIDREVAVKELRLPADLSRSERESLLQRTTREARVAGR
FT                   LTHPSLVTVLDVVDEDDRPWIVMELVEASTLEELIQVGGPLPYQRVAEIGLQLIDALKV
FT                   AHAEGIVHRDVKPDNVMISQAGRVVLTDFGLAAWNGESALSASGRIIGSPAYIPPERAK
FT                   AGPVGPESDLWSLGATLYAAVEGHPPYDRKGYIKILRQEQLDEPAEAASAGPLAPVLAG
FT                   LLRVEPSERLTAENATKMLRIAALAPWAPETSPETAAQGTATPAEPRPEGEERESAREH
FT                   FKAGAHVLAESINERLSNSPEAMNSIMTSIRESTDTLGLTSSGKHAERSRLPAVATIAA
FT                   VSLGVLVLLAVMLWALLGR"
FT   gene            complement(499437..499514)
FT                   /locus_tag="Ndas_R0013"
FT   tRNA            complement(499437..499514)
FT                   /locus_tag="Ndas_R0013"
FT                   /product="tRNA-Leu"
FT   gene            complement(499606..500088)
FT                   /locus_tag="Ndas_0407"
FT   CDS_pept        complement(499606..500088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0407"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="COGs: COG1225 Peroxiredoxin; InterPro
FT                   IPR017936:IPR012335:IPR012336:IPR000866; KEGG: tfu:Tfu_2360
FT                   bacterioferritin comigratory protein; PFAM: alkyl
FT                   hydroperoxide reductase/ Thiol specific antioxidant/ Mal
FT                   allergen; SPTR: C1YLZ4 Peroxiredoxin; PFAM: AhpC/TSA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65855"
FT                   /db_xref="GOA:D7AW89"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW89"
FT                   /protein_id="ADH65855.1"
FT                   /translation="MSDPIRLEPGDQAPDFTLDDADGKPVTLSEVLASTGKRVVLYFYP
FT                   AAMTPGCTTQACDFRDNLRDFDSAGLTVLGVSPDTSDKLARFRDKEGLTFPLLGDPGKD
FT                   TLRAYGAFGEKKNYGRVVQGVIRSTVVVGTDGRVEKAFYNVKATGHVDRIKRELGL"
FT   gene            500401..501519
FT                   /locus_tag="Ndas_0408"
FT   CDS_pept        500401..501519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0408"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="COGs: COG0558 Phosphatidylglycerophosphate synthase;
FT                   InterPro IPR000462; KEGG: tfu:Tfu_2359 hypothetical
FT                   protein; PFAM: CDP-alcohol phosphatidyltransferase; SPTR:
FT                   C1YLZ3 Phosphatidylglycerophosphate synthase; PFAM:
FT                   CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65856"
FT                   /db_xref="GOA:D7AW90"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW90"
FT                   /protein_id="ADH65856.1"
FT                   /translation="MPGFTLDEVRARTLKERDSWWTVYLVDPIAVRLVRLVANRTSITP
FT                   NQLTVVALFLGLGAAVCFSLGYRHFLALGTLLYLLSFLMDCTDGKLARLTGSESLFGSW
FT                   MDYVSDRFRVLVCVVALMGGQYVVAENAEGDGPVWFVWLALAVVFLDMLRYLNALQVYK
FT                   VRREMRSHLAAALERARATLSMLEPEEDDTGSATGAGGRTMSDGGEQAVLRHGIGVLEQ
FT                   ILHSQNEREARNQRTAGKQPDLTLPKVDLHQEFRNRFPWYQRFWSALNARRVRTHLVGG
FT                   IEFQMSVFVIAPLAAAVFGAPSLIGWITAVAGVLLLAFEIAIIYKLWLSTRDFFRVVDG
FT                   IDSALRFSGPSDGAEEGSRDTGSDTGSQTTLR"
FT   gene            501535..501933
FT                   /locus_tag="Ndas_0409"
FT   CDS_pept        501535..501933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0409"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2358 hypothetical protein; SPTR:
FT                   C1YLZ2 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF3618)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65857"
FT                   /db_xref="GOA:D7AW91"
FT                   /db_xref="InterPro:IPR022062"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW91"
FT                   /protein_id="ADH65857.1"
FT                   /translation="MTGRDTEPRLTPADVVAEINREQRQLAETLDELSVQARPANIARK
FT                   QMERVRERGARIVDEARALVVGGGAVRVESHPVEPEEGSIVVKGDGHVVTTYQSRGQLP
FT                   PEALLLAVGVGAVVAVGVVAWAVHRRRK"
FT   gene            complement(502231..503478)
FT                   /locus_tag="Ndas_0410"
FT   CDS_pept        complement(502231..503478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0410"
FT                   /product="alanine racemase domain protein"
FT                   /note="COGs: COG3616 amino acid aldolase or racemase;
FT                   InterPro IPR001608; KEGG: tfu:Tfu_2357 hypothetical
FT                   protein; PFAM: alanine racemase domain protein; SPTR:
FT                   C1YLZ1 Predicted amino acid aldolase or racemase; PFAM:
FT                   Alanine racemase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65858"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW92"
FT                   /protein_id="ADH65858.1"
FT                   /translation="MFWHAQDMTSLRETYESATRGLEAPFALVDLAALRSNAADLTRRA
FT                   HGRPIRIASKSVRSRELLRTVLALPGYAGVMAFTLPEALWLATGDRPLSDDVLVAYPTV
FT                   DRQALARLVRDPRAARAITLMVDDTAHLDLIGAAVADAAESRGPDAPPVRVCLDVDTSW
FT                   QPVGPRLRVGTYRSPVRTPAQAAAFARAVAARPGLELDGIMAYEGQIAGVGDAPPGRPL
FT                   YGRLLRAVQRRSAVELAKRRAAIVHAVREVADLRFVNGGGTGSLHTTGRERAVTELAAG
FT                   SGLYHPHLFDHYRSFGGRPAALFALPVVRRPGPGVATALGGGYPASGPVNAHRAPLPHL
FT                   PAGLSYSVNEGAGEVQTPLLGAAADGLSVGDRVWMRHAKAGELCERFDTLHLVDSDTGE
FT                   YAGAVPTYRGEGQTFL"
FT   gene            503636..504523
FT                   /locus_tag="Ndas_0411"
FT   CDS_pept        503636..504523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0411"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /note="COGs: COG0788 Formyltetrahydrofolate hydrolase;
FT                   InterPro IPR002376:IPR004810:IPR002912; KEGG: tfu:Tfu_2356
FT                   formyltetrahydrofolate deformylase; PFAM: formyl
FT                   transferase domain protein; amino acid-binding ACT domain
FT                   protein; SPTR: C1YLZ0 Formyltetrahydrofolate deformylase;
FT                   TIGRFAM: formyltetrahydrofolate deformylase; PFAM: ACT
FT                   domain; Formyl transferase; TIGRFAM: formyltetrahydrofolate
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65859"
FT                   /db_xref="GOA:D7AW93"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW93"
FT                   /protein_id="ADH65859.1"
FT                   /translation="MSEREYVLTLSCPDSRGIVAAVANLLSDHGCNITESQQYGDHYTG
FT                   RFFLRMQFVAERGGDGVVGEDVLRGAFAALAGDFGGRGGDAFVEWTLNPRDVRPRMIVM
FT                   VSKFGHCLNDLLYRQRSGLLDADIAAVVSNHPDLEFLADSYGVDFHHLPVTAGSKKEQE
FT                   ARLLELVDSYDVDLVVLARYMQVLSEQLCAKMSGRIINIHHSFLPSFKGARPYHQAHAR
FT                   GVKLIGATAHYVTADLDEGPIIEQEVSRVDHTHSPEQLTAIGRDLESVALARAVNWHAQ
FT                   RRVLLNGDKTVIFG"
FT   gene            504551..504851
FT                   /pseudo
FT                   /locus_tag="Ndas_0412"
FT   gene            505199..505678
FT                   /locus_tag="Ndas_0413"
FT   CDS_pept        505199..505678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0413"
FT                   /product="protein of unknown function DUF322"
FT                   /note="COGs: COG1302 conserved hypothetical protein;
FT                   InterPro IPR005531; KEGG: sro:Sros_8027 hypothetical
FT                   protein; PFAM: protein of unknown function DUF322; SPTR:
FT                   C1YLY9 Uncharacterized conserved protein; PFAM: Protein of
FT                   unknown function (DUF322)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65860"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW94"
FT                   /protein_id="ADH65860.1"
FT                   /translation="MTDMRTETKVPGARESGRTSRGDSSRDEGGRTQIADGVVAKIAGM
FT                   AAREIGGVHAMGGGTARAVGAVRDVVTRGGDSGSVARGVSVEVGERQAAVDIDLVVEYG
FT                   AAIQDLAAAVRRNVTSAVERMTGLEVTEINIRVDDIHLPDDDRGEDDGESAPRVQ"
FT   gene            505678..505998
FT                   /locus_tag="Ndas_0414"
FT   CDS_pept        505678..505998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0414"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_8028 hypothetical protein; SPTR:
FT                   C1YLY8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65861"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW95"
FT                   /protein_id="ADH65861.1"
FT                   /translation="MAAADGDPGEVARRLVREAERFPDVVELSSGGFGTLTTPVPGGRV
FT                   LGVAVRDDSVEVGVVVRFGRPLPEIAAELRRGLTPVAGGRTVHVSVEDVVAGLRDGART
FT                   GG"
FT   gene            506036..506209
FT                   /locus_tag="Ndas_0415"
FT   CDS_pept        506036..506209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sro:Sros_8029 hypothetical protein; SPTR:
FT                   C1YLY7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65862"
FT                   /db_xref="GOA:D7AW96"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW96"
FT                   /protein_id="ADH65862.1"
FT                   /translation="MWPIVGLSYGTVLGLAAAFGGFTAFALVLILGLAGFVAGRAMEGE
FT                   IDLTAMFSRRSA"
FT   sig_peptide     506036..506113
FT                   /locus_tag="Ndas_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            506227..506601
FT                   /locus_tag="Ndas_0416"
FT   CDS_pept        506227..506601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sro:Sros_8030 hypothetical protein; SPTR:
FT                   C1YLY6 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF322)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65863"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW97"
FT                   /protein_id="ADH65863.1"
FT                   /translation="MAGVRTSTVPRQRERPGDEVARERSGGGGGRDPGGRTVIEPGVVE
FT                   KAAARAVREVPGALPARSRTARARVSGEVVLLRLRVGVRYPHSVREVAARVRGHVGRRI
FT                   EQITGKRVHHIDIEIAELVR"
FT   gene            506603..507208
FT                   /locus_tag="Ndas_0417"
FT   CDS_pept        506603..507208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2355 hypothetical protein; SPTR:
FT                   C1YLY5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65864"
FT                   /db_xref="GOA:D7AW98"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW98"
FT                   /protein_id="ADH65864.1"
FT                   /translation="MTTVEEVLGRPDQGVDRRARRVAVHTFRPRRSWPAVITGFVILLV
FT                   AVVAAAEVISALAGSPLGLIPVGAASGYAATTTWSMPSVQIASAVLALIGLALIVAALA
FT                   PGRGRWTALRTDDPALVVGLTRPALRRAVAAAAEGVSGVDGVHVTVRGNRIRVHARTGM
FT                   RGSAGLPAEVTAAVERRLEELAPLRSMRIATHVRYAEG"
FT   gene            507211..507801
FT                   /locus_tag="Ndas_0418"
FT   CDS_pept        507211..507801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0418"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR002345; KEGG: nml:Namu_4999 hypothetical
FT                   protein; SPTR: C1YLY4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65865"
FT                   /db_xref="GOA:D7AW99"
FT                   /db_xref="UniProtKB/TrEMBL:D7AW99"
FT                   /protein_id="ADH65865.1"
FT                   /translation="MAGDRSRRSARGNRWGLAVVGAVLLVAGLASLAAGRGLFGGGAAD
FT                   SALLGPGAREALDQQWVPYAVVAVAFVAGFLALRWLMSQGLNDTVGRLVLERGEQGRVE
FT                   MSENVARGALEQEVADYPGVRRARARLTESAEAPHLRLALTLDDDADVAGVWRRVSSEA
FT                   LANLRRALDLEQVPAVVRMSMTAPAKNPRRSLA"
FT   sig_peptide     507211..507309
FT                   /locus_tag="Ndas_0418"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            507845..508246
FT                   /locus_tag="Ndas_0419"
FT   CDS_pept        507845..508246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0419"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="COGs: COG3607 lactoylglutathione lyase; InterPro
FT                   IPR004360; KEGG: rer:RER_40730 hypothetical protein; PFAM:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase; SPTR:
FT                   C1YLY3 Predicted lactoylglutathione lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65866"
FT                   /db_xref="GOA:D7AWA0"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWA0"
FT                   /protein_id="ADH65866.1"
FT                   /translation="MTRTTFVNLPVKSVDATREFFSALGFGYDEAFSDDRALCMVVSDT
FT                   SRVLFLSEPFFAEFTPSGIADTSAGAEVITCLSADSREDVDRIAEAAAVAGATHARTTE
FT                   HTGMYSRSFADPDGHLWEFLYMDATATIS"
FT   gene            complement(508291..509547)
FT                   /locus_tag="Ndas_0420"
FT   CDS_pept        complement(508291..509547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0420"
FT                   /product="amidohydrolase"
FT                   /note="COGs: COG1228 Imidazolonepropionase and related
FT                   amidohydrolase; InterPro IPR011059:IPR006680; KEGG:
FT                   ami:Amir_2756 amidohydrolase; PFAM: amidohydrolase; SPTR:
FT                   C1YLY1 Amidohydrolase, imidazolonepropionase; PFAM:
FT                   Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65867"
FT                   /db_xref="GOA:D7AWA1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWA1"
FT                   /protein_id="ADH65867.1"
FT                   /translation="MTRQSEPHILFTGAGLLDPEAGTRTPGSWLLVRDGLVAGSGRGTP
FT                   PEVGPRVPTVDVAGATLMPGLIDAHVHPTAFSADLGAAMDQSPAYIASYAGRSLGDMLR
FT                   RGFTTVRDVAGGDWGLARAVEEGLVDGPRLMFGGKALSQTGGHGDFRTPGRQGNDTHAC
FT                   CPGAGIVCDGPVEFRRAAREQLRTGAHHLKIMLSGGVASPTDRIDSTQSSEDEIRAVVE
FT                   EAEAANRYVTGHAYTARAVNRGLRLGVRCIEHGNLIDESSIELFLEHDAYLVPTLVTYQ
FT                   ELSRQGAANGLPAASQAKVDTVLDRGLDALRMAHEAGVNLVFGSDLLGGMQDRQSQEFA
FT                   IRGRVQPAADVLRAATVNAARLLGLEGVVGTLRDGARADLVVVDGDPLTDIGVLASPET
FT                   SVRTVLRDGRIRHERDAVR"
FT   gene            509669..510502
FT                   /locus_tag="Ndas_0421"
FT   CDS_pept        509669..510502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0421"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="COGs: COG1737 Transcriptional regulators; InterPro
FT                   IPR001347:IPR000281; KEGG: ami:Amir_2753 transcriptional
FT                   regulator, RpiR family; PFAM: helix-turn-helix protein
FT                   RpiR; sugar isomerase (SIS); SPTR: C1YLY0 Transcriptional
FT                   regulator; PFAM: SIS domain; Helix-turn-helix domain, rpiR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65868"
FT                   /db_xref="GOA:D7AWA2"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWA2"
FT                   /protein_id="ADH65868.1"
FT                   /translation="MADWIEAALGGGRLGRAAERVVRVLRDEPRFASYASTAELAERAG
FT                   VNVATVVRAAQALGFTGWPALRVELRSRYLASLSAGEVLAEHAGSDADPVREAFRADRE
FT                   GLRDLERTLDPARVRALAGAVHGARRTRVVGSGTFAAPGVQLAHAAGIMGYDVERLELG
FT                   GTGLVSALARMGPGDLLLACDLWRLPVALRSAARVARERSVPVAVITDRRDSPLAEGAA
FT                   HVLLVPSEGVGMFPSLTPVMAVVHAVLAELARLGGDEVLAAVRDTERLWESTELF"
FT   gene            510689..512119
FT                   /locus_tag="Ndas_0422"
FT   CDS_pept        510689..512119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0422"
FT                   /product="Na+/solute symporter"
FT                   /note="COGs: COG0591 Na+/proline symporter; InterPro
FT                   IPR001734; KEGG: nth:Nther_2710 Na+/solute symporter; PFAM:
FT                   Na+/solute symporter; SPTR: C1YLX9 Na+/proline symporter;
FT                   PFAM: Sodium:solute symporter family; TIGRFAM: SSS sodium
FT                   solute transporter superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65869"
FT                   /db_xref="GOA:D7AWA3"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWA3"
FT                   /protein_id="ADH65869.1"
FT                   /translation="MQTTHLVILAVYILAMIGIALYFVRSGRLRGGDDFLFAGRSLPRP
FT                   VMIATMLVTWVGSGTIIGGANFAYTYGPTAGMVFFAGTPLGILVLLLAARRIRRASRHT
FT                   IPELLEVRFGIGVRTVAAVVTTIAFLGLTASQFVGGGYVVSLVTPLSATQGTVLIAVVV
FT                   TLLTVTGGLFSVAYTDFVSAILILLSLFVSVPLVFAAIGGPGAYWDGLPEQATTFSGGL
FT                   TALQLLGYFLPLFLLLLADQNMYQRLAAAKDEREARSSTLGMFVGSFFVFVPVVLLATC
FT                   AAILMPGINGDMAVLSLASEGYLPVVLGGLILAGAVAFVITTGSSYMLSCASNVAYDLY
FT                   ARFAGDGVDERRKLVVQRLSVLGIALAGLALSLFFPTVLELQMYSYTVYGAAITPVVLS
FT                   VLFWKRATTAGAVAALVVGAATTIGWQIAGTPGGLNAVIVALPAALVALVVASLVTKAP
FT                   DPARVAAAEEPAPTGTDA"
FT   gene            complement(512215..513627)
FT                   /locus_tag="Ndas_0423"
FT   CDS_pept        complement(512215..513627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0423"
FT                   /product="L-serine dehydratase 1"
FT                   /EC_number="4.3.1.17"
FT                   /note="COGs: COG1760 L-serine deaminase; InterPro
FT                   IPR004644:IPR005130:IPR005131; KEGG: sro:Sros_1754 L-serine
FT                   ammonia-lyase; PFAM: serine dehydratase alpha chain; serine
FT                   dehydratase beta chain; PRIAM: L-serine ammonia-lyase;
FT                   SPTR: C1YLX8 L-serine ammonia-lyase; TIGRFAM: L-serine
FT                   dehydratase 1; PFAM: Serine dehydratase alpha chain; Serine
FT                   dehydratase beta chain; TIGRFAM: L-serine dehydratase,
FT                   iron-sulfur-dependent, single chain form"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65870"
FT                   /db_xref="GOA:D7AWA4"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWA4"
FT                   /protein_id="ADH65870.1"
FT                   /translation="MAISVFDLFKIGIGPSSSHTVGPMKAARTFVAGLREEGLLDGVAR
FT                   VRAELYGSLALTGKGHGSDRAVVLGLMGHTPEHVDVDAVPELVEGVRRERTLYPGGPEG
FT                   PPVAFDPAVDVDFRRRESLPDHPNGMRFVALDSSGAELAAKVYYSVGGGFVVDERAAGA
FT                   DRIKADDTRVPHPFSSAEELLGICADTGMSISAVMLANEQAFGRSPERIRAELLVLWEA
FT                   MRQCVRRGVTTEGSLPGGLKVPRRAHRLYRQLGGNCDESGLLAPTGVDSDPMRGSDWIT
FT                   LYALAVNEENAAGGRVVTAPTNGAAGIVPAVLHYYLHFSPGAGDEGVVRFLLTAGAVGI
FT                   LFKQNASISGAEVGCQGEVGSASSMAAAGLAEVLGGTPAQVENAAEIAMEHNLGLTCDP
FT                   IGGLVQVPCIERNALASVKAISAARIALRGDGSHFVSLDKVIRTMRDTGRDMMDKYKET
FT                   SRGGLAVNVIEC"
FT   gene            complement(513705..514973)
FT                   /locus_tag="Ndas_0424"
FT   CDS_pept        complement(513705..514973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0424"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="COGs: COG0112 Glycine/serine
FT                   hydroxymethyltransferase; InterPro
FT                   IPR015424:IPR001085:IPR019798:IPR015421; KEGG: tfu:Tfu_2353
FT                   serine hydroxymethyltransferase; PFAM: glycine
FT                   hydroxymethyltransferase; PRIAM: Glycine
FT                   hydroxymethyltransferase; SPTR: C1YLX7 Serine
FT                   hydroxymethyltransferase; PFAM: Serine
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65871"
FT                   /db_xref="GOA:D7AWA5"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWA5"
FT                   /protein_id="ADH65871.1"
FT                   /translation="MATDNTLNQTLGELDPEVAAAVDAELARQRDTLEMIASENFAPQA
FT                   VIEAQGTVLTNKYAEGYPGRRYYGGCEHVDVVEQLAIDRAKALFGAEHANVQPHSGAQA
FT                   NTAVYFALLKPGDTILGLDLAHGGHLTHGMKINYSGKILNAVAYHVRDEDGTVDYDEVE
FT                   ALAEEHRPKMIVAGWSAYPRQLDFARFRKIADSVGALLMVDMAHFAGLVAAGLHPNPVP
FT                   HADVVTTTTHKTLGGPRGGMILAKAELGKKINSAVFPGMQGGPLEHVIAAKAVALKVAA
FT                   GEEFADRQRRTVSGARLLAERLTRPDAAEVGVKVLSGGTDVHLVLVDLVNSELNGQEAE
FT                   DRLHSIGITVNRNAVPNDPRPPMVTSGLRIGTPALATRGFGDEDFAEVADVIAEALKPE
FT                   FDEAALRGRVQALTAKYPLYPNL"
FT   gene            complement(514981..515361)
FT                   /locus_tag="Ndas_0425"
FT   CDS_pept        complement(514981..515361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0425"
FT                   /product="glycine cleavage system H protein"
FT                   /note="COGs: COG0509 Glycine cleavage system H protein
FT                   (lipoate-binding); InterPro
FT                   IPR003016:IPR011053:IPR017453:IPR002930; KEGG: tfu:Tfu_2352
FT                   glycine cleavage system H protein; PFAM: glycine cleavage
FT                   H-protein; SPTR: C1YLX6 Glycine cleavage system H protein;
FT                   TIGRFAM: glycine cleavage system H protein; PFAM: Glycine
FT                   cleavage H-protein; TIGRFAM: glycine cleavage system H
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65872"
FT                   /db_xref="GOA:D7AWA6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWA6"
FT                   /protein_id="ADH65872.1"
FT                   /translation="MSVPTELGYTAKHEWVVVEDGIATVGITSFAAESLGDIVYVEVPE
FT                   VGSEVTADEPCGEVESTKSVSDVYSPVSGEVTEVNAILENEPETINSSPFEDGWLFRAR
FT                   ISEEPTDLLSAEEYTKLTEGEE"
FT   gene            complement(515520..516638)
FT                   /locus_tag="Ndas_0426"
FT   CDS_pept        complement(515520..516638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0426"
FT                   /product="glycine cleavage system T protein"
FT                   /EC_number="2.1.2.10"
FT                   /note="COGs: COG0404 Glycine cleavage system T protein
FT                   (aminomethyltransferase); InterPro
FT                   IPR006223:IPR006222:IPR013977; KEGG: tfu:Tfu_2351 glycine
FT                   cleavage system aminomethyltransferase T; PFAM: glycine
FT                   cleavage T protein (aminomethyl transferase); Glycine
FT                   cleavage T-protein barrel; SPTR: C1YLX5
FT                   Aminomethyltransferase; TIGRFAM: glycine cleavage system T
FT                   protein; PFAM: Aminomethyltransferase folate-binding
FT                   domain; Glycine cleavage T-protein C-terminal barrel
FT                   domain; TIGRFAM: glycine cleavage system T protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65873"
FT                   /db_xref="GOA:D7AWA7"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWA7"
FT                   /protein_id="ADH65873.1"
FT                   /translation="MPMSDAASAPRATALREVHEKAGATLVDFAGWLMPLRYGSETAEH
FT                   RAVREAAGLFDLSHMGEIRLTGPQAAQALDHALVGHLSQVKVGRARYSMITAEDGGVLD
FT                   DLIVYRLREDEYLVVANAANTAVVAPALAERAAGFDVEVRDESAEYALIAVQGPRAVDV
FT                   LAPLTDADLDGIRYYAGYEHTVAGEPVLLARTGYTGEDGFEIFVSPADRAPKVWDALMA
FT                   EGERHGLVPAGLSARDTLRMEAGMPLYGQELTADLTPFDAGLGRVVKFDKGDFVGRAAL
FT                   EEASRSSRPRRLIGLVARGRRPLRQGQEVLRDGTPVGTITSGAPSPTLGRPIAMAYVDG
FT                   DLDTSTGAFTVDVRGRGEDVDVVELPFYKRQS"
FT   gene            517097..518017
FT                   /locus_tag="Ndas_0427"
FT   CDS_pept        517097..518017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0427"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="COGs: COG2602 Beta-lactamase class D; InterPro
FT                   IPR001460:IPR012338; KEGG: sro:Sros_8961 beta-lactamase;
FT                   PFAM: penicillin-binding protein transpeptidase; PRIAM:
FT                   Beta-lactamase; SPTR: C1YLX4 Beta-lactamase class D; PFAM:
FT                   Penicillin binding protein transpeptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65874"
FT                   /db_xref="GOA:D7AWA8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWA8"
FT                   /protein_id="ADH65874.1"
FT                   /translation="MRTDTGRTARSLAAGCVLSLAAGTGCAGAVDGPREPDGHAREGAE
FT                   AGPPPLTRGDVAAVEREALEAVFADAGVEGTFVLHDVMEREATVVGPERARERAVPAST
FT                   FDLVSTLVGLQTGAVGDVDEVVPHGGGSRSADRRERDTAPREALPDSNVPVYQEVARRV
FT                   GHGPMAAWVDRLDYGNRSVGDANALDRFWLEGPLEISAMEQTAFLARLARDELPVDDAH
FT                   QEAVRALALLEEGDGYALHAKAGRGREADPAPGWWVGWVERGEDLYTFALRVEPEGDED
FT                   AELGESLGREMLVELEVLPEEGRTA"
FT   sig_peptide     517097..517183
FT                   /locus_tag="Ndas_0427"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(518135..519190)
FT                   /locus_tag="Ndas_0428"
FT   CDS_pept        complement(518135..519190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0428"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="COGs: COG0722 3-deoxy-D-arabino-heptulosonate
FT                   7-phosphate (DAHP) synthase; InterPro
FT                   IPR006218:IPR006219:IPR013785; KEGG: tfu:Tfu_2350
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; PFAM: DAHP
FT                   synthetase I/KDSA; PRIAM: 3-deoxy-7-phosphoheptulonate
FT                   synthase; SPTR: C1YLX3
FT                   3-deoxy-D-arabinoheptulosonate-7-phosphate synthase;
FT                   TIGRFAM: phospho-2-dehydro-3-deoxyheptonate aldolase; PFAM:
FT                   DAHP synthetase I family; TIGRFAM:
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65875"
FT                   /db_xref="GOA:D7AWA9"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWA9"
FT                   /protein_id="ADH65875.1"
FT                   /translation="MPSTNDTRVASYKPLIAPRDLLAELPLGAERSALVEESRAEVKRV
FT                   LDGEDDRLLVVVGPCSVHDPESAMDYARRLKELVPSLRDELCVVMRVYFEKPRTTVGWK
FT                   GLINDPGLDDTYDVHRGLRTARKLLLDINALGLPAGTEFLDPITPQYIADVVSWGAIGA
FT                   RTTESQVHRQLSSGLSTPVGFKNGTDGDVQVAVDAVGAAAASHTFFGIDPTGAGSVVVT
FT                   EGNPDCHVILRGGRSGPNFGAGQVNAALDVIEGAGLPRRLMIDASHANSGKDHTRQPGV
FT                   AAAIAAQVAEGQTGVIGVMLESFIVEGAQKLGDPAALTYGQSITDKCMGWETTGEVLTQ
FT                   LAEAVRQRRKA"
FT   gene            complement(519424..521142)
FT                   /locus_tag="Ndas_0429"
FT   CDS_pept        complement(519424..521142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0429"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG0365 Acyl-coenzyme A synthetase/AMP-(fatty)
FT                   acid ligase; InterPro IPR000873; KEGG: ami:Amir_2275
FT                   AMP-dependent synthetase and ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; SPTR: C1YLX2 Acyl-CoA
FT                   synthetase/AMP-acid ligase; PFAM: AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65876"
FT                   /db_xref="GOA:D7AWB0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWB0"
FT                   /protein_id="ADH65876.1"
FT                   /translation="MSRETAAAGAAEFRAARDLLLDLREDQGRAHREFTWPRSDRFNWA
FT                   LDYFDEVAGRRPDRTALWIVEEDGGQARYTYRRMSERSAQVANWLNNQGVHPGDRILLM
FT                   LGNQVELWETLLAATKLGAVVCPTPTSLSEGDLLDRLERGEIAHVVCSAAETEKFAPLR
FT                   GHWTRICTGYMEGWLNYADSEHAGLDFHPPHTTHPDDPLLLYFTSGTATLPKLVVHTQR
FT                   SYPVGHLSTMYWLGVRPGDVHLNVSEPGWAKHAYGSVFAPWNAEATVLVVNQERFDAAG
FT                   LLDAIVRCGVDTLCAPPTVWRTLAQADPAAWDVGLREAVAAGEPLNPEVVDRVREAWGV
FT                   TVRDGFGQTETTVLLGNGPGQRVVRGSMGREMPGYDVVLTDPATDEPADTGQICVDLAR
FT                   EPVGVMKGYADNPGLSREVVRGDRYRTGDIASRDSNGYITYIGRSDDVFKASDYRISPF
FT                   ELESVLVEHEYVVEAAVVPSPDPLRLAVAKAYVALAEGVAPDAETARSILAHARERLSP
FT                   HQRVRRLEFGELPKTVSGKIRRVQLRRAEAERGTVADGARNPREYWEEDLPGLER"
FT   gene            521493..522374
FT                   /locus_tag="Ndas_0430"
FT   CDS_pept        521493..522374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: svi:Svir_14400 hypothetical protein; SPTR:
FT                   C1YLX1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65877"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="InterPro:IPR027860"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWB1"
FT                   /protein_id="ADH65877.1"
FT                   /translation="MEELRGHHGTWRIDDETIRVRFDSGRKVPALFRSLGSCSVPLAAV
FT                   REVDFDRGTRKHGWRLRLRLVEGGDPYALLGVPGRDALTPLLITGPHDGELLAEYYSEQ
FT                   IASSARFARETLTGELDPREVARGLVARPPLQVRTAEGTASFDGTRVRLQWDNWLASTA
FT                   KQKEKARDYQLSEIETAHWHPPVDVTEGYLRIVLRGVTIPEATALDHDFFTLASHGTKG
FT                   SEETLLMAATVNAHVAAAEDPRQERAALGAADDDGSEAVFAKIRELGRLHAEGLLTDDE
FT                   FSAKKAELLDRL"
FT   gene            522543..523499
FT                   /locus_tag="Ndas_0431"
FT   CDS_pept        522543..523499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0431"
FT                   /product="proline iminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /note="COGs: COG0596 hydrolase or acyltransferase
FT                   (alpha/beta hydrolase superfamily); InterPro
FT                   IPR005944:IPR002410:IPR000073; KEGG: tfu:Tfu_2349 prolyl
FT                   aminopeptidase; PFAM: alpha/beta hydrolase fold; PRIAM:
FT                   Prolyl aminopeptidase; SPTR: C1YLX0 Proline iminopeptidase;
FT                   TIGRFAM: proline iminopeptidase; PFAM: alpha/beta hydrolase
FT                   fold; TIGRFAM: proline iminopeptidase, Neisseria-type
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65878"
FT                   /db_xref="GOA:D7AWB2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWB2"
FT                   /protein_id="ADH65878.1"
FT                   /translation="MRTLYPPIEPYDSGMLDVGDGHRVYWELCGNPAGKPVVFLHGGPG
FT                   GGCVPDHRRLFDPERYRILLFDQRNCGRSTPHASQMDTDLSTNTTWTLVQDMERLREMI
FT                   GAESWQVFGGSWGSCLALAYAQRHPDRVSELVVRGIFTLRESELRWFYQEGASQLFPDL
FT                   WESYLAPIPEEERGDLIAAYARRLNSPDREERLAAARSWSVWEGSTVTLLPNHELREHH
FT                   ADEDYALAFARIENHYFVNRGFLEPDQLIDGAEAIRHIPGVIVQGRYDVCTPARTAYDL
FT                   HKAWPEAEFHIVDDAGHAFSEPGILDHLIEATDRFAK"
FT   gene            complement(523706..525010)
FT                   /locus_tag="Ndas_0432"
FT   CDS_pept        complement(523706..525010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0432"
FT                   /product="signal transduction histidine kinase-like
FT                   protein"
FT                   /note="KEGG: sro:Sros_1550 signal transduction histidine
FT                   kinase-like protein; SPTR: C1YLW9 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65879"
FT                   /db_xref="GOA:D7AWB3"
FT                   /db_xref="InterPro:IPR025231"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWB3"
FT                   /protein_id="ADH65879.1"
FT                   /translation="MLAAALLFTAVFRDAGWVLLWTLTASFLFASMAFAARNPASRQGA
FT                   AGVVTGSLALLRNLPSTPRFLAAPLQSSRSRRLVGPVLVTTVATVGLLLVFGVLFAFAD
FT                   PVFGSYLGRMFTNLFREGDLNPFGDLFAMVTAMLLTGSAVLAARRRHAPRHAPRATPVN
FT                   PSPERTPLPVWVWTIPLGALVLLFTAFLAVQAVAMFGGDEYVQRVAGVTYAEYARQGFF
FT                   QLVVVSLLVLCVIAVVVRILPSSTTRVLRNVLLGLLCTLTLVILASAMLRLQLYIDTYG
FT                   LTRMRASAEAWIVWSAGVFGLLLVAGALDTLGRSAAWLPRVTAALAGTALAVFAYGNPD
FT                   LRIAESHRDLDLSTIDTWYLRDLSADAIPGLLELEGDERDCALVGFQDLVEEADDAGFA
FT                   SWNLSRHRGLQQLDELGLFEIGGQAGMSCSYERGY"
FT   sig_peptide     complement(524906..525010)
FT                   /locus_tag="Ndas_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            526548..526739
FT                   /locus_tag="Ndas_0433"
FT   CDS_pept        526548..526739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0433"
FT                   /product="protein of unknown function DUF1271"
FT                   /note="InterPro IPR010693; KEGG: afo:Afer_0565 ferredoxin
FT                   (3Fe-4S); PFAM: protein of unknown function DUF1271; SPTR:
FT                   C1YLW8 Ferredoxin; PFAM: Protein of unknown function
FT                   (DUF1271)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65880"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWB4"
FT                   /protein_id="ADH65880.1"
FT                   /translation="MRVEVDYDQCESNALCMAAAPEVFEVRDDDFLYLLTEEPAAASRE
FT                   RVRQAERMCPKRAITVRE"
FT   gene            complement(526723..527994)
FT                   /locus_tag="Ndas_0434"
FT   CDS_pept        complement(526723..527994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0434"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG1251 NAD(P)H-nitrite reductase; InterPro
FT                   IPR004099:IPR016156:IPR013027; KEGG: tfu:Tfu_2348 putative
FT                   ferredoxin reductase; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; SPTR: C1YLW7
FT                   NAD(P)H-nitrite reductase; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65881"
FT                   /db_xref="GOA:D7AWB5"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWB5"
FT                   /protein_id="ADH65881.1"
FT                   /translation="MRDTLNDIVVVGAGMAGLHTAEALRERGYEGRLTLLGEEAHRPYS
FT                   RPPLSKEVLTGVGMEPPGGGPGWLVGHRALRLREDEAVDALDLDFRPGSRAVGLDTAAR
FT                   EVSVSGPGGAASTVRYDGLVIATGARARRPATDLAGVYVLRTLDDAEAVRSEFDSGGRL
FT                   VVVGAGFVGAEVAASARAVGMDVTLVEAAPTPLTRVVDPRIGEVLTELHRENGVDVRLG
FT                   VGVAGFEGRGRVERVRLADGSAVEASLVVAGIGVHLNTEWLRGSGVELLADGSVACDEY
FT                   SATSVPNVYAVGDLANWPHPRYGGRIRLEHWTNAGEQGEAAAHNLLAGDGGRTPFTPVP
FT                   YFWSDQYRMKVQLLGQGAPADQVAFVHGSPEDRKFVAFLGRGGMLTGVLGLRSTPKTMR
FT                   YRGLLEKPTTWDEALAAAGVTPAR"
FT   gene            complement(528037..528999)
FT                   /locus_tag="Ndas_0435"
FT   CDS_pept        complement(528037..528999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0435"
FT                   /product="L-asparaginase II"
FT                   /note="COGs: COG4448 L-asparaginase II; InterPro IPR010349;
FT                   KEGG: sro:Sros_6297 hypothetical protein; PFAM:
FT                   L-asparaginase II; SPTR: C1YLW6 L-asparaginase II; PFAM:
FT                   L-asparaginase II"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65882"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWB6"
FT                   /protein_id="ADH65882.1"
FT                   /translation="MPQSPLPEYVPLAQVVRSGMLESVHYGAVVGLAADGRIAYARGPV
FT                   HQPMFPRSSAKPFQALAMLRAGARLEGPSLAIAAGSHSGEEAHTAETERILAAAGLTAD
FT                   ALGCPPAAPGGREARAAFVRAGREPERVLMNCSGKHAGMLAACVARGWSTGDYLEAEHP
FT                   FQVLVRETIEELCEEPVAHTAVDGCGAPQMAVSLTGLARGLWRMRTAPEGGPERAVVEA
FT                   MSAHPLYVAGSDRIDTDLMRRMPGLVAKGGADGVLVLSAATGETVAVKISDGDAEERAR
FT                   TLVALDALRTLGVDVSPVQDRLRVDVLGGGAPVGEVRPL"
FT   gene            529302..530321
FT                   /locus_tag="Ndas_0436"
FT   CDS_pept        529302..530321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0436"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="COGs: COG0847 DNA polymerase III epsilon subunit and
FT                   related 3'-5' exonuclease; InterPro
FT                   IPR012337:IPR006055:IPR013520; KEGG: tfu:Tfu_2347
FT                   exonuclease; PFAM: Exonuclease RNase T and DNA polymerase
FT                   III; SMART: Exonuclease; SPTR: C1YLW5 DNA polymerase III
FT                   epsilon subunit-like 3'-5' exonuclease; PFAM: Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65883"
FT                   /db_xref="GOA:D7AWB7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWB7"
FT                   /protein_id="ADH65883.1"
FT                   /translation="MGTLRMGALTRRRVGMRAADLEYAVLDMETTGLEPREGARIVEIA
FT                   VVRVRGDGKFVEEFSTLIDPRAPVGGREFHGIGEGDTVGAPTAAQVVPRLTELLSGAVV
FT                   VGHNLDFEQRFLASELVPAGLPTGQAGLCTLRALRSQVELERYSLPKASHRLSGDWPTG
FT                   QHTALGDARACAKLLAEMLTNAPGELRYGGPAPKRLTVPDPVPGPVGAAGPVRWKPRTS
FT                   SVPGGLPPLSPWQARWRPHELDPLLCGGAFGATDRAIAEMAAHRDTRFRERLAAAAAVT
FT                   GGLAATAAGGLLLRMAGGGGTRDLGYPAGRGDGSPERLLGRIGRSVLRDRPGFTDRTG"
FT   gene            complement(530302..530565)
FT                   /locus_tag="Ndas_0437"
FT   CDS_pept        complement(530302..530565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0437"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpr:GBP346_A0535 hypothetical protein; SPTR:
FT                   C1YLW4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65884"
FT                   /db_xref="GOA:D7AWB8"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWB8"
FT                   /protein_id="ADH65884.1"
FT                   /translation="MSLVLILLGAVLVAVAMFNKVPSYVPGRIPAPRPGRGGSVAAARS
FT                   PEMVRPRVRLVSARLTEPGKALLTTFGGSALIVAFFLTLSGL"
FT   sig_peptide     complement(530437..530565)
FT                   /locus_tag="Ndas_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(530720..531379)
FT                   /locus_tag="Ndas_0438"
FT   CDS_pept        complement(530720..531379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0438"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="COGs: COG1309 Transcriptional regulator; InterPro
FT                   IPR001647:IPR012287:IPR011075:IPR009057; KEGG: tfu:Tfu_2346
FT                   hypothetical protein; PFAM: regulatory protein TetR; SPTR:
FT                   C1YLW3 Transcriptional regulator, TetR family; PFAM:
FT                   Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65885"
FT                   /db_xref="GOA:D7AWB9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWB9"
FT                   /protein_id="ADH65885.1"
FT                   /translation="MPKITAPTIAAHRARTRDRIMDAVDELIRTQGIDRISMTDVANSA
FT                   GITRTALYNYFPDKPALLLAFTEQVNSAFVERYRRELPSGVSAARRLSAFVRLQLEGIM
FT                   AHPHPPAAELGASLGPDAYQALAAHVAPMQRLLTEILEEGTAAGEFDPLPAEPVSRLAL
FT                   SMVGSQRLPLVSGEIDLDETHALVTRFVLRALGVATETVDTVLPQTATKNTRSGDS"
FT   gene            complement(531572..532453)
FT                   /locus_tag="Ndas_0439"
FT   CDS_pept        complement(531572..532453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0439"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COGs: COG0596 hydrolase or acyltransferase
FT                   (alpha/beta hydrolase superfamily); InterPro
FT                   IPR000639:IPR000073; KEGG: mjl:Mjls_0879 alpha/beta
FT                   hydrolase fold; PFAM: alpha/beta hydrolase fold; SPTR:
FT                   C1YLW2 Predicted hydrolase or acyltransferase of alpha/beta
FT                   superfamily; PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65886"
FT                   /db_xref="GOA:D7AWC0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWC0"
FT                   /protein_id="ADH65886.1"
FT                   /translation="MTEIRHQYATVRGHRVFYREAGPRDAPALVLLHGFPTSSRMFRRL
FT                   IPRLADRFRVIAPDHLGFGHSDAPPADAFAYTFDALTDVTEALLAGLGVTSYAMYVQDY
FT                   GAPVGWRLALRAPEAVTAVVTQNGNAYEDGFVPEFWAPVWAYAKDPGPATEPAVRTALD
FT                   LDAVRWQYLHGVDRPELVDPDTWTADHRDISRPGNDLVQLALLRDYATNPPLYPRVHAY
FT                   FRESRVPLLAVWGAEDRIFGPDGARAFARDLPDAEIRLVPGGGHFLLESHLDGTAERIR
FT                   DFLTRTLTAPRG"
FT   gene            532561..533064
FT                   /locus_tag="Ndas_0440"
FT   CDS_pept        532561..533064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0440"
FT                   /product="protein of unknown function DUF1470"
FT                   /note="InterPro IPR010852; KEGG: sco:SCO0460 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1470; SPTR:
FT                   C1YLW1 Conserved protein containing a Zn-ribbon-like motif,
FT                   possibly RNA-binding; PFAM: CGNR zinc finger"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65887"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWC1"
FT                   /protein_id="ADH65887.1"
FT                   /translation="MVDEEALLEALNSTPVVDGRRRDLWADDAAPRRWAREHGGSDDAA
FT                   AIDWLRTARDVLQAATRGPVPEARMRGMLAGVTRVPDIDGADLRWTLRAPPERTLAVEL
FT                   VLAWYDVQERRPGRLRPCGNDECRLFLLDRSRANTARWCSMRTCGNRLKARRHQERARR
FT                   APEA"
FT   gene            complement(533083..533790)
FT                   /locus_tag="Ndas_0441"
FT   CDS_pept        complement(533083..533790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0441"
FT                   /product="Heme oxygenase"
FT                   /EC_number="1.14.99.3"
FT                   /note="COGs: COG5398 Heme oxygenase; InterPro
FT                   IPR016053:IPR002051:IPR016084; KEGG: tfu:Tfu_2345 heme
FT                   oxygenase (decyclizing); PFAM: Haem oxygenase-like; PRIAM:
FT                   Heme oxygenase; SPTR: C1YLW0 Heme oxygenase; PFAM: Heme
FT                   oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65888"
FT                   /db_xref="GOA:D7AWC2"
FT                   /db_xref="InterPro:IPR002051"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWC2"
FT                   /protein_id="ADH65888.1"
FT                   /translation="MSATAEVPATTAPDTPGTFSERLRAATWSDHQAAEDHGFTRALMD
FT                   GTLPLDGYTGMVAQHYFAYVALEETGRRLADDPVAGRFHYPELERVPALVRDLEHLLGA
FT                   DWRDRIAPTPATRTYAARIEQMADHPEGFVAHHYTRYMGDVSGGQFIRRVAASAYGLTD
FT                   AAGVSFYVFDALGSLPRFRAGYRERLDSLALDEAAAARLVAETRLAYQLNTEVFADLGR
FT                   MYAPGTGADADAA"
FT   gene            534380..535645
FT                   /locus_tag="Ndas_0442"
FT   CDS_pept        534380..535645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0442"
FT                   /product="response regulator receiver modulated serine
FT                   phosphatase"
FT                   /note="COGs: COG2208 Serine phosphatase RsbU regulator of
FT                   sigma subunit; InterPro
FT                   IPR001789:IPR011006:IPR001932:IPR010822; KEGG: tfu:Tfu_2344
FT                   response regulator receiver:protein phosphatase 2C-like;
FT                   PFAM: Stage II sporulation E family protein; response
FT                   regulator receiver; SMART: protein phosphatase 2C domain
FT                   protein; response regulator receiver; SPTR: C1YLV9 Serine
FT                   phosphatase RsbU, regulator of sigma subunit; PFAM:
FT                   Response regulator receiver domain; Stage II sporulation
FT                   protein E (SpoIIE)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65889"
FT                   /db_xref="GOA:D7AWC3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWC3"
FT                   /protein_id="ADH65889.1"
FT                   /translation="MTVIGGEAARAASANDAAPHDGAFLGDDTVPNERVEAAVEPVDVL
FT                   LIEDDPGDAFLAEELLDETALPTHITWVPTLAEARRHLEGFRGCVLLDLNLPDAHGLDL
FT                   LREVLEGAPEAAVVVLTGLDDEHEGVAAVAAGAQDYLVKGQVDGSLLGRSLRYSLERRR
FT                   ADENARQLREARMSARENMRLERGLLPQVLLQRSPLEHLAYYRPGRKRALVGGDFYDAV
FT                   EKDGTTHVIIGDVSGHGPDEAALGVSLRIAWRALIMGGVDEDKVLTSLEDILVTERAQE
FT                   EMYATLCMASLDTGDDRVRLRVLGHPPPMVLRGGAVEETRVTPQPPLGVFPVEQTDTDT
FT                   VVLPTGATMLFYTDGLVDAYDGAPPARLEVAGLRRMVSGVLERGTSLAGLPERLVDEAE
FT                   RSNGGPLQDDVAMLLITHGEPE"
FT   gene            535672..537597
FT                   /locus_tag="Ndas_0443"
FT   CDS_pept        535672..537597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0443"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG4251 Bacteriophytochrome (light-regulated
FT                   signal transduction histidine kinase);
FT                   InterProIPR009082:IPR003660:IPR003594:IPR003661:IPR
FT                   005467:IPR007891:IPR004358; KEGG: tfu:Tfu_2343 multi-sensor
FT                   signal transduction histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase HAMP region
FT                   domain protein; histidine kinase A domain protein; CHASE3
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; histidine
FT                   kinase HAMP region domain protein; SPTR: C1YLV8 Sensor
FT                   protein; PFAM: HAMP domain; Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; His Kinase A (phosphoacceptor)
FT                   domain; CHASE3 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65890"
FT                   /db_xref="GOA:D7AWC4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWC4"
FT                   /protein_id="ADH65890.1"
FT                   /translation="METEGSGPAPDTGVHGAASTGGTHFVNGTNREGKRSAHQSWSLRR
FT                   RVTSLLAVVAVVLVVAVSVITLAAFQARESLALQVDSLTPAVSAVEQTHSAYLTQDHAL
FT                   RGYILTQDREFLQPYVESQLTLTENQAVLAQLAEDNPEVATNVDDLLTAGRVWTEEFAE
FT                   PALERVSGGQEVTQEELRRGRVLFLELSRISDATTSQLEAEIKEAREGLTLATQQVVAL
FT                   LVLVGLVVVFLSVFLWVMLQQWVLRPLEELAGHMRQVSEGYYAHRISLHGPPEIVRLGQ
FT                   DVDAMRERIVQDLDEVASARRKLQEQSVLMENQTEELRRSNLELEQFAYVASHDLQEPL
FT                   RKVASFCQLLQRRYQGQLDERADAYIDFAVEGAKRMQTLINDLLAFSRVGRVRNFAPVA
FT                   LDDALDDALSSLSTRLEEADAEVTRDPLPTVQGDRTLLTQVFFNLVGNAVKFRGEEDPR
FT                   VHISVERRGDEWVFCCSDNGIGIEPQYAERIFVIFQRLHTRDKYTGTGIGLAMCKKIVE
FT                   FHGGRIWLETGSRDPGESETSGDRDSGRTGTRICWSLPADPAEDEDPAPDRGTAEPLAV
FT                   DNGDEGTEDAETTPEDSAPTAARQPTGTDNPGEDGAEPGDRPGGVRSAQPDTGGGTVPP
FT                   GHGAGP"
FT   gene            537626..538060
FT                   /locus_tag="Ndas_0444"
FT   CDS_pept        537626..538060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0444"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG2197 Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain;
FT                   InterPro IPR001789:IPR011006; KEGG: tfu:Tfu_2342 response
FT                   regulator receiver; PFAM: response regulator receiver;
FT                   SMART: response regulator receiver; SPTR: C1YLV7 Response
FT                   regulator containing a CheY-like receiver domain and an HTH
FT                   DNA-binding domain; PFAM: Response regulator receiver
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65891"
FT                   /db_xref="GOA:D7AWC5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWC5"
FT                   /protein_id="ADH65891.1"
FT                   /translation="MLVHPIEVLLVEDDPGDVLMTREAFEEHKLGNRLHVVSDGVEALR
FT                   FLRREEEFADAPRPHLILLDLNLPRKDGREVLEEVKNDEDLAHIPVVVLTTSEAEEDVL
FT                   RSYRLHANAYVPKPVDFDQFIRVVRQIDDFFVSVVRLPKG"
FT   gene            538283..538843
FT                   /locus_tag="Ndas_0445"
FT   CDS_pept        538283..538843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0445"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="COGs: COG0394 Protein-tyrosine-phosphatase; InterPro
FT                   IPR017867:IPR000106; KEGG: tfu:Tfu_2341
FT                   protein-tyrosine-phosphatase; PFAM: Protein-tyrosine
FT                   phosphatase, low molecular weight; SMART: Protein-tyrosine
FT                   phosphatase, low molecular weight; SPTR: C1YLV6
FT                   Protein-tyrosine-phosphatase; PFAM: Low molecular weight
FT                   phosphotyrosine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65892"
FT                   /db_xref="GOA:D7AWC6"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWC6"
FT                   /protein_id="ADH65892.1"
FT                   /translation="MAAAVFRYGKGMSLPEPRDPAGPYRVSVVCLGNICRSPMAEKILA
FT                   ADLERAGMSDLVAVDSFGTGDWHVGGGMDPRAASTLRVHGYLTSHTARQFAHEVLADRD
FT                   LVLAMDLDNVDEIRRIVDEYGEEYGFDMSRVRLFRSFAPGTGPNPEVPDPYYGGDDGFT
FT                   AVLNMVESAAKGLTGELVTRLRR"
FT   gene            538867..539793
FT                   /locus_tag="Ndas_0446"
FT   CDS_pept        538867..539793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0446"
FT                   /product="Fructosamine/Ketosamine-3-kinase"
FT                   /note="COGs: COG3001 conserved hypothetical protein;
FT                   InterPro IPR011009:IPR016477; KEGG: tfu:Tfu_2340
FT                   hypothetical protein; PFAM:
FT                   Fructosamine/Ketosamine-3-kinase; SPTR: C1YLV5
FT                   Fructosamine-3-kinase; PFAM: Fructosamine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65893"
FT                   /db_xref="GOA:D7AWC7"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016477"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWC7"
FT                   /protein_id="ADH65893.1"
FT                   /translation="MRDFGGDGGDGHGEGRRRDPVNGTMAERLTVLLDRDVRRAARAGS
FT                   SHDWDIYYAELTDGTRLFVKSLVRGAPPNGVLTAEARGLDWLGRTFGSPAVDVVAWDDR
FT                   ILVLPWIEEREPTAQAAERLGRQLAGMHLTGADHFGADWPGYIGPLTMDNTPSRDWPRF
FT                   YAEQRLRPYLRQALDQGSLTPSDGRVVEKVVDAVADLAGEPEEPARVHGDLWSGNVLWR
FT                   AQDAVVIDPAAHGGHREADLAMLALFGLPHLERVRDAYNEVAPLASGWRSRVALHQLHP
FT                   LLVHVCLFGAAYRTTTLEAARTALRGG"
FT   gene            540102..540794
FT                   /locus_tag="Ndas_0447"
FT   CDS_pept        540102..540794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0447"
FT                   /product="haloacid dehalogenase, type II"
FT                   /note="COGs: COG1011 hydrolase (HAD superfamily); InterPro
FT                   IPR005833:IPR006328:IPR006388:IPR005834; KEGG: sma:SAV_737
FT                   2-haloalkanoic acid dehalogenase; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; SPTR: C1YLV4
FT                   2-haloalkanoic acid dehalogenase, type II; TIGRFAM:
FT                   haloacid dehalogenase, type II; HAD-superfamily hydrolase,
FT                   subfamily IA, variant 2 (HAD-like); TIGRFAM: Haloacid
FT                   dehalogenase superfamily, subfamily IA, variant 2 with 3rd
FT                   motif like haloacid dehalogenase; 2-haloalkanoic acid
FT                   dehalogenase, type II"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65894"
FT                   /db_xref="GOA:D7AWC8"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWC8"
FT                   /protein_id="ADH65894.1"
FT                   /translation="MTSPSDIDVIVFDVLGTMVDEPAGIGRGIRTLLPDIDDVRARELV
FT                   QVWNRHVDEQQQEILAGRRPYANSTVIDLEAATRVAAEAGVDDADAIRSLAASAQRLAP
FT                   WPDSASALDRIASYFPVVGLSNASHPALTRISAHAGLRWHQVLSAEDARGYKPHPDVYR
FT                   LAIANADCPPDRLLMVAAHAWDLRGAQALGMRTAYVERPVGDPPRATDRFDLAVKSLDE
FT                   LAISLNAI"
FT   gene            541192..541569
FT                   /locus_tag="Ndas_0448"
FT   CDS_pept        541192..541569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0448"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="InterPro IPR004360; KEGG: rop:ROP_63350 hypothetical
FT                   protein; PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; SPTR: C1YLV3 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65895"
FT                   /db_xref="GOA:D7AWC9"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWC9"
FT                   /protein_id="ADH65895.1"
FT                   /translation="MACRISELVLSCRDPEVLARFWCEVLDFVVLDREEGCIEIGPREG
FT                   FGGLQPTIILSRTEEPERAKPRLHIDVNATDRDQDAELERLLAAGAVFADIGQSGEEPW
FT                   HVLADPEGNEFCLLRARLDRL"
FT   gene            complement(541781..542713)
FT                   /locus_tag="Ndas_0449"
FT   CDS_pept        complement(541781..542713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0449"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="COGs: COG0604 NADPH:quinone reductase and related
FT                   Zn-dependent oxidoreductase; InterPro
FT                   IPR013149:IPR016040:IPR011032:IPR013154; KEGG:
FT                   sro:Sros_7645 oxidoreductase; PFAM: Alcohol dehydrogenase
FT                   zinc-binding domain protein; Alcohol dehydrogenase GroES
FT                   domain protein; SPTR: C1YLV2 Zn-dependent oxidoreductase,
FT                   NADPH:quinone reductase; PFAM: Zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65896"
FT                   /db_xref="GOA:D7AWD0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWD0"
FT                   /protein_id="ADH65896.1"
FT                   /translation="MRALVVDRTAPHHLRLGEAPEPVAAPHQALVRVTATSLNFGEVST
FT                   VSHLPDGTVPGWDAAGFVERPAADGSGPAVGTAVVTLGAAGGWAELRAVDTASLGAAPE
FT                   GADHGALSTVPVAATSALRALREVGFLLGRRILVTGATGGVGRYAVQLARMGGAHVTAC
FT                   TGGPRTHGAELRGLGAHEVVSQPGEPDYLFDGVVDCVGGPQLVTAFDRLNAGGTLVAVG
FT                   HVTGQPEHFPLDAFLVDDGRHSRSITAFHLQNGVAPAGDLGWLAGRVASGDLDPGISWR
FT                   GSWDRADEAVAALLERRLRGKAVLELTAG"
FT   gene            542862..543503
FT                   /locus_tag="Ndas_0450"
FT   CDS_pept        542862..543503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0450"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647:IPR012287:IPR009057; KEGG:
FT                   ami:Amir_3846 transcriptional regulator, TetR family; PFAM:
FT                   regulatory protein TetR; SPTR: C1YLV1 Transcriptional
FT                   regulator, TetR family; PFAM: Bacterial regulatory
FT                   proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65897"
FT                   /db_xref="GOA:D7AWD1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWD1"
FT                   /protein_id="ADH65897.1"
FT                   /translation="MASTRPRPAASEESLRERKKRRTRRALVDTALERFTRAGYDQVTL
FT                   DEVCAEAEVSKRTFFRYFASKEELAMAPLQDLWGAFLRVLEEKGPDGRPLVELARDAIL
FT                   EAVEHVADREWTHAARLSLSLAGSTPAISAHNLQFCERTTVRALAVLGVGDQGDPRSRL
FT                   ALDMVASAARYALADWAAAPGTPTVPDLLARYRRAFDALPGGLTVSAPER"
FT   gene            543583..544674
FT                   /locus_tag="Ndas_0451"
FT   CDS_pept        543583..544674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0451"
FT                   /product="oxidoreductase domain protein"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR016040:IPR000683:IPR004104; KEGG: nfa:nfa23680
FT                   putative oxidoreductase; PFAM: oxidoreductase domain
FT                   protein; Oxidoreductase domain; SPTR: C1YLV0 Predicted
FT                   dehydrogenase; PFAM: Oxidoreductase family, NAD-binding
FT                   Rossmann fold; Oxidoreductase family, C-terminal alpha/beta
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65898"
FT                   /db_xref="GOA:D7AWD2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWD2"
FT                   /protein_id="ADH65898.1"
FT                   /translation="MADAPEAQSTPEHDGPELHVALIGYGKGGEVFHAPLIDAVPGLRL
FT                   SAVVTGNPDRRRAAEARYPGVTVYPNVAELWADAERYEIAVVTTPNDTHAPLAQAALEA
FT                   GLAVVVDKPFALTALQARELTDLADKLGRVLTVYQNRRWDADFLTLWGLIEEGRLGRVH
FT                   RFESRFERWRPQAKGTWRESGGVEAGAGLLYDLGPHLIDQAVNLFGPVSSVYAEIDARR
FT                   EGVNADDDVFLALDHARGTRSHLWMSALTAQGGPRFRVLGDEGAFTSHGMDGQEARLTA
FT                   GERADADDWGVVPEADWGVLGVDGHTRPVPSARGAYPEFYAGVRDAVGEGEPLPVDPHE
FT                   VIHGLEVIEAARRSARTRSVVDV"
FT   gene            544790..546157
FT                   /locus_tag="Ndas_0452"
FT   CDS_pept        544790..546157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0452"
FT                   /product="type III effector Hrp-dependent outers"
FT                   /note="COGs: COG3395 conserved hypothetical protein;
FT                   InterPro IPR010737; KEGG: tfu:Tfu_2336 hypothetical
FT                   protein; PFAM: type III effector Hrp-dependent outers;
FT                   SPTR: C1YLU9 Uncharacterized conserved protein; PFAM:
FT                   Protein of unknown function, DUF1537"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65899"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWD3"
FT                   /protein_id="ADH65899.1"
FT                   /translation="MAQVLVVADELTGANATGARFARTGMRVATVTPEHVSRVVGDYDV
FT                   VVANLDSRHVPPEHAADLVTDVVEAVWPVGLVVKRTDSTLRGNIGAELEATYDAVRERV
FT                   PAGTRVRVLFVPAFPSSGRITEDGLQFLNGVPLERTELADDPLCPMTTSSVADILAVQT
FT                   DLPVRHVPVRQVTQTMLTAELLAGDEPVVVCDASTEQHLTDIAEAAAAAHHDTGIVWLA
FT                   ADPGPTGALLAYALRLRGQAGSRGPLLGVVGSTTELTRRQLATVARTGAVRFVDLDAVE
FT                   FSVGDRADEVAEQTARELSEQLTSSGFPELCVLRVVTPSDRVRELPVQVRAELPGRIAR
FT                   LVADVVNEVADTTGAHALPSGLYLTGGDLVASLLDELDVHAFDVGGEIVPLTVHGHLSG
FT                   GPLDGTPVVAKGGLVGDDITLVECLTKLRRAVQTRLHQVHSEVSEHVVPTPLRDTV"
FT   gene            546547..547272
FT                   /locus_tag="Ndas_0453"
FT   CDS_pept        546547..547272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR011059; KEGG: ami:Amir_4817 hypothetical
FT                   protein; SPTR: C1YLU8 Putative uncharacterized protein;
FT                   PFAM: Agrobacterium tumefaciens protein Atu4866"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65900"
FT                   /db_xref="GOA:D7AWD4"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR020955"
FT                   /db_xref="InterPro:IPR038646"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWD4"
FT                   /protein_id="ADH65900.1"
FT                   /translation="MSTTFFDEDLLRTVAAEPHRPLMFVNAAVYTFDPLIGDLTGADLL
FT                   LDGKEIAGVGTGLHTAAEDDGAVVVDCSGLTVVPGVVENDTVAGLRRSPSDRVGTLAPG
FT                   NPATFVVLSGHRPGTTALEQVVWSPERAAAVVIDGEFALFNGRRLVEPRTERFPGPMRT
FT                   PADSPYLGMWIDETGFIHQELTADGRYDETRGGRPHAYQGSFWIEGDRIVYRDDLGFWA
FT                   YGRFADDVLHHAGYVFHRG"
FT   gene            complement(547461..548690)
FT                   /locus_tag="Ndas_0454"
FT   CDS_pept        complement(547461..548690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0454"
FT                   /product="beta-lactamase"
FT                   /note="COGs: COG1680 Beta-lactamase class C and other
FT                   penicillin binding protein; InterPro IPR001466:IPR012338;
FT                   KEGG: pjd:Pjdr2_1656 beta-lactamase; PFAM: beta-lactamase;
FT                   SPTR: C1YLU7 Penicillin-binding protein, beta-lactamase
FT                   class C; PFAM: Beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65901"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWD5"
FT                   /protein_id="ADH65901.1"
FT                   /translation="MENDNGRFSKAGLRRMRDVLTRHVESGRIPGLVALVSRGGETHVE
FT                   AIGTMRHDGGAPMRRDTIFRMASTSKPVTMAAAMVLLDECGLRLDDLVEQWLPELADRQ
FT                   VLRRIDGPLDDTVPARRPITVRDVLTSTFGLGIDRSALGTPIMNALFAQGLTPDLPEPM
FT                   PEPDEWMRRLGTLPLMHQPGEQWQYHVGNDLLGVLVSRVTGKSFDAFLRERVFEPLGMG
FT                   DTGFHVPADKTDRLPPLYAPDPQTGEFHVWDPAEGGRHSQPPAFQGGGGGLVSTVDDYH
FT                   AYFRMLLNQGMHGSERILSRPAVQLMTTNRLTPAQQAARNAMATENVHVSFGQGQHGGW
FT                   GFGMAVRTYRGDYAPVGQFGWDGGSGTSTYADPENRLTGIVLTQVGMSVPDSARLIHDF
FT                   WTTLYQAIDN"
FT   gene            complement(548735..549400)
FT                   /locus_tag="Ndas_0455"
FT   CDS_pept        complement(548735..549400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sro:Sros_5014 hypothetical protein; SPTR:
FT                   C1YLU6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65902"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWD6"
FT                   /protein_id="ADH65902.1"
FT                   /translation="MHTFPTPTAITTVLDIPAGRVQLIAADRTDTTVQVQPADPDKNRD
FT                   VKAAQQTTVTYDDGVLRVQAPPAKNQAFGPSGSVEITVQLPTGSHLQATAASAGLRGVG
FT                   RLGRVAFEAARGPVKLDEAASAHLTLQDGDVTLGRLGGPAQVSTARGDIVIAHATQGTV
FT                   EVRTESGDITVSAAPGVSAALDAGTPHGRVHNALKNDGETTLDIRATTSHGDITARSL"
FT   sig_peptide     complement(549326..549400)
FT                   /locus_tag="Ndas_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            549644..550399
FT                   /locus_tag="Ndas_0456"
FT   CDS_pept        549644..550399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0456"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="InterPro IPR000835:IPR011991:IPR009057; KEGG:
FT                   sma:SAV_697 hypothetical protein; PFAM: regulatory protein
FT                   MarR; SPTR: C1YLU5 Transposase, IS30 family; PFAM: MarR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65903"
FT                   /db_xref="GOA:D7AWD7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWD7"
FT                   /protein_id="ADH65903.1"
FT                   /translation="MPGGRLTQSERQRIELGLAQGLAYARIAKDLDRPTSTVTREVTRN
FT                   GGPTSYRADLAHRATQHRTRRRTRTATRAGQAPPQAYGRDAEAVREYEEAFTAVFMQSG
FT                   LPKMTSRVLVSLYTTDEGSLTAAELVQRLQVSPASVSKAITFLEGQGLVRRERDERRRE
FT                   RYVVDDDVWYQSMLANARAEAHLVEAARQGVQVLGPGTPAAVRLENIARFVDFVRESII
FT                   RASEQAREVLHTKPEPVPDGADEPSPEPR"
FT   gene            complement(550604..551503)
FT                   /locus_tag="Ndas_0457"
FT   CDS_pept        complement(550604..551503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0457"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COGs: COG0596 hydrolase or acyltransferase
FT                   (alpha/beta hydrolase superfamily); InterPro IPR000073;
FT                   KEGG: tfu:Tfu_1699 putative hydrolase; PFAM: alpha/beta
FT                   hydrolase fold; SPTR: C1YLU4 Predicted hydrolase or
FT                   acyltransferase of alpha/beta superfamily; PFAM: alpha/beta
FT                   hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65904"
FT                   /db_xref="GOA:D7AWD8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWD8"
FT                   /protein_id="ADH65904.1"
FT                   /translation="MATRHVGQVRELQVRSDDGTLLHVEVRGPEDGPTVVLAHCWATSL
FT                   ASWGPVVRELDPSLRVVLYDQRGHGRTQAPLTRAGYGARKLAEDLCAVLEATVPEGEKA
FT                   VVAGHSMGGMTIMSAGAHPVFRERAAAVLLTNTGCKELPMRSTAIPLPGPLGTFGAQVF
FT                   LRAPIPLGPRNALTTAVLKSMVMGRRADPRMVRLCMRMVHACGGVSRGAWGRVICTLEA
FT                   EETARQISVPTVVMVGTDDKLTPPWHAHHIASLLKDCREVREIPGAGHMGPLEYPRALA
FT                   ETVDRLAAEHLEPRTRAA"
FT   gene            complement(551595..552092)
FT                   /locus_tag="Ndas_0458"
FT   CDS_pept        complement(551595..552092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0458"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2335 monooxygenase; SPTR: C1YLU3
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65905"
FT                   /db_xref="InterPro:IPR032371"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWD9"
FT                   /protein_id="ADH65905.1"
FT                   /translation="MSGFGDEEEEYRGPVTVVLPVNGGAQRSERAPGTKVAVDAEGSPE
FT                   SPDTDGVKDGSGVENAADTRDTADAEGTEDKGVAVRVQAHLAGHFSPLTGDYRWRGRLS
FT                   PSPEVTAAFRAGARTVVVRTPDGFEGTGVLDEPNLWGGHPVNGAGSPPFAVPHVDIDAS
FT                   DD"
FT   gene            complement(552076..553638)
FT                   /locus_tag="Ndas_0459"
FT   CDS_pept        complement(552076..553638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0459"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG2072 flavoprotein involved in K+ transport;
FT                   InterPro IPR013027:IPR006076; KEGG: tfu:Tfu_1698 putative
FT                   monooxygenase; PFAM: FAD dependent oxidoreductase; SPTR:
FT                   C1YLU2 Predicted flavoprotein involved in K+ transport;
FT                   PFAM: Flavin-binding monooxygenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65906"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWE0"
FT                   /protein_id="ADH65906.1"
FT                   /translation="MTEAPPHFRVAVIGSGFAGIGMAVRLKQAGLKDFVVLERADGIGG
FT                   TWRDNSYPGAACDVPSHLYSFSFAPNPHWSRSFSPQPEIHDYMERVAGEHGVREHVRPD
FT                   HDMRSAHWEPEGNRWRIETSRGTVTAQFLISAAGPLADPSYPDIKGLDTFEGTMFHSAA
FT                   WDHDHDLTGRRIAVIGTGASAIQFVPRIQPKAGRLTLFQRTAPWVMFRHDRDITRLERW
FT                   LYRNVPLTQQIARKSIYWGRETYVLGFAKNPRLLSIVEGLGRANIRRSVKDPELRAKLT
FT                   PSFRAGCKRILMSNDYYPALARPNVDVVTDGIVEVRPHAVVTRDASGRETEHEVDTIIL
FT                   GTGFHVSDPPVARRIFNAEGRSLSDHWGTDMQAFRGTTVAGFPNAFVLAGPNTGLGHTS
FT                   QLFMIEAQIRYTMQALKYLCRNGLDRMDVLPKAQRDYNEMVAKAMEGTVWVTGGCDSWY
FT                   LNEQGRNTTLWPTFTWEFALRTRWFDPHNYDLRVDRSRGRGARRPAVRAEAAPEGERYE
FT                   RVR"
FT   gene            complement(553929..554840)
FT                   /locus_tag="Ndas_0460"
FT   CDS_pept        complement(553929..554840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2334 hypothetical protein; SPTR:
FT                   C1YLU1 Putative uncharacterized protein; PFAM:
FT                   P-aminobenzoate N-oxygenase AurF"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65907"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR025859"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWE1"
FT                   /protein_id="ADH65907.1"
FT                   /translation="MTAEITAKPKITDREDIAKRLLRGSAKASFDPLVEIDWDAPVDKD
FT                   MWAIRPERLSLYGTYLWDRLTEEQRKELSRLEIASVATIGIWFETILMQMLVRHAYHHD
FT                   PSTNHVQYAYTEIADECRHTVMFAKMVGKLGWQTHKLDPVAFHLGNLFKTIAHGPLIFA
FT                   GALFVEEVLDQLQREAVPDEQILPLVRSVSRIHVVEEARHMRYAREEFQRDWATRGPLN
FT                   RAYSRIILGLVTYYSATRLINPKVYAQVGLDPREASRVARDNPHWIGTKTWAARKVVST
FT                   LDTAGAITGLGRYFWKKAGLLG"
FT   gene            complement(554855..555709)
FT                   /locus_tag="Ndas_0461"
FT   CDS_pept        complement(554855..555709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0461"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="COGs: COG4221 Short-chain alcohol dehydrogenase of
FT                   unknown specificity; InterPro
FT                   IPR016040:IPR013149:IPR002198:IPR002347; KEGG: sco:SCO0356
FT                   oxidoreductase; PFAM: Alcohol dehydrogenase zinc-binding
FT                   domain protein; short-chain dehydrogenase/reductase SDR;
FT                   SPTR: C1YLU0 Short-chain alcohol dehydrogenase; PFAM: short
FT                   chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65908"
FT                   /db_xref="GOA:D7AWE2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWE2"
FT                   /protein_id="ADH65908.1"
FT                   /translation="MRTPLPRHLRRLPGQNALVTGASGAFGSATVAVLRHLGVNVVGID
FT                   RKPAPGVVGCDITDDAQVREGVAEALDRLDGRLDLLIHYAGVGPAVDIGQAPDVHVHQA
FT                   LEVNLLGTWRVTAAAMPALLRSRGRVLVTASLLANLSLPFAGAYTVSKRALTAYADCLR
FT                   AEYGSHIGVTTVHPGYVDTPIHNSSRATGVALDGLVPAESARDTVMAVVRAAGARYARR
FT                   DTASTALGTAGLHLFRHFPGTTEQIVSLQVGLLLSDGAFGDAEIARGLHSRHANPLVRP
FT                   DAS"
FT   sig_peptide     complement(555581..555709)
FT                   /locus_tag="Ndas_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            555826..556620
FT                   /locus_tag="Ndas_0462"
FT   CDS_pept        555826..556620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0462"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="InterPro IPR000551:IPR009061; KEGG: tfu:Tfu_2333
FT                   MerR family transcriptional regulator; PFAM: regulatory
FT                   protein MerR; SMART: regulatory protein MerR; SPTR: C1YLT9
FT                   Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65909"
FT                   /db_xref="GOA:D7AWE3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWE3"
FT                   /protein_id="ADH65909.1"
FT                   /translation="MAEYRIDELARLADTTVRNVRVYQDRGLLAPPRREGRVGIYSEAH
FT                   LARLRLIGQLLRRGYTFANIGEMFRVWERGGDLSDILGFESAIGDAWSDEIAGYLTMGD
FT                   LRELFGHGVTPRTVKRSLDLGVLERDGLRFRVPSPRLLHAGVELVKLGMTVDSVLDIAE
FT                   NLRDKVGHVAEHMVRLVADHIIAEYAPGTVVRSEETAEMAELIRRVRPLAQQAVDAVLA
FT                   QAMAENLTNVMGEHFALAMEYLDKEGADKEGVGGGAAAPPKG"
FT   gene            complement(556853..557563)
FT                   /locus_tag="Ndas_0463"
FT   CDS_pept        complement(556853..557563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0463"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mea:Mex_1p0657 hypothetical protein; SPTR:
FT                   C1YLT8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65910"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWE4"
FT                   /protein_id="ADH65910.1"
FT                   /translation="MLALGALAFLGFAVTACAPEPGTVQAEATEQDALPPLGADGQAPS
FT                   EDLSLEEAAPFLEAQGYFPAEGDLNGYEVGYLPDDVGGTPYDLDHTALAAAQGHVVPDL
FT                   HEVERSWLADTVQVDYLVDDNDQVMPEREAVAVSALYVSVMRRDDLADADAYYELLGST
FT                   LEEEFPDSPARELPDGDGHYNGSTAVFCPEPGVIVWLSYVDDAYWEEVEASEDLTAEGD
FT                   PGEVLRIVEGITPA"
FT   sig_peptide     complement(557486..557563)
FT                   /locus_tag="Ndas_0463"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(557848..559821)
FT                   /locus_tag="Ndas_0464"
FT   CDS_pept        complement(557848..559821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0464"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG2303 Choline dehydrogenase and related
FT                   flavoprotein; InterPro IPR017896:IPR006076; KEGG:
FT                   tfu:Tfu_2332 putative cholesterol oxidase; PFAM: FAD
FT                   dependent oxidoreductase; SPTR: C1YLT7 Choline
FT                   dehydrogenase-like flavoprotein; PFAM: FAD binding domain;
FT                   GMC oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65911"
FT                   /db_xref="GOA:D7AWE5"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWE5"
FT                   /protein_id="ADH65911.1"
FT                   /translation="MPPERSTDPTATPSSSAPTSRTAAETPTETPTGTRAETGSATGDR
FT                   ADRFDYDVLVVGSGFGGSVSALRLTEKGYRVGVLEAGRRFTPQTLPSSSWDVRNFLWAP
FT                   RLGMYGIQRIHLLRDVVILAGAGVGGGSLNYANTLYHPLDPFFEDPQWRHITDWKSELA
FT                   PFYDQARRMLGVRTNPTVTPSDVHMKAIAEDMGVGHTFRLTPVGVCFGDGRDGDGRRAE
FT                   PGASVGDPYFGGAGPDRRACTECGECMTGCRHGAKNALTENYLYFAERDGAEVHPLTTV
FT                   ERLRELPGGGFAADTVRTDAPRRRSSARTFTARQVVVAAGTYNTQTLLHRMRDSGALPR
FT                   LSARLGTLTRTNSEALVGAMTRRVRPQEDLTRGVAITSSIHPDENTHIEPVRYGKGSNA
FT                   MALLTAMQVPGGGRIPRWLRFLGLAARHPVVFARSLSARRWSERTIIGLVMQSLDNSLT
FT                   TSVRRGPLGGRKRLTSRQGHGEPNPTWIPAGQDAATRLAERIDGFPGGTVGDVFNVPMT
FT                   AHFLGGCPIGDSPETGVIDPYHRLYGHPGVHVVDGSAVTANLGVNPSLTITAQAERAMS
FT                   MWPNKGEEDTRPEQGERYRRVGPVFPASPAVPAGAFAELRFTAPLPLSVVDSEAPSADA
FT                   AAVGGTTGAAGETGADGEDART"
FT   sig_peptide     complement(559753..559821)
FT                   /locus_tag="Ndas_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            560036..560683
FT                   /locus_tag="Ndas_0465"
FT   CDS_pept        560036..560683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0465"
FT                   /product="putative cholesterol esterase"
FT                   /note="KEGG: tfu:Tfu_2331 putative cholesterol esterase;
FT                   SPTR: C1YLT6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65912"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWE6"
FT                   /protein_id="ADH65912.1"
FT                   /translation="MPKASGEASEAPQDAPEQHEAGGGTRWRRFALVAVPGFAAAAVLG
FT                   GMTTQGLLAASFAVSGDSFKMSADQLVGTGFTQYGDAATSVDGSSRPVGLSSVGSAELT
FT                   NLCMSSLWDLPIGQATLVITAGESTPVQGTNLVLDIEQLQGDAEFGSIEIGRDASTLDR
FT                   AEGGQGPAGGFGLQSQNITVSDMELTTWAVTSGSLKLSGLSLAVRPGEHECF"
FT   sig_peptide     560036..560158
FT                   /locus_tag="Ndas_0465"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            560688..562178
FT                   /locus_tag="Ndas_0466"
FT   CDS_pept        560688..562178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2330 hypothetical protein; SPTR:
FT                   C1YLT5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65913"
FT                   /db_xref="GOA:D7AWE7"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWE7"
FT                   /protein_id="ADH65913.1"
FT                   /translation="MAHALTLLRGGRARLRDWRRGRPFWGGLLLVIAGVELLVAPAAQS
FT                   LILPIDLIAYTGIAGVSGPLIAVLLITLGALSWFQPAQHLFFGVVGLMLALVSFVTSNF
FT                   GGFVIGMLLGIVGGSLVFAWAPRVVRRRRRGRGRRRVADADAAGPGVSAGAPPGAAVPR
FT                   GPEAPDGTGGRAAGEEPPTAVPAETAPDAGVPGTPPGRDTGSATPDGSVSAPRPPSRPL
FT                   AALALPLALAVTLVGAAAPADWPWDWFLPPGEEEEQPSPSPSPSDEPSASPTDRPTPPG
FT                   PGPGAGEGDGPDERPEDGETEEEPEEDGRDREANPDECEMGTGESALAGSEEEFLDAVR
FT                   ACQAAQDAGELPEVPLEEAHDCSTGSVRASGLTADRLTMSGARYDGVVECPTLDGPRRY
FT                   IRLTMSRADFVNAELWFEDAGTRMSLGLPTMVMDGSVQMHITRMHVRILGIPLTFTPDF
FT                   PPPLLLPYMIVTDVDVDDPLASTDVMNIPDLNGRYGGA"
FT   gene            complement(562239..564050)
FT                   /locus_tag="Ndas_0467"
FT   CDS_pept        complement(562239..564050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0467"
FT                   /product="UvrD/REP helicase"
FT                   /note="COGs: COG0210 Superfamily I DNA and RNA helicase;
FT                   InterPro IPR014016:IPR000212; KEGG: tfu:Tfu_2329
FT                   superfamily protein I DNA/RNA helicase; PFAM: UvrD/REP
FT                   helicase; SPTR: C1YLT4 DNA/RNA helicase, superfamily I;
FT                   PFAM: UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65914"
FT                   /db_xref="GOA:D7AWE8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWE8"
FT                   /protein_id="ADH65914.1"
FT                   /translation="MSALAIAPTFLSDFTRLTPDVQLNTLAVMRACQVGDEPDLESVAG
FT                   AADPGVRVVSIAPDWSGVVVPDAAGHGRTGDGGLADGTHYRLVTVRPRDEALRFARDLR
FT                   PEVSAGIDPAEADPTPSGPPELAGALRAPFDQWQLTLHPDQHRITEAHYNGSTQVTGGP
FT                   GTGKTVIALHRAAYLAERDAAARPEDTRESVLLTTYNRALAQSLAERMDQLLPDPAVRA
FT                   RVRVATIDSLARSVVQTHTSVAPRMVGKDELARRWRAVAVADGLPFSGRFLVDEWEQVI
FT                   LAKGLELLPDYIRCERSGRVQHLAPEHRRQVWETVRRYVGAMRVEGMWSYPQLAAEAAR
FT                   ILGRREPLFRHAVVDEAQDLHPAQWRMLRAAVPEGPDDLFIVGDPHQRVSDNRVSLASL
FT                   GINVRGRGQRLRVSYRVTQEILDWSMPILDRRAALGMDDNADTLAGYRSLLRGPAPVVR
FT                   GCEDRAEELTALGDWVRVWLEAGVNPAEIAVAGRNQWIVRGIAKELEARGVPTAQLEDS
FT                   GAAEAVRVGTMHRLKGQEFRCVALIGVSDHLLPPKAAIEAADGDQVALEHAFQQERTLL
FT                   FVACTRARDALYVSHVGRASRLIDPGL"
FT   gene            564921..565541
FT                   /locus_tag="Ndas_0468"
FT   CDS_pept        564921..565541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0468"
FT                   /product="protein of unknown function DUF1707"
FT                   /note="InterPro IPR012551; KEGG: svi:Svir_39520 protein of
FT                   unknown function (DUF1707); PFAM: protein of unknown
FT                   function DUF1707; SPTR: C1YLT3 Putative uncharacterized
FT                   protein; PFAM: Domain of unknown function (DUF1707)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65915"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWE9"
FT                   /protein_id="ADH65915.1"
FT                   /translation="MSRMRVSDAERDQVAEVLREAAAQGRITLDELDERLNAVYAAKTY
FT                   ADLEPVTADLPTGAETLPGAVARPVEGVLPERHDGGDALVIRSQGGGPVIRRGAWQVPR
FT                   RVEVHNKYGLTRLDFREASLTSAVVEVHVDASWGNGTVILPEGATAEVEADASWFGTLR
FT                   NSTDSLRRASAPHFVITGSCQGGSLTVRYKRPFSWGGLAGLGS"
FT   gene            565784..566389
FT                   /locus_tag="Ndas_0469"
FT   CDS_pept        565784..566389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0469"
FT                   /product="protein of unknown function DUF218"
FT                   /note="COGs: COG2949 Uncharacterized membrane protein;
FT                   InterPro IPR003848; KEGG: tfu:Tfu_2325 hypothetical
FT                   protein; PFAM: protein of unknown function DUF218; SPTR:
FT                   C1YLT2 Uncharacterized membrane protein; PFAM: DUF218
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65916"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWF0"
FT                   /protein_id="ADH65916.1"
FT                   /translation="MGLWIAAVGAGACALALGPYAWTFLGSAGRRGEVDTVPHRPVAVV
FT                   LGAAAWNDGPSPLLARRLDLAVRLYENGRVERIIVSGDNREVSRRETDTMTAYLVAQGV
FT                   PADRIDADRHGYRTWDTCVRVRDLFGVREATMVTQSFHLPRTVALARAAGIDAVGVGDS
FT                   SMGARRRSTVIGYAREVAAAVKALRDAVLRPAPARSEL"
FT   gene            566641..568074
FT                   /locus_tag="Ndas_0470"
FT   CDS_pept        566641..568074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0470"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcu:Tcur_1429 PBS lyase heat domain protein
FT                   repeat-containing protein; SPTR: C1YLT1 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65917"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWF1"
FT                   /protein_id="ADH65917.1"
FT                   /translation="MNATTDPHDGAENVDWATLAPEGGARIPELLGQLAGSDSALSELH
FT                   DIIHFPAPGHLAAPKAVDFLVDLACAESTPATDRWRPLSLLLELVAGHAEDRFPETRDL
FT                   DQWRDEVAWAASNDAEKVRQQYRDWAEEAPDEQHYHRMRNRLAVMEQPDGAAILQAELD
FT                   TYEAVRARVPDLVALLHGGANRGGMDRAGEWVSYLLAFLPDDAERITTEITGASQVLLA
FT                   KDLRPAPQAPTSLRDVMNALDSGGDPLPAELFALGLLASPNDIDVSVGLTHQMAGGNLY
FT                   NSFAASVAMLLIHGEKTPREALRRVGRGGGTSMGYQGLFNESWPHCGGHSPQVLGFLAL
FT                   GRAGDRARRLRLDILPGLINGEEDSRALVTGVGLELVLGPRSKGHTAEEHAEADYDEET
FT                   LKVLWTIAELPASAWEDEEFTRTLSAWALPDNAEDFCALVGVESQPEPEPERAAVPQPQ
FT                   QPAAPQPGGLLGRLFGGGR"
FT   gene            complement(568187..568837)
FT                   /locus_tag="Ndas_0471"
FT   CDS_pept        complement(568187..568837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0471"
FT                   /product="protein of unknown function DUF218"
FT                   /note="COGs: COG2949 Uncharacterized membrane protein;
FT                   InterPro IPR000209:IPR003848; KEGG: tfu:Tfu_2325
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF218; SPTR: C1YLT0 Uncharacterized membrane protein;
FT                   PFAM: DUF218 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65918"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWF2"
FT                   /protein_id="ADH65918.1"
FT                   /translation="MLAVFAMVAGCVPFLWVLSSTSDHRHTAASVPERPVALVLGAGVR
FT                   PDGRPSLLLARRLDTAADLYFAGKVDVVLVTGDNSVEHYNETDTMRAYLVDAGVPGEHI
FT                   VGDYAGFSTWDSCVRAHEVFGVREVTVVTQDFHLPRAVRLCRSAGIDAVGVADSSLEER
FT                   TFATVYGWFREVPAAVAALGSVVLRPDPTFLGDYETAVDEALALEREPGPTDG"
FT   gene            569063..569266
FT                   /locus_tag="Ndas_0472"
FT   CDS_pept        569063..569266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0472"
FT                   /product="NUP153 protein"
FT                   /note="KEGG: similar to NUP153 protein; SPTR: C1YLS9
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65919"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWF3"
FT                   /protein_id="ADH65919.1"
FT                   /translation="MRRKFRYGTADPAAPVRTVRLWPGFARFGFGTAPVPTRLRLRPAK
FT                   RSAFRSRFPAGSMPGSGPFQGR"
FT   gene            569308..570876
FT                   /locus_tag="Ndas_0473"
FT   CDS_pept        569308..570876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0473"
FT                   /product="protein of unknown function DUF885"
FT                   /note="COGs: COG4805 conserved hypothetical protein;
FT                   InterPro IPR010281; KEGG: sro:Sros_1181 putative secreted
FT                   protein; PFAM: protein of unknown function DUF885; SPTR:
FT                   C1YLS8 Uncharacterized conserved protein; PFAM: Bacterial
FT                   protein of unknown function (DUF885)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65920"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWF4"
FT                   /protein_id="ADH65920.1"
FT                   /translation="MSFQPQHEDLPARLRRLADLRPRNMRDGSGMHEYDGKAADLSPEG
FT                   VREALAGLGGDPLDDPHDEAHLAAFENALRYELGELQLHRANPLYHVNELDLSGYDRAY
FT                   APQAERDAARVAHLAEWPRVVDNAIAALDRLPAPLAESLLGAVRGVADGLPEDVPADVR
FT                   DAALAAHARLLAHVEKAVREGPRSAGLGAGPLARLMGSGEAVEVDLADLAVRADAERDR
FT                   LRARLAEAVGRLAPGRDTMEFVRELTRQHPDTDGVLDAARRWTELAVAFTAERGLAPHN
FT                   DGECRVDVSPPSQRWATAMMAWSGPWEADTPSFYFITPPDASWTAEEADEWLEMFSHTT
FT                   LPAVSVHEVAPGHFSHGRALRRAPGPVRRALHSMTFAEGWAHYVEEVCVDEGFGAYAAE
FT                   RLGDPAWTADHYETGVWVEALIRVTRLSVAIGMHSGTMTVEEAAARFAEDTPLQGPAAL
FT                   AEARRATFDPTYGRYTWGKLEILRLRERARERWGDGFTLERFHRALLDLGSPPIGLIGT
FT                   AVERG"
FT   gene            complement(571138..572151)
FT                   /locus_tag="Ndas_0474"
FT   CDS_pept        complement(571138..572151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0474"
FT                   /product="sugar isomerase (SIS)"
FT                   /note="COGs: COG2103 sugar phosphate isomerase; InterPro
FT                   IPR005486:IPR001347; KEGG: tfu:Tfu_2324 N-acetylmuramic
FT                   acid-6-phosphate etherase; PFAM: sugar isomerase (SIS);
FT                   SPTR: C1YLS7 Predicted sugar phosphate isomerase, COG2103;
FT                   PFAM: SIS domain; TIGRFAM: N-acetylmuramic acid 6-phosphate
FT                   etherase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65921"
FT                   /db_xref="GOA:D7AWF5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWF5"
FT                   /protein_id="ADH65921.1"
FT                   /translation="MHDDGRGTRPEGGDAPREAGAPLPSGENGGGAAVIVRAPTEARNS
FT                   GTHDIDLLPALDVLRQINAEDVTVPGAVGAVLPELARAVELGVAALESGAAIHYFGAGT
FT                   SGRIAAQDAAELPPTYGVPASWVVAHHAGGGEALARAVEGIEDDWESGRADAAGIVPGS
FT                   LAVGLAASGRTPYVGGALEAARERSAATVLISANPQAPLAREADVHVGMATGAEVIAGS
FT                   TRMKAGTAQKLALNAFSTAVMVRMGRTYSNLMVGVDATNGKLRGRVVTILTQATGLDER
FT                   VCARALNAAGGDTRVALVSLLADVDADTAARALGEARGRVRPALAGLGLPGRVAPE"
FT   gene            complement(572257..573240)
FT                   /locus_tag="Ndas_0475"
FT   CDS_pept        complement(572257..573240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0475"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="COGs: COG1737 Transcriptional regulators; InterPro
FT                   IPR001347:IPR000281; KEGG: tfu:Tfu_2323 putative
FT                   transcriptional regulator; PFAM: helix-turn-helix protein
FT                   RpiR; sugar isomerase (SIS); SPTR: C1YLS6 Transcriptional
FT                   regulator, RpiR family; PFAM: SIS domain; Helix-turn-helix
FT                   domain, rpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65922"
FT                   /db_xref="GOA:D7AWF6"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWF6"
FT                   /protein_id="ADH65922.1"
FT                   /translation="MAEIPKPAGGRAESGHVSAPSVPTTVLRIRSLLPSLAPAERRVAQ
FT                   HVVDDPERAAASSITQLAKDCATSEATVIRFCRTIDFSGYRELRLALATEAGQARGARG
FT                   AAPELSSDINPDDTLVTVVQKIAYTDARAVEETGAALDVEVLRTVIDTMAGARRIDVYG
FT                   VGASAFVGADLQQKLHRIGLTSFAWSDAHVMLTSAALLDERDVAIGISHSGTTIDTVQA
FT                   LTEAGRRGARTVAVTNFPRSPIGFADHVLTTAARETTFRSGATASRLAQLTVVDCLFVG
FT                   LAQSRYTDSRTALETTFEAVRGLRINDDRRRRRGEAPGGSTDDNDG"
FT   sig_peptide     complement(573124..573240)
FT                   /locus_tag="Ndas_0475"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            573439..575358
FT                   /locus_tag="Ndas_0476"
FT   CDS_pept        573439..575358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0476"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="COGs: COG3629 DNA-binding transcriptional activator
FT                   of the SARP family; InterPro IPR016032:IPR001867:IPR005158;
FT                   KEGG: svi:Svir_00460 DNA-binding transcriptional activator
FT                   of the SARP family; PFAM: transcriptional activator domain;
FT                   transcriptional regulator domain protein; SPTR: C1YLS5
FT                   DNA-binding transcriptional activator of the SARP family;
FT                   PFAM: Bacterial transcriptional activator domain;
FT                   Transcriptional regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65923"
FT                   /db_xref="GOA:D7AWF7"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWF7"
FT                   /protein_id="ADH65923.1"
FT                   /translation="MSLSDPARRWHDTAGQARQGASGHTARGLRVGLLGQFGVEMDGAP
FT                   LRLRGDKRRALLATLLLNTGRTVPTAHLIERVWGSPASPSARSALQVHVTRVRAVLDQH
FT                   CGTPLITGGDGGYRVDLAEDQCDLLRFRSLVRRADGGADPSDRADLLISALRLWRGPVL
FT                   ADIVSPVLHERDIPPLNEELLRAAEEGFGAALARGDHERVADQIGPIATDHPEREPLIR
FT                   VQMTALYRCGRPSEALRVYARTRDALAEHLGADPGRELQETFHGILRGDLDRAPGTSVP
FT                   RQRASVEEGAGVRPLSADTGPNTGSADAPGTEPEAGSHAGPGPGADPDVPAGAEERDDR
FT                   GDGPVHAPAPVSAALAPAELPAAPSALLGREEALAELDRLVDPSSTAPGSALVRGPAGA
FT                   GASALALSWARAAAPHFPDGQLYVDLRGGDGSPRDPVEVLRRLVRSLSTGTRGTEAMDA
FT                   DEAAARVRTLLAHRRVLLVLDNAASVRQVRPLLPGGTGCAALVTSRYWLTDLLVRDGLR
FT                   ALPVGPLPPDAAVDLLRPREGRDRRAESVLRRLAQVLGHLPLALRMAAVWLDDTRPDRS
FT                   AAELVRRLEGADPARGSTPTARMAAVLRAGPREGRHGRGEVPAEPRPPDTSVERGSYVR
FT                   LSPR"
FT   gene            575519..575704
FT                   /locus_tag="Ndas_0477"
FT   CDS_pept        575519..575704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2321 hypothetical protein; SPTR:
FT                   C1YLS4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65924"
FT                   /db_xref="GOA:D7AWF8"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWF8"
FT                   /protein_id="ADH65924.1"
FT                   /translation="MTENNDPNMDPAGTTQHFRRFVDENPSTEEPARRPVMPIVLAVVG
FT                   AVLLIAVIVALFLAFA"
FT   gene            575842..575915
FT                   /locus_tag="Ndas_R0014"
FT   tRNA            575842..575915
FT                   /locus_tag="Ndas_R0014"
FT                   /product="tRNA-Lys"
FT   gene            576111..576187
FT                   /locus_tag="Ndas_R0015"
FT   tRNA            576111..576187
FT                   /locus_tag="Ndas_R0015"
FT                   /product="tRNA-Lys"
FT   gene            576643..577134
FT                   /locus_tag="Ndas_0478"
FT   CDS_pept        576643..577134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_3422 hypothetical protein; SPTR:
FT                   C1YLS3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65925"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWF9"
FT                   /protein_id="ADH65925.1"
FT                   /translation="MSNFSPLLRTAGVSVLAAGSVFALSGCGALMSFMGAGNVMELNVG
FT                   DCFVEEQMNTALASGEVSNIPLVDCAEEHDSEFFFAYDMTEAEYPGEDATLTQAEELCT
FT                   GEEFTNFIGVPYSESEIYAGHLYPTQESWDQFNDREIICYATTSTSGEMVTGTLSGANR
FT                   "
FT   sig_peptide     576643..576711
FT                   /locus_tag="Ndas_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            577378..577998
FT                   /locus_tag="Ndas_0479"
FT   CDS_pept        577378..577998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0479"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_3422 hypothetical protein; SPTR:
FT                   C1YLS2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65926"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWG0"
FT                   /protein_id="ADH65926.1"
FT                   /translation="MLSATHRPLFGRVVLGTLAVGATLVATTACGSLPLLPPALQGGGE
FT                   TVSPAPRETVEPTESTETAEPVETETTEPVAPGDGDVFSLEVGDCFIEEEMNTALFSDG
FT                   ISEVPLVDCSQEHDSEFFHSHQMTDAEYPGEDATMTEAEEVCTGEEFTSFVGVEYAYSE
FT                   IYAGHLYPTQQSWDMLGDREIICYVTTSNTGEMVTGTLEGANR"
FT   sig_peptide     577378..577503
FT                   /locus_tag="Ndas_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            578211..578807
FT                   /locus_tag="Ndas_0480"
FT   CDS_pept        578211..578807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_3422 hypothetical protein; SPTR:
FT                   C1YLS1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65927"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWG1"
FT                   /protein_id="ADH65927.1"
FT                   /translation="MLSETRRPLFSRVVLGTLAVGATLVATTACGSLPLLPPALQGGGG
FT                   TVAPEPTDAAAPTASEETTEPVSPGTVDVFSLEVGDCFIESEMETALFSDGISEVPLVD
FT                   CSQEHDSEFFYSHQMTDAEYPGDSTVQTEADEICTGQNFTDFIGVDYLDSEIYAYYLTP
FT                   TQDSWDQANDREIICYATTANIGEMVTGTLAGANR"
FT   sig_peptide     578211..578372
FT                   /locus_tag="Ndas_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(579001..580620)
FT                   /locus_tag="Ndas_0481"
FT   CDS_pept        complement(579001..580620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0481"
FT                   /product="TAP domain protein"
FT                   /note="InterPro IPR000073:IPR013595; KEGG: tcu:Tcur_2785
FT                   TAP domain protein; PFAM: TAP domain protein; alpha/beta
FT                   hydrolase fold; SPTR: C1YLS0 Alpha/beta hydrolase family
FT                   protein; PFAM: TAP-like protein; alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65928"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWG2"
FT                   /protein_id="ADH65928.1"
FT                   /translation="MRTARATTLASTVLVTALAASLAAASPAAADPLDSPADDTALAEF
FT                   HDQELAWAPCTEEVLQGLECADVVVPLDYSDPGGERVTVAISRARAADPEQRRGILLTN
FT                   PGGPGGHGRSMPLPLDPQTGTGLVGGLRVAEVYDVIGMDPRGTGGSSPRLDCDSEPPPV
FT                   YPSPTDEEISEATRSAIRYQRACEQAEGDVRPHMTTANTARDMDVIRAALGEEKTNYLG
FT                   YSYGTYLGAVYGSLFPERLDRSVLDSSVHPDGVWRDVFMMQAPAYSENMDRYTAWVAGY
FT                   DDVFGFGSTREEVYATFEATAERLREEPLEVAPGVLYDNHLFHMEVGMYSRFQDRWDVV
FT                   SEILGYIVHDQPLPQPIAAQAGALAEEEYGTATIDLQTAVLCEAEWPERISTYHADARE
FT                   YREEHPYGSGAYWAVPHPCTFNGLDRPEPPVELEREGYPEALVIAGEFDANTAYEGGPA
FT                   MADRLDSSLITVAGDGGHGFYLPGGLDCVADAVDAYLVDGARPEDLTCQGLPPAEVDGE
FT                   IEVEAEDLVALRDRTGPSGLGI"
FT   sig_peptide     complement(580531..580620)
FT                   /locus_tag="Ndas_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            580942..582033
FT                   /locus_tag="Ndas_0482"
FT   CDS_pept        580942..582033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0482"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: ttr:Tter_0896 binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: C1YLR9 ABC-type
FT                   dipeptide/oligopeptide/nickel transport system, permease
FT                   component; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65929"
FT                   /db_xref="GOA:D7AWG3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWG3"
FT                   /protein_id="ADH65929.1"
FT                   /translation="MATEIAASPPPPRAGSGASARTDEPAPPLRRIWRHYAAVKVRKAV
FT                   VVVFVVANVTFFLGRAMPGDPIDVMAGRLTQGGMSMEEARVIAMNSLAYDPDAPLYQQW
FT                   WDFLVGLVTFDLGMTINRPGQSVMEAIGAYLPWTLFSIGVGTVIAVVLGLALGMVMAYW
FT                   RNRLLDHVLSVLASVLGAVPNYLIAMALVFGGGMYLGWFDPIDLRGTISPGVQAGFNAE
FT                   FLGDALYHAALPIVTYVLAIIGTWMLIMKASTTEVLGEDYVTVARARGLRDQRIAVSYV
FT                   GRNAVLPLVAQIAISFGTLVGGAIFVEQVLVYKGVGGLLLDAVNYRDYPLLQGLLIIIT
FT                   SCVVVANLVADLLYSRLDPRIRT"
FT   gene            582047..582922
FT                   /locus_tag="Ndas_0483"
FT   CDS_pept        582047..582922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0483"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: ttr:Tter_0897 binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: C1YLR8 ABC-type
FT                   dipeptide/oligopeptide/nickel transport system, permease
FT                   component; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65930"
FT                   /db_xref="GOA:D7AWG4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWG4"
FT                   /protein_id="ADH65930.1"
FT                   /translation="MAVTTTAAPGVWGTIWQGLTRSTSGFVGLCLVLSVLLFSFVGPLL
FT                   IDHHNPTDVTAIWGPITAEHWLGTNHQGKDTFTQLVLGGREPIWVGFVAAVITVAIAVV
FT                   LGGVAGYVRGRIDHFLLQLTDITMTIPFIVLMLVIASFFRTSSPLVVSFIIGLVTWPYL
FT                   MRSIRAQVLTLREREFVEAARLQDLGTARILFVEVLPNMAGYIFINFIIAITNAIYAVV
FT                   GMYLLGLLPSTADNWGLMIQQAWNNNAFLLPQAAPFLIAPMVMIMLFQIGLVTMTRSLE
FT                   QALNPRLRDR"
FT   gene            582926..583987
FT                   /locus_tag="Ndas_0484"
FT   CDS_pept        582926..583987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0484"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COGs: COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component; InterPro
FT                   IPR003593:IPR010066:IPR003439:IPR013563; KEGG:
FT                   ttr:Tter_0898 oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; SPTR: C1YLR7 Oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter; Oligopeptide/dipeptide transporter,
FT                   C-terminal region; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65931"
FT                   /db_xref="GOA:D7AWG5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWG5"
FT                   /protein_id="ADH65931.1"
FT                   /translation="MTDHTAAPPSAEGPLLSVRGVDVGYRTGRRKQVTAVRDVSFDLHP
FT                   GQSMALVGESGCGKTTLGLGLLRLLPRTGVLSAGEVLFRRKDGRLVDVRTLAREDLRRF
FT                   RWNEAAMVFQGAMNAFNPVLRVRDHFLDTFRAHDRGRRTRAEVLERSAELLRMVRLDPA
FT                   RVLDSFPHELSGGMRQRTLIALALALEPQLLILDEPTTALDILTQRSIVERLAELREEL
FT                   RFSMVFITHDLGLAAELADRVGTMYAGRLIETGTTRDIFHRARHPYTSALINSVPPVTG
FT                   DLRVPESLPGGPPSLSALPPGCSFAPRCKHAVERCASTRPVLDVLTHRPDGLSHAAACL
FT                   RSNELSTEGATRD"
FT   gene            583980..585029
FT                   /locus_tag="Ndas_0485"
FT   CDS_pept        583980..585029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0485"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COGs: COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component;
FT                   InterProIPR003439:IPR017871:IPR003593:IPR010066:IPR 013563;
FT                   KEGG: ttr:Tter_0899 oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; SPTR: C1YLR6 ABC-type
FT                   dipeptide/oligopeptide/nickel transport system, ATPase
FT                   component; TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter;
FT                   Oligopeptide/dipeptide transporter, C-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65932"
FT                   /db_xref="GOA:D7AWG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWG6"
FT                   /protein_id="ADH65932.1"
FT                   /translation="MTDRTVSADPRPEPGAAPAGDAGDAPPPVLSLRGAHQVFSTPRGD
FT                   VPAVAGVDLDVRPGRVLCLVGESGCGKTTSARMAAGLADPVRGSVLFRGRDVAEMDRSE
FT                   RRRFRRSVQFIHQDPYASLNPVRTVYSTVSAGLRRHGLVKDRHEARRATAELLRRVDLT
FT                   PAEEYLDKYPHQMSGGQRQRVAVARALAMEPEVIIADESTSMLDVSIRVSLLNTLGALR
FT                   DDLGVGFLFITHDLAVAKYFAWEGEIAVMYLGRIVEHGPTPRVVNDPRHPYTKALIDAV
FT                   CEPDPDLAHGRERIRLRSSEIPDLTDLPSGCDFHPRCPLYEEGRCDTVRPPLAPAHDRL
FT                   LACHVVGRG"
FT   gene            585034..585222
FT                   /locus_tag="Ndas_0486"
FT   CDS_pept        585034..585222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0486"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ttr:Tter_0900 hypothetical protein; SPTR:
FT                   C1YLR5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65933"
FT                   /db_xref="GOA:D7AWG7"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWG7"
FT                   /protein_id="ADH65933.1"
FT                   /translation="MLAVVGRFGLLAGAFLALTSALMLVLTPPGTAEFVISALTVVIGL
FT                   VVLSLGLLAVLLGRNRQ"
FT   sig_peptide     585034..585129
FT                   /locus_tag="Ndas_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            585245..587023
FT                   /locus_tag="Ndas_0487"
FT   CDS_pept        585245..587023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0487"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="COGs: COG0747 ABC-type dipeptide transport system
FT                   periplasmic component;
FT                   InterProIPR017909:IPR013838:IPR002173:IPR006311:IPR 000914;
FT                   KEGG: ttr:Tter_0901 extracellular solute-binding protein
FT                   family 5; PFAM: extracellular solute-binding protein family
FT                   5; SPTR: C1YLR4 Extracellular solute-binding protein,
FT                   family 5; PFAM: Bacterial extracellular solute-binding
FT                   proteins, family 5 Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65934"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWG8"
FT                   /protein_id="ADH65934.1"
FT                   /translation="MRDLSRRRLLRTIGLGAAGVAGAGVLSSCAGGDNAESGATQFTGV
FT                   FDFDLAAQTRNVAVEDGALLMNSVYADLFLPAGAFYNWETHEWDYLLLENSAWEGDDLV
FT                   VTLRPGLKWSDGTDLTAEDLHQNYAIRVLEAPAWSVGFPQITELERLDDLSVRARFGNP
FT                   FPGIELQVVKHRIFSKSTYGDFGERAITMVADGVRQGDDEHTEFNAEFIEFNPEEIITS
FT                   GPYTFDRAQMSDARITLVRESTGYRGEEVNFEEVVVHKGDNRQASLLIQQGEVDYSTLA
FT                   TSAADQQAFRGVEGFRWIEHPGYDGCGLMFNYAAKPELKDVRVRKALKHLLDSDQIGQV
FT                   ARGEAYDRVRYYSGLVDLQTEQIFTPEELAEFAAYDHDPDRATELLEEAGWTKEGGVWH
FT                   TAEGQEASYEIIGVAGWGDFELTATQVEEAWNAFGIKTTARNVPADNPWGIWAAGDFEV
FT                   AVRHWGNPEIPQYWGAFQMNFLVENARTGETPGQDFDLKVDSPSRGEVDLEALVEVAKT
FT                   AQTEEEQTEALKTMAIVFNELLPRIPIWTYKYLAPALEGARVESFPEDHPAAQNQIYRD
FT                   NHIILSLMQGGLEAAG"
FT   sig_peptide     585245..585358
FT                   /locus_tag="Ndas_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            587774..589018
FT                   /locus_tag="Ndas_0488"
FT   CDS_pept        587774..589018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0488"
FT                   /product="crotonyl-CoA reductase"
FT                   /note="COGs: COG0604 NADPH:quinone reductase and related
FT                   Zn-dependent oxidoreductase;
FT                   InterProIPR016040:IPR013149:IPR011032:IPR013154:IPR
FT                   010085:IPR002364; KEGG: sma:SAV_414 dehydrogenase; PFAM:
FT                   Alcohol dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein; SPTR: C1YLR3
FT                   Crotonyl-CoA reductase; TIGRFAM: crotonyl-CoA reductase;
FT                   PFAM: Alcohol dehydrogenase GroES-like domain; Zinc-binding
FT                   dehydrogenase; TIGRFAM: crotonyl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65935"
FT                   /db_xref="GOA:D7AWG9"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR010085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWG9"
FT                   /protein_id="ADH65935.1"
FT                   /translation="MPKDLYDLGEVPPLGHVPARMHAFTLRRERYGQPREAFAREVVPV
FT                   PRLEPGHVLVYTMSAGINYNNVWAAMGHPVDVIAMREKVGAAEEYHIGGSDGAGVVWAV
FT                   GEGVRGVEVGDHVIIAPGQWDESADDIRMGRDPIASQSMRVWGYENNFGSFGQFTLVRD
FT                   IQCHRKPENLPWDVAGGFLVSAATAYRQLFGWEPNVVRPGDPVLIWGGAGGLGTSAIQL
FT                   ARQVGGKPVAVVSTEDKARMCRELGAVGVIQRTEFDHWGRVPDEGDTQAYASWMRGVRA
FT                   FGKRFWEELGERRAPRIVFEHTGADTLPTSLYLCDNAGMVVLCGATSGFQADVDLRFLW
FT                   MRLKRLQGSHFASPAQCRMVIDLVAGGQLDPCVTRIVEFDEIGEAHQLIRDNAQPPGNM
FT                   SALVNARAGQTGLDV"
FT   gene            589633..592131
FT                   /locus_tag="Ndas_0489"
FT   CDS_pept        589633..592131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0489"
FT                   /product="histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterPro IPR005467:IPR003594; KEGG: fal:FRAAL1814 putative
FT                   sensor-like histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; SPTR: C1YLR2 Signal transduction histidine
FT                   kinase, COG0642; PFAM: Histidine kinase-, DNA gyrase B-,
FT                   and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65936"
FT                   /db_xref="GOA:D7AWH0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWH0"
FT                   /protein_id="ADH65936.1"
FT                   /translation="MHHPVHPHSQNSGRASDRDSAQPTGGSAPESGATERGDAAPPATG
FT                   PFSGSAENGYRPASRTSVPNPYTTRRVNVDDVDTGASPVNQWRGVGLDEPEPRTPPITA
FT                   TTDTMTDTSSPTERAERPQAPAAQTQAAPADTTPQPAPRPEQAGRQRAEAPHGRTRLPE
FT                   EQGRSPRPEQADSHRQDPPQAADDHRRTEQPQADAPQADDHRQPEQPQAAAPAQGHQQP
FT                   PQAWPAPQPYQVPGERPAAPQVQGQHGYAQQPVPGPVGHDPYAAPAPYQAPPGAQYGPY
FT                   HPAGQEPHHPYPPHPQAAPAPYPAAPPQHGGYAPQPQGQHPYPAQPAHYPAQYPPQPLV
FT                   TYQSAYPAPFQPPGYVMHGQPMFYPGQYNPYGQPVQHIIVLTAGQQPQVISAESASTLF
FT                   AEHAETRTDSAEREDRALTRAGSGTDAGKEQPEREEEREAPAEAAAEPAEAAPEAPAET
FT                   LTERRAALMDAIAPAAAAAPAPSEGGDSLLNEALAGLAMRDLSLVDALLEMVEELETDA
FT                   QDPDLLDKLFQIDNFATRMRRNGENFLVLTGHDGGESDAHDEIVPLLDVARAATSEIKD
FT                   YPRVRMGKIPQTSITGMAADDISHLLAELLDNATANSPEHSQVVISAQQMTDGRLMIVV
FT                   EDEGVGIPEGQLAELNDRLAGEPVLDADVPRHMGLYVASRIAKKHGLEARLEPRSFRGV
FT                   SAYAIIPKELLRVATPRTPGQARTSTVPASAPPAKPVAPAPAPARPAANGTGRPSAASG
FT                   SAVTSAGLPRRSATPHGSPLRMMPRPGQKPDAAPQAREDTPPRLTGEARAEQIRDELGD
FT                   FFDGEREAREGGDEPKDDKK"
FT   gene            592229..592654
FT                   /locus_tag="Ndas_0490"
FT   CDS_pept        592229..592654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0490"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="COGs: COG2018 Uncharacterized distant relative of
FT                   homeotic protein bithoraxoid; InterPro IPR004942; KEGG:
FT                   ami:Amir_5417 roadblock/LC7 family protein; PFAM:
FT                   Roadblock/LC7 family protein; SPTR: C1YLR1 Uncharacterized
FT                   conserved protein; PFAM: Roadblock/LC7 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65937"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWH1"
FT                   /protein_id="ADH65937.1"
FT                   /translation="MTESVNDSVENFSWLIDRFVRDVRGVEHAVVVSSDGLVLTHSSDF
FT                   PEEHAEQLAAIASGLHSLAVGGANLFQRGECEQLLVRFNHGHLFIMAISDGSCMAVLTA
FT                   PGTELKIVGFQMTKLVENVAHVLTPQLRSQLREVIQN"
FT   gene            592692..593051
FT                   /locus_tag="Ndas_0491"
FT   CDS_pept        592692..593051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0491"
FT                   /product="protein of unknown function DUF742"
FT                   /note="InterPro IPR007995; KEGG: fal:FRAAL1812 hypothetical
FT                   protein; PFAM: protein of unknown function DUF742; SPTR:
FT                   C1YLR0 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF742)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65938"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWH2"
FT                   /protein_id="ADH65938.1"
FT                   /translation="MSFRRRRSNRVRPFTFTGGRTRSRHPLMVQTLVSTSEPGQEPPGT
FT                   LMPESISIYKLCRETRSLAEVSAELNIPLGVTQVLVSDLAEQDLVYIHPTITGSSPSEN
FT                   QVLERALRGLERLFQ"
FT   gene            593026..593631
FT                   /locus_tag="Ndas_0492"
FT   CDS_pept        593026..593631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0492"
FT                   /product="protein of unknown function ATP binding protein"
FT                   /note="COGs: COG2229 GTPase; InterPro IPR004130; KEGG:
FT                   sma:SAV_2697 ATP/GTP-binding protein; PFAM: protein of
FT                   unknown function ATP binding; SPTR: C1YLQ9 Predicted
FT                   GTPase, COG2229; PFAM: Conserved hypothetical ATP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65939"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWH3"
FT                   /protein_id="ADH65939.1"
FT                   /translation="MVSNDFSSDKRSNRKKMSSKIVIAGGFGAGKTTLVRSVSEIPPVT
FT                   TEAIMTEASIGHDDTSITPDKTTTTVAMDFGRITIDDELVMYMFGTPGQARFWFMWDDL
FT                   VRGAVGAVVVVDCRRLADSFDAVDYFETNKRIPYIVALNKFEGRLEYTSEQVREALEVS
FT                   PEVPIIDFDARNRLSGGEVLKTLLRYALEHNRASEPVA"
FT   gene            593692..594948
FT                   /locus_tag="Ndas_0493"
FT   CDS_pept        593692..594948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0493"
FT                   /product="putative oxygenase subunit protein"
FT                   /note="KEGG: fre:Franean1_5474 putative oxygenase subunit
FT                   protein; SPTR: C1YLQ8 2-polyprenyl-6-methoxyphenol
FT                   hydroxylase-like oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65940"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041654"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWH4"
FT                   /protein_id="ADH65940.1"
FT                   /translation="MRKILIVGAGHAGLHLAHGLLTHGYDVTVITGQSSMEIRTGRCSV
FT                   AQFTFPTALEYERKFDLDFWSALAPQIREQKLFMYMEGGVSSAFSGSSHPGNGYSVSVD
FT                   RRVKMADWLEFFEDRGGKVVIHGVTVTDLDYFSRMFDLIIVAVGHGELGQLFDNDTSRF
FT                   SGARPRSIAQAHIYDVWPDPEGDDNIGWAATAQSAGNLMLIPMLGQDGPCHNLLLVDRK
FT                   GGPMDAWPDRPGQEEQLRRMKDLLRKHAPDAFERIKDANLTDGRSTLVEELTPQVRNPV
FT                   GKLPNGGSVLGMADVVVTMDPYTGQSWNNSTRCAQAYLEAIIERGDQPFDDDFLVAAFD
FT                   RFWEFGQDNQEWAEFASTLWERELPPHLGVVMEAAARYREVGDRWIQAWDNPSDFKNWL
FT                   FNPEAAMRYIEEVKERHGD"
FT   gene            595373..603373
FT                   /locus_tag="Ndas_0494"
FT   CDS_pept        595373..603373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0494"
FT                   /product="Acyl transferase"
FT                   /note="COGs: COG3321 Polyketide synthase modules and
FT                   related protein;
FT                   InterProIPR009081:IPR006162:IPR018201:IPR018294:IPR
FT                   016038:IPR001227:IPR016040:IPR016039:IPR016035:IPR011032:I
FT                   PR016036:IPR014030:IPR014031:IPR014043:IPR006163:IPR013154
FT                   :IPR013149:IPR002198; KEGG: sgr:SGR_6179 putative type-I
FT                   PKS; PFAM: Acyl transferase; Beta-ketoacyl synthase ;
FT                   phosphopantetheine-binding; Alcohol dehydrogenase GroES
FT                   domain protein; Alcohol dehydrogenase zinc-binding domain
FT                   protein; short-chain dehydrogenase/reductase SDR; SPTR:
FT                   C1YLQ6 Short chain dehydrogenase/beta-ketoacyl
FT                   synthase/zinc-binding dehydrogenase; PFAM: Acyl transferase
FT                   domain; Phosphopantetheine attachment site; KR domain;
FT                   Beta-ketoacyl synthase, N-terminal domain; Zinc-binding
FT                   dehydrogenase; Beta-ketoacyl synthase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65941"
FT                   /db_xref="GOA:D7AWH5"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWH5"
FT                   /protein_id="ADH65941.1"
FT                   /translation="MSGRSDGAPAHGPWEPIAVVGLSCRLPGARTPDAFWRLLCEGREA
FT                   ITPPPARLGEPPTGRGSTWGGYLDNAEDFDAAFFGISPREALAMDPQQRLMLELSWEAV
FT                   ENSRTAPGTLRGARVGVFTGAIGSDYALLYDRGGAGAITHHTLTGTHRSMIANRVSHAL
FT                   GLVGPSLTVDAGQSSSLVGVQLAVESLRRGDSDVALAGGVNLILVAESTESVARFGGLS
FT                   PDARCHTFDSRANGYVRGEGGAVVVLKPLGRALADGDRVHAVIHGGAVNNSGAGEFLTR
FT                   PTVDGQEAVIRAAYADAGKDPGQVAYVELHGTGTPAGDPVEAAALGGVFGRGAEEPLRV
FT                   GSAKTNVGHLEGAAGVVGLVKTVLSLDHQQIPPTLNFAEPHPDIDLDGLGLSVQTRREP
FT                   WPTHTPLAGVSSFGMGGTNCHLVLGPGPVPERTGSDPVTKRVLDPVPWVLTARSPEALR
FT                   AQASALHAYVSSRPGVRAHDVGLSLATTRDVMEHRAVVLAPGEDSDRELESVRLEGGPD
FT                   TEPGHDGPVLVFPGQGGQWAGMGRSLLDGEGVLAEAFTRRLRECERALEPHTDWSVSAV
FT                   LRGDSQAPPLTGEGSRADVVQPALWAVMVSLAGVWEDLGVRPSAVVGHSQGELAAACVS
FT                   GALSLEEAARIVALRSRALTALSGSGGMASLGVTAEEAAELAADIPDLNVAAVNGPEAV
FT                   VVSGSPRAVREAVERCVDRGVHGALVDVDYASHSAHVERIRDTIVRDLGEVRWRAPRIP
FT                   FYSTLVGARLDGDGPALDAGYWYTALREPVLFASAVGALIADGRRVFIEVGPHPVLSYG
FT                   VRRSLEAAGVRGHVLETLRRGDGDQAQLLTAAARAFTTGVDIDWPMLFEGTGARRIDLP
FT                   PYQFQRRRHWPDDLAARRPASGAPAPESEDDQRARERTAPVLELVCEHTARVLDREALD
FT                   PGEEKRAFRDLGFDSIMTLELGDELEERTGVRLEDTVLFELPTPAELAAFLVTELGREE
FT                   VTTASAPSRPAPVPAPAPAPARPADEDDPVAITAMACRLPGGVSSPEQLWRLVEDGVDA
FT                   TGDLPDNRFWDLDSLYDPEPGAPGRTYTRRGGFLYDADLFDADFFGISPREADAMDPQQ
FT                   RLLLETSWEAVRRAGLSDEALRAENVGVFVGAMPSDYGPRLADPVRGNDGGYRLTGSTL
FT                   SVASGRIAYVLGLNGPAMTIDTACSSSLVAVHQAAEAIRRGECAMALAGGATVMATPGM
FT                   LLEFAAQRGLSADGRCRAFGEGADGTAWAEGAGVLLLERASRARRAGRPVLALIRGGAV
FT                   NSDGASNGLTAPNPQAQQRLIRSALADAGLEPGEVDAVEAHGTGTRLGDPIEAKALIAV
FT                   YGRDRDGEPLRLGSLKSNIGHAQAAAGVAGVIKTVQALRHGRLPRTLHADVPTTQVDWE
FT                   DAGVRLLRENEPWPDTGRPRRAAVSSFGISGTNAHLVLEGVVDEGAPVSMVDLPFQRRR
FT                   HWTRPPAPEAAPAAAPRLLDGPGLELVDGSTVFGGRIGEAAHPWTRDHRLLGRVVLPGT
FT                   ALAELALYAGAHTGAAAVADLTLERPLILPRGGETSVQVTVAAPDARGRRAVSVHSRGP
FT                   DAGEWTRHASGALEPDTGGEAPSAGAWPPPEAAPAPFGYDEDYGRLARRGYAYGPVFRG
FT                   LRSVWRGRGDTLLATVALPEGHRGGAFRGPHPALLDAALHAVLLFGESRDGPPLVPFAW
FT                   SGMRVPDRDGPPPAELRVVLEPLGGDRHRLTAFDERGDLAVGVDELALRPIDAEDLPPA
FT                   PDEEPGLYRVRWDPVPAPEPAARVPIGLAALGDLAPDAPVPDTVYAELPPRAVYADHDP
FT                   VPSSVYEGLHAVLDTVRTWLSEDRFAHARLVLVTWRSVSTSPEDRLGGPAASPVWGLLR
FT                   SVQREHPDRFVLVDSDGSEDSHRVLPAAATLGEPQLALRSGRVLAPRLVPAHADDVPVP
FT                   PGPAWRIEVGGPDGSALSAAPAAAAPLEGHQVRVAVRAAGAAPDVEASVRRTGAQGAGV
FT                   VLETGAQVHDLVPGDRVTGLFDDAFATTAVADRRLLARVPREWGLEEAAAVPFPALTAY
FT                   HALVDLAAVRPGESVLVHDAARGAGPVAVQLARHMGAHVLATADPRQWPLLVGLGLSED
FT                   CLASSRDPGFAAAVREANGGRGVDVVLDTRAGDGVDALMGLLVAPSDGGGVGGRFVEMT
FT                   GTGPRDGAEPPVADHPGRGYEAFRLADVDAERVGQMLTRVMELFASGVLSPLPVDVHDL
FT                   RDAHLAPTDPDGAVVLAVPAPFPQDGTVLVTGGTGTLGHQVARHLVTGYGVRHLTLISR
FT                   SGAAARGQDGRTDELRRLGAQVEVHACDAADRDALARLIDSLPGERPLRAVVHTAGVLD
FT                   DATVLSLDAQRLEAVLRPKVDAAWNLHELTADLDLGAFVLFSSVTGTLGSPGQANYAAA
FT                   NVFLDVLARLRRERGLPALSLAWGLWDEASGMTAHLDGGDLGALGRAGLLPMPVDRALA
FT                   KMDAALYLGGDVLVPALLNLGDGADLPILRELAGPAGEDDPGAGGGGEPPLSRRSLTGL
FT                   APAERGRLLLTEVRERTALVLSRQDAGQVPADRPFRELGLDSLTGVELRNRLGAASGLR
FT                   LPATAVFDHPTPRALARFLEGLLFPAEPEEPGDARRSGNAEPETEPGDAGSSIDDMDVE
FT                   DLLHLALGREGAASDGEQETADGYR"
FT   gene            603360..606740
FT                   /locus_tag="Ndas_0495"
FT   CDS_pept        603360..606740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0495"
FT                   /product="6-deoxyerythronolide-B synthase"
FT                   /EC_number="2.3.1.94"
FT                   /note="COGs: COG3321 Polyketide synthase modules and
FT                   related protein;
FT                   InterProIPR009081:IPR018201:IPR014030:IPR006162:IPR
FT                   016036:IPR001227:IPR016035:IPR006163:IPR020841:IPR014031:I
FT                   PR016039:IPR016038:IPR014043; KEGG: mpa:MAP1371 Pks8; PFAM:
FT                   Beta-ketoacyl synthase ; phosphopantetheine-binding; Acyl
FT                   transferase; PRIAM: 6-deoxyerythronolide-B synthase; SMART:
FT                   Polyketide synthase, beta-ketoacyl synthase region; SPTR:
FT                   C1YLQ5 Polyketide synthase family protein; PFAM: Acyl
FT                   transferase domain; Phosphopantetheine attachment site;
FT                   Beta-ketoacyl synthase, N-terminal domain; Beta-ketoacyl
FT                   synthase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65942"
FT                   /db_xref="GOA:D7AWH6"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR041314"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWH6"
FT                   /protein_id="ADH65942.1"
FT                   /translation="MATDSAQNTKLVAALRSALKENERLRGRNRELDRRSDPVAVVGMG
FT                   CRLPGGVDSPEGLWDLVEQGTDAIGPFPEDRGWDLDAVLGGSEPLSAMDQGGFLEGAAD
FT                   FDAAFFGISPKEAAAMDPQQRLLLELSWEALERAGIDPSSLAGTPTGVYVGLMAAEYGP
FT                   RLSDAPEDGHLLTGTMPSVASGRIAYTLGLAGPALTVDTACSSSLVALHLAVRALRERE
FT                   CSLALVGGATVMGTPGVLAEFSRKQGLSADGRCRAFGAGANGTGFAEGAGALVLERLSD
FT                   ARRNGHRVLALVRGSAVNQDGASNGLTAPNGPSQVSVVRAALDDAGISPDGVDAVEAHG
FT                   TGTTLGDPIEAQALIEAYGGERGAPLLVGSLKSNIGHTQAAAGVSGVVKAVQSLLHGTV
FT                   APTLHAEEPSTHVDWDSGAVRLATRAHPLPDLGRPARIGVSSFGISGTNAHVILEAPPA
FT                   EAADTGAPASARESGPVPAPRTLPFVVSARGEEALRTQAARLSAHLGAAPATDPGREPE
FT                   GGPGEHAALVATARALATTRARLEDRAVVLASDTGGLTAALDALAEGRPDAALVRGRAD
FT                   TGGSVAFVFSGQGSQRLGMGRGLYEAHPAFARALDEAVDALDCHLPRPLRTVMWAREGT
FT                   AEAELLDQTLYTQAGVFAVEVAVVRLLESLGVVPDHVVGHSIGELAAAYAAGVFTLEDA
FT                   AALVAARGALMQDLPEGGAMVAVQAEEREARQAVARSGGQLSVAAVNAPDSVVLSGEET
FT                   AVAALADHFARQGRRTKRLTVSRAFHSPLMDPMLGAFARAAERVSYHRPVLPLVSNLTG
FT                   ARAGEEVREHGYWVRHVREAVRFADGVAHLHKAGVTEFVEVGPGGVLSSMVQSCLGGDR
FT                   GARVTALLGGERDEQRGFAEGLAALHARGAHVDWSAYLPPGPVTALPTYPFQRERYWMN
FT                   PPAGGRVVVETGAGATAAGGGAAPGARADLTALGDDERTEALLDLVRRESAALLGHASP
FT                   RDVRSDQGFLEMGLDSLGAVRLGERLSAATGLDVSATTVFDHPEPRVLAAHLSAELAPE
FT                   DIDASQAAGGDERVRAALARIPVDRLRSAGLLEALLALDTGVAAGDAGEDGAAEEEGAN
FT                   TDVDSMDVDDLMRMVYGRD"
FT   gene            606759..613031
FT                   /locus_tag="Ndas_0496"
FT   CDS_pept        606759..613031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0496"
FT                   /product="Acyl transferase"
FT                   /note="COGs: COG3321 Polyketide synthase modules and
FT                   related protein;
FT                   InterProIPR009081:IPR006162:IPR018201:IPR000408:IPR
FT                   016038:IPR001227:IPR016040:IPR016039:IPR016035:IPR016036:I
FT                   PR014030:IPR014031:IPR014043:IPR002198:IPR006163:IPR001031
FT                   ; KEGG: sgr:SGR_6183 putative type-I PKS; PFAM: Acyl
FT                   transferase; Beta-ketoacyl synthase ; short-chain
FT                   dehydrogenase/reductase SDR; phosphopantetheine-binding;
FT                   Thioesterase; SPTR: C1YLQ3 Short chain
FT                   dehydrogenase/acyltransferase/thioesterase; PFAM:
FT                   Thioesterase domain; Phosphopantetheine attachment site;
FT                   Acyl transferase domain; KR domain; Beta-ketoacyl synthase,
FT                   N-terminal domain; Beta-ketoacyl synthase, C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65943"
FT                   /db_xref="GOA:D7AWH7"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR041314"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWH7"
FT                   /protein_id="ADH65943.1"
FT                   /translation="MHKPADGRPDERVVQALRASVKENERLREQNRRLVEAATEPVAIT
FT                   GMACRYPGGVQTPEQLWDLLIAERDTVSAFPDDRGWDLAGLFDDDPDRPGRSYVRAASF
FT                   LDDPAGFDAAFFGISPKEAQAMEPQQRLLLECAWEAVERAGTDPTTLRGTRTGVFAGVV
FT                   AVPYGPRAVDATDGSEGHLITGTAPSVAAGRVSYTLGLEGPAVSFDTACSSSLTALHAA
FT                   VESLRRGECERALVGGVSVVTDPAVFAGLSGQRALSPDGRSKAFDAAADGTGWSEGCGV
FT                   LVVERLSDARRHGRPVLALVRGVAVNQDGASSGLTAPNGSAQRRVITRALEAAGVTADQ
FT                   VDAVEAHGTGTALGDPIEAEALIATYGRAHTPEAPLHLGSLKSNIGHTVAAAGVSGVIK
FT                   TVLALRNETLPRTLHLTEPTPRVNWSAGTVVPLTEARPWPRREDRPRRAGVSAFGMSGT
FT                   NAHAVLEEAPAAEPAPAAPADAPPAASDLVPWPVSARGAAALAAQAARLADHLDAHPDL
FT                   APADVGHTLATARADLPDRAVVLSADTDGFREALRALAEGRDTAAVVRGRVREQAKTAL
FT                   VFPGQGSQWIGMAVSLMDTVPEFADRIDQCQKAFASHLDWSLASVLRGEPGAPGLERID
FT                   VVQPVLFAVMVALADLWRAHGLRPSAVVGHSQGEIAAAHVAGALSLEDAARVVITRSRL
FT                   LTSLVGRGAMATLALSADEAAKRIGPWEGQLSVAVVNGPGTVVVAGDKQAVAELVGDCE
FT                   ADGIKVRRIHEDVAGHSPHVEALRADLVAALAGIRPRPTNLPLYSTVTGERIEGTALDA
FT                   EYWYRNLRRTVLFEPAVRALHEAGFTAFVEVSSHPVTTYGIQQTVEAAGGDESAVLHTL
FT                   RREEGGYGHFLTALARAHVSGVAVDWTRAHAPHAPRAVELPTYAFQRDRYWLVPGRASD
FT                   VLGSGADPAGHPLLGAAVDLPDGEGHLFTGQLSLATAPWLADHAVGSTVVLPGAAHLDL
FT                   VLHAAEHVGLPSVAELTLLAPLALRPGADTRLQVAVSGPDASGRRSVRVHARPADRSDG
FT                   WTLHAEGLLEPASAPAPGTASAQTAPPPEAEPVPVDGLYADLARDGYGYGPAFQGLRAA
FT                   WREGGRVWAEARLPDGHREDAAAFGVHPALLDAAQHAIALTAPGESGRVRLPFSWTGVR
FT                   LYASGADHLRVHVSPVGPDEYALTMTDTDGNPVLTAESLAVRPVDAARVEEEARRALPR
FT                   ELYALEWPTVDLADTGPLPALAVLAPDTTGLTEALARTGAVVHLVTGLEELRELPGETV
FT                   VLAPFAAAVPEAGTARVETAEETPAASGAGVPEDAGASLRRALELLQEWSADEGATDHR
FT                   LIVVTRGAVAVAPEEDVTDLVHAPLWGLLRSAQAEQPDRFTVVDLDGSDAAAATLTRAL
FT                   ASGEPQLALRGSTAHAPRFTRARVPGESAAPDLGGGTVLVTGATGVLGSAVARRLVERH
FT                   GARDLLLLSRRGGGAPGATALVEELTSLGARAAFAACDVSDADALAAVIDAVPEERPLR
FT                   AVVHVAGGIDDGVLATLTPESLDAVMRPKADAAHHLHRLTEHLDLAAFVLFSSAAGVLG
FT                   SPGQANYAAANTFLDALAHHRRSRGMAAQSLSWGLWERLGEAGSHLEAADISRLRRLGM
FT                   ARTLEQREALDLLNAALACGAPHLVPLPLDLEGVRDRAARTGQVPPLMRGLVRQPRYRA
FT                   SKGGAAEGAGVSAALAASTGEERERLLLELVGALTTEVLGRPGDESPDPDQDFLELGMD
FT                   SLTAVELRNELRAATGLRLTASVVLAHSTPARLARHLAAELPEPGSAAPTAVADTAGAD
FT                   PLEGAVPLFRESCRQGRIADGIRMVQAASRLRPEFTGPEDFGALPRPVTVARGPVLPRM
FT                   VCLPSLVMVSGVQEYARFGAALQGLREVVVLPQPGFTPGDPLPRTLEAALAVQARAVRE
FT                   VVGDEPYVLVSRSSGGWVTHSVATLMEAGGHAPGAVVLMDTPMPEEPTAFPIIQAGVLE
FT                   RETRFGLMDGTRVTAMGRYIGLCADWEPAPTAVPTLAVRPGQQMLDASGTPIGGRDWRF
FT                   DWPLPHEAVDVDGDHITMLEEHGPDTALTVHRWLEEHVR"
FT   gene            613369..617319
FT                   /locus_tag="Ndas_0497"
FT   CDS_pept        613369..617319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0497"
FT                   /product="ATP-dependent helicase HrpA"
FT                   /note="COGs: COG1643 HrpA-like helicase;
FT                   InterProIPR001650:IPR007502:IPR014021:IPR010222:IPR
FT                   011709:IPR003593:IPR014001; KEGG: tfu:Tfu_2317
FT                   ATP-dependent helicase HrpA; PFAM: helicase-associated
FT                   domain protein; helicase domain protein; protein of unknown
FT                   function DUF1605; SMART: helicase-associated domain
FT                   protein; DEAD-like helicase ; helicase domain protein; AAA
FT                   ATPase; SPTR: C1YLQ2 ATP-dependent helicase HrpA; TIGRFAM:
FT                   ATP-dependent helicase HrpA; PFAM: Helicase conserved
FT                   C-terminal domain; Helicase associated domain (HA2); Domain
FT                   of unknown function (DUF3418); Domain of unknown function
FT                   (DUF1605); DEAD/DEAH box helicase; TIGRFAM: ATP-dependent
FT                   helicase HrpA"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65944"
FT                   /db_xref="GOA:D7AWH8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010222"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWH8"
FT                   /protein_id="ADH65944.1"
FT                   /translation="MSTTTPAPAADTLRSRLRDLMPSDRHRLRRRIDGLAKIGDERRRA
FT                   SVAAQISGDVDEALLRVNLRRESVPELSYPESLPVSSRRDDIAEAIRDHQVVIVAGETG
FT                   SGKTTQLPKICLELGRGVMGTIGHTQPRRLAARTVAERIAEEIGTPLGETVGYKVRFTD
FT                   SSSDSTLVKLMTDGILLAEIQHDRMLRQYDTLIIDEAHERSLNVDFLLGYLKQLLPRRP
FT                   DLKVVITSATIDPERFSRHFDDAPIVEVSGRTYPVEVRYRPISEEILDPEEKNPGGGTD
FT                   RDQTQAILDAVDELGREAPGDVLVFLSGEREIRDTAEALEKRKLPGTEVLPLYARLSTS
FT                   EQRRVWSSHSGRRIVLATNVAETSLTVPGIKYVIDPGTARISRYSHRTKVQRLPIEAVS
FT                   QASANQRKGRCGRVSEGICIRLYSEEDFLSRPEYTDPEILRTNLASVILQMAALGLGDV
FT                   AAFPFVDGPDHRQIKDGVNLLNELGALHPDESGGKRRLTPMGRRLAQLPIDPRLGRMVL
FT                   EAEERDCLGEVLVITAALSIQDPRERPTDKQQQAQQAHARFTDKESDFLAYLNLWNHLR
FT                   EKQRELSGNQFRRLCRDEYLNYLRVREWQDIHGQLRQVLRSMGVEVPHPREEAADPRGV
FT                   HMSLLAGLLSHVGLKDPEKHEYLGGRGARFAVFPGSALFKKQPRYVMAAELVETSKLWG
FT                   RMVARIEPEWAEELAGDIVKRSYSEPHWERKRGAVMAFERVTLYGVPIVVQRKVSYGRI
FT                   DPELSRELFIRRALVEGDWETRHHFFHDNRKLLDEVEDLEHRARRRDIVVDDETLFQFY
FT                   DARLPDSVVSAAHFDSWWKKARRTEPELLDFTREELINEGAGAISEDDYPDVWRQGEFT
FT                   FPLSYQFEPGSDSDGVTARVPVKFLNQVEDTGFDWQIPGLRDELVTALIRSLPKPLRRN
FT                   FVPVPDNAARALAGLVPYEGPLTAALAAELTRMAGERIAPGDFQLDRVPDHLRITFRAV
FT                   DDRGRTLAESKDLEKLRAKLKPRLREAISAEAKGVEKKGLTSWDFGPLEQTLERKALGP
FT                   KVKGYPALVDEGDSVAIRIFDTRPEQRAAMWAGTRRLLLLTVPSVANVVSKGLNNPDKL
FT                   ALADNPHGSIRRMLDDAEAAAVDHLLAREGGPVWNGEDFAKLADRVRADLGDTLAEILD
FT                   RSARVLVLWRKVSKKVKGTTSLAVLPSLNDVQGQLGDLVGEGFVTRTGLARLDDLHRYL
FT                   RGVEYRLNKLPENPRRDQVNMSKVEQMRQAVAKLRGSLPPGRAADPDVAELRWMLEEYR
FT                   VSLFAQELRTAYPVSDKRILKAVEAVKAAERK"
FT   gene            complement(617395..617886)
FT                   /locus_tag="Ndas_0498"
FT   CDS_pept        complement(617395..617886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0498"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="InterPro IPR000182:IPR016181; KEGG: bpa:BPP0380
FT                   acetyltransferase (GNAT) family protein; PFAM: GCN5-related
FT                   N-acetyltransferase; SPTR: C1YLQ1 Acetyltransferase (GNAT)
FT                   family protein; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65945"
FT                   /db_xref="GOA:D7AWH9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWH9"
FT                   /protein_id="ADH65945.1"
FT                   /translation="MFVCQPLQRAHRTDSFSCGKEELDSWLRRSALHARANNTAATFVW
FT                   CEEGSTEVAAYYSFTSMSLEREELPKTLARGSMHRIPAVLLARLALHTRYQGQGLGPVL
FT                   LVDAFERALAGNQVFAVRFLVVDALDEDAHTFYEKHGFRGIPGSMRLYRKMSDIAKTLE
FT                   "
FT   gene            complement(617894..618166)
FT                   /locus_tag="Ndas_0499"
FT   CDS_pept        complement(617894..618166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0499"
FT                   /product="Protein of unknown function DUF1778"
FT                   /note="InterPro IPR014795; KEGG: syn:sll7031 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF1778; SPTR:
FT                   C1YLQ0 Uncharacterized conserved protein; PFAM: Protein of
FT                   unknown function (DUF1778)"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65946"
FT                   /db_xref="GOA:D7AWI0"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWI0"
FT                   /protein_id="ADH65946.1"
FT                   /translation="MSTATERIEVRLTPEDKDLLLEAARISHESTSKFVVRVAREAAEE
FT                   IVEREQTTTVPAAFFDAMVESLEEPAQPIEELASAVRKHRSIVKR"
FT   gene            complement(618310..618435)
FT                   /locus_tag="Ndas_0500"
FT   CDS_pept        complement(618310..618435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0500"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="KEGG: dvm:DvMF_1433 iron-containing alcohol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65947"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWI1"
FT                   /protein_id="ADH65947.1"
FT                   /translation="MLQALILSYESGPGEPGVPKYFPSPAQDCPKRCRTCLRPAT"
FT   gene            618506..619603
FT                   /locus_tag="Ndas_0501"
FT   CDS_pept        618506..619603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0501"
FT                   /product="Domain of unknown function DUF2394"
FT                   /note="COGs: COG2706 3-carboxymuconate cyclase; InterPro
FT                   IPR019758:IPR015943:IPR019405; KEGG: tfu:Tfu_2315 putative
FT                   secreted protein; PFAM: Domain of unknown function DUF2394;
FT                   SPTR: C1YLP9 3-carboxymuconate cyclase; PFAM:
FT                   3-carboxy-cis,cis-muconate lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65948"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWI2"
FT                   /protein_id="ADH65948.1"
FT                   /translation="MGESADSSVDGKRLLLVGTYTPDSDPPGEGEGIYRVWFDPMTGEM
FT                   THGGAAARTPGPSFLAFREDPPTVYAVNEREKGTVTAFRIDGAAGLTELGQSPTGGGSP
FT                   CHVLARGSELAVTNYANGVATLYALAEDGSLDGTAAEFAHSGSGPVTDRQEGPHAHSTA
FT                   APDDHHLLVADLGTDELRVLRGGEEVGAVSLPPGTGPRHTAVLGEYLYVAGELDSRVHV
FT                   LRWNPDEGTAEHLGSVEATGEEAAGENFPAEILSNGDHVYVSNRGADTIATFAVRDGGA
FT                   RLEHVADTPAGGPWPRNFTVVRGHREEPDHLVVAAQNGGSLASLLLDPGTGVPADTGHR
FT                   LRLPVPVCVLPVPITRIRRAGGTRG"
FT   gene            complement(619694..620026)
FT                   /locus_tag="Ndas_0502"
FT   CDS_pept        complement(619694..620026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0502"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO7669 oxidoreductase; SPTR: C1YLP8
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65949"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWI3"
FT                   /protein_id="ADH65949.1"
FT                   /translation="MGAVMTLETVEASVPQEVGRLRATYRKRGWTVWHGNATGQYWAAH
FT                   TGRMVMLSGDTAQELAAEIERTQPGRPVEAVPTQARRRHTELVLLLKPRPCVSRGRADT
FT                   TAGGRR"
FT   gene            620326..621729
FT                   /locus_tag="Ndas_0503"
FT   CDS_pept        620326..621729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saq:Sare_4993 hypothetical protein; SPTR:
FT                   C1YLP7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65950"
FT                   /db_xref="InterPro:IPR026588"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWI4"
FT                   /protein_id="ADH65950.1"
FT                   /translation="MCIIDNAKLTRRSVPRRTGRTFLVTAATLALAAGALSTAPGFRGW
FT                   WAPAPASAAVTVNPVAPALGFNAISEGDTYLAGTESEGPIAVGGDLSFGRDYRVRIHND
FT                   GTFTDTGESNPVALLVQGEVDFEDSDPQGVLSIPTGAYVKIGDLDDADVYTTDLNNASA
FT                   NTRIVPQGAGYEGYPRVQLSTMQPADSVGPAPDLIDFEEAFSAFRSYSSGFALCSTTAT
FT                   LTTPNGDPIDPDAIPEGADLHVSLTPGEQNVLNLTAEELNSLSQLTFDDPPSQDTPLII
FT                   NVDTSGVGGDFTWEGPTGAGLSSSTAPYTLWNFSDARTVTIPVGTDSIEGTVYAPNAAV
FT                   NHYSSANIEGTVVAREFTQDVGGPRESQRDTRVVRPFELHYHPFDAELTTCDAGPSPDP
FT                   DEPTDPDEPTDPDEPTDPDEPTDPDEPTDPDETDDPDETDDPDEPGDPDEPGRPDETDD
FT                   PDDPAPGYR"
FT   sig_peptide     620326..620484
FT                   /locus_tag="Ndas_0503"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            621954..622586
FT                   /locus_tag="Ndas_0504"
FT   CDS_pept        621954..622586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0504"
FT                   /product="BioY protein"
FT                   /note="COGs: COG1268 conserved hypothetical protein;
FT                   InterPro IPR003784; KEGG: tfu:Tfu_2314 hypothetical
FT                   protein; PFAM: BioY protein; SPTR: C1YLP6 Uncharacterized
FT                   conserved protein; PFAM: BioY family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65951"
FT                   /db_xref="GOA:D7AWI5"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWI5"
FT                   /protein_id="ADH65951.1"
FT                   /translation="MPTTRTNIRHRGLTARDLALIAVFAGLIAALSVTVAIPLPFSPVP
FT                   ITLQTLGIMLAPSLLGWKRGPLAVAAFIVLGLAGLPLFAGGMGGVGVLARPSAGFIVSW
FT                   VFAALVIGLLTDLMVRGSRGRYRFWAGLGINVVGGILVIYAIGVPWMAVVMGDGVLAAA
FT                   YSMVAFLPGDLVKAVVTALIASAVYRAYPIPPAGRPVVEAGTGRGES"
FT   gene            622586..623266
FT                   /locus_tag="Ndas_0505"
FT   CDS_pept        622586..623266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0505"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1122 ABC-type cobalt transport system
FT                   ATPase component; InterPro IPR017871:IPR003593:IPR003439;
FT                   KEGG: tfu:Tfu_2313 ABC-type cobalt transport system ATPase
FT                   component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: C1YLP5 ABC-type cobalt transport system,
FT                   ATPase component; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65952"
FT                   /db_xref="GOA:D7AWI6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWI6"
FT                   /protein_id="ADH65952.1"
FT                   /translation="MLRLEGVSHSYDDRAVLRDVTLDLAEHRIGVIGANGSGKSTLART
FT                   LNGLVVPDEGRVTLGEWDTRRHAKQIRRRVGFVFSDAANQIIMPTVAEDVEIGLRSLRL
FT                   GREETARRVEAALVRYGLDGHRDHPGHLLSGGQKQLLALASVLVTEPEVLVCDEPTTLL
FT                   DLRNTRIVHRTLDGLDQQVVLFTHDLDLLDGFDRVLVMDAGRVVFDGVPDDAVPHYTKL
FT                   MDER"
FT   gene            623263..623877
FT                   /locus_tag="Ndas_0506"
FT   CDS_pept        623263..623877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0506"
FT                   /product="cobalt transport protein"
FT                   /note="COGs: COG0619 ABC-type cobalt transport system
FT                   permease component CbiQ and related transporter; InterPro
FT                   IPR003339; KEGG: tfu:Tfu_2312 putative cobalt transport
FT                   system permease protein; PFAM: cobalt transport protein;
FT                   SPTR: C1YLP4 ABC-type cobalt transport system, permease
FT                   component CbiQ; PFAM: Cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65953"
FT                   /db_xref="GOA:D7AWI7"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWI7"
FT                   /protein_id="ADH65953.1"
FT                   /translation="MSAVGLYVPGAGFLYRVPAGAKLLALLLVGVGLVVWGGPRVAVGA
FT                   LAAALAVYPLAGLPLGRAWSALRALSPFLLAIGLFQVLFADWQTALRLCAQLAALVLFA
FT                   NLVTLTTRVRAMLDLFERMARPLRHVGANPDRVALVLALTVRSIPMAASAWQAAREAYR
FT                   ARGLSGRPHLLVVPVIVQLLRMADATGEALVARGIDEDTHR"
FT   sig_peptide     623263..623325
FT                   /locus_tag="Ndas_0506"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            624011..624991
FT                   /locus_tag="Ndas_0507"
FT   CDS_pept        624011..624991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0507"
FT                   /product="putative secreted protein"
FT                   /note="InterPro IPR012338; KEGG: tfu:Tfu_2311 putative
FT                   secreted protein; SPTR: C1YLP3 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65954"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWI8"
FT                   /protein_id="ADH65954.1"
FT                   /translation="MPRHPPADTRARSVAVVAAVLAVLMAFTLPGATPASGAVPPGPDP
FT                   ALSRSPVSRDAFPPAPFAPVDAPATGGRGLTPVQREELTERIGAIGEEHPADFAVAVQD
FT                   LRTGATFSHGAHRQFPTASVAKLTILTMLLLRAEEEGRDLTGAERAQVSAMIRHSDNEV
FT                   TDGLYSRIGFTDGFVEGARTLGFTDTDPHPRGRWGATMTTAADQVRLLRALYCDGSPLA
FT                   EEDRAYARGLMESVAAEQSWGISASAGPADTVGLKNGWTPREANGGLWNVNSVGYVAGP
FT                   GREYLIAVLTDGSPDYTAGVTLVEEVAATVTAAMEEARAAGPPDE"
FT   sig_peptide     624011..624121
FT                   /locus_tag="Ndas_0507"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            625237..626799
FT                   /locus_tag="Ndas_0508"
FT   CDS_pept        625237..626799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0508"
FT                   /product="Resolvase domain protein"
FT                   /note="COGs: COG1961 Site-specific recombinase DNA
FT                   invertase Pin homologs; InterPro IPR006119:IPR011109; KEGG:
FT                   sma:SAV_5555 integrase/recombinase; PFAM: Resolvase domain;
FT                   Recombinase; SPTR: C1YLP2 Site-specific recombinase, DNA
FT                   invertase Pin; PFAM: Recombinase; Resolvase, N terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65955"
FT                   /db_xref="GOA:D7AWI9"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWI9"
FT                   /protein_id="ADH65955.1"
FT                   /translation="MGQLRAVVAVRLSDFTDTSTSPERQTDAGNEAARDLGARVVGYPV
FT                   DLDVSASKTTPWERPQLAEWLNKPDEFDVLIWWRMDRAVRSMADMSALGHWAREHNKRL
FT                   VFAEGPTGGRLELDMGSATGELMAILMAFAAQMEAQAIRERVTGSRAQLRRTGRWGGGQ
FT                   PPYGTQPIPNPDGPGVVLGEDADAVQVLRYGQKLLHAGMRPHPIAEHLNGMAIPNATRH
FT                   FALKAGTSTDKAGNWTGFAFKKIMRNPALLGYAVHGGTIVRDERGEPVIVGPEIFTREE
FT                   FDAVGVILDEMENPNADKRPRKDSGSRMLNVGFCGGCGGKLYPTKPTKKAARRYMCRKA
FT                   SAGVKCARPVSIRADWLEDYAEREFLKRFGRMDVVRVVSHGGYDPGPEMDEVTRELRVM
FT                   IARLTEAKTRTTQAVWQERVDALEARAATLEATPVTEPYEEQIPTGEKYAAMWHNADDM
FT                   GKRRMMQDAGVRIVVQRKAPAEGKTRTGRVTRLDESLLSFDVATNRDPVADAEAEALYQ
FT                   ATS"
FT   gene            627575..627745
FT                   /locus_tag="Ndas_0509"
FT   CDS_pept        627575..627745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0509"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: C1YLP1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65956"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWJ0"
FT                   /protein_id="ADH65956.1"
FT                   /translation="MSFEQYTRVLDALTYAVHATAHRRDPKNTAVFIATRDAFAALYPE
FT                   HRDAYVPTGDR"
FT   gene            627745..627963
FT                   /locus_tag="Ndas_0510"
FT   CDS_pept        627745..627963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0510"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: C1YLP0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65957"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWJ1"
FT                   /protein_id="ADH65957.1"
FT                   /translation="MFASFGQPGHVTTAIDKELNTLPSELEKLATDGDISELKRVATAL
FT                   NKRFMERQMKEDPRVLVSAIMKAKNGK"
FT   gene            628032..628895
FT                   /locus_tag="Ndas_0511"
FT   CDS_pept        628032..628895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kra:Krad_1719 hypothetical protein; SPTR:
FT                   C1YLN9 Putative uncharacterized protein; PFAM: P22 coat
FT                   protein - gene protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65958"
FT                   /db_xref="InterPro:IPR024659"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWJ2"
FT                   /protein_id="ADH65958.1"
FT                   /translation="MAHTIQVSDVINASLGLVEAESVLGNLVYRDAEAGFTGGVGDTVR
FT                   VRVPNVIDAQNGAGQATVFSDIAEGAVPVTLTDEAYSAVKLSDKELSLDIVNFGAQVLQ
FT                   PQAAGVAKYCEKAIAGVMNAQVNDAANTKTINPDAPLSAIARAAAEFTRRELPMNGRIL
FT                   VIGPEMLEAFLNLPALQDVASAGADEALRGGELTRLMGFSVRVSPYTDGAVAFTREAFT
FT                   LACRAPLPPEGAGFAETRAHNGYALRYLRDFDISVRADVSLMGTFVGAGKMDDRRFMAF
FT                   KVAMSA"
FT   sig_peptide     628032..628133
FT                   /locus_tag="Ndas_0511"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(629995..631200)
FT                   /locus_tag="Ndas_0512"
FT   CDS_pept        complement(629995..631200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0512"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="InterPro IPR001387:IPR010982; KEGG: sma:SAV_5551
FT                   hypothetical protein; SMART: helix-turn-helix domain
FT                   protein; SPTR: C1YLN8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65959"
FT                   /db_xref="GOA:D7AWJ3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWJ3"
FT                   /protein_id="ADH65959.1"
FT                   /translation="MAPKPFRLVLRELRSARGWSQARLAEALCDVSGRPTVTRHDVSRW
FT                   ERGKRVPRAWLPYLAEVLDVSRETLERATVTEPEPFPVAETLASLLPPGEAVAPLQARA
FT                   GRRVGQTTADDLATRAHGLRLADDVLAGGDLIGPAFRELDAAVRVLRESTHTDEVRREL
FT                   LRAVGELAQIAGWIASDAADSRAEGAYRLGLDAAREAGDGPLAAQLAGSLGYHLVNNGR
FT                   VADGAALSVAAVAEAGPDAPGKTRALFHDRAAWAHTQAGDAQAAMRSLGAAHEALAEDS
FT                   GDTPEWAYWVNEAELEVMDSRVYTELRRPLRAVPLLSRVLREYPATSTRERALYESWLA
FT                   VAYADANEPEEAARVAARVIELSGDVASARTSDRVRVVLSRLADFPDVPEVREVLDSVG
FT                   PA"
FT   sig_peptide     complement(631120..631200)
FT                   /locus_tag="Ndas_0512"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            631321..631614
FT                   /locus_tag="Ndas_0513"
FT   CDS_pept        631321..631614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_2095 hypothetical protein; SPTR:
FT                   C1YLN7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65960"
FT                   /db_xref="UniProtKB/TrEMBL:D7AWJ4"
FT                   /protein_id="ADH65960.1"
FT                   /translation="MSCSFTPLDQRTGVESPLSDLVDFLRTTHGVQAEAGPLPGYVTAS
FT                   SGDRSVTVILVGRQWFRQIPAERGNTLVPLHWHGMEWSVARTVAETLAEDET"
FT   gene            631611..631838
FT                   /locus_tag="Ndas_0514"
FT   CDS_pept        631611..631838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0514"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: C5PGP0 RNA
FT                   recognition motif containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65961"
FT                   /db_xref="UniProtKB/TrEMBL:D7AX87"
FT                   /protein_id="ADH65961.1"
FT                   /translation="MTAWTCPACAHTETSGHKAHTACPKGNPQDDSADVPAVFHEAEAT
FT                   RPRTPEPSRLPQRDRRVHRWPLSIRQERTS"
FT   gene            631835..632179
FT                   /locus_tag="Ndas_0515"
FT   CDS_pept        631835..632179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0515"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0481 hypothetical protein; SPTR:
FT                   C1YLN6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65962"
FT                   /db_xref="UniProtKB/TrEMBL:D7AX88"
FT                   /protein_id="ADH65962.1"
FT                   /translation="MTAYDPAEDEVPDPTRDPEGFADYLFDAVSGNLRERPDAGAWAAP
FT                   PSRATKAQLRAALATADEDYKALRRNLVETDAAFDQLHEWLMAGRPLPDPWRKHFRPVD
FT                   DVQDEDEPDA"
FT   gene            complement(632615..632881)
FT                   /locus_tag="Ndas_0516"
FT   CDS_pept        complement(632615..632881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0516"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011991; KEGG: tfu:Tfu_0482 GntR family
FT                   transcriptional regulator; PFAM: regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; SPTR: C9Z968
FT                   Putative GntR-family regulator; PFAM: Bacterial regulatory
FT                   proteins, gntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65963"
FT                   /db_xref="GOA:D7AX89"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7AX89"
FT                   /protein_id="ADH65963.1"
FT                   /translation="MTTPLPDGYGPNSRIKEGPEPKYVQLAAILAARIDRGDFPEDTPL
FT                   PSVAKLQTAYGVSRGTAQRAVSVLAEHGRVRVSNGKGAWPVHT"
FT   gene            633030..633458
FT                   /locus_tag="Ndas_0517"
FT   CDS_pept        633030..633458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0481 hypothetical protein; SPTR:
FT                   C1YLN5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65964"
FT                   /db_xref="UniProtKB/TrEMBL:D7AX90"
FT                   /protein_id="ADH65964.1"
FT                   /translation="MHTLLSVLATLVRLLRPARGLHAGPGDFLRELQAEARARRANRVR
FT                   RYAADPVPARPAGPGYVYPSPCGAAPLEAGRTSRVPAPRRSLDKVLSVALRPAPTDYVP
FT                   VVDPEGVQPPAAMVRGYYCAHEASQDATRATRMAKVTA"
FT   sig_peptide     633030..633098
FT                   /locus_tag="Ndas_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(634197..634952)
FT                   /locus_tag="Ndas_0518"
FT   CDS_pept        complement(634197..634952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0518"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR002198:IPR016040:IPR002347;
FT                   KEGG: tfu:Tfu_2308 putative 3-oxoacyl-ACP reductase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; SPTR: C1YLN3
FT                   Putative uncharacterized protein; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65965"
FT                   /db_xref="GOA:D7AX91"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7AX91"
FT                   /protein_id="ADH65965.1"
FT                   /translation="MSPTPRVAIVTGAARGIGAAVAERLAREGRSVAVLDLRESDAREV
FT                   VDRVTAAGGTALAVGCDVSDPDQVTAAVDTVAERLGPPAILVNNAGVLRDNLLFKMSVE
FT                   DWDTVMNVHLRGSFLMSRAAQAHMTAGGWGRIVNLSSSSALGNRGQANYSAAKAGLQGF
FT                   TKTLAIELGKFGVTCNAVAPGFIETAMTRATAERIGVKYEDMKAFKEAEIPVRRVGVPE
FT                   DIANAVAFLTGEEAGFVSGQVLYVAGGPL"
FT   sig_peptide     complement(634887..634952)
FT                   /locus_tag="Ndas_0518"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            635276..635773
FT                   /locus_tag="Ndas_0519"
FT   CDS_pept        635276..635773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ndas_0519"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="InterPro IPR003594; KEGG: tfu:Tfu_2307 putative
FT                   regulator; PFAM: ATP-binding region ATPase domain protein;
FT                   SPTR: C1YLN2 Histidine kinase; PFAM: Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ndas_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADH65966"
FT                   /db_xref="GOA:D7AX92"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7AX92"
FT                   /protein_id="ADH65966.1"
FT                   /translation="MECAEAVADPAGGWWLRVLTHGSRRWNTPVCGDRHDAVTWSFEPR
FT                   PHSVGAAREISEALLHEWEMHYLSSDVAVVVSELVTNALRHGGPLPLTGQSEGGIQLSL
FT                   MRSGSEFICAVRDGGDRLPERRET