(data stored in ACNUC7421 zone)

EMBL: CP002045

ID   CP002045; SV 1; circular; genomic DNA; STD; PRO; 1986154 BP.
XX
AC   CP002045;
XX
PR   Project:PRJNA37925;
XX
DT   30-MAY-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Arcanobacterium haemolyticum DSM 20595, complete genome.
XX
KW   .
XX
OS   Arcanobacterium haemolyticum DSM 20595
OC   Bacteria; Actinobacteria; Actinomycetales; Actinomycetaceae;
OC   Arcanobacterium.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-1986154
RX   PUBMED; 21304742.
RA   Yasawong M., Teshima H., Lapidus A., Nolan M., Lucas S.,
RA   Glavina Del Rio T., Tice H., Cheng J.F., Bruce D., Detter C., Tapia R.,
RA   Han C., Goodwin L., Pitluck S., Liolios K., Ivanova N., Mavromatis K.,
RA   Mikhailova N., Pati A., Chen A., Palaniappan K., Land M., Hauser L.,
RA   Chang Y.J., Jeffries C.D., Rohde M., Sikorski J., Pukall R., Goker M.,
RA   Woyke T., Bristow J., Eisen J.A., Markowitz V., Hugenholtz P.,
RA   Kyrpides N.C., Klenk H.P.;
RT   "Complete genome sequence of Arcanobacterium haemolyticum type strain
RT   (11018)";
RL   Stand Genomic Sci 3(2):126-135(2010).
XX
RN   [2]
RP   1-1986154
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K.,
RA   Mikhailova N., Teshima H., Brettin T., Detter J.C., Tapia R., Han C.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Pukall R., Gehrich-Schroeter G., Schneider S.,
RA   Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Arcanobacterium haemolyticum DSM 20595";
RL   Unpublished.
XX
RN   [3]
RP   1-1986154
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K.,
RA   Mikhailova N., Teshima H., Brettin T., Detter J.C., Tapia R., Han C.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Pukall R., Gehrich-Schroeter G., Schneider S.,
RA   Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (18-MAY-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; b3f98dc863f777e1bac5b2710ccf4507.
DR   BioSample; SAMN02598519.
DR   CABRI; DSM 20595.
DR   EnsemblGenomes-Gn; Arch_R0001.
DR   EnsemblGenomes-Gn; Arch_R0002.
DR   EnsemblGenomes-Gn; Arch_R0003.
DR   EnsemblGenomes-Gn; Arch_R0004.
DR   EnsemblGenomes-Gn; Arch_R0005.
DR   EnsemblGenomes-Gn; Arch_R0006.
DR   EnsemblGenomes-Gn; Arch_R0007.
DR   EnsemblGenomes-Gn; Arch_R0008.
DR   EnsemblGenomes-Gn; Arch_R0009.
DR   EnsemblGenomes-Gn; Arch_R0010.
DR   EnsemblGenomes-Gn; Arch_R0011.
DR   EnsemblGenomes-Gn; Arch_R0012.
DR   EnsemblGenomes-Gn; Arch_R0013.
DR   EnsemblGenomes-Gn; Arch_R0014.
DR   EnsemblGenomes-Gn; Arch_R0015.
DR   EnsemblGenomes-Gn; Arch_R0016.
DR   EnsemblGenomes-Gn; Arch_R0017.
DR   EnsemblGenomes-Gn; Arch_R0018.
DR   EnsemblGenomes-Gn; Arch_R0019.
DR   EnsemblGenomes-Gn; Arch_R0020.
DR   EnsemblGenomes-Gn; Arch_R0021.
DR   EnsemblGenomes-Gn; Arch_R0022.
DR   EnsemblGenomes-Gn; Arch_R0023.
DR   EnsemblGenomes-Gn; Arch_R0024.
DR   EnsemblGenomes-Gn; Arch_R0025.
DR   EnsemblGenomes-Gn; Arch_R0026.
DR   EnsemblGenomes-Gn; Arch_R0027.
DR   EnsemblGenomes-Gn; Arch_R0028.
DR   EnsemblGenomes-Gn; Arch_R0029.
DR   EnsemblGenomes-Gn; Arch_R0030.
DR   EnsemblGenomes-Gn; Arch_R0031.
DR   EnsemblGenomes-Gn; Arch_R0032.
DR   EnsemblGenomes-Gn; Arch_R0033.
DR   EnsemblGenomes-Gn; Arch_R0034.
DR   EnsemblGenomes-Gn; Arch_R0035.
DR   EnsemblGenomes-Gn; Arch_R0036.
DR   EnsemblGenomes-Gn; Arch_R0037.
DR   EnsemblGenomes-Gn; Arch_R0038.
DR   EnsemblGenomes-Gn; Arch_R0039.
DR   EnsemblGenomes-Gn; Arch_R0040.
DR   EnsemblGenomes-Gn; Arch_R0041.
DR   EnsemblGenomes-Gn; Arch_R0042.
DR   EnsemblGenomes-Gn; Arch_R0044.
DR   EnsemblGenomes-Gn; Arch_R0045.
DR   EnsemblGenomes-Gn; Arch_R0046.
DR   EnsemblGenomes-Gn; Arch_R0047.
DR   EnsemblGenomes-Gn; Arch_R0048.
DR   EnsemblGenomes-Gn; Arch_R0049.
DR   EnsemblGenomes-Gn; Arch_R0050.
DR   EnsemblGenomes-Gn; Arch_R0051.
DR   EnsemblGenomes-Gn; Arch_R0052.
DR   EnsemblGenomes-Gn; Arch_R0053.
DR   EnsemblGenomes-Gn; Arch_R0054.
DR   EnsemblGenomes-Gn; Arch_R0055.
DR   EnsemblGenomes-Gn; Arch_R0056.
DR   EnsemblGenomes-Gn; Arch_R0057.
DR   EnsemblGenomes-Gn; Arch_R0058.
DR   EnsemblGenomes-Gn; Arch_R0059.
DR   EnsemblGenomes-Gn; Arch_R0060.
DR   EnsemblGenomes-Gn; Arch_R0061.
DR   EnsemblGenomes-Gn; Arch_R0062.
DR   EnsemblGenomes-Gn; Arch_R0063.
DR   EnsemblGenomes-Gn; Arch_R0064.
DR   EnsemblGenomes-Gn; Arch_R0065.
DR   EnsemblGenomes-Gn; EBG00001247199.
DR   EnsemblGenomes-Gn; EBG00001247200.
DR   EnsemblGenomes-Gn; EBG00001247201.
DR   EnsemblGenomes-Gn; EBG00001247202.
DR   EnsemblGenomes-Gn; EBG00001247203.
DR   EnsemblGenomes-Gn; EBG00001247204.
DR   EnsemblGenomes-Gn; EBG00001247205.
DR   EnsemblGenomes-Gn; EBG00001247206.
DR   EnsemblGenomes-Gn; EBG00001247207.
DR   EnsemblGenomes-Gn; EBG00001247208.
DR   EnsemblGenomes-Gn; EBG00001247209.
DR   EnsemblGenomes-Gn; EBG00001247210.
DR   EnsemblGenomes-Gn; EBG00001247211.
DR   EnsemblGenomes-Gn; EBG00001247212.
DR   EnsemblGenomes-Gn; EBG00001247213.
DR   EnsemblGenomes-Gn; EBG00001247214.
DR   EnsemblGenomes-Gn; EBG00001247215.
DR   EnsemblGenomes-Gn; EBG00001247216.
DR   EnsemblGenomes-Gn; EBG00001247217.
DR   EnsemblGenomes-Gn; EBG00001247218.
DR   EnsemblGenomes-Gn; EBG00001247219.
DR   EnsemblGenomes-Gn; EBG00001247220.
DR   EnsemblGenomes-Gn; EBG00001247221.
DR   EnsemblGenomes-Gn; EBG00001247222.
DR   EnsemblGenomes-Gn; EBG00001247223.
DR   EnsemblGenomes-Gn; EBG00001247224.
DR   EnsemblGenomes-Gn; EBG00001247225.
DR   EnsemblGenomes-Gn; EBG00001247226.
DR   EnsemblGenomes-Gn; EBG00001247227.
DR   EnsemblGenomes-Gn; EBG00001247228.
DR   EnsemblGenomes-Gn; EBG00001247229.
DR   EnsemblGenomes-Gn; EBG00001247230.
DR   EnsemblGenomes-Gn; EBG00001247231.
DR   EnsemblGenomes-Gn; EBG00001247232.
DR   EnsemblGenomes-Gn; EBG00001247233.
DR   EnsemblGenomes-Gn; EBG00001247234.
DR   EnsemblGenomes-Gn; EBG00001247235.
DR   EnsemblGenomes-Gn; EBG00001247236.
DR   EnsemblGenomes-Gn; EBG00001247237.
DR   EnsemblGenomes-Gn; EBG00001247238.
DR   EnsemblGenomes-Gn; EBG00001247240.
DR   EnsemblGenomes-Gn; EBG00001247241.
DR   EnsemblGenomes-Gn; EBG00001247242.
DR   EnsemblGenomes-Gn; EBG00001247243.
DR   EnsemblGenomes-Gn; EBG00001247244.
DR   EnsemblGenomes-Gn; EBG00001247245.
DR   EnsemblGenomes-Gn; EBG00001247246.
DR   EnsemblGenomes-Gn; EBG00001247247.
DR   EnsemblGenomes-Gn; EBG00001247248.
DR   EnsemblGenomes-Gn; EBG00001247249.
DR   EnsemblGenomes-Gn; EBG00001247250.
DR   EnsemblGenomes-Gn; EBG00001247251.
DR   EnsemblGenomes-Gn; EBG00001247252.
DR   EnsemblGenomes-Gn; EBG00001247253.
DR   EnsemblGenomes-Gn; EBG00001247254.
DR   EnsemblGenomes-Gn; EBG00001247255.
DR   EnsemblGenomes-Gn; EBG00001247256.
DR   EnsemblGenomes-Gn; EBG00001247257.
DR   EnsemblGenomes-Gn; EBG00001247258.
DR   EnsemblGenomes-Gn; EBG00001247259.
DR   EnsemblGenomes-Gn; EBG00001247260.
DR   EnsemblGenomes-Gn; EBG00001247261.
DR   EnsemblGenomes-Gn; EBG00001247262.
DR   EnsemblGenomes-Gn; EBG00001247263.
DR   EnsemblGenomes-Gn; EBG00001247264.
DR   EnsemblGenomes-Gn; EBG00001247265.
DR   EnsemblGenomes-Gn; EBG00001247266.
DR   EnsemblGenomes-Gn; EBG00001247267.
DR   EnsemblGenomes-Gn; EBG00001247268.
DR   EnsemblGenomes-Gn; EBG00001247269.
DR   EnsemblGenomes-Gn; EBG00001247270.
DR   EnsemblGenomes-Gn; EBG00001247271.
DR   EnsemblGenomes-Tr; Arch_R0001-1.
DR   EnsemblGenomes-Tr; Arch_R0002-1.
DR   EnsemblGenomes-Tr; Arch_R0003-1.
DR   EnsemblGenomes-Tr; Arch_R0004-1.
DR   EnsemblGenomes-Tr; Arch_R0005-1.
DR   EnsemblGenomes-Tr; Arch_R0006-1.
DR   EnsemblGenomes-Tr; Arch_R0007-1.
DR   EnsemblGenomes-Tr; Arch_R0008-1.
DR   EnsemblGenomes-Tr; Arch_R0009-1.
DR   EnsemblGenomes-Tr; Arch_R0010-1.
DR   EnsemblGenomes-Tr; Arch_R0011-1.
DR   EnsemblGenomes-Tr; Arch_R0012-1.
DR   EnsemblGenomes-Tr; Arch_R0013-1.
DR   EnsemblGenomes-Tr; Arch_R0014-1.
DR   EnsemblGenomes-Tr; Arch_R0015-1.
DR   EnsemblGenomes-Tr; Arch_R0016-1.
DR   EnsemblGenomes-Tr; Arch_R0017-1.
DR   EnsemblGenomes-Tr; Arch_R0018-1.
DR   EnsemblGenomes-Tr; Arch_R0019-1.
DR   EnsemblGenomes-Tr; Arch_R0020-1.
DR   EnsemblGenomes-Tr; Arch_R0021-1.
DR   EnsemblGenomes-Tr; Arch_R0022-1.
DR   EnsemblGenomes-Tr; Arch_R0023-1.
DR   EnsemblGenomes-Tr; Arch_R0024-1.
DR   EnsemblGenomes-Tr; Arch_R0025-1.
DR   EnsemblGenomes-Tr; Arch_R0026-1.
DR   EnsemblGenomes-Tr; Arch_R0027-1.
DR   EnsemblGenomes-Tr; Arch_R0028-1.
DR   EnsemblGenomes-Tr; Arch_R0029-1.
DR   EnsemblGenomes-Tr; Arch_R0030-1.
DR   EnsemblGenomes-Tr; Arch_R0031-1.
DR   EnsemblGenomes-Tr; Arch_R0032-1.
DR   EnsemblGenomes-Tr; Arch_R0033-1.
DR   EnsemblGenomes-Tr; Arch_R0034-1.
DR   EnsemblGenomes-Tr; Arch_R0035-1.
DR   EnsemblGenomes-Tr; Arch_R0036-1.
DR   EnsemblGenomes-Tr; Arch_R0037-1.
DR   EnsemblGenomes-Tr; Arch_R0038-1.
DR   EnsemblGenomes-Tr; Arch_R0039-1.
DR   EnsemblGenomes-Tr; Arch_R0040-1.
DR   EnsemblGenomes-Tr; Arch_R0041-1.
DR   EnsemblGenomes-Tr; Arch_R0042-1.
DR   EnsemblGenomes-Tr; Arch_R0044-1.
DR   EnsemblGenomes-Tr; Arch_R0045-1.
DR   EnsemblGenomes-Tr; Arch_R0046-1.
DR   EnsemblGenomes-Tr; Arch_R0047-1.
DR   EnsemblGenomes-Tr; Arch_R0048-1.
DR   EnsemblGenomes-Tr; Arch_R0049-1.
DR   EnsemblGenomes-Tr; Arch_R0050-1.
DR   EnsemblGenomes-Tr; Arch_R0051-1.
DR   EnsemblGenomes-Tr; Arch_R0052-1.
DR   EnsemblGenomes-Tr; Arch_R0053-1.
DR   EnsemblGenomes-Tr; Arch_R0054-1.
DR   EnsemblGenomes-Tr; Arch_R0055-1.
DR   EnsemblGenomes-Tr; Arch_R0056-1.
DR   EnsemblGenomes-Tr; Arch_R0057-1.
DR   EnsemblGenomes-Tr; Arch_R0058-1.
DR   EnsemblGenomes-Tr; Arch_R0059-1.
DR   EnsemblGenomes-Tr; Arch_R0060-1.
DR   EnsemblGenomes-Tr; Arch_R0061-1.
DR   EnsemblGenomes-Tr; Arch_R0062-1.
DR   EnsemblGenomes-Tr; Arch_R0063-1.
DR   EnsemblGenomes-Tr; Arch_R0064-1.
DR   EnsemblGenomes-Tr; Arch_R0065-1.
DR   EnsemblGenomes-Tr; EBT00001592807.
DR   EnsemblGenomes-Tr; EBT00001592808.
DR   EnsemblGenomes-Tr; EBT00001592809.
DR   EnsemblGenomes-Tr; EBT00001592810.
DR   EnsemblGenomes-Tr; EBT00001592811.
DR   EnsemblGenomes-Tr; EBT00001592812.
DR   EnsemblGenomes-Tr; EBT00001592813.
DR   EnsemblGenomes-Tr; EBT00001592814.
DR   EnsemblGenomes-Tr; EBT00001592815.
DR   EnsemblGenomes-Tr; EBT00001592816.
DR   EnsemblGenomes-Tr; EBT00001592817.
DR   EnsemblGenomes-Tr; EBT00001592818.
DR   EnsemblGenomes-Tr; EBT00001592819.
DR   EnsemblGenomes-Tr; EBT00001592820.
DR   EnsemblGenomes-Tr; EBT00001592821.
DR   EnsemblGenomes-Tr; EBT00001592822.
DR   EnsemblGenomes-Tr; EBT00001592823.
DR   EnsemblGenomes-Tr; EBT00001592824.
DR   EnsemblGenomes-Tr; EBT00001592825.
DR   EnsemblGenomes-Tr; EBT00001592826.
DR   EnsemblGenomes-Tr; EBT00001592827.
DR   EnsemblGenomes-Tr; EBT00001592828.
DR   EnsemblGenomes-Tr; EBT00001592829.
DR   EnsemblGenomes-Tr; EBT00001592830.
DR   EnsemblGenomes-Tr; EBT00001592831.
DR   EnsemblGenomes-Tr; EBT00001592832.
DR   EnsemblGenomes-Tr; EBT00001592833.
DR   EnsemblGenomes-Tr; EBT00001592834.
DR   EnsemblGenomes-Tr; EBT00001592835.
DR   EnsemblGenomes-Tr; EBT00001592836.
DR   EnsemblGenomes-Tr; EBT00001592837.
DR   EnsemblGenomes-Tr; EBT00001592838.
DR   EnsemblGenomes-Tr; EBT00001592839.
DR   EnsemblGenomes-Tr; EBT00001592840.
DR   EnsemblGenomes-Tr; EBT00001592841.
DR   EnsemblGenomes-Tr; EBT00001592842.
DR   EnsemblGenomes-Tr; EBT00001592843.
DR   EnsemblGenomes-Tr; EBT00001592844.
DR   EnsemblGenomes-Tr; EBT00001592845.
DR   EnsemblGenomes-Tr; EBT00001592846.
DR   EnsemblGenomes-Tr; EBT00001592847.
DR   EnsemblGenomes-Tr; EBT00001592848.
DR   EnsemblGenomes-Tr; EBT00001592849.
DR   EnsemblGenomes-Tr; EBT00001592850.
DR   EnsemblGenomes-Tr; EBT00001592851.
DR   EnsemblGenomes-Tr; EBT00001592852.
DR   EnsemblGenomes-Tr; EBT00001592853.
DR   EnsemblGenomes-Tr; EBT00001592854.
DR   EnsemblGenomes-Tr; EBT00001592855.
DR   EnsemblGenomes-Tr; EBT00001592856.
DR   EnsemblGenomes-Tr; EBT00001592857.
DR   EnsemblGenomes-Tr; EBT00001592858.
DR   EnsemblGenomes-Tr; EBT00001592859.
DR   EnsemblGenomes-Tr; EBT00001592860.
DR   EnsemblGenomes-Tr; EBT00001592861.
DR   EnsemblGenomes-Tr; EBT00001592862.
DR   EnsemblGenomes-Tr; EBT00001592863.
DR   EnsemblGenomes-Tr; EBT00001592864.
DR   EnsemblGenomes-Tr; EBT00001592865.
DR   EnsemblGenomes-Tr; EBT00001592866.
DR   EnsemblGenomes-Tr; EBT00001592867.
DR   EnsemblGenomes-Tr; EBT00001592868.
DR   EnsemblGenomes-Tr; EBT00001592869.
DR   EnsemblGenomes-Tr; EBT00001592870.
DR   EnsemblGenomes-Tr; EBT00001592871.
DR   EnsemblGenomes-Tr; EBT00001592872.
DR   EnsemblGenomes-Tr; EBT00001592873.
DR   EnsemblGenomes-Tr; EBT00001592874.
DR   EnsemblGenomes-Tr; EBT00001592875.
DR   EnsemblGenomes-Tr; EBT00001592876.
DR   EnsemblGenomes-Tr; EBT00001592878.
DR   EnsemblGenomes-Tr; EBT00001592879.
DR   EuropePMC; PMC3539103; 23323228.
DR   EuropePMC; PMC5576266; 28851356.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002045.
DR   SILVA-SSU; CP002045.
DR   StrainInfo; 33330; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4084304
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Arcanobacterium haemolyticum CCM, DSM
CC                            20595
CC   Culture Collection ID :: DSM 20595, ATCC 9345, CCM 5947, NCTC 8452
CC   GOLD Stamp ID         :: Gi02547
CC   Greengenes ID         :: 24783
CC   Body Sample Site      :: Blood
CC   Oxygen Requirement    :: Anaerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Nonmotile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 37C
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: Osteomyelitis, Pharyngitis, Sepsis,
CC                            Tonsillitis
CC   Habitat               :: Blood, Host
CC   Energy Source         :: Chemoorganotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1986154
FT                   /organism="Arcanobacterium haemolyticum DSM 20595"
FT                   /strain="DSM 20595"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:644284"
FT   gene            77..1711
FT                   /locus_tag="Arch_0001"
FT   CDS_pept        77..1711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COGs: COG0593 ATPase involved in DNA replication
FT                   initiation;
FT                   InterProIPR003593:IPR013159:IPR013317:IPR001957:IPR
FT                   010921:IPR020591:IPR018312; KEGG: ace:Acel_0001 chromosomal
FT                   replication initiator protein DnaA; PFAM: Chromosomal
FT                   replication initiator DnaA; Chromosomal replication
FT                   initiator DnaA domain; SMART: Chromosomal replication
FT                   initiator DnaA domain; AAA ATPase; SPTR: D0WL10 Bacterial
FT                   DnaA protein helix-turn-helix protein; TIGRFAM: chromosomal
FT                   replication initiator protein DnaA; PFAM: domain; Bacterial
FT                   dnaA protein; TIGRFAM: chromosomal replication initiator
FT                   protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91769"
FT                   /db_xref="GOA:D7BLH0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLH0"
FT                   /protein_id="ADH91769.1"
FT                   /translation="MEDRTAFNAQGENMSDGSFAQDAWAAAIELSRAEGRLSDSQTAFV
FT                   RLAKPLAIVDDRFMIVVATEFTRNLLNTSVVQALTDKLSAIIGRKLTLDISVDSSLSEV
FT                   AVNPPPAAKIPAPVATPSTPITTIPQPTPVRPLRSVSQPENVDMPTFSTPATPSSEPTS
FT                   IFPKPDYVTEPTAPTPRRNDHRSQGTRESARLNPRYTFETFVIGESNRFAHATALAVSE
FT                   QPGSTYNPLFLYSESGMGKTHLLHAIGNSVQEMFPNRKVLYVSAEEFTNAFINALANGQ
FT                   MHNFKDQFRTVDVLLIDDIQFLSGRDRSRTLEEFFHTFNALINANKQIVITSDVAPNLL
FT                   VDFEDRMISRFNSGITAAIDLPNLETRIAILNRKAVAEGLDVPRDVVEFIASKMTTNVR
FT                   EMEGALRRVRAFADLTKQSISLELAESQLKDMISDPTSIQVTAGMIVAQVSSYFNVPLA
FT                   DLKSPTRTRSLTQPRHVAMYLCRELTDLSLPKIAEEFNRRDHTTVMNAVRKVEALMTEK
FT                   QTIFTQVSELTTIIRNAAKDHAQIASE"
FT   gene            2071..3189
FT                   /locus_tag="Arch_0002"
FT   CDS_pept        2071..3189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); InterPro IPR001001; KEGG: jde:Jden_0002 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain; PRIAM: DNA-directed DNA polymerase; SMART: DNA
FT                   polymerase III beta chain; SPTR: D0WL07 DNA polymerase III,
FT                   beta subunit; TIGRFAM: DNA polymerase III, beta subunit;
FT                   PFAM: DNA polymerase III beta subunit, C-terminal domain;
FT                   DNA polymerase III beta subunit, N-terminal domain; DNA
FT                   polymerase III beta subunit, central domain; TIGRFAM: DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91770"
FT                   /db_xref="GOA:D7BLH1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLH1"
FT                   /protein_id="ADH91770.1"
FT                   /translation="MKIIVEHDVFTEAVTWVARTIPNRPAIPVLAGLKIQASQNGIVSL
FT                   GSRDSDISSHVDIEADVLNAGDVLVNGRLLADICRALPRKPIELTLDGTKLDIECGSSH
FT                   FSMKTMASEDYTDGTDMPPVIGTVDGSAWLEAISQVTIAASNDDTLPLLVSVCLEINGD
FT                   SIALMATDRYRLAVRDLEWTPTDTTISKRILVRASRLLDIAKALGSAGPIEISLSDSLI
FT                   GFAAGGKQNTVQLIDGEYPQVLSLFPAESAGYMVMNRADMLDAIKRSRLVVEKNAAVRL
FT                   SFTEGEVTIEAGQGDQAQASEALPADVVGEDVKMAFNPIFLQEGFSAMNCEKVRLSVTH
FT                   PTKPAVMTAEKDGESVEDFRLLLMPVRTFGNN"
FT   gene            3195..4427
FT                   /locus_tag="Arch_0003"
FT   CDS_pept        3195..4427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="COGs: COG1195 Recombinational DNA repair ATPase
FT                   (RecF pathway); InterPro IPR003395:IPR001238:IPR018078;
FT                   KEGG: bcv:Bcav_0004 DNA replication and repair protein
FT                   RecF; PFAM: SMC domain protein; SPTR: D0WL06 DNA
FT                   replication and repair protein RecF; TIGRFAM: DNA
FT                   replication and repair protein RecF; PFAM: RecF/RecN/SMC N
FT                   terminal domain; TIGRFAM: recF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91771"
FT                   /db_xref="GOA:D7BLH2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLH2"
FT                   /protein_id="ADH91771.1"
FT                   /translation="MYISDLALNDFRSYRDVVVSFSPGITTFVGENGQGKTNLVEAIGY
FT                   LATFSSHRVNADAALVRQGANAAVVRAKVMHGDSPTMVELEILSGRANRARINRGNAQP
FT                   SDVLGIVRTVVFAPEDLELIKGDPGVRRRFLDDVMVQLRPRMAQVKADYEKVARQRAAL
FT                   LKTIWKARRRGGPVDETMLDIFDSQLAALGARIIGQRARIVSALRPYVEAYYREVSGGK
FT                   GVARIDYAANIDARSGWDFPAITDISADSSGALAAEIAQHERELQDESATAARLQATLR
FT                   EWREQEIERGVNLVGPHRDDFVTFLGTLPAKGYASHGESWSYALSLRLASWRVLRDDDS
FT                   GNWTDDGEPILILDDVFAELDARRRQRLAAIVREGSQVFVTAAVGDDLPDELDGATFYV
FT                   HGGTVTRGEQP"
FT   gene            4424..5008
FT                   /locus_tag="Arch_0004"
FT   CDS_pept        4424..5008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0004"
FT                   /product="protein of unknown function DUF721"
FT                   /note="COGs: COG5512 Zn-ribbon-containing possibly
FT                   RNA-binding protein and truncated derivatives; InterPro
FT                   IPR007922; KEGG: bcv:Bcav_0005 protein of unknown function
FT                   DUF721; PFAM: protein of unknown function DUF721; SPTR:
FT                   D0WL05 Protein in RecF-GyrB intergenic region; PFAM:
FT                   Protein of unknown function (DUF721)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91772"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLH3"
FT                   /protein_id="ADH91772.1"
FT                   /translation="MSRIEVAKREAAHKHGDVLPLQILERVRRMAADQGFVRRRSVSRE
FT                   TLAATKPTPIGDAPLVPSPGQEVGSGARPSYRDPKPVFELMKKAIEERGWKSQLDVASV
FT                   AARWPEIVGESVAANCAVVEFTPDGTLTLKARTVAWETQMRSLLHHLDARLAQELGEGV
FT                   VKEIVLNGPYVPSWKHGKLSVPGRGPRDTYS"
FT   gene            5191..7239
FT                   /locus_tag="Arch_0005"
FT   CDS_pept        5191..7239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="COGs: COG0187 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) B subunit;
FT                   InterProIPR003594:IPR001241:IPR013506:IPR006171:IPR
FT                   002288:IPR013759:IPR011557:IPR013760:IPR020568:IPR000565:I
FT                   PR018522; KEGG: jde:Jden_0005 DNA gyrase, B subunit; PFAM:
FT                   DNA topoisomerase type IIA subunit B region 2 domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA gyrase subunit B domain protein; PRIAM:
FT                   DNA topoisomerase (ATP-hydrolyzing); SMART: DNA
FT                   topoisomerase II; ATP-binding region ATPase domain protein;
FT                   SPTR: D0WL04 DNA gyrase, B subunit; TIGRFAM: DNA gyrase, B
FT                   subunit; PFAM: Toprim domain; Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; DNA gyrase B; DNA gyrase B
FT                   subunit, carboxyl terminus; TIGRFAM: DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91773"
FT                   /db_xref="GOA:D7BLH4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLH4"
FT                   /protein_id="ADH91773.1"
FT                   /translation="MSDEQKTAEDTEQRAGTVAQGTEYNASNITVLEGLEAVRKRPGMY
FT                   IGSTGERGLHHLVYEVVDNSVDEALAGYASEITVTLLDNGGVKVEDDGRGIPVDIHPTE
FT                   GVAAVQVVMTVLHAGGKFGNGSYAVSGGLHGVGISVVNALSTRMDTEVRRDGYVWRISY
FT                   ENGVPVAPLEQGEPTDKTGTTQTFWPNADIFETVEFDFDTLRQRFHQMAFLNKSLKITL
FT                   IDERETAVVEGDEVTGEDDATETKHTQVTYQYDNGLHDYVTHLIKTKKSEPVHEHPIYF
FT                   EAEDKERVISVEVAMQWTNAYSESLHTFANTINTTEGGTHEEGFRTALTSIINKYARDK
FT                   AILKEKDANLTGDDIREGLTAVISVKLGEPQFEGQTKTKLGNTEARTFVQQTTYAQLTD
FT                   WLDMHPSEGKEIIRKAMQAQTARLAARKAREATRRKSVLESAAMPGKLKDCTSRKPEEC
FT                   EIFIVEGDSAGGSAVNGRDPNHQAIMPIRGKILNVEKARLDRALSSDSIQSLITAFGTG
FT                   VGEEFDIDKLRYHKIVFMADADVDGQHIATLLLTLVYRYMRPLIEHGYIYLAMPPLYRL
FT                   KWTNAEHEYVFSDKERDIKLEEGLAAGKRLPKAEGQGIQRYKGLGEMNDHELWDTTMNP
FT                   ETRTLKRVSIGEAAATDESFSVLMGEDVASRRSFIQRNAHDVRFLDI"
FT   gene            7264..9828
FT                   /locus_tag="Arch_0006"
FT   CDS_pept        7264..9828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="COGs: COG0188 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) A subunit;
FT                   InterProIPR002205:IPR006691:IPR013758:IPR013757:IPR
FT                   005743:IPR013760; KEGG: bcv:Bcav_0007 DNA gyrase, A
FT                   subunit; PFAM: DNA gyrase/topoisomerase IV subunit A; DNA
FT                   gyrase repeat beta-propeller; PRIAM: DNA topoisomerase
FT                   (ATP-hydrolyzing); SMART: DNA gyrase/topoisomerase IV
FT                   subunit A; SPTR: D0WL03 DNA gyrase, A subunit; TIGRFAM: DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV,
FT                   subunit A; DNA gyrase C-terminal domain, beta-propeller;
FT                   TIGRFAM: DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91774"
FT                   /db_xref="GOA:D7BLH5"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLH5"
FT                   /protein_id="ADH91774.1"
FT                   /translation="MAEEMIQYNHGLIKDVDLQREMETSYLDYAMSVIVGRALPDVRDG
FT                   MKPVHRRVIYAMWDGGYRPDSSFSKSVKIVGDVMGNFHPHGDAAIYDTMVRLVQPWNMR
FT                   YPLVAGQGNFGTAGDLGAAAPRYTEARMAQLAVEMVRDINEETVDFVPNFDGSVQEPTV
FT                   LTARFPNLLVNGSEGIAVGMATRIPPHNLREVAAGVQWFLDNPEATREELLDALLERVK
FT                   GPDFPTGATILGTKGIESMYRTGNGSITQRAIVEVDEINGRQCLVVTDLPFQVNPDRLL
FT                   DKMVEGIKDGRLPGIADIRDESSGRAGQRIVIVLKKDAVAKVVLNNLYKHTQMQNNFPA
FT                   NMLALVDGVPRTLSLDGFVRHWVNHQIEVIRRRTEFRLRKVLERLMILEGLVKALDALD
FT                   EVIALIRRSPTVDEAREGLMKLLDINEIQADHILAMQLRRLAALERQKILDERDEKLAL
FT                   RDDYQDILAKPERQRTIVSDEVGDIVAKFGDDRRTKILPFDGEVSDEDLIPEDDVVVTI
FT                   TRSGFVKRTKVSEYRAQHRGGKGIKGTTLRDDDIVEHFEVTSTHDWQLFFTNMGRVYRI
FT                   KGYELPEGARDAKGQHIANLLAFQPDERIASMVSIRSYDQADYLVLATEDGLVKKTRLA
FT                   DYDSARTGGLIAVKLREREDGTMDRLVSARLLDDGADVLLVSRGGQSLRFTADDATLRP
FT                   MGRATSGVTGMKFRGDDRLLAMDVVDEGAEVFVVTEGGYAKRTDIEQYRVQGRAGLGIK
FT                   VANVVEARGDLVGALITHPGDEVMVIMESGKVVRSAVDEVSLTGRNTQGVKFATPDKGD
FT                   KIISIALNLEKQEDDEEVTTDVVEPTTEPVSEQDAETTTDVE"
FT   gene            9864..10298
FT                   /locus_tag="Arch_0007"
FT   CDS_pept        9864..10298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kra:Krad_0008 hypothetical protein; SPTR:
FT                   D0WL02 Putative integral membrane protein; PFAM:
FT                   Transmembrane domain of unknown function (DUF3566)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91775"
FT                   /db_xref="GOA:D7BLH6"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLH6"
FT                   /protein_id="ADH91775.1"
FT                   /translation="MTTPTETIATPTMVDTMAVQDTHEVGIRRVKMTISRVDPWSALKL
FT                   SFLMSVAIGIMIVIATAVLWFVLDSMYVWSQIDGLLKTLNSEALLQLGQFMEFGRVLSF
FT                   SVVVAVVEIILMTAFGALMALIYNLVAMLVGGLHVTVTDE"
FT   gene            10504..10577
FT                   /locus_tag="Arch_R0001"
FT   tRNA            10504..10577
FT                   /locus_tag="Arch_R0001"
FT                   /product="tRNA-Ile"
FT   gene            10600..10719
FT                   /locus_tag="Arch_0008"
FT   CDS_pept        10600..10719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_0009 hypothetical protein; SPTR:
FT                   C5BUQ1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91776"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLH7"
FT                   /protein_id="ADH91776.1"
FT                   /translation="MKKFVLFSLVLVGGYAFFLRASETMQRQAMWQSVTDPVE"
FT   sig_peptide     10600..10662
FT                   /locus_tag="Arch_0008"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            10740..10812
FT                   /locus_tag="Arch_R0002"
FT   tRNA            10740..10812
FT                   /locus_tag="Arch_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(11373..13109)
FT                   /locus_tag="Arch_0009"
FT   CDS_pept        complement(11373..13109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0009"
FT                   /product="putative transcriptional regulator"
FT                   /note="COGs: COG2865 transcriptional regulator protein;
FT                   InterPro IPR007421; KEGG: cef:CE2684 hypothetical protein;
FT                   PFAM: AAA-4 family protein; SPTR: C0VWZ2 Transcriptional
FT                   regulator; PFAM: Divergent AAA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91777"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLH8"
FT                   /protein_id="ADH91777.1"
FT                   /translation="MEWDENLLHKTLKQLRLFGDDTTLIECKRAKEGTPKNLGETLCAF
FT                   ANMPEGGTILLGVDERSGFRVTGVPDPAQLEKSVTSLCRNAVDPAPQVSFTHIKAYGKD
FT                   VVAVTVHSLQPSEKPARYRGTAYLRQADGDYAMNSNDFRMLQISALHSSERENFDRRVL
FT                   PGTSIAELDSTLLDTYLRNVRRNSTRLSKIDDDARLLQILNITDSDGNLRLGGLYALGY
FT                   FPQTTEPALGATVAVRLARTDSLKRNQNLKDLEGPLPELINEAMLWIQQNTNTVTAYKP
FT                   NGHMVDRPEFPPSAIREVVANAFVHRDLGPTLDVGKRVDIRVSDKALIIQNPGGLQGIS
FT                   VAQLESSELTKAAVNQRLYEIAKNLHTDDGQRVIEGEGGGIREVLAAVHEARLHPPKFI
FT                   DTGTQFKVIFPRGERFNEEDKEWLDSHEITLNAMQEDLLIALREGARISFSYLCREYHY
FT                   LSEKALRSAVNQLIERDIIVETDEGLALYNFAFSPKEKREAQPDREVTRVPNDLSKLGK
FT                   NVPIVYNLLFSSDSLTLKDILFRTELTENQVRYALGPLLEQKLVEMRGGQGNRGTQYYI
FT                   PR"
FT   gene            complement(13363..16311)
FT                   /locus_tag="Arch_0010"
FT   CDS_pept        complement(13363..16311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0010"
FT                   /product="coagulation factor 5/8 type domain protein"
FT                   /note="COGs: COG1196 Chromosome segregation ATPase;
FT                   InterPro IPR000421:IPR008979; KEGG: cai:Caci_5658 ricin B
FT                   lectin; PFAM: coagulation factor 5/8 type domain protein;
FT                   SPTR: C7QC69 Ricin B lectin; PFAM: F5/8 type C domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91778"
FT                   /db_xref="GOA:D7BLH9"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLH9"
FT                   /protein_id="ADH91778.1"
FT                   /translation="MKSRRIIGGASVVALALAGLSLPAVAADEEYELTYEAINQSTIKA
FT                   VYVSSEATYENPGTIDSTLDGNNETFWHSDWKAGAPAPHELIYDLGKNTTNVGRISLTP
FT                   RQDNLSGHARVINVYTSSDPKCSVKNTTLNAKWDKRLEEKGISYNEDRTTIHVDFEQTT
FT                   AHCVRISFLKSWTSSGNEIDHRGMEFTDSSLAEFNVSIVTGKQPKPKEEPRPPVEKVIP
FT                   NNIFKAGIDVTSVDRKTWKTPSDTPAWPYLDKDGSFHYVHAAALYKKNDPRHWQFYKGQ
FT                   NMDHMFYDGELNNSGTNANTTVICNNSVTGKESTYSPNHNDPNASHSEKNYCDLINVWV
FT                   DPDTGDWYGLVHNEFTPSPFGDGYHYDGIDYAVSKDQGKSWTIEDHVITSPYSTERNDT
FT                   TEFPHQTYHYGDGDPRLYVDYASGYFYVFYGSRILNKPPYAAWVAFHEHVARAPISEKM
FT                   AKGSWQKWYNGQWSEPGIKGKESNILPVTEENPNGYTPIDKEYNPKTQGYVQNQFQTDQ
FT                   IPKTSPLFVMDISYNAYLGLYIGQPQNPDQSGNASQEFYATDNLATQKWIKIGDTGEKY
FT                   KSASWYRWFLDTANKTNSAIVGKDFRGYCSFGCAKPLYSGNRLINGAEWNTSLLNLTVD
FT                   AENPYKPVESDISYTITNSQGNTLKDQTTNTEAWTFKYLDDGSYMILNKDGKALGVDSS
FT                   SDAGRAWTTKPTLLDAKKEDVGQQWFIVPTTDKTSGERNGKFRLINRYSGHALGFNDAT
FT                   IIITPQRSWDGDAKLSGLGAEKEQIITLTAAGEKPKTGNEDLKKIEKLEADKAELEKKL
FT                   DQATKDKEVALTKKKEAEDAAQKAKESLTKINDELAKLQKEYEKAIDGKEALKTKIDTL
FT                   NKQRQNLENQINTAKTELEKAKKQLEEAKKDPKENPQPGPKPVDPTPVPPGEDPSPQVK
FT                   DVPQDKVDTKITADTKAESKGLAKTGLSLGIITALAALCIIGGTTAIRRRNN"
FT   sig_peptide     complement(16234..16311)
FT                   /locus_tag="Arch_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            16863..18680
FT                   /locus_tag="Arch_0011"
FT   CDS_pept        16863..18680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0011"
FT                   /product="sulfatase"
FT                   /note="COGs: COG1368 Phosphoglycerol transferase and
FT                   related protein alkaline phosphatase superfamily; InterPro
FT                   IPR000917:IPR017849:IPR017850; KEGG: sca:Sca_2153
FT                   hypothetical protein; PFAM: sulfatase; SPTR: B9DJW2
FT                   Putative uncharacterized protein; PFAM: Sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91779"
FT                   /db_xref="GOA:D7BLI0"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLI0"
FT                   /protein_id="ADH91779.1"
FT                   /translation="MVIGIQIVLLAAVVALSLWVFGRSLGSALRGLAVGVVANAVTFYG
FT                   MVFFLGNVGIYGAMPSWTVLLSYVVSVAMLSALLLGALAFAYKRRGLEKRGERKILGMI
FT                   LFSVGGALVGFLTGLLFFIPKWFNETLGDIPADHFVFLLTQGNGSSTVQQDLEVLNKMV
FT                   VPVIFLTLLGALIGFIRSDVVFFSRKDDDEVFRFRYLRGTSMLVMVALMVGAVPYAFAK
FT                   VPLAGVLRQSYVHSDYIEGNFVFANDKNVRLPEKKRNLIHIYMESIENSYYSSDLGGYS
FT                   RDNLMPELAALSDTGVSFSDNTKHGGPQQTYASGHSVAAMVNMWAGTPMLSSGAGDGSQ
FT                   MSFPDFPTIGDILHKHGYATTYMVGSDSSWGGTGEYYRRHGKFKVEDTPYFKKQGYIPD
FT                   DYHVWWGVEDDKLYEYAKKSLTQLGEGKDPFYFILENADTHFPRGYVSKNMTDAPFAQQ
FT                   YANVIHYSQREVVKLVEWIKAQSWSDNTTIVITGDHLSMDGEFFEGWDPAYNRTIVNMI
FT                   LNPVPGLDTSDKITKNRQYAPFDFFPTILSSIGAQVNGGQLGLGTDLFSGKPTLLERRG
FT                   KDLIDQEFSKKSTFYDSHRETKAKTSGPQ"
FT   sig_peptide     16863..16976
FT                   /locus_tag="Arch_0011"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(18755..19831)
FT                   /locus_tag="Arch_0012"
FT   CDS_pept        complement(18755..19831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0012"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="InterPro IPR002575:IPR011009; KEGG: blj:BLD_1766
FT                   putative homoserine kinase type II; PFAM: aminoglycoside
FT                   phosphotransferase; SPTR: A7BJ81 N-acetylhexosamine kinase;
FT                   PFAM: Phosphotransferase enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91780"
FT                   /db_xref="GOA:D7BLI1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLI1"
FT                   /protein_id="ADH91780.1"
FT                   /translation="MDATSIAEKFLIAGKITTIVPWGDGHINRTFRVTTTARDYVLQQI
FT                   NTTVFRDVTALIRNIDLVTGYLTDAGHETLELIPTLDGGLYYEDEAHGCYRMYVFINNT
FT                   VSYSLVDSAETLESTAEAFGEFQNQLAGFDASLLAETIPLFHHTPNRYVLFDAAVDADR
FT                   IGRVAGVSEEIGFFEERRAEASVVTDCLADGSIPVRVTHNDTKINNILIDADTGTARAI
FT                   IDLDTVMPGSLLYDFGDALRTGGAVAAEDEQDVALVGFSLELFEAYCRGFIRALRDSIT
FT                   PRELELLPDSVRLMTLECGLRFLTDYLDGDNYFGIAYPEHNLVRARNQMALVRDLEEKM
FT                   SRMREIVREVSGEFGLNY"
FT   gene            complement(19831..22062)
FT                   /locus_tag="Arch_0013"
FT   CDS_pept        complement(19831..22062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR012711; KEGG: blj:BLD_1765 Lacto-N-biose
FT                   phosphorylase; PFAM: conserved hypothetical protein; SPTR:
FT                   B3DQH2 Lacto-N-biose phosphorylase; PFAM: Lacto-N-biose
FT                   phosphorylase; TIGRFAM: conserved hypothetical protein
FT                   TIGR02336"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91781"
FT                   /db_xref="GOA:D7BLI2"
FT                   /db_xref="InterPro:IPR012711"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035080"
FT                   /db_xref="InterPro:IPR035356"
FT                   /db_xref="InterPro:IPR035363"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLI2"
FT                   /protein_id="ADH91781.1"
FT                   /translation="MHPLSNGFSIFMLRRSFLANFLEEPMSTGRFTLPSESNFAEVSRA
FT                   LAEKWGADAIRNSDGTHLDDDVLSMGKRIYSAYFPTRGHNDFMEERMHTVPMVFLLSER
FT                   TLAEDITLDVPLMDTYFAEQLQVNRDASPAEFWEVIDRTTGDVVDASEWELDAQSDVVH
FT                   IHCAKPMHEYTVTFLAYVIWDPVQMYNHITNDWGDKEHEIAFDPRDPEVRDFMFTTLRT
FT                   WLADNPHVDVVRFTTFFYQFTLIFNNERKEKIVDWTGFQVTVSPGALAEFEAEYGYRLR
FT                   PEDFVDAGSFGSSFVYPSQRQRDWLDFTSRFVQETMRTMVDLVHDAGKEAMMFLGDQWI
FT                   GTEPYSENFGTLGMDAIVGSVGDGSTTRMIADIPGVRYHEGRFLPYFFPDSFFEGADPS
FT                   IEAWDNWRKARRAILRSPLQRMGYGGYLSLAAKFPTFVDAVAKIADEFRDIYDRSGGKK
FT                   SATHLNVAFVDAWGKRRSWQEFTVAHALPNKYNRSYYGLLESLSGMRVNVTFLSFDDVL
FT                   AYGIDPSIDVVINAGPAGSAYSGGDIWTNSELVSYLRSWVRSGKGFVGVGEPTAVTHGG
FT                   RYFQLADVMGIDKEVYRSLNVDKYWPQTTGEHFMNQDIDLDSLDFGDPIINTFPINESV
FT                   TVLSDRDGEVQLATNNYGSGRGVYLSGLPYSATHARLLERALFFAAGKEDEYSIWSSSN
FT                   PDCEVAHYPEKRLIAVVNNTEIEQTTTVTLDNATRELTLPGSGIEWIEY"
FT   gene            22246..23418
FT                   /locus_tag="Arch_0014"
FT   CDS_pept        22246..23418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0014"
FT                   /product="ROK family protein"
FT                   /note="COGs: COG1940 Transcriptional regulator/sugar
FT                   kinase; InterPro IPR001367:IPR000600; KEGG: stp:Strop_4335
FT                   ROK family protein; PFAM: ROK family protein; iron
FT                   dependent repressor; SPTR: C0W0N6 Transcriptional
FT                   regulator; PFAM: ROK family; IclR helix-turn-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91782"
FT                   /db_xref="GOA:D7BLI3"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLI3"
FT                   /protein_id="ADH91782.1"
FT                   /translation="MDAERKTSTVSERLIHPAYQLIKTGAAIQRSDLVRELSISPSTAS
FT                   NLVRTLVERGLVREAELRRATGGRPARKLEPVDEADVVAVAEIGTRHIRYWIVNSLESI
FT                   DEAREISFERLDSPRDTMETMLGLWNDLRDELFPGAKIVAYGISVSAPVDSTTQRIIMP
FT                   ARMVGWHDVDLRAIVHELTGCPAWIENDARAAALGEIRSQEGTGTFIYIKAGSGIGGAL
FT                   VINGEVFAGGGGMAGDVGHARVTTGSDVTCPCGRVGCLEAEASGGAILRQAREVGLELA
FT                   SMSDLVQATIVQTPDIMTIIRRSGELVGNALSPLVNFVNPDEVLVGGSLSSMNTFMSSL
FT                   RAALFSRASSTATAKLVIEPARLGQNSPLMGAARGAYRVLSHERGTSTSE"
FT   gene            complement(23405..24727)
FT                   /locus_tag="Arch_0015"
FT   CDS_pept        complement(23405..24727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0015"
FT                   /product="sodium/glutamate symporter"
FT                   /note="COGs: COG0786 Na+/glutamate symporter; InterPro
FT                   IPR004445; KEGG: lba:Lebu_0654 sodium/glutamate symporter;
FT                   PFAM: sodium/glutamate symporter; SPTR: C2CRY4 ESS family
FT                   glutamate:Na+ symporter; PFAM: Sodium/glutamate symporter;
FT                   TIGRFAM: sodium--glutamate symport carrier (gltS)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91783"
FT                   /db_xref="GOA:D7BLI4"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLI4"
FT                   /protein_id="ADH91783.1"
FT                   /translation="MIVGWDGFVIVCKEKYRFFWYLPDVKEVFMTIEFSMIQTIGFAVL
FT                   LLFFGRSLRNRISFFERFAIPAPVIGGFTFAIVNLIFYLTETVSFQFDTTLQNFFMILF
FT                   FTSIGFGASPIVLRQAGPKVATFLLVALGLVIAQNLIVLGLAPILDLPGPLALMVGSTA
FT                   MSGGHGTSAGIAPLVQAAGFEGAESIAYTAATFGLVAGSLMGGPITTRLLRRRNLIDLH
FT                   DNAPFDDSFLHEKIHALDAERVLTGFMSLLVAMFVGSYVTDGLNLLVGNWTSMAQFPAY
FT                   IGPMICGIFARWYSDNRFKREGGEESGAKELVPHQEIDMLGTVTLSIFLSMALMSVKLW
FT                   ELGSLAIALGVLLLAQMLLTALYTRYVTFHAMGATYDAAVLVAGHVGFSMGATPNGMAN
FT                   MEAIARKYGPAPTAFFVLPVVGGMFIDFFNILTITSFLTLM"
FT   gene            24767..25372
FT                   /locus_tag="Arch_0016"
FT   CDS_pept        24767..25372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0016"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR016181; KEGG: cai:Caci_8064 GCN5-related
FT                   N-acetyltransferase; SPTR: C0UD33 Acetyltransferase (GNAT)
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91784"
FT                   /db_xref="GOA:D7BLI5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLI5"
FT                   /protein_id="ADH91784.1"
FT                   /translation="MAIFLHGKMLPVRDLSFETLSVIESATIRADMIDFWQRNTEAGAA
FT                   IGAQAGDPLSHYEALLADHEKAMAEGKAWLCVMRDADSGDLLGFAWWALGVPEGQPEHI
FT                   ATIKRLQLHPERQGEGLGKALLDYLHSESVLNRLGDQVDFLHLQFRAGRGLGRLYAKYG
FT                   YEMNLRWDMIRKNEAGEYDGWIEMIRRRDGQPMPEVRW"
FT   gene            complement(25350..26057)
FT                   /locus_tag="Arch_0017"
FT   CDS_pept        complement(25350..26057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0017"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647:IPR012287:IPR009057; KEGG:
FT                   jde:Jden_0686 transcriptional regulator, TetR family; PFAM:
FT                   regulatory protein TetR; SPTR: C0W4B6 Transcriptional
FT                   regulator; PFAM: Bacterial regulatory proteins, tetR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91785"
FT                   /db_xref="GOA:D7BLI6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLI6"
FT                   /protein_id="ADH91785.1"
FT                   /translation="MEIHTRSLRRQTITKLAATPLSPRRKRTRTKLLDAGSVLIIEKGI
FT                   LGTSVGDICERADFSRGAFYSNFADMDHFIQTLADNQWASIMIAMNKTFSSEDIASARE
FT                   TSEDATITAVGKLAQRILDALPLSRDFYLLAMELTIYLARSEDKDTPLREGANAFKEEL
FT                   GHALEVNIAAIGREYILPLDDTTELILAAAERSMNLALSEGKTNLTEYLVRVLPQLLVR
FT                   LTRPITPTSEPQA"
FT   gene            26177..29101
FT                   /locus_tag="Arch_0018"
FT   CDS_pept        26177..29101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0018"
FT                   /product="YhgE/Pip C-terminal domain protein"
FT                   /note="COGs: COG1511 membrane protein; InterPro
FT                   IPR017500:IPR017501; KEGG: jde:Jden_0687 YhgE/Pip
FT                   C-terminal domain protein; SPTR: C0W4B7 Phage infection
FT                   protein; TIGRFAM: YhgE/Pip C-terminal domain protein;
FT                   YhgE/Pip N-terminal domain protein; TIGRFAM:
FT                   X-X-X-Leu-X-X-Gly heptad repeats; YhgE/Pip C-terminal
FT                   domain; YhgE/Pip N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91786"
FT                   /db_xref="GOA:D7BLI7"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLI7"
FT                   /protein_id="ADH91786.1"
FT                   /translation="MMTRLKGPRLGTAIVIFAVALIPLLYAGLLTMTYQNPTNRLYTMT
FT                   AAIVNEDQPYSGTLVTGTQETFSLGRELSDALVHPESGEDVGFTWKTMDRDEATRRLND
FT                   ERVRAILYIPRDFSKNVAKIGTDIGSSATQELRLVTDDGVNYLAGTMAKTVSEAMTNRI
FT                   NERGATRITDRLLVSIEKVRTGLTSAADGSATLADGTTKLTDGTKKFADGLGELSRGTG
FT                   ELSRGTGRLVVGMNDLANGTVTLSDGLTRLNAGAGRAADGSGKLSAGLTDLSAGITKAK
FT                   NGTADVKNGADQLAGGIHQLTAHAGQLGDGVTKLDQGAQQLLPGINAYTAGVDQAQAGS
FT                   AKLAGAAAALPDALNNMSDGVGKPGDYTPTNPESATKSLTAGAEALNAGLNKLHSGVTQ
FT                   PNGTTPSLQQGATQLAGLTKLLTDSLSMIDTSDVQKLGAGAKDLLQTTNSYTESVDKLA
FT                   QGCEPKTSETCVGLQKLAETSGKLRAGTKVVEQGAFSVTTKIQGFEPFTKIMAKLTEGT
FT                   QGLKQGIDQVADGSAQLRDGSAKLTQSLAQASQGIGELKKKVGTASSAGDGTLLGGIND
FT                   LNAGLTKISGTNAAQSEKLRAGTRALADGIGKMNGKLPELTAGVIKLDQGAGKLSAGMG
FT                   ELSSGMTALSDGANTAAGKSRELATGLGELKNGVETASNGANKLASGSQSAKDGVQALD
FT                   QGAHKLDAGAAEAATKAGELGGAATKLNDGAHKLHDGLAAGAHKIPQLTTPQQKNVAET
FT                   AGKVVHVQPVREHAVANNGAGFTPMFMSLALWVGTIALFLVLPALDHDERARGRWVRAV
FT                   TRPAVTATLLAIVQAVIMMVVVNAMGELHAANLVGLSALAVLASICFMAINQACVAAFA
FT                   FRGRFLSIVLLSLQITSMGATFPIETAPRFFQWIHWFLPMSDTQLAFRSLIAGGGVDGI
FT                   VGKTVLVLVFWTVVSFTISLFASKVRIVRNSPRVHDEALAPTAG"
FT   sig_peptide     26177..26257
FT                   /locus_tag="Arch_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            29308..30975
FT                   /locus_tag="Arch_0019"
FT   CDS_pept        29308..30975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0019"
FT                   /product="L-lactate permease"
FT                   /note="COGs: COG1620 L-lactate permease; InterPro
FT                   IPR003804; KEGG: cdi:DIP1033 putative L-lactate permease;
FT                   PFAM: L-lactate permease; SPTR: A7BE61 Putative
FT                   uncharacterized protein; PFAM: L-lactate permease; TIGRFAM:
FT                   L-lactate transport"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91787"
FT                   /db_xref="GOA:D7BLI8"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLI8"
FT                   /protein_id="ADH91787.1"
FT                   /translation="MYSTVMHAVTFVPSTESIGGSTVLSALVGILPLIAFFIMLGVFKM
FT                   KTHWCALGSLIIALIIAVFGFQMPTAMAANSALFGMAFGIMPILYIVVAAVWLYNLTVD
FT                   SGRDEDVRSVFSAVGKGDIRIQALLLGFSFCGLLEGLAGFGAPVAIVAAMIVSLRIDPI
FT                   KAALVTMVGNAINVGFGAMAIPVTTAGKIGGVSGAQVANTASSLTPWIIVLVPFLLLLI
FT                   LDGARGIRQLWHVALLQGIVTAIGHFVAAHYVSYELTAVFASLLGFAVVAGALVLLTPT
FT                   TPEEWRSESSAEGVPNAGRITLALMPYWLVVVIFAIAKLWTIGVNIPETLAKTTIPVEW
FT                   PGLYGSLLTHTGEPSTGAILNVQTLSNPGTMIVLTALIVSLVYGINSTERFTFSFGRGF
FT                   AVLFNTIHALRWSLLTIALVMALAYVMNFSGQTAAIGAALAATGAAFAFLSPILGWIGT
FT                   AVTGSATSANALFASLQSTAAAGANLDPNVLLSANTIGGGLGKIVSPQNLAIAATAINK
FT                   PGSEAEILRKAAPFSGTLLLILCVLTFLATQGIVPIVQ"
FT   gene            31039..31827
FT                   /locus_tag="Arch_0020"
FT   CDS_pept        31039..31827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0020"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="COGs: COG0247 Fe-S oxidoreductase; InterPro
FT                   IPR004017; KEGG: xce:Xcel_0891 protein of unknown function
FT                   DUF224 cysteine-rich region domain protein; PFAM: protein
FT                   of unknown function DUF224 cysteine-rich region domain
FT                   protein; SPTR: C0W209 (S)-2-hydroxy-acid oxidase; PFAM:
FT                   Cysteine-rich domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91788"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLI9"
FT                   /protein_id="ADH91788.1"
FT                   /translation="MKVALFATCIADAMFPQAPQATMHLLKRLGVEVFFPESQACCGQM
FT                   HINTGYYPEAMPLIKNHVKTFEPVLDGEWDAIVVPSGSCTGSIREQQEMVANTLDDHPL
FT                   AVKAAAIAEKTFELSEFLIDVLGTDDVGAYFAHRVTYHPTCHSIRVAKVGDKPLQLLRK
FT                   VGGIDLVDLPSAESCCGFGGTFSLKNHETSASMLTDKMNNIIATKADVLVAGDYSCLMN
FT                   IAGGLSRNRAGIRAMHLAEVLAGTQDEPWSAPETTTKAGV"
FT   gene            31827..33353
FT                   /locus_tag="Arch_0021"
FT   CDS_pept        31827..33353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0021"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /note="COGs: COG1139 conserved hypothetical protein
FT                   containing a ferredoxin-like domain;
FT                   InterProIPR003741:IPR012285:IPR004452:IPR009051:IPR 017900;
FT                   KEGG: nml:Namu_1033 iron-sulfur cluster binding protein;
FT                   PFAM: protein of unknown function DUF162; SPTR: D0WLY3
FT                   Iron-sulfur cluster-binding protein; TIGRFAM: iron-sulfur
FT                   cluster binding protein; PFAM: Domain of unknown function
FT                   (DUF3390); Uncharacterised ACR, YkgG family COG1556;
FT                   TIGRFAM: 2[4Fe-4S] protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91789"
FT                   /db_xref="GOA:D7BLJ0"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLJ0"
FT                   /protein_id="ADH91789.1"
FT                   /translation="MGTFLGIPKFGKRHNEQWVNGDPLPEHTLDWGTAFPQGAAVTLRD
FT                   NQLRKNLRHATTVIRNKRAQRVEEMPDWQALRDAGSAIKHKTMSNLPQLLAQMEENVTK
FT                   RGGIVHWARDKEEANKIILEILREKNAEEVIKVKSMVTQEINLNEALEKEGIVAHETDL
FT                   AEMIVQLGKDMPSHIVVPAIHRNRAEVREIFNREMKDLPAPIETTEPRVLAMAARAHLR
FT                   ELFLKTKVAISGSNMMIAETGTLSVFESEGNGRMCLTLPETLISVVGIEKMVPTFQDAE
FT                   VFAQLLPRSSTGERMNPYTSMWTGVTPGDGPQEFHLVLLDNGRTKVLADEIGRQALHCI
FT                   RCAACMNACPVYEHVGGHAYNSVYPGPIGAILTPQLLGAMDHHDPASSLPYASSLCGAC
FT                   YEVCPVKINIPEVLVDLRHRITEANRGGIPDIWDVSMKAASKVMGNGKVWAAATKGVKA
FT                   GRTVAGKDRKIHNVPLPIAKRWTMVRDVPAPPAQTFREWLKEEQKKETEK"
FT   gene            33350..34003
FT                   /locus_tag="Arch_0022"
FT   CDS_pept        33350..34003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0022"
FT                   /product="protein of unknown function DUF162"
FT                   /note="COGs: COG1556 conserved hypothetical protein;
FT                   InterPro IPR003741; KEGG: nml:Namu_5228 protein of unknown
FT                   function DUF162; PFAM: protein of unknown function DUF162;
FT                   SPTR: A7BE65 Putative uncharacterized protein; PFAM:
FT                   Uncharacterised ACR, YkgG family COG1556"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91790"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLJ1"
FT                   /protein_id="ADH91790.1"
FT                   /translation="MSSARDEIMQRINDALAASQREPAPEPPREYIREGEFAPGAPEVI
FT                   DDLIEKLVDYTAVVVTTDEAGIPDAIDKYLEDVSSVVVPHGLNDEWKAAAGRNGRSVSE
FT                   DSREKALGNYDLDKIDAVVTASRVAISMSGTIVLDGEPDQGRRAITLVPDTHVIVLRAK
FT                   DVYPTVPQAVSVLNENPTRPITWIAGPSATSDIELVRVDGVHGPRNLRVIIVTD"
FT   gene            34762..37215
FT                   /locus_tag="Arch_0023"
FT   CDS_pept        34762..37215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0023"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="InterPro IPR008454:IPR019931; KEGG: car:cauri_0187
FT                   surface-anchored fimbrial subunit; PFAM: Cna B domain
FT                   protein; SPTR: A7BA22 Putative uncharacterized protein;
FT                   TIGRFAM: LPXTG-motif cell wall anchor domain protein; PFAM:
FT                   Cna protein B-type domain; TIGRFAM: LPXTG-motif cell wall
FT                   anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91791"
FT                   /db_xref="GOA:D7BLJ2"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLJ2"
FT                   /protein_id="ADH91791.1"
FT                   /translation="MAMRVQHPGKTTSFRRSVTSFLGAALLFGLGGLVPAYAANGTSGA
FT                   AEAPAPGAKIMATPETLPNQNGKNLPEIEIGEVTGQLVGHTTKGHPELDAGNKIRFGVA
FT                   TTQGGQAIPSGETRDMISTGKSPEVKSGENKTALVSHGQPFQVIPKKEDENYFLKLGSS
FT                   MEYELEHNKTYIFERYSGQTTIRSAGTSNRFQLTEAQSDLVSRIKNLDVRQYVFYAGAW
FT                   YPLRTSLYPPYTRLNPNERIEDKGIHYLPKKIKMGQLGDGYNIGNGHSVLAFKPIANEY
FT                   KVKPGEKFPIGMFTHYNNRVTIVSGAPGVFLGNIKVGILGQTFSFPYTLTETDNGNDST
FT                   ADEADDTLSFDKETNLEKKITVGNVEYTLRLHGFSQANGHKCENKIDDSQIDKPLKTKE
FT                   NQQTSGCLWASLEQVRTLQISKELVNGPESENKNEFSFGIDSRDVTFKDPEKDLQNLKA
FT                   KPTTTGKGGRAKVFTTPAKFVVGKELSIEEKDLPANWKLDSAKCYEGSDKDEKKPLMGV
FT                   TLKNTKLTLPANLYAKTTEDLPITCVFTNKYDSPKAKLTLKKEVKNEFGGQGVLDEKSW
FT                   SGKLTAQRVDNSEGKPTVHSGAFEFKDGKWQKQEIDPGKYELKEETLNGYAFESLVCKD
FT                   AKKPEKSAESPIELVTAGDKHFIDLKPGQDVECTFTNKQIPGEITWEKVDAEAKEKLLE
FT                   GSEWTLVRKGGTDKDKITVVENSEKDTEKTNGKFHVKNLAWGEWELVETKAPFGYLIDA
FT                   SQKKTITIGPDKTQQNLGKIENKKAHTPVIPLTGGMGTQSIVLGGLFLLGIAGFAVIRS
FT                   RRAHA"
FT   sig_peptide     34762..34875
FT                   /locus_tag="Arch_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            37240..38715
FT                   /locus_tag="Arch_0024"
FT   CDS_pept        37240..38715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0024"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="InterPro IPR001899:IPR019931; KEGG: cur:cur_1898
FT                   putative surface-anchored protein (fimbrial subunit); SPTR:
FT                   C2BJ18 Fimbrial subunit; TIGRFAM: LPXTG-motif cell wall
FT                   anchor domain protein; TIGRFAM: LPXTG-motif cell wall
FT                   anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91792"
FT                   /db_xref="GOA:D7BLJ3"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLJ3"
FT                   /protein_id="ADH91792.1"
FT                   /translation="MTKKIFRKTAIAIAIALVGVSTSGALAAGAENKGNDDVRVENIGT
FT                   YKRGSVTVFKKGAENDEAAKTGDPKDKKPLQGITFKIEKIKDIDLTKVKGWKDVAKLTA
FT                   ADVKPERLDTEKAESAVTNYEGKAKFGRLPLGAYLVTETSIGKQFVKSKAEPFIVTIPR
FT                   PKADNMPLGTPEKIDGWEYDVVAYPKNVLSEQTQFSKKAVAVDGLEKKTEVEQTGVVKS
FT                   DKAGAKVTWELAYDIPDLAEYTELTLVDTLPAGATHVTESLVLDSVMLLRSDYERTEAD
FT                   GKVTFKFTSSGLAKLKAGMKLTAKIETTHVDATGNVDNSGELTINGNKFTSKDSVYFQK
FT                   FEVTKQDATSQQRLAGAKFDIYDDVNRNKKLDSADRKIGSFVTPKGGVKEMNVYLGRGD
FT                   SESVYRTILLKETEAPAGYLLPSDAVTVVELAAMGEPATAKVAIDNYKPLVPGLPLTGA
FT                   SGIVAMSAIGVGLLGLGAFAVRQSRKARQGVED"
FT   sig_peptide     37240..37329
FT                   /locus_tag="Arch_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            38911..40626
FT                   /locus_tag="Arch_0025"
FT   CDS_pept        38911..40626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0025"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="COGs: COG0737 5'-nucleotidase/2' 3'-cyclic
FT                   phosphodiesterase and related esterase; InterPro
FT                   IPR008334:IPR006179; KEGG: mxa:MXAN_5361 putative
FT                   5'-nucleotidase; PFAM: 5'-Nucleotidase domain protein;
FT                   SPTR: A8TK86 5'-Nucleotidase; PFAM: 5'-nucleotidase,
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91793"
FT                   /db_xref="GOA:D7BLJ4"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLJ4"
FT                   /protein_id="ADH91793.1"
FT                   /translation="MKGVRVTAACGAAVLASLGVLPVAAAEGSEAPAPVSAPNPASTPE
FT                   ASILFFQDGHDAMPVNQGKKDAPNFHGGAARLATVVKDQRADGVPSDLVFGGDLGGGTL
FT                   FGAVFHGEAMVDLFNKIGVDLAGFGQHDFDYGVEQTRKNVADSRFPWVSSNLTVAGHPF
FT                   NGAENITAVRTVGGLKIGYIGLTAGMDTTSVSGQVMEEDYVSAAKSAVVRLGEVDIVVA
FT                   LAQFPKAADATKLLQEVPQISVVLREENEAKQEGNDVTMLPDGRFAVAPEGNYGSVARI
FT                   DFVRGADGHVVAKHREVQVDGTVAEDPAIAQVAGEYQDKLDARLAQQVGCSERALAKPT
FT                   ELGHVAAEAFRRVADADFGWVNAGGVRADLPAGPVTMKDVWAVFPYGNKVMKIEATGAQ
FT                   LRAALEQGADSVPEGNSAGYPLVAGFDFVYDAGAPAGAKISGLVRADGSEIKDADRVVL
FT                   AVTNYVVNGGNKVEAFKGARVLAGEGTLDTDFEALEKFLTTTQCGNPAPSPSPETSLSP
FT                   APVLSPAPGATGSDSRKVAPGALANTGSSVLWVCGVAGVALMIGVVLRRKVKVN"
FT   sig_peptide     38911..38985
FT                   /locus_tag="Arch_0025"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            40803..43460
FT                   /locus_tag="Arch_0026"
FT   CDS_pept        40803..43460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0026"
FT                   /product="Exo-alpha-sialidase"
FT                   /EC_number="3.2.1.18"
FT                   /note="COGs: COG4409 Neuraminidase (sialidase); InterPro
FT                   IPR011040; KEGG: pac:PPA1560 sialidase precursor; PRIAM:
FT                   Exo-alpha-sialidase; SPTR: Q44562 Sialidase; PFAM:
FT                   BNR/Asp-box repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91794"
FT                   /db_xref="GOA:D7BLJ5"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR026856"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLJ5"
FT                   /protein_id="ADH91794.1"
FT                   /translation="MKYQHIRKAVLAGIASSTLVFSGLAMAPLGHAADAEAPHPEAATA
FT                   APASEETLGTAEAVNLPAKEGLKPQPSAQIGLGFSDITEPIAIQENVEGINYRIPAITA
FT                   TPKGDLIAAFDERPLSSEKASWTQLFGRRHWKNGGDSPNPNSIVQYRSVDNGKSWQKEN
FT                   NICDGTVTSDMEKISGCSDPSYVVDWDTGKIFNFHVRSYRAGLHESKSGNDAASHDVVQ
FT                   VEISESIDDGKTWNSRIITKNVTPDGNVKWRFATSGQGIQLTHRSHKGWLIQQFTLGQG
FT                   EPGTKQEAFSFISKDGGTTWNAGDAVGADMDENKVVELSDGRLLLTSRHKNGKRLGKRI
FT                   QAFSKNGGFSWERESVMPDVVDHGTNGQILKVFPGIPSEDPRSKVLLFANSTSNIGDND
FT                   RHNGTVWLSCNDGENWTSKEFNKGSTGYVTITTQHDGRIGMLSEDGKNGKKEHGIYYRS
FT                   FGLDWVGTCPGVKEAIELDKAKADLEKAKSEKAKLEKQVAKQAEGLEKLQQNLEKAENK
FT                   AVALQENVDKLALDIKAKTEALDELKADSETTRAEKARLQKEFDSINAKLEVAKAEKQR
FT                   VASDLAVKEAKLTESEKQKAAAEKKVAEQHKQIEDLNAKVKKAESERDQATESAKNLEE
FT                   KAKEDAKSIEGLEGNLSEFADENDALRSKINKLTKENTDLKAQLEKVKKELEEAKKVPQ
FT                   DDVKPKPAPQPAPQPEPAPEVKGVTPHVDGITPDASDPAACMVTPYVKVSPVEGVTYEV
FT                   TVDGQVISPTKDDLFTYEYLYGKTVKVNAILKDGFTLAKGAKTTWSWTAPNRDELKCDT
FT                   PARPVDPTPVPPGEDPSPQVKDVPQDKVDTKITADTKAESKGLAKTGLSLGIITVLAAL
FT                   CIIGGTTATRRRHD"
FT   sig_peptide     40803..40898
FT                   /locus_tag="Arch_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            43596..43865
FT                   /pseudo
FT                   /locus_tag="Arch_0027"
FT   gene            44099..45943
FT                   /locus_tag="Arch_0028"
FT   CDS_pept        44099..45943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0028"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="COGs: COG1292 Choline-glycine betaine transporter;
FT                   InterPro IPR000060:IPR018093; KEGG: cgt:cgR_1005
FT                   hypothetical protein; PFAM: BCCT transporter; SPTR: C8NW06
FT                   BCCT family osmoprotectant transporter; TIGRFAM:
FT                   choline/carnitine/betaine transporter; PFAM: BCCT family
FT                   transporter; TIGRFAM: choline/carnitine/betaine transport"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91795"
FT                   /db_xref="GOA:D7BLJ6"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLJ6"
FT                   /protein_id="ADH91795.1"
FT                   /translation="MDSNDRPDSNVEEKTENKPLDATSSATSALAAILSVEQHINAADI
FT                   QEKPVELASETEDTTIAWSVVVPAMILVLGTVVWGLCAPENFSTASSAAFAWVLNNLGW
FT                   AFVLFTTIFVAFVIFIAVSKFGTIRLGAAEEQPEFSNSSWIAMMFAAGMGIGLMFYGAS
FT                   EPLAFYRDGVPGHNPHEVGTAMATAMFHWTLHPWAMYAIVGLAIGYSTYRVGRRQLISA
FT                   AFTPLIGEKHANGFVGKTIDALSIFATVFGTACSLGLGALQIRAGLKAAGFVENPDTGL
FT                   IVTIVSVLTLAFLVSAMSGVGKGIRILSNVNMVFAASLAVFVFAFGPMIVQLNLLPTSL
FT                   GAYASQFFEMAGRTASSVDGTAGEWISSWTIFYWAWWISWSPFVGMFIARISRGRTIRE
FT                   FCTGVLLVPAGLSTIWFAIFGGTAISMEQGGNSIYADGASEAQLFNLLHSLPGGFVMGI
FT                   VAVLLLATFFITSADSASTVMGSLSQGGRSTATPWLTGAWGLVTALIGLTLLVSGGDKA
FT                   LNSIQSVTIVAATPFLFVVVALMFAIVKDLRGDVIYLDQREQERFNRQLAVERRHHRER
FT                   EEIRRAKKRMARMAHASGAGAAKPKVKANPKAKANPKA"
FT   sig_peptide     44099..44224
FT                   /locus_tag="Arch_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            46249..47247
FT                   /locus_tag="Arch_0029"
FT   CDS_pept        46249..47247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0029"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="COGs: COG2962 permease; InterPro
FT                   IPR000620:IPR004626; KEGG: pfl:PFL_3385 RarD protein; PFAM:
FT                   protein of unknown function DUF6 transmembrane; SPTR:
FT                   C0W1I2 DMT superfamily drug/metabolite transporter;
FT                   TIGRFAM: RarD protein, DMT superfamily transporter; PFAM:
FT                   EamA-like transporter family; TIGRFAM: ATP synthase subunit
FT                   6 (eukaryotes),also subunit A (prokaryotes); rarD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91796"
FT                   /db_xref="GOA:D7BLJ7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLJ7"
FT                   /protein_id="ADH91796.1"
FT                   /translation="MSNRGVVISLLSSVAFAMFSYIAALTEPLTGVELWAWRMVMTVPG
FT                   VLLVLLITKRFSWFTGEWDRVRSDPKKLIAYAFCAPMLAGQMWLFGWAPQVGRTLEVGM
FT                   GYFLMPLVMVVIGRVFYKERMTPLMMVATVIAACAVAYEAWRAGGIGWVASFIALGYPA
FT                   YFVVRRYFETDGVGALAWEMALALPVSLWVAAGSHSIQSAFSSVSLVLILLSLGALSVL
FT                   GVITYVLAVKWLSYGMFGLLSYVEPVLVIIVAILLGERIDPTQWWTYVGIWLSVFLLGV
FT                   DGVIALSKRVRWSVPAVRPWRRRRPRHPRTEPDSWARFFRTRKGELVEKPR"
FT   sig_peptide     46249..46326
FT                   /locus_tag="Arch_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            47504..49942
FT                   /locus_tag="Arch_0030"
FT   CDS_pept        47504..49942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: car:cauri_0187 surface-anchored fimbrial
FT                   subunit; SPTR: C1RFM0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91797"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLJ8"
FT                   /protein_id="ADH91797.1"
FT                   /translation="MVMLAVGSLTALTLAGVALAAPVVDGEGNTAAPEIVDIAEKSADL
FT                   TPTVGSTSEGKKSGFTCGVGEVYSLRGDGRITKINYGENSNISRSNVPDLPVAVDDEAN
FT                   QYYNGLGISPKGDVAWAYRRVFADGSRYPYAKENKLILYRFEGKDWAEVGQIDLLKGDY
FT                   SRLELAANRFISGAVDEHGDFYFSTTVTMTGTNVKPGGKKGENSAAAVLVKASMSQGRF
FT                   SDSVVAVVKDLTRFYTSDGRPSNNGDIAFDSSGNMFLINAEPVSDEGGGIFELATISSD
FT                   VLDEAKAKVRHEISGNDYTLVKEVSVEPKSTINGIAFDYDGRIFVGEAISVLKTDVSSK
FT                   SEYKMRKTIEGTRKDENLLSSTDLASCGVPPTVTLKKELLGNRLDSTDQFKLSLQTGRN
FT                   KAVSVDTDGSGKTVENQVGPIPFIPGEQLAISEEMAENSVSGEDAYEAQWKCYSTVRHS
FT                   DGSVDGKKRLLSQNKGVRGTITLNLSIEAGHSSSVECTFFNKPKPKLTLVKKVDAGKSA
FT                   EMLVPEDWTLAAWQEERESRKEPVFEGKSSVKKVVNVGRYELTESPTRADDERVKRYQL
FT                   ESLVCHDQVANENLKIEHDESGNRNFIHLKYNQDVTCTFTNKLQEATLELKKVVQNNHG
FT                   GTKKPEDFELTASKQGAEQKKYSWNADSSDKTILKVIEPGDYLLSEKNLSGYKLKNLVC
FT                   ADESGKSLQDFNAKDKKLSVKPGDKISCTFTNQDLPGKVRWKKIDSESKESLIGSKWKL
FT                   TKKDSISREPVVVEQDDNGVFSVDNLEWGTWTLTETQAPFGYLIDSNSTRTFEINPEKN
FT                   "
FT   sig_peptide     47504..47581
FT                   /locus_tag="Arch_0030"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            50172..51638
FT                   /locus_tag="Arch_0031"
FT   CDS_pept        50172..51638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0031"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="InterPro IPR008454:IPR019948:IPR001899:IPR019931;
FT                   KEGG: cdi:DIP0235 putative fimbrial subunit; PFAM:
FT                   Gram-positive anchor; Cna B domain protein; SPTR: Q1G4W1
FT                   Type-2 fimbrial major subunit; TIGRFAM: LPXTG-motif cell
FT                   wall anchor domain protein; PFAM: Gram positive anchor;
FT                   TIGRFAM: LPXTG-motif cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91798"
FT                   /db_xref="GOA:D7BLJ9"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="InterPro:IPR032364"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLJ9"
FT                   /protein_id="ADH91798.1"
FT                   /translation="MSRNFKRSVALLATTTLAFVGLGVSAAVAETNSQRSSAEVVNIDK
FT                   EKEGSLTIHKKAVDKEEDIKKPNPDEKDALEGVTFEIRKINDIDLSKIEGWQKVADLKA
FT                   EKIDLDAVEKLGLTPIKSDKTNINGEVKFDNLKIGAYLVTEKSIGSRYIKKISEPFVVT
FT                   IPQPKKDVALGSPKKTDGWNYDVVAYPKNVWSKATPLSKKATAIEGLQIGGTIDQPGIV
FT                   KNYQKGVVVTWDLEYVIPELAEYREFEISDKLPGGAKLIDADIKMDGAIPLTSYYTRTT
FT                   DNNLVKYVFTPEGLAKLKAGQKITVKVKTKLQPGNGSIKNEGNVNINGNKIPGQDIVNF
FT                   RNVELTKQDSASKEKLAGAEFDIYQDVDNDSKVTDTDRKIGQLIVPAGGVARFTTYIGR
FT                   GEAKEMNLLVKETHAPKGYLLPSDAVTPVKISSLNETDPVKIAIDNYKPIVPGLPLTGA
FT                   TGILVLTLAGGAMILLGVFAVYKARSRKAA"
FT   sig_peptide     50172..50258
FT                   /locus_tag="Arch_0031"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            51741..52616
FT                   /locus_tag="Arch_0032"
FT   CDS_pept        51741..52616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0032"
FT                   /product="sortase family protein"
FT                   /note="COGs: COG3764 Sortase (surface protein
FT                   transpeptidase); InterPro IPR005754; KEGG: cdi:DIP2225
FT                   putative fimbrial associated sortase-like protein; PFAM:
FT                   peptidase C60 sortase A and B; SPTR: C2CUX9 Sortase
FT                   (Surface protein transpeptidase); TIGRFAM: sortase family
FT                   protein; PFAM: Sortase family; TIGRFAM: LPXTG-site
FT                   transpeptidase (sortase) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91799"
FT                   /db_xref="GOA:D7BLK0"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLK0"
FT                   /protein_id="ADH91799.1"
FT                   /translation="MKKYYWKTDRWTVIAALSFLMATALLTYSPMSTWLYQYNQTAILT
FT                   GYHAAAVQQRNPSAVEQLEAANEYNKKLVSGATYHANANNAEGSAESNRQRYNELLAVG
FT                   PEAMMGRVKVPSVNIDLPIFHGTTEETLLKGVGHLEGTSLPVGGLSTRSVLTAHRGLAS
FT                   AKLFTDLVNVKKGDEIIVEVLDQALVYQIERIEVIDPEDTYKILPEENRDLLTLITCTP
FT                   LGINSQRVIVTGSRVIPTPAVHENNIGGPTDIGFPWWLVIQASAVTFTLGGLFLAGLHK
FT                   KKDAQAPMTA"
FT   gene            complement(52741..53979)
FT                   /locus_tag="Arch_0033"
FT   CDS_pept        complement(52741..53979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR013781:IPR017853; KEGG: bfa:Bfae_10930
FT                   hypothetical protein; SPTR: C7MBG8 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91800"
FT                   /db_xref="GOA:D7BLK1"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLK1"
FT                   /protein_id="ADH91800.1"
FT                   /translation="MKFGVNYTPRIDWFHSWLDFNPDHVRADLDSIAGLGIDHVRIFPL
FT                   WPVIQPNRTLIREKALDDVATVVELAHERGMNTFVDVLQGHLSSFDYLPSWVNAWHRRN
FT                   IFTDPDVISGEKALVNALATRLRDVPGASGLSLGNEFIQFAADRHPEQHKITADQAKTW
FT                   LGELLGVARDVWPEGLHVHTHDDDVWFDTGHPFGPESAVTFGDHTTVHSWVFGKVGPRF
FT                   GAGTPQLEWFSRYLCELAAAWGDAHGQVGRKVWLQEIGSPSNYVDPADSAAFLTANVER
FT                   LMGVHGGGTSPRLDAITWWCSHDVSRSLADFPELEHTLGLFDSEGAVKPIGQAYAEAIA
FT                   AWKATSPVAVGDHAMGASTSGADVPSAPEEDRPVLELELTPETRDLADANHAFFDQWME
FT                   SALDGQVPAIRVR"
FT   gene            complement(53976..57023)
FT                   /locus_tag="Arch_0034"
FT   CDS_pept        complement(53976..57023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0034"
FT                   /product="glycoside hydrolase family 38"
FT                   /note="COGs: COG0383 Alpha-mannosidase; InterPro
FT                   IPR000602:IPR015341:IPR011682:IPR011330; KEGG: pac:PPA1459
FT                   alpha-mannosidase; PFAM: glycoside hydrolase family 38;
FT                   Glycoside hydrolase family 38 central region; glycosyl
FT                   hydrolase 38 domain protein; SPTR: Q6A7Q8
FT                   Alpha-mannosidase; PFAM: Glycosyl hydrolases family 38
FT                   C-terminal domain; Glycosyl hydrolases family 38 N-terminal
FT                   domain; Alpha mannosidase, middle domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91801"
FT                   /db_xref="GOA:D7BLK2"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="InterPro:IPR041147"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLK2"
FT                   /protein_id="ADH91801.1"
FT                   /translation="MLSSERVAMDAGLLLTRVKRTLSERIARAQYTPVSQLQLETWRVP
FT                   DELVDGQEVIGEPTTPPSSAIFTPLNVGETWGKPWQTVWFNVRGTTPRTVPAGDTVEAH
FT                   IDLGWADHSAGFQSEGLVRDTAGRTIKALNPRNQWIPLPQTPETDVQFSIEAAANPLLL
FT                   EVLPFQVTMDGDKFTSSHNDMYTLAKADIVIRHTEVVGLTTDITVLYELLEAKGVAAFT
FT                   NDDFETLYVLNAALDRVDLDDIPGTAAYAREALQPILSRSALPGAHRLSAVGHAHIDSA
FT                   WLWPIRETKRKVNRTIANVVRLIEDGTGLVFALPAAQHVAWLREEDPELFERVRECVKK
FT                   GSIVPVGSMWVEPDAVLPSGEAMARQLTEGISFFREALDYECKEIWLPDSFGYSAALPQ
FT                   LAREAGIERFLTQKISWNQTNVFPHHTLQWEGIDGSRIFTHFPPADTYGSEITGAQIRH
FT                   AVENFKNKGEANCSLLPYGYGDGGGGPTREMMERLDRLEDLRGAPRIVRESPHDFFDRA
FT                   EEEFPEPPVWVGELYLELHRGTFTSQIATKQGNRRSEALLRETELWCTIAALAGAEYPY
FT                   AELRDTWRNVLLCQFHDILPGTSVAWVYREVADIYTAVKETCERLMNDAFEFLRHGRTP
FT                   VRARANATSFSSHGVVALGAEPFSGGADDRANAAESSLSNGVLTIDFAPSGACTQITDA
FT                   TGRTFIPEGQRAGEFSIFQDFPNMWDAWDIDPFYKGSEQVLPLEFVGTGMDDAVATARA
FT                   RSTFGKSEMSIEWRLAPGADFVDVHVEVEWHEREKLLKLGFPVDIHTNKAQYETQMGFI
FT                   ERPTHTNTSWDSAKFEVSTHRWVRLENAGAAWSIANDSTYGWDVSRHSSGRRGTWSLVR
FT                   ATLVKSAVYPDPHQDQGRFTWNFRIHPNASLREAIADGQQINLPLRDVPVSIAAPFTVD
FT                   GAIVESVSMAPDKSGDVVVRLYEGEGTETTATLTWPGVTVRATDLCYRESAHAPAIASH
FT                   GDTHTFQIGAFQIVTLRVTQNKENQA"
FT   sig_peptide     complement(56937..57023)
FT                   /locus_tag="Arch_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            57174..58202
FT                   /locus_tag="Arch_0035"
FT   CDS_pept        57174..58202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0035"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000843:IPR001761:IPR010982; KEGG: pac:PPA1457 LacI
FT                   family transcriptional regulator; PFAM: regulatory protein
FT                   LacI; periplasmic binding protein/LacI transcriptional
FT                   regulator; SMART: regulatory protein LacI; SPTR: Q6A7R0
FT                   Putative LacI family transcriptional regulator; PFAM:
FT                   Bacterial regulatory proteins, lacI family; family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91802"
FT                   /db_xref="GOA:D7BLK3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLK3"
FT                   /protein_id="ADH91802.1"
FT                   /translation="MSRKTIKDIAHEAGVSITAVSFALNNRPGISDATRERILAIANRM
FT                   DWVPNSRAQSLSLAKADAVGLFIARQPDSYTTERFFFNFIIGLQETLTTHNYDLVFHTG
FT                   PDLKAEISTYRTWWAQGRVDGVVVVDPIPGDPRIETLNDIGMPAVVVGTETPHTASVTG
FT                   DEAAIVTTLADHLYEQGARTIGFVTGIPDLIHTQERIRALEEYAARRGFTAIVASGTNA
FT                   TEEAGRKAIAELLAGKTQPDAIIFDNEILTLGGFNALREAGKEIGRDVLICSCEDSPLC
FT                   RIVTPAITVIDREPSVLGRKAAGLLLDVLGGQKPRIEKLDPAPILIRESTKRLGRSASA
FT                   RA"
FT   gene            58253..59203
FT                   /locus_tag="Arch_0036"
FT   CDS_pept        58253..59203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0036"
FT                   /product="PfkB domain protein"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR011611:IPR002173; KEGG: bcv:Bcav_1099
FT                   fructokinase; PFAM: PfkB domain protein; SPTR: C1RNV6 Sugar
FT                   kinase, ribokinase; PFAM: pfkB family carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91803"
FT                   /db_xref="GOA:D7BLK4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLK4"
FT                   /protein_id="ADH91803.1"
FT                   /translation="MSILIIGEAVIDIIKQTDGTTNEHPGGSPANVAIGASRLGVAPEL
FT                   LTMVGADRRGAVIREWLAQDAVHTTFVETERTATAIATLDASGASTYTFDMGWDLAGIQ
FT                   PDLAGVSHIHTGSIAAYIQPGAGDVSRIVAAGRAAGATISYDPNIRPALIDDMEAVRAQ
FT                   VLDLVRQADVVKCSDEDLGFLFERSALSRDEAIELAKNWIAEGRAAGHGPLVVAITAGK
FT                   DGVIAVNAAGENVHVAADPAVKVVDTVGAGDSFMGALVYQLSVRGLAGNRAGIAGLSVE
FT                   DLREIAEFAARVADVTVSRAGANPPRLTELTRPGI"
FT   gene            complement(59335..60612)
FT                   /locus_tag="Arch_0037"
FT   CDS_pept        complement(59335..60612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0037"
FT                   /product="N-acylglucosamine 2-epimerase"
FT                   /note="COGs: COG2942 N-acyl-D-glucosamine 2-epimerase;
FT                   InterPro IPR010819:IPR012341:IPR008928; KEGG: bcv:Bcav_0388
FT                   N-acylglucosamine 2-epimerase; PFAM: N-acylglucosamine
FT                   2-epimerase; SPTR: C0W0U9 N-acylglucosamine 2-epimerase;
FT                   PFAM: N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91804"
FT                   /db_xref="GOA:D7BLK5"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLK5"
FT                   /protein_id="ADH91804.1"
FT                   /translation="MVIDETTRTWLADEFTALVDFARKSRCEHGFSTLDANGQADPDAG
FT                   LQLWINCRMTHVFCLATLKGDESAREFAQHGIDCLRTHFYDAEFGGFFTNLRFDTNEPQ
FT                   GPDGERKAAYAHAFVLLAASSGLQAGIEGARELYDLARAAHEDHFWESRFGLARESWNR
FT                   SFTETENYRGANANMHTLEASLAAWDATADPRWLEKSASILMFVLGEAEKIGWRIPEHF
FT                   DSSWNLLKDFNKDRPADPFRPFGLTPGHGIEWARLALHFWAAIHRLAGDFAADFMEFVD
FT                   SLPAAAYSLFTVALADGWDADGAPGIVYTTDFDGEPVVHERMHWTICEGIAASAAFATY
FT                   AEQSGDQEKVAEMQLWFDTFMDYAREYLIEAPGRWIHELDQTNTPSGITWPGKPDVYHA
FT                   AQCMLMPELGLTPCFAGWHSHTSPAF"
FT   gene            61302..62435
FT                   /locus_tag="Arch_0038"
FT   CDS_pept        61302..62435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0038"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="COGs: COG1062 Zn-dependent alcohol dehydrogenase
FT                   class III; InterPro
FT                   IPR013154:IPR013149:IPR011032:IPR016040; KEGG: hypothetical
FT                   protein; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; SPTR:
FT                   D0YPM1 Alcohol dehydrogenase; PFAM: Alcohol dehydrogenase
FT                   GroES-like domain; Zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91805"
FT                   /db_xref="GOA:D7BLK6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLK6"
FT                   /protein_id="ADH91805.1"
FT                   /translation="MSAQIPATMRAAVLRDPKVGLQVEVIKTPKPRDGEVLIKVAACGM
FT                   CHSDLHVIGGKIAFPMPCVLGHEVTGEIVEVGPGNQHTGLEVGQRVAGAFLMPCGQCEF
FT                   CAEGRDDLCAPFFDMNRLKGQLYDGHTRLFGLDGEPIAMYSMGALSEYCVIPSTSVAVL
FT                   DETMDMVSGSILGCAALTGYGAVRRGANLQYGETVAVVATGGIGSNIIQVAKAFGASKI
FT                   IAVDVADDKLEAAKRLGATDVVNSSVQNVREAVFALTDGRGVDVAFEALGRPETWASAL
FT                   DSLRDGGRMVPIGLGAGVQTAAVEINRTVRRSQSILGSYGARTRQDLPTVVKMASEGCI
FT                   DYRHIVTRKFSLEEAGSGYELLSQGKIQGRAVVDMSL"
FT   gene            62830..64497
FT                   /locus_tag="Arch_0039"
FT   CDS_pept        62830..64497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0039"
FT                   /product="sugar transporter"
FT                   /note="InterPro IPR005828:IPR003663:IPR016196:IPR005829;
FT                   KEGG: pac:PPA0467 putative sugar transporter YfiG; PFAM:
FT                   General substrate transporter; SPTR: C0W6M7 MFS family
FT                   major facilitator transporter; TIGRFAM: sugar transporter;
FT                   PFAM: Sugar (and other) transporter; TIGRFAM: MFS
FT                   transporter, sugar porter (SP) family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91806"
FT                   /db_xref="GOA:D7BLK7"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLK7"
FT                   /protein_id="ADH91806.1"
FT                   /translation="MVHQDMKRVPIEGLSKNDLRQMVEETPASGKHRGVIAIAGVATLG
FT                   SLLFGYDTGVISGALPYMHMPTGAGGLGLTAAEEGAIGGVLTVGAAFGALFGGRLSDRY
FT                   GRRHNIILLAILFFIGAIGNTFAPNVWVMYPFRLILGLAVGGASATVPVYLAETAPKRI
FT                   RGTIVALDQLMIVTGQLLAFAMNAGINAAHGGPQLTVAADPSGKIEAGAYSWDALQKAI
FT                   EQATNTTDMNVIRDFAMQLSIQEGTGNGAAWRWMIVLCSIPAILLWIGMHFMPESSRWY
FT                   VLRTEVYAAIGSLKTVREGETNAAVTDELYEMVENRQKAAKQAHAKGLREVWRTPWLRK
FT                   LLLVGIFLAIVNQTTGVNTVMYYAPKVLGYAGMGTSAAISAQVANGIMSVIGSAIGLIL
FT                   ITKFSRRQILIWDVTLVGVALLSIAGIFQFAIAPYMNAGTVPPAWAAYAILGMMAFFML
FT                   VVQSSNGTVVWTMLGEMFPASVRGVMNGTAIFCMWMVNALITWTFPTMMNSLGGGLTYT
FT                   IYGVMNLVIAVILWKIMPETSNKSLEEIEVYMERKYSN"
FT   gene            complement(64556..64816)
FT                   /locus_tag="Arch_0040"
FT   CDS_pept        complement(64556..64816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpy:Cphy_0503 hypothetical protein; SPTR:
FT                   Q0CAY2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91807"
FT                   /db_xref="GOA:D7BLK8"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLK8"
FT                   /protein_id="ADH91807.1"
FT                   /translation="MTTTFAPTLNPAKVTIRTNSTSEPNAQTPATALNLTPALFILGML
FT                   FTATILAVVAQASMIAFLTGIAAAIMIPVFAFVDLYMRLQH"
FT   gene            complement(65252..66115)
FT                   /locus_tag="Arch_0041"
FT   CDS_pept        complement(65252..66115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0041"
FT                   /product="Myo-inosose-2 dehydratase"
FT                   /EC_number="4.2.1.44"
FT                   /note="COGs: COG1082 Sugar phosphate isomerase/epimerase;
FT                   InterPro IPR012307:IPR013022; KEGG: pac:PPA0468 putative
FT                   myo-inositol catabolism protein; PFAM: Xylose isomerase
FT                   domain protein TIM barrel; PRIAM: Myo-inosose-2
FT                   dehydratase; SPTR: D0YPM5 Sugar phosphate
FT                   isomerase/epimerase IolE; PFAM: Xylose isomerase-like TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91808"
FT                   /db_xref="GOA:D7BLK9"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLK9"
FT                   /protein_id="ADH91808.1"
FT                   /translation="MKIAGAPISWGVCEVPNWGYQLSPERVLTEMKEMGLTATEFGPQG
FT                   WLPQEPSERAEAVSRYGLEAVGSFFLAIMHDPDVDPIPAVEKELDAFEVAGGTNLILAA
FT                   DSGQDGYDSRPVLDETGWNTLFTNLSRITEVAAARGVTASLHPHWGTMVQNVDEVERVL
FT                   DNSQVGLCLDTGHLACGGADVLELVRRYADRVKIVHAKDIHKDMTDQLLPGAITWGQGV
FT                   KAGMFAPIGQGDIDFAAVVAELDKVGFDGYYVLEQDIMIDGEPAPGEGPILDAKKSFDA
FT                   LRALAH"
FT   gene            complement(66156..67142)
FT                   /locus_tag="Arch_0042"
FT   CDS_pept        complement(66156..67142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0042"
FT                   /product="oxidoreductase domain protein"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR000683:IPR004104:IPR016040; KEGG: pac:PPA0469
FT                   putative myo-inositol 2-dehydrogenase; PFAM: oxidoreductase
FT                   domain protein; Oxidoreductase domain; SPTR: C0W6K5
FT                   Inositol 2-dehydrogenase; PFAM: Oxidoreductase family,
FT                   NAD-binding Rossmann fold; Oxidoreductase family,
FT                   C-terminal alpha/beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91809"
FT                   /db_xref="GOA:D7BLL0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR030827"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLL0"
FT                   /protein_id="ADH91809.1"
FT                   /translation="MIRIGLVGAGRIARVHARTVEAHLNAELVFIADPVEDAVKPLAEK
FT                   YGVRYSLNPDDVFTDPAVDAVIICSPTPLHVDHILKAAKAGKPALCEKPVAMETETVTQ
FT                   LMAELEGIEHTTMLGFNRRFDPTFARMHKLVDEGVVGKVEQVTIISRDPAAPPKEYIAV
FT                   SGGIFKDMTIHDFDTARFFLGDITSVYVVGQNLDPELADTGDFDAAVITLTNSDGATAT
FT                   ITNSRHCSSGYDQRLEVFGDKATLNGENMRSHQVRVSNGEYTDAKDVYLDFFLERYEEA
FT                   YAIELNEFFAAIAENRKPATSIEDGAKALRIAEAAEESAHTGKIVYL"
FT   sig_peptide     complement(67077..67142)
FT                   /locus_tag="Arch_0042"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(67179..68258)
FT                   /locus_tag="Arch_0043"
FT   CDS_pept        complement(67179..68258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0043"
FT                   /product="Transaldolase"
FT                   /note="COGs: COG0176 Transaldolase; InterPro
FT                   IPR001585:IPR013785; KEGG: pac:PPA0454 transaldolase; PFAM:
FT                   Transaldolase; SPTR: Q6AAL0 Transaldolase; PFAM:
FT                   Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91810"
FT                   /db_xref="GOA:D7BLL1"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLL1"
FT                   /protein_id="ADH91810.1"
FT                   /translation="MSDTKHIPGPLLTACQNFDTVLWNDSSDLEELRTSISWGGVGATC
FT                   NPVIAYTTIAKHPEIWTERIQKIADDHPAWSESAIGWQAVMDMSIEAAKLLEPAFDRTN
FT                   GHDGRLSVQTDPRLHRDAEALADQAEAFHNLAKNIIVKIPATKTGIEAIELATERGVSV
FT                   NVTVSFSVPQAVEAAAAIQRGLEKREAAGHDTSQMSPVVTIMVGRLDDWLKHVVKRDKI
FT                   FVDPSALEWAGVAAVKRAYKIFQERNYRSRVLVAAFRNVLQWSEFQGGDLVVSPPFGWQ
FT                   KLINDSDYEPLERMSADVDEHYLEQLRRIPDFNRAYEVDGMNIEEFETFGPTARTLRQF
FT                   LNADNDLDILIRNILVPAQ"
FT   gene            complement(68491..69267)
FT                   /locus_tag="Arch_0044"
FT   CDS_pept        complement(68491..69267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0044"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011663:IPR011991; KEGG: msm:MSMEG_4659
FT                   GntR-family protein transcriptional regulator; PFAM: UbiC
FT                   transcription regulator-associated domain protein;
FT                   regulatory protein GntR HTH; SMART: regulatory protein GntR
FT                   HTH; SPTR: C2KTD8 Transcriptional regulator; PFAM:
FT                   Bacterial regulatory proteins, gntR family; UTRA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91811"
FT                   /db_xref="GOA:D7BLL2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLL2"
FT                   /protein_id="ADH91811.1"
FT                   /translation="MEDTEKDASLDSPFILNVKLNRNSAEPLYQQILMPISQLIKSGKL
FT                   KPNQLLEDEISMAHRLDISRPTARRALQELVDSGLLVRRRGVGTRVTPSHVHRQLALTS
FT                   LNDDLLKAGHSTRTEVLKYQIHLATAEEVEFLSCEPDEELVTIQRLRWIDDRPLAILNN
FT                   TIPSRIAPTLTELSHYGLYESFGHNNITPVSALQTLGAKNASRAEADMLNIEPNMALFT
FT                   MQRTAYDASGKVIEHGNHVYDAQQYKMTFPLVTPLN"
FT   gene            69438..70427
FT                   /locus_tag="Arch_0045"
FT   CDS_pept        69438..70427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0045"
FT                   /product="PfkB domain protein"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR011611:IPR002139; KEGG: rer:RER_20210
FT                   5-dehydro-2-deoxygluconokinase; PFAM: PfkB domain protein;
FT                   SPTR: C0W6K8 Possible 5-dehydro-2-deoxygluconokinase; PFAM:
FT                   pfkB family carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91812"
FT                   /db_xref="GOA:D7BLL3"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR023314"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030830"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLL3"
FT                   /protein_id="ADH91812.1"
FT                   /translation="MTRESQYPEVITMGRSGVDIYPLQAGVGLEAVETFGKFLGGSPTN
FT                   VAVAAARMGHSAAVITGVGDDPFGRFVCQEMRRLGVSDEYVITTDSYKTPVTFCEIFPP
FT                   DTFPLYFYREPSAPDLQIREEDLPCEAIKQARVFSLSGTGLSDEPSRSAHWAALRARKE
FT                   STGWTIADLDYRPMFWDCEETATEQIGSMLEYVNVAVGNKEECRIAVGETEPDRAADAL
FT                   LERGVTLAIVKQGPKGTLAKTREQRIEVPVTHVDTLNGLGAGDAFGGALSHALLTGWDF
FT                   PKAIHFASTAGAIVSSRLECSTAMASEEEVLDLMNQRPETNPRVQELP"
FT   gene            70424..71287
FT                   /locus_tag="Arch_0046"
FT   CDS_pept        70424..71287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sro:Sros_5538 hypothetical protein; SPTR:
FT                   D0YPL4 Deoxyribose-phosphate aldolase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91813"
FT                   /db_xref="GOA:D7BLL4"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLL4"
FT                   /protein_id="ADH91813.1"
FT                   /translation="MMTINELAQIRLHSPEVIEKKLVERVPGTYPNGRKLMIIACDHPA
FT                   RGALGAGKDPNAMANRKELLARCQEALSRPGVDGFLGSADMIEDLTLLGALEGKLVFGS
FT                   MNRTGLQGSSFEIDDRFGCYTPDAIERHRLDGGKTLTRICFEDANTPRTLEATANAVNE
FT                   LARRKKIAMIEPFISTWNDGRTVNDLSPEAVIKSITIASALGDTSAYTWLKLPYVNDME
FT                   RVMSSTTLPSLILGGEVSQDPDTALSGWAKAMTLPNVCGLVIGRSLLFPPDGDVQKAVD
FT                   NAVELL"
FT   gene            71284..72180
FT                   /locus_tag="Arch_0047"
FT   CDS_pept        71284..72180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0047"
FT                   /product="Myo-inositol catabolism IolB domain protein"
FT                   /note="COGs: COG3718 Uncharacterized protein involved in
FT                   inositol metabolism; InterPro IPR010669:IPR011051; KEGG:
FT                   rop:ROP_10680 5-deoxy-glucuronate isomerase; PFAM:
FT                   Myo-inositol catabolism IolB domain protein; SPTR: D0YPL3
FT                   5-deoxy-glucuronate isomerase; PFAM: KduI/IolB family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91814"
FT                   /db_xref="GOA:D7BLL5"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR024203"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLL5"
FT                   /protein_id="ADH91814.1"
FT                   /translation="MNDNDKYVLPAGSTAREQFDTYITAKQAGWEFSSLRIARLEQGES
FT                   VELDTGDDEVLVLPLSGSIDVVVDETSYTLAGRESVFTSVTDYIYVPRGKNVTLIARTS
FT                   GRFAVPGARATRDLPVRYCPASEVNSGLRGAGVCSRQVNNYALGNDVETSHLLVTEVLT
FT                   PGGNWSSYPPHKHDEHNENERVLEEIYYFELRKGGPERATDGFGLQRVYPSAGKEIDVC
FT                   TEVRSGDTVVVPFGYHGPSVAAPGHDMYYLNVMAGPAEDSVWMMTDDPVHTWQRQSWEG
FT                   EDVDPRLPFMPLTKEKL"
FT   gene            72177..74060
FT                   /locus_tag="Arch_0048"
FT   CDS_pept        72177..74060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0048"
FT                   /product="thiamine pyrophosphate protein central region"
FT                   /note="COGs: COG3962 Acetolactate synthase; InterPro
FT                   IPR012001:IPR012000:IPR011766; KEGG: pac:PPA0459 thiamine
FT                   pyrophosphate-requiring enzyme, putative acetolactate
FT                   synthase; PFAM: thiamine pyrophosphate protein central
FT                   region; thiamine pyrophosphate protein TPP binding domain
FT                   protein; thiamine pyrophosphate protein domain protein
FT                   TPP-binding; SPTR: D0YPL2
FT                   3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase; PFAM:
FT                   Thiamine pyrophosphate enzyme, central domain; Thiamine
FT                   pyrophosphate enzyme, N-terminal TPP binding domain;
FT                   Thiamine pyrophosphate enzyme, C-terminal TPP binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91815"
FT                   /db_xref="GOA:D7BLL6"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR030817"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLL6"
FT                   /protein_id="ADH91815.1"
FT                   /translation="MTTVRLTVGQATIRFLVNQYVESDGHEDRLIAGAFGIFGHGNVAG
FT                   LGQALLQNEIDPEPDGGSMPYYMPRNEQGMVNAAAAYAKAKNRTQTLMCTSSIGPGALN
FT                   MVTGAALATTNRVPVLLFPSDQFATRVPDPVLQQIENAQTLDTSVNDAFRPVSVFFDRI
FT                   NRPEQLLPSLMQAMRALTDPADTGAVTIAMPQDVQAEAFDFPQEAFAKRVWHIRRPPAE
FT                   KSQLEIAAEKIRAAKAPLVIAGGGVIYSKASEELREFARVTGIPVADTQAGKGAINCDH
FT                   PQSVGGVGSTGGDSANHLADEADLIIGIGTRYSDFTTASRTQFKNPDVSFININVKAFD
FT                   AVKNGAQMVVADAREALADLTTMLADYHVSDEYAAKVDSERTAWLKIVDELTHIGHGPL
FT                   PAQIEVFGALNEMMGDNDILINAAGSMPGDLQALWQAKTPVQYHVEYAFSTMGYEIPAG
FT                   IGVKMACPESEVVSIVGDGTYQMLPMELATVAQEGLKVIYVLLENHGFASIGALSESRG
FT                   SQRFGTRYRMGGHPHNEEGELIPVDIAKNAESWGLTVLRVKSIADFKEAYRQAADMTSA
FT                   VMIYIETDLYGPNPPSSSYWDVPVAQVSRLESTQQAYLDYREGVKPQRHYF"
FT   sig_peptide     72177..72245
FT                   /locus_tag="Arch_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            74258..75751
FT                   /locus_tag="Arch_0049"
FT   CDS_pept        74258..75751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0049"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.27"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterPro IPR015590:IPR016162:IPR010061:IPR016161; KEGG:
FT                   pac:PPA0461 methylmalonic acid semialdehyde dehydrogenase;
FT                   PFAM: Aldehyde Dehydrogenase; SPTR: C0W6L2
FT                   Methylmalonate-semialdehyde dehydrogenase (Acylating);
FT                   TIGRFAM: methylmalonate-semialdehyde dehydrogenase; PFAM:
FT                   Aldehyde dehydrogenase family; TIGRFAM: methylmalonic acid
FT                   semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91816"
FT                   /db_xref="GOA:D7BLL7"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLL7"
FT                   /protein_id="ADH91816.1"
FT                   /translation="MENLTQWVAGEPYIGSPEKYADVENPATGTVENRIALASEEDLNH
FT                   VVAVAQKAQKEWAKTSLAQRVAIMFNMRQLVLDHQDDIARAIVAEHGKDYSDAIGEIQR
FT                   GRETLDFACSINTALKGNYSFDVSRGVDVHTIRQPVGVVAGICPFNFPVMVPMWMHPIA
FT                   LATGNAFILKPATTTPSASLIIARLYKEAGLPDGLFNVLSGSRTTVTRILEHPGIDAIS
FT                   FVGSTPVAHIIQEVGTKNGKRVQALGGANNHAIVMPDADLDFAAQHISAAAFGAAGERC
FT                   MALPAVVAVGGIGAKLAEKIKKHAEKIHVGMGLDDGVQMGPVIDRAAKERIVGLIDDAE
FT                   ARGATVVLDGRNITVPGYENGHFVGPTILTGVGYDADIYREEIFGPVLTIHDAESYDEA
FT                   IDVVNKQPFGNGSAIFTNDGGMARRFQLDVEAGMVGVNVPIPTPVAYYSFGGWKESLLG
FT                   DHHIHGPEGVNFYTKAKVITTRWPSEQSYDATMSFQREE"
FT   gene            complement(75960..77477)
FT                   /locus_tag="Arch_0050"
FT   CDS_pept        complement(75960..77477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0050"
FT                   /product="Microcystin LR degradation protein MlrC"
FT                   /note="COGs: COG5476 conserved hypothetical protein;
FT                   InterPro IPR015995:IPR010799:IPR009197; KEGG: pac:PPA2061
FT                   hypothetical protein; PFAM: Microcystin LR degradation
FT                   protein MlrC-like; MlrC domain protein; SPTR: Q6A639
FT                   Conserved protein; PFAM: MlrC C-terminus; Protein of
FT                   unknown function (DUF1485)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91817"
FT                   /db_xref="InterPro:IPR009197"
FT                   /db_xref="InterPro:IPR010799"
FT                   /db_xref="InterPro:IPR015995"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLL8"
FT                   /protein_id="ADH91817.1"
FT                   /translation="MRIAICGIHIESSTFTPYLSVESDFTVRRGEELLERYPFITESDI
FT                   PLIDRVPENLAGAEWGVTGHREWTDGVEWVPILHASALPGGPIDPPAFLAWRREICERL
FT                   AEAGPLDAIFFDIHGAMSVPGFDDAEGYLIDGIRMAIGPDLLVGACMDLHGNVSHKLFE
FT                   QTDMLTCYRMAPHEDAWVTRERAARTLVERVRSGKGRPKKSLVHVPILLPGEKTSTRMQ
FT                   PAARLYDAVAEFADHTDGVIDASFWIGFAWADQPRCSAAFAAYGDDQAVLDAGMMRFAR
FT                   AAWEARHEFVFVAPVDEIDVAVTKAIESDKRPFFISDSGDNPGAGGANDVTVALAEVLK
FT                   RPEVVRGDVSVIVASIFDPAAVAMAAGAGIGADVTVSVGGKVDTRDPGPVTITARVDNL
FT                   VDDPAGLLTAVLAVGGLRLIVTTRRNQYTMREQFTRLGLEPELTDIVIVKIGYLEPYLH
FT                   DIHADWILALTPGGVDQNLVRLGHSHIERPMFPFDDPENVELEVVRR"
FT   gene            complement(77503..78672)
FT                   /locus_tag="Arch_0051"
FT   CDS_pept        complement(77503..78672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0051"
FT                   /product="ROK family protein"
FT                   /note="COGs: COG1940 Transcriptional regulator/sugar
FT                   kinase; InterPro IPR000600; KEGG: pac:PPA2062 ROK family
FT                   transcriptional regulator; PFAM: ROK family protein; SPTR:
FT                   Q6A638 Transcriptional regulator, ROK family; PFAM: ROK
FT                   family; IclR helix-turn-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91818"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLL9"
FT                   /protein_id="ADH91818.1"
FT                   /translation="METITLNSIAAPSSSSLTDARSNDSILLAELSHGPQSRTDLAQKT
FT                   GLPRSTVHACIRRLIANNEVEEFQLASSTGGRRAALIRISPLRDIADVVELGSHHARLG
FT                   IVDLFGNVRATTNIPLNIADGPEATITTLYNGWAQLHKEHPTIPQASVIGAAVPGPVNA
FT                   QGHVISAARMPGWNNTNLATLLADATGRPVVVENDARAAAVGEWAKRGETTESAIYIKA
FT                   GAGIGASWIADGIVFRGHQGFAGELTHTRVETLNPILCSCGNTGCLETVASGAAMLRHL
FT                   ASIGSPITTTAELIEAAQTGDYTVAPLVRNAGAHIGEALSGLVNFLNPQHIIIGGSLSQ
FT                   TRTLIAGIRSELYQRCLPLSTANLTVDTAISGPDAPLIGLAILARQKTM"
FT   gene            78859..80667
FT                   /locus_tag="Arch_0052"
FT   CDS_pept        78859..80667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0052"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="COGs: COG0747 ABC-type dipeptide transport system
FT                   periplasmic component; InterPro IPR000914; KEGG:
FT                   pac:PPA2063 putative peptide-binding transport protein;
FT                   PFAM: extracellular solute-binding protein family 5; SPTR:
FT                   C0W0N7 Peptide-binding transport protein; PFAM: Bacterial
FT                   extracellular solute-binding proteins, family 5 Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91819"
FT                   /db_xref="GOA:D7BLM0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLM0"
FT                   /protein_id="ADH91819.1"
FT                   /translation="MRSFSRVAKVAAFASAMLLVASCSGQPTANTPSNNGSVAPTGDIQ
FT                   EGGEATIALRTPTWIFPISAPGKTQGENGIFITMLYKSFFDYKLDTDNKFNLDKRSLAE
FT                   DPVVSDDGLTYTLKMKPAKWSDGKEITTRDVEFWWNILNANKEQWSGYRKGNFPDNVAE
FT                   FKIIDDRTVSFTTKELFNPGWFVDNQLSSVKPLPQHVWGKTSPDGEIGDHDRTPEGAQA
FT                   IFTMLTEASKDLQSYGTNPLWQVVSGPFKIESFVPNGEVKMVANKAYEGADKPHLDSIT
FT                   FRPFTSDDAQFNVLRSGGIDHGYIPAGSINQRSAIEGKGYSVEPWAGWSITYMPFNFAN
FT                   PKSGPIFQQKYVRQAMQMLIDQEAIAKTVWAGTATPTCGPVPQKPGTAGSTEGCAYKFD
FT                   PAKAKKLLESHGWKINGGGTSVCEKPGSGDGKCGDGIDKGAELRFKMISQSGFPATTRM
FT                   MTEINSRFSEVGIKLDIQEVPDSVAVSQKCKPNEACDWDLSFFGSQSSWYYPVYASGER
FT                   LFQTDAPVNLGSYSNPDADKLIEASLRAKDTSALKEYNDFLAEDLPVLWMPNPVAQISA
FT                   WKKDIAGISPQDPMLGLFPQDWAHTK"
FT   sig_peptide     78859..78951
FT                   /locus_tag="Arch_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            80747..81709
FT                   /locus_tag="Arch_0053"
FT   CDS_pept        80747..81709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0053"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: pac:PPA2064 dipeptide transport system permease
FT                   protein DppB; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: Q6A636 Dipeptide
FT                   transport system permease protein DppB; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91820"
FT                   /db_xref="GOA:D7BLM1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLM1"
FT                   /protein_id="ADH91820.1"
FT                   /translation="MVRYISRRLLQSFVVVLLVTVITFTILHMLPGGAARSALGLQATQ
FT                   EQLDAYAHQMGYDRPIYEQYISYLGQLIRGELGTSFALNMDVSQAIAQRLPKTMLLSFC
FT                   GLVLAVIIAIPLGMLQAWKRNRWPDYLITALALLMYSTPLFFMGLLLIVAFSQVWPILP
FT                   PEAPQGFTVSEMLADWQGLILPSVTLAIVSLAAYTRYVRSSMVDNLEENYIRTARAKGL
FT                   SESRVVMKHAMRNSLFPVITLLGMSLPGLFSGGLVVESLFNYPGMGLMYWQAAQGRDYP
FT                   ILLAVTTIISIATVIGALLADIMYAIADPRVRYGGGDAR"
FT   sig_peptide     80747..80848
FT                   /locus_tag="Arch_0053"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            81706..82563
FT                   /locus_tag="Arch_0054"
FT   CDS_pept        81706..82563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0054"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: pac:PPA2065 dipeptide transport system permease
FT                   protein DppC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: Q6A635 Dipeptide
FT                   transport system permease protein DppC; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91821"
FT                   /db_xref="GOA:D7BLM2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLM2"
FT                   /protein_id="ADH91821.1"
FT                   /translation="MSAPKNVFRQGVSVFMSNRLAVVGLSILIAFTLFSFVGPYVWVTE
FT                   QQYSSLSDAYLPLSSQHPLGTDGVGFDQLGRLMEGGKTSIIIGLAAGILATTIGTIWGA
FT                   IAGFIGGWVDSAMMRIVDAMMAVPALFLFILIASVITPNVPLLVLTIGAFAWLNPARLI
FT                   RGESLALRSREYIVAMRGMGGSPMRAVRTHIVRNAIGTVIVNATFQVADAILYVAYLSF
FT                   LGLGVPPPAANWGGMLSTGMNEVYNGHWWLLYPPGIMIIMLVVAFNFVGDGLRDAFEVR
FT                   LRSR"
FT   sig_peptide     81706..81768
FT                   /locus_tag="Arch_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            82572..84563
FT                   /locus_tag="Arch_0055"
FT   CDS_pept        82572..84563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0055"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COGs: COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component;
FT                   InterProIPR003593:IPR003439:IPR013563:IPR010066:IPR 017871;
FT                   KEGG: pac:PPA2066 ATP-binding protein of dipeptide ABC
FT                   transporter; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; SPTR: Q6A634 ATP-binding protein of
FT                   dipeptide ABC transporter; TIGRFAM: oligopeptide/dipeptide
FT                   ABC transporter, ATPase subunit; PFAM: ABC transporter;
FT                   Oligopeptide/dipeptide transporter, C-terminal region;
FT                   TIGRFAM: phosphonate C-P lyase system protein PhnK;
FT                   oligopeptide/dipeptide ABC transporter, ATP-binding
FT                   protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91822"
FT                   /db_xref="GOA:D7BLM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLM3"
FT                   /protein_id="ADH91822.1"
FT                   /translation="MTGEPLLSIDDLNVTITLRKGHVQPLRGVNLQVLPGETLGIVGES
FT                   GCGKTMTALSVMGLLPQMGKVSGGKIVFKGRDLTGLAPKEARRIRGLDIGMIFQDPLTS
FT                   LNPTMKIGDQVAEPLRVHRGVSKAEGRQAAIDVLRKVGMPRPEAIVNDYPHQLSGGMRQ
FT                   RVMIAMALICQPSLLIADEPTTALDVTIQRQILDLIDSLKKEFDTSVILVTHDLGVVAG
FT                   RADRVAVMYAGKVVEVGTTDEIFTNPQHQYTRSLMAALPENTQDSRQELYAIPGMPPSL
FT                   REDIVGCPFAPRCPRATDVCRTDAPELVAVGESAHTYSCWHPAGAPLERPTTMRPERDL
FT                   TNRPVICSIRNLTKHYPAMGGKIIRHNIGSVHAVSDVSLDVHEGETLGIVGESGCGKST
FT                   LGRVVTALEPATGGSVLIGGKDIAQASRNELKKMHRDVQMMFQDSYAAMDPRMRVDEIL
FT                   TEPLKIQKIGNARQQQERADELVEKIGIDHGAMWKYPHEFSGGQLQRIGLARSLVLEPR
FT                   LIVCDEPVSALDVSVQAQVLNVMRKLQEEHSLTYIFISHDLSVVKYISDRIAVMYLGKI
FT                   VEIGPAASVVEQPRHPYTQALIEAIPVADPHHKREEIVHLTGEPASAINPPAGCRFKNR
FT                   CPFATELCDTEPVPTGDAHSVACHYPLR"
FT   gene            84569..85471
FT                   /locus_tag="Arch_0056"
FT   CDS_pept        84569..85471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0056"
FT                   /product="ROK family protein"
FT                   /note="COGs: COG1940 Transcriptional regulator/sugar
FT                   kinase; InterPro IPR000600; KEGG: pac:PPA2359 putative
FT                   transcriptional repressor protein; PFAM: ROK family
FT                   protein; SPTR: Q6A633 Putative transcriptional repressor
FT                   protein; PFAM: ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91823"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLM4"
FT                   /protein_id="ADH91823.1"
FT                   /translation="MDNHETIRIGVDIGGTTMSVARIHSGGKITERIEIPSPARISGAA
FT                   VVRELRDIVTRNWPGAASLGIGAAGVIDSHGRILTASDSFNGWAGFHLREETEAALGIP
FT                   VGVENDVNAFLLGETTCGVVAGETTCLGVMLGTGVGGAIMIDGQILHGARGAAAEIGHM
FT                   PGFGTAPCTCGGNGHVECTSSGRSIADRYGRATGQHVPSARVVSDAARSGDHVAQEILK
FT                   DAGRVVALAILQVATIVDLSSVVIGGGVTRDWDFVSAGIAEVTSRHPLISGADLTIHKS
FT                   TLGGDAVLIGAARKGELAC"
FT   gene            85465..86736
FT                   /locus_tag="Arch_0057"
FT   CDS_pept        85465..86736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0057"
FT                   /product="Alpha-L-fucosidase"
FT                   /EC_number="3.2.1.51"
FT                   /note="COGs: COG3669 Alpha-L-fucosidase; InterPro
FT                   IPR000933:IPR013781:IPR016286:IPR017853; KEGG: pac:PPA2070
FT                   alpha-L-fucosidase precursor; PFAM: glycoside hydrolase
FT                   family 29 (alpha-L-fucosidase); PRIAM: Alpha-L-fucosidase;
FT                   SMART: glycoside hydrolase family 29 (alpha-L-fucosidase);
FT                   SPTR: Q6A632 Alpha-L-fucosidase; PFAM: Alpha-L-fucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91824"
FT                   /db_xref="GOA:D7BLM5"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR016286"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLM5"
FT                   /protein_id="ADH91824.1"
FT                   /translation="MLNFDERQGDRTDVAYPDTTVPEWFQDAKVGLMIHWGIYSIPAWA
FT                   VTSDERFSAAEEYAFHRYAEWYGNTVRIPGSPTALLHRARYGSVAYEDLVDRWQIRSGA
FT                   VEGMVALASAAGARYVVPTTKHHDGLCLWDTQTTSFSTVRRGPHMDLIEDFARSVRAEG
FT                   LRLGLYFSGALDWHVSDFGPITSDEELFAFRRNDAEFSQYAATQLRELIDQYSPDYVWN
FT                   DIDWPDGGKGHEDYGLASLFTHYFAKVPHGTINDRWGVPAQGVITREYRDVDGVMDRPW
FT                   EAVRGIGRSFGYNADEAESVSLSGADLIRYLVDVVAKNGNLLINIGPRADGSIPDVQRR
FT                   ALQEMGEWLDIFGEAIYSTRPWGPGTLGDCYFTQPKGNPDVVYMLQRPKNPRVVPAELE
FT                   DWHFEWIGSRDHPIVVGKFVRDEA"
FT   gene            87163..87822
FT                   /locus_tag="Arch_0058"
FT   CDS_pept        87163..87822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0058"
FT                   /product="CutC family protein"
FT                   /note="COGs: COG3142 Uncharacterized protein involved in
FT                   copper resistance; InterPro IPR005627; KEGG: sma:SAV_3917
FT                   homeostasis protein; PFAM: CutC family protein; SPTR:
FT                   Q82GI0 Putative homeostasis protein; PFAM: CutC family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91825"
FT                   /db_xref="GOA:D7BLM6"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLM6"
FT                   /protein_id="ADH91825.1"
FT                   /translation="MLEIIALNVEDALAAAEGGADRIELVGTMDSDGLSATVEQVRQIR
FT                   AACSIPIRAMVRDQAGFVPRDLGALAQVGCDLRDAGAEALVIGWVRDGIFDHAAVHSFI
FT                   SRVGGCELTIHRAVDNVADYAAGWRAILGLPNVTSVLTAGSSAGVDTGMKNVLAQAADP
FT                   RIADLMMVGGGLRLEHLPTLKAAGIGKFHVGSAVRDSFDSPIDPLLVEKWVAAVRA"
FT   gene            87959..88837
FT                   /locus_tag="Arch_0059"
FT   CDS_pept        87959..88837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0059"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1216 glycosyltransferase; InterPro
FT                   IPR001173; KEGG: sen:SACE_6472 putative dTDP-rhamnosyl
FT                   transferase; PFAM: glycosyl transferase family 2; SPTR:
FT                   C0W8B3 dTDP-rhamnosyl transferase; PFAM: Glycosyl
FT                   transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91826"
FT                   /db_xref="GOA:D7BLM7"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLM7"
FT                   /protein_id="ADH91826.1"
FT                   /translation="MSATLSTIHVVTIAFNPGPELDAMIESLCHAGDGTGDVAGVAVRL
FT                   TIVDNGEDPQRVDRLAYEYAERLGVRVIRTGENVGYGRAANVGLEDATEPWVCVANPDT
FT                   VFHPGSLAQLVSAGERWDKGGVFGPRLLENDGSTYPSARALPLLSNGIGHALFVHIWRS
FT                   NPWTRAYHGRTDKEHAAGWLSGACLLIRTTVWNQLGGFDPNYFMFFEDVDLGRRAGEAG
FT                   YLNIYVPSAVVTHEQGASWKKRPAKMIRAHHDSAKRYLAGTYSGARYAPLRALLGTALN
FT                   FRAWWQTRDAR"
FT   gene            88960..89703
FT                   /locus_tag="Arch_0060"
FT   CDS_pept        88960..89703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0060"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="COGs: COG0584 Glycerophosphoryl diester
FT                   phosphodiesterase; InterPro IPR004129:IPR017946:IPR000909;
FT                   KEGG: pac:PPA1839 glycerophosphoryl diester
FT                   phosphodiesterase; PFAM: glycerophosphoryl diester
FT                   phosphodiesterase; SPTR: D0YTV4 Glycerophosphoryl diester
FT                   phosphodiesterase; PFAM: Glycerophosphoryl diester
FT                   phosphodiesterase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91827"
FT                   /db_xref="GOA:D7BLM8"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLM8"
FT                   /protein_id="ADH91827.1"
FT                   /translation="MKHSLLKRQVIAHRGLNRLAPENTLAAFRLAAEHGCQWIETDVDI
FT                   LKDGTPIIMHDTLLDRTTNATGYFYDLDSTDVANIDAGSWFSSQYAGEPIPTLRQLVDL
FT                   MNETGLNANIELKSNERGKATSMQLIDNTLAELDRLDPEREIIISSFNHLLLHHVHEAR
FT                   PDIPIGALFVVDNLWEDWKSILELVGATYIHPEDAGLTPHKVAAFREAGYGVNVWTVNG
FT                   KDRANELFNWGVTGVFTDIANEFRQ"
FT   sig_peptide     88960..89037
FT                   /locus_tag="Arch_0060"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            89823..91235
FT                   /locus_tag="Arch_0061"
FT   CDS_pept        89823..91235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0061"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701:IPR016196; KEGG: pac:PPA1837
FT                   membrane protein, putative permease; PFAM: major
FT                   facilitator superfamily MFS_1; SPTR: C0VTP9 Major
FT                   facilitator family transporter; PFAM: Major Facilitator
FT                   Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91828"
FT                   /db_xref="GOA:D7BLM9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLM9"
FT                   /protein_id="ADH91828.1"
FT                   /translation="MKVTTMNESGVLSKRFPKFLQRGKLGAFLTVVLTGQLVYVSFEAF
FT                   KGSLLLPLSESLGISVDQFGILMGWIGIAMFFYVPAGWVNNRFTIRSILIAFAGWRLIT
FT                   FLILFLVPGLSFKIMVAIAASWGIWDAIGWPAVVNGVVFVAKDEDTKGRGLAMGLLETV
FT                   RRAVEFAMNAVILVFIGMFPDSAVSILKGFAIGYALLLIPLIFALLRYVPKNAVAESVQ
FT                   IGEKKAGKNVAALAGLVNVLLKPRVWMAGVAAMCLYWTYVNLIYLSAPYIKLVFNASDA
FT                   VAGAFGIFNTGLIGVFAGLVSGAVADYVFKSSTVMLGISLAVTAGGAFTVSLLPAGSES
FT                   MWLAMILLMVMAIGIFMGKAVILAPIAELHLPEHISGSAMSVGSFLAFASVFWAHPMTA
FT                   GLVESHKNNVYEGYQQILWITIVVAGIGAACALILAIVNNRMDKAGMLEDHGENDPLAV
FT                   KAEVVGEGSTIL"
FT   gene            91422..91940
FT                   /locus_tag="Arch_0062"
FT   CDS_pept        91422..91940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0062"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: prw:PsycPRwf_1453 LysR family transcriptional
FT                   regulator; SPTR: C2KPU0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91829"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLN0"
FT                   /protein_id="ADH91829.1"
FT                   /translation="MGDERVSSIFIDESGAKNTRGGSFVVGFLKTSSPAVLSREIRDLR
FT                   QRNQYYDEIKFSSINGGNVRFYFDIVEAIGAANLRVGGSVYDASLGFVDDVDSRAVDLV
FT                   QLADVVASSINYLRTHEEVVNQKKVPVKRQVALRLARALGLLDFSDVREGKVNILTMQR
FT                   PCVGDSTLF"
FT   gene            92238..92766
FT                   /pseudo
FT                   /locus_tag="Arch_0063"
FT   gene            complement(92889..93896)
FT                   /locus_tag="Arch_0064"
FT   CDS_pept        complement(92889..93896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0064"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="InterPro IPR001254:IPR009003:IPR001314:IPR018114;
FT                   KEGG: cdi:DIP0736 putative protease; PFAM: peptidase S1 and
FT                   S6 chymotrypsin/Hap; SMART: peptidase S1 and S6
FT                   chymotrypsin/Hap; SPTR: C2BVZ1 Protease; PFAM: Trypsin"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91830"
FT                   /db_xref="GOA:D7BLN1"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLN1"
FT                   /protein_id="ADH91830.1"
FT                   /translation="MKKTSFSIAAIASAVLLMTATPALALEYGDPAPDNAESSSVAALK
FT                   MGKIGNFGDCTGTLIADQWVLTARHCLESVNNEGTQARIAGKIYNADSWAVSPTSDAGL
FT                   LHLTEKVTNATPAKISHDTPSSGQTGTLYGWSSSSSMARSGQLPMAKMVVKEILGGAPS
FT                   GSDTPSAPETPSDSKAPTGADASTETAPPQASQSKPGMSESGQTADNSMQPRIETSILD
FT                   VQSVSGAGMQGGDSGGPFFVNGKLAGLATAGTANGDPDLPSPSAAITTIAGITEWIDNI
FT                   VSGRDTQSVLTAENTPAPPKNVQTSGDNIWGYLAIALVGLAVAAGGSRIRNARQ"
FT   sig_peptide     complement(93822..93896)
FT                   /locus_tag="Arch_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(93899..94852)
FT                   /locus_tag="Arch_0065"
FT   CDS_pept        complement(93899..94852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cdi:DIP0737 hypothetical protein; SPTR: C2BVZ2
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF418)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91831"
FT                   /db_xref="GOA:D7BLN2"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLN2"
FT                   /protein_id="ADH91831.1"
FT                   /translation="MSKPSRIVGLDVARSLAIIGMITIHMASLLWSTKVMLSGLPASLF
FT                   AIIAGATMMIIGRNYTSTAFLRLIARGALIILIGLALLPVGGQIQVVLIVMGLVMILVS
FT                   WIPALGTWWRLGLFIAATIAATVVYAPVDLLIYPLLAWIAYFIGGMLLFDVYLRGRLQR
FT                   DSGSNTSTNTRLSWIVTAISAVITIIGLYYRFDPNIPSWLRFTGHTGVAGEIILSVAVA
FT                   AVVIHLCVLIGNLSSTLVYPFAAMGTMSLTVYILHILTAFYWQQNVALHSTLSAIGFIV
FT                   FFLVAATLWKKFVGQGPAEKLVATAIKAIVPSKKGK"
FT   gene            95194..95613
FT                   /pseudo
FT                   /locus_tag="Arch_0066"
FT   gene            complement(95705..96697)
FT                   /locus_tag="Arch_0067"
FT   CDS_pept        complement(95705..96697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0067"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="COGs: COG1088 dTDP-D-glucose 4 6-dehydratase;
FT                   InterPro IPR001509:IPR016040:IPR005888; KEGG: xce:Xcel_2563
FT                   dTDP-glucose 4,6-dehydratase; PFAM: NAD-dependent
FT                   epimerase/dehydratase; SPTR: D0WPK4 dTDP-glucose
FT                   4,6-dehydratase; TIGRFAM: dTDP-glucose 4,6-dehydratase;
FT                   PFAM: NAD dependent epimerase/dehydratase family; TIGRFAM:
FT                   dTDP-glucose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91832"
FT                   /db_xref="GOA:D7BLN3"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLN3"
FT                   /protein_id="ADH91832.1"
FT                   /translation="MKVLVTGGAGFIGANFVHQTVETMPDADVVVLDKLTYAGNPASIA
FT                   GLDRVTLVEGDIADRDTVDPLVKDADVVVNFAAESHNDNSLNDPSPFIRSNIVGTFELL
FT                   EAVRRHGTRFHHISTDEVYGDLEIDEPRRFQPGDAYVPSSPYSSSKAASDHLVRAWVRS
FT                   FGIEATISNCSNNYGPYQHVEKFIPRTITNLMDGIRPRIYGTGEQIRDWIHVRDHNTAV
FT                   WAIINKGRLGETYLIGADGELNNLQVTQMILEEFGRDAGDFDHVNDRPGHDQRYAIDNS
FT                   KLVEETGWEPSFKNFRDGLHNTIEWYKTNEAWWRPAKEAVEAKYAKNGQ"
FT   gene            complement(96727..97953)
FT                   /locus_tag="Arch_0068"
FT   CDS_pept        complement(96727..97953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0068"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1134 ABC-type polysaccharide/polyol
FT                   phosphate transport system ATPase component; InterPro
FT                   IPR003593:IPR003439; KEGG: lxx:Lxx05010 lipopolysaccharide
FT                   exporter; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: C1RIM8 ABC-type polysaccharide/polyol phosphate
FT                   transport system, ATPase component; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91833"
FT                   /db_xref="GOA:D7BLN4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029439"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLN4"
FT                   /protein_id="ADH91833.1"
FT                   /translation="MTTSPNSSLDVISVEHVSKHFTLRKDKSLKERIVNAARNRQHIEH
FT                   YMALDDVSFSVAAGESLGLTGANGSGKSTLLKLIGGIISPDSGHVKVRGRLAALLELGA
FT                   GFHPDLTGMENIFLNASIMGLSEKEIDSQIDSIIDFSGISKFIDTQVKFYSSGMYVRLA
FT                   FAVAVHSDPDILLVDEVLAVGDEPFQRKCMERIHQFQDDGRSIILVSHSPDQIVEMCDR
FT                   AVVLQQGKLVTIGPTRESMNILHKSYAQQIQADRAAQSTPELPAEAAHELTIDCVRAEG
FT                   FTTLPSGIDLFLSGSDLTILADVTTQSPLSNYNVELTIDALDGTRVFAMDTRKLDYALP
FT                   PITTSGTINIQIPQFFLGEGQFVFGVVISDSTGIVLAHKENALVLQVGSDAKTTGLVKA
FT                   FPEVSVSAS"
FT   gene            complement(97956..98891)
FT                   /locus_tag="Arch_0069"
FT   CDS_pept        complement(97956..98891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0069"
FT                   /product="ABC-2 type transporter"
FT                   /note="COGs: COG1682 ABC-type polysaccharide/polyol
FT                   phosphate export systems permease component; InterPro
FT                   IPR013525:IPR000412; KEGG: lxx:Lxx05020 lipopolysaccharide
FT                   exporter; PFAM: ABC-2 type transporter; SPTR: C0W8E3
FT                   Polysaccharide ABC superfamily ATP binding cassette
FT                   transporter, membrane protein; PFAM: ABC-2 type
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91834"
FT                   /db_xref="GOA:D7BLN5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLN5"
FT                   /protein_id="ADH91834.1"
FT                   /translation="MREHTSGKAPTTAAQQRFERLASQEMRSVSPDSGFLSGMIPSWIT
FT                   IWEHKNLLWLLVRRELKSKYKDSFLGFAWTLIRPLVQLFIYYFAIGKILGAERGIPDFG
FT                   VYVFAGLTAWALFNEIVSMGTSSIVSNGGIIKKVYLPREIFPLAAAGAALINFGAQLIV
FT                   LLTGAFFIRGILIVPFLIYVPIGVAILVVWGSALALWLSAVNVRMRDTQYLVEVGLLIG
FT                   MWLSPIVYSFEMVKNAANSTIAAIYSWNPITIAVSDFQAGIWKQGTLTGAELPSELLAR
FT                   SFTVLAIGLLLGILAQRYFAHAQRNFAQDL"
FT   gene            99082..100605
FT                   /locus_tag="Arch_0070"
FT   CDS_pept        99082..100605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0070"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nml:Namu_4203 glycosyl transferase family 2;
FT                   SPTR: C1RIN5 Predicted glycosyltransferase (Fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91835"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLN6"
FT                   /protein_id="ADH91835.1"
FT                   /translation="MSVLVIINEGEALSPAWKKALPEDAIIREATPKGVGMALDHLEPS
FT                   SVLIVLPGQRAVRNGGIAELVTSGVASALAGTNVAYVDSAKDMPIVSTSAPIYFFNSEH
FT                   VHHAGGIDTSLSAQGIGMDIMYRLNRRGEKVTCTVSRQLSAYSLAPITDYLDVVSRNMA
FT                   IEEQMAELAPLYLGLVSVPLEGTDTDALDLQLSPGNDDDEFLSVSPQALDGARTLHMWS
FT                   ASFGEARTAFELNETMARIPDGDLAGRDAFIQEMWDASGITPEKSCYLHNLFHVSRETE
FT                   RRCVIAVSSTDTHSVERVMQICEHTQASIVVWDVATRRVLTPENGKLVETSIETQELVN
FT                   ETLLILVGTQARQVPWIAQYKGMVVADMTTVDLISDIRLDPTGFGADFLGPRSTMWGET
FT                   FSRADRIVVSDSEQRDLYLGFIAGLGRLNPMAYDEDHSYSNLVAVENGVEQIESVLSQP
FT                   RKSLDTVKSVELFETTPYGELAKRKLSFTDGVKSIGSAAAGVMKKVIQK"
FT   gene            100602..103040
FT                   /locus_tag="Arch_0071"
FT   CDS_pept        100602..103040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0071"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1216 glycosyltransferase; InterPro
FT                   IPR001173:IPR001296; KEGG: nml:Namu_4203 glycosyl
FT                   transferase family 2; PFAM: glycosyl transferase family 2;
FT                   glycosyl transferase group 1; SPTR: C1RIN5 Predicted
FT                   glycosyltransferase (Fragment); PFAM: Glycosyl transferases
FT                   group 1; Glycosyl transferase family 2; TIGRFAM:
FT                   glutamate--cysteine ligase/gamma-glutamylcysteine
FT                   synthetase, Streptococcus agalactiae type"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91836"
FT                   /db_xref="GOA:D7BLN7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLN7"
FT                   /protein_id="ADH91836.1"
FT                   /translation="MTKVSVILVNFRGSDDTIAAVEHLRACDWPKEDLEIVIVENGSGD
FT                   GSLERLQQAVGNEVIVDAGKNLGFAAGCNTGVAHSSGDIVAFLNNDARPDSQWIKEAVK
FT                   ALESDPSIGCVASKVLDWGGHKIDYVDGALTWFGMSYKQQVEQEDQGQWNTPKNVLFPT
FT                   GAAMFVPRAIFDELGGFDERFFMFYEDVDFGWRVTLAGYDVRYVPTSVAFHRHHVSMNK
FT                   HGKFRENYLLERNALACLYKNLDDEHLQAVFAATLLLTNERSAARVEKHSTMDAYDGGT
FT                   ISKDAATGPYAIAWFTKHMDYFRAQRESIQGARKRTDAEILRLMRNAYEPLFSFPKYLD
FT                   LYENLTKHFGLFDTFSNQSKVLIITDDSISEKMAGPAIRAWEMATRLSLTHDVRLFSTA
FT                   GTAKAQSPLFEVLSGSEAVFHGLTDWADFIIFQGFALEKAPWLMESSKVIVADIYDPMH
FT                   LEQLEQAKDLGPQGRKETIQAVTDVLNRQIARADLFLCASEKQRAFWMGQLAAMGRLNA
FT                   NLLDGVEDPRSLIEIVPFGLNEERPTQDYHAIKGKVPGISLDDKVILWGGGVYNWFDPL
FT                   TLIRAVDRLAKKHNNVRLYFLGVKHPNPGVPKMRMTQEAMDLSDSLGLTGKHVFFNHDW
FT                   VDYNDRHNYLLDADCGVSTHFEHIETQYSFRTRILDYLWAGLPIVATNGDSFGNVLDSE
FT                   KIGVSVSPEDVNELSDALEKVLFDDDFARVCRENVARYSVRFEWNNALAPLLRFAQNPR
FT                   RAADMKYMTAGHLPQSFLGFVKVKFNLLRDVKLVASHLKAGGPKLLIHKVQSRLRKMLP
FT                   "
FT   gene            103068..103784
FT                   /locus_tag="Arch_0072"
FT   CDS_pept        103068..103784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0072"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: bfa:Bfae_20890
FT                   glycosyl transferase; PFAM: glycosyl transferase family 2;
FT                   SPTR: C7ME89 Glycosyl transferase; PFAM: Glycosyl
FT                   transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91837"
FT                   /db_xref="GOA:D7BLN8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLN8"
FT                   /protein_id="ADH91837.1"
FT                   /translation="MSLSDSEHKIDGWNEKLADQTWLVIPLYNEGQVIFDVLDKAKRVF
FT                   PRIVCVDDGSSDNSVEEARRAGVAVVRHPINLGQGAALRTGLDYALMQEGSEYFVTFDS
FT                   DGQHRVDDAQRMVVRLKNEPLDVVIGSRFLDGRTKPGTLKRIVLKMAVVFQRMTTGMNL
FT                   TDAHNGLRALNRHAAQSIDIQQDRMAHASEIVSAISAHKLRYAEEPVLIEYTDYSRAKG
FT                   QSLWNSINILSDLLFK"
FT   gene            103793..104161
FT                   /locus_tag="Arch_0073"
FT   CDS_pept        103793..104161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cai:Caci_8173 hypothetical protein; SPTR:
FT                   C0VZS1 Putative uncharacterized protein; PFAM:
FT                   Uncharacterized conserved protein (DUF2304)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91838"
FT                   /db_xref="GOA:D7BLN9"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLN9"
FT                   /protein_id="ADH91838.1"
FT                   /translation="MSSGQILIKVILVTIFIVLALAIIVPRESARGLAIRRISWLLGIF
FT                   LAIIAVIFPSMTDHVANFVGVGRGADLILYLSIVFFIGFAFATGSHMRKLDRKLTLLSR
FT                   KYALLEAELRTDNHRLGE"
FT   sig_peptide     103793..103882
FT                   /locus_tag="Arch_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            104168..105514
FT                   /locus_tag="Arch_0074"
FT   CDS_pept        104168..105514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0074"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ace:Acel_0695 hypothetical protein; SPTR:
FT                   A0LSQ8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91839"
FT                   /db_xref="GOA:D7BLP0"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLP0"
FT                   /protein_id="ADH91839.1"
FT                   /translation="MTAIAQKYKESYSRFYLWFLGSGQYWVLGFLIVATMLSYRARYAA
FT                   TMSPFDEATYLDSILSLPDNMIAQRGEFYGDDIREKFACDGVYYFGTSGPPCGGDYSEV
FT                   ERFPQYGKNTADAYTPIFFWVTWVFARVFSVFGIDMMVGARLAMIIYGTAAFLVLYKTM
FT                   RMLNVPIAVGYTTIAFALTSPFVWWTYTFVTTDSTVLLIGALALFVTIRFLQGAGSLWP
FT                   LVAVGVLGMALKITNILAIGLAGLIVLMYVAFERFSSDSSAQKLPLRSWLVPGLVSVFA
FT                   ALGTHVTWEVIRRLIALGDSPDQGISMERNTIGELINQAQSGFGSLVSNGHGESISSPF
FT                   SFLISRFLVFLIIAAVIGMMLKKPASQLEFALAWATGIAAVIFLPILFIIVQRLVLPFS
FT                   IPARYAAAILPAMFLCVGLSIRWAGARWLMGTVAAGAWIYVVFSGMTYL"
FT   gene            complement(105518..105877)
FT                   /locus_tag="Arch_0075"
FT   CDS_pept        complement(105518..105877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsa:RSal33209_1610 hypothetical protein; SPTR:
FT                   D0WPI8 Putative uncharacterized protein; PFAM:
FT                   Uncharacterized conserved protein (DUF2304)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91840"
FT                   /db_xref="GOA:D7BLP1"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLP1"
FT                   /protein_id="ADH91840.1"
FT                   /translation="MTTIQIISLIATLLIGIQLIRFVRHRVIKEKYVWLWLCLDILAII
FT                   FILWPSGLTKIADFAGFDVPSNMVFFVVMAVLVFVEIHQAFTVSKLEEDRRRLTEEIAI
FT                   LRHDVDRLTYLINKQ"
FT   gene            complement(105880..106608)
FT                   /locus_tag="Arch_0076"
FT   CDS_pept        complement(105880..106608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0076"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: xce:Xcel_2568
FT                   glycosyl transferase family 2; PFAM: glycosyl transferase
FT                   family 2; SPTR: D0WPI9 Dolichyl-phosphate mannose synthase;
FT                   PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91841"
FT                   /db_xref="GOA:D7BLP2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLP2"
FT                   /protein_id="ADH91841.1"
FT                   /translation="MEGKALTHNELLVIIPAWNEEKSITDVIHAITTHVPFADCIVVND
FT                   GSRDATATVAAQAGAAVLDLPINLGVGGAMRAGFRYAVRKGYTYAVQVDADGQHDPRYI
FT                   AQMLTEAQQGADVIIGARFAGVGTYTASGPRWWAMVVMSKIMSRLAKVKLTDVTSGFKL
FT                   YSRRALEFYSENYPAEYLGDTIEALVLGIKSGLVVKQIGVEMHARTAGTPSHSPIKAAI
FT                   YLVRATLALGIALMSRSRKA"
FT   gene            106734..108260
FT                   /locus_tag="Arch_0077"
FT   CDS_pept        106734..108260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0077"
FT                   /product="Protein of unknown function DUF2142, membrane"
FT                   /note="InterPro IPR018674; KEGG: lxx:Lxx05060 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2142,
FT                   membrane; SPTR: A7BEE9 Putative uncharacterized protein;
FT                   PFAM: Predicted membrane protein (DUF2142)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91842"
FT                   /db_xref="GOA:D7BLP3"
FT                   /db_xref="InterPro:IPR018674"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLP3"
FT                   /protein_id="ADH91842.1"
FT                   /translation="MEITTHSRFANTAQKMRNPRILAVVCLLGLLSAGFSWIVASPIGG
FT                   SPDDDFHMGSIWCPRPAGESCASKMVDGTLRVQVPEPVALATECHAFKEAQPASCPREL
FT                   SNDKLAFTYRYDEGNYPTTYYRFHHLLISHSVADSVILMRTVNFLIAVFLLGTIGWLLR
FT                   PEHRPAYVFAMLGAWVPMGFYFLTSMNPSAWAITGVFAYATAMYAAFFAEGKRRWGLLA
FT                   CAIIGAFMSFASRGDSAFYIFVVTAALLWAIKIKRSDWRLWSLAGALSIFGCYMMLGGG
FT                   QANIVANHATVSDNFIGSVLRTTMDLPRYFAGFVSFGYGPGWFDVPLDVTFPLLALFAS
FT                   GSLLMAGFRRGTWRKWMAVLMIAGAMCGIPVLIVAVGSYPHLGPYQPRYMLPLFAVLFF
FT                   FLFVLSKERIRILDFSQKVVLAGILFIVNSYTLHAVLWRYVSGAQGIRPVNIDAHMHWW
FT                   WDIPISPMGVWFVGTVGFLIAIVAGMLLSRAPEEKEVLANREVSDSTLAV"
FT   sig_peptide     106734..106868
FT                   /locus_tag="Arch_0077"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(108237..109472)
FT                   /locus_tag="Arch_0078"
FT   CDS_pept        complement(108237..109472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0078"
FT                   /product="putative integral membrane protein"
FT                   /note="KEGG: mva:Mvan_5388 putative integral membrane
FT                   protein; SPTR: D1BC66 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91843"
FT                   /db_xref="GOA:D7BLP4"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLP4"
FT                   /protein_id="ADH91843.1"
FT                   /translation="MAEATTPKSSAIVSVGAIFAALSGFSILIITARTLTAEDNAIFLA
FT                   FWSTLFLITGILSGIQQEVTRAVANESLISRKEESVRPLILGISIGVLASLAFLAVSPL
FT                   LSHVLETDYPAAFTSLLIACGLTLYAGQVSLLGVLGGNKNWNLFASITSCEALGRLTFI
FT                   TLVALTAATTLRFEIATVIAFALWLLFFLHPQVCRSSHFLVSVSWKKMTRQIGLALAAS
FT                   GATALLINGFPLLMALTTSLDEYKNSADLVMAVSITRAPLLVPIFAFQSVVIAHYVTHP
FT                   EKRRSTTRTLFLGLSGFALCASPIVALIGPTIMHAVFGASYRSTGMILGILIVDATLLA
FT                   LLVLGGTITIALTNYKACLLGWYTTATVSFVLMLLPFSLEARTLSTLTFGPLLGIAIHF
FT                   STILRSDRERRI"
FT   sig_peptide     complement(109362..109472)
FT                   /locus_tag="Arch_0078"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            109526..110395
FT                   /locus_tag="Arch_0079"
FT   CDS_pept        109526..110395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0079"
FT                   /product="glycosyl transferase family 2"
FT                   /note="InterPro IPR001173; KEGG: art:Arth_2683 glycosyl
FT                   transferase family protein; PFAM: glycosyl transferase
FT                   family 2; SPTR: A0JYE2 Glycosyl transferase, family 2;
FT                   PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91844"
FT                   /db_xref="GOA:D7BLP5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLP5"
FT                   /protein_id="ADH91844.1"
FT                   /translation="MVIDIMVPYWGRVDWLEELVSSVKAQDCDHWRLVIIDDCYPGDAA
FT                   KKFIDQCDDDRISYIRNEENIGLAKNFQRCLELSSAEYVVIPGCDDRFLPNYISAMQRT
FT                   IAQEQPDIVQPGVRTIDENGTVISGLTEKVKTLIQPKDSHLLEGEIVATSLMRGNWLYW
FT                   PSLMIKREKALAHGFRDFFIMLDLGLIVDMILDGARLYVLEEICFEYRRSASSVSGKTA
FT                   IDGKRFVDERAYFALVARLFAEKGWKKAARAARFHITSRIHAGLRMPNALIHRDFSGMK
FT                   MILDHLIR"
FT   gene            110523..111524
FT                   /locus_tag="Arch_0080"
FT   CDS_pept        110523..111524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0080"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: llk:LLKF_0209
FT                   glycosyltransferase, family 2; PFAM: glycosyl transferase
FT                   family 2; SPTR: C0FV38 Putative uncharacterized protein;
FT                   PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91845"
FT                   /db_xref="GOA:D7BLP6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLP6"
FT                   /protein_id="ADH91845.1"
FT                   /translation="MAFISIIIPVYNSETYLAHCLDSIHAQSFTDWEVVLVDDGSSDSS
FT                   PELCDRYAEKDSRFTVIHQANTGTSGARNAGIAAAKGGYVTFVDNDDWWIDSNCLENIY
FT                   QKLTLHPVDILCHNSLLASSGGKDIDYGEETHYAEIIDSLSTPDAIKFLVDKDVLTRAV
FT                   WTKVVRRELLDIHSIEFPTGMRNEDTDWSAKVLAYCTSIGWIDQKFYAYRVGHSYAQTA
FT                   HKLAVSSVNDLQKIIEENLLIAEQLDAEKGEALKAFLAYPLFVWAGQASALSLFKDGDR
FT                   SRKALRAKMPHIFAHCNTPVVRIAGMMARIFGTAFTAKMLGIAFKKKYPQHS"
FT   gene            complement(111539..112399)
FT                   /locus_tag="Arch_0081"
FT   CDS_pept        complement(111539..112399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0081"
FT                   /product="LicD family protein"
FT                   /note="COGs: COG3475 LPS biosynthesis protein; InterPro
FT                   IPR007074; KEGG: apv:Apar_1000 LicD family protein; PFAM:
FT                   LicD family protein; SPTR: C0W8F2 Possible
FT                   lipopolysaccharide cholinephosphotransferase; PFAM: LICD
FT                   Protein Family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91846"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLP7"
FT                   /protein_id="ADH91846.1"
FT                   /translation="MINQAYDPKMLSKIQQAMRLSLVEFDRICTELQLRYVVYGGSAIG
FT                   AVRHQGLIPWDDDIDICMPRADYDRFFTEAPALLNEAFVVMDSRTNPDYPKTFGVLGLK
FT                   GSRFIPGIAANRSFPIPLGIDLFPLDPIPSHPKQFAKQSRATWFWGRLLYLQGTPHAEL
FT                   SLPRPVKAIVSVATHVIHWGIKSTRITPKALVRKWERAARQYENSGSTLFGDFSTRDPK
FT                   RWSASLEEMFPAQRVPFDDITVMLPRDVDAILTRGYGDYMTIPPENERVNHAAALIDFG
FT                   PYMTI"
FT   gene            complement(112409..113356)
FT                   /locus_tag="Arch_0082"
FT   CDS_pept        complement(112409..113356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0082"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: ccu:Ccur_08310 integral
FT                   membrane protein DUF6; PFAM: protein of unknown function
FT                   DUF6 transmembrane; SPTR: C0W8F3 Integral membrane protein;
FT                   PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91847"
FT                   /db_xref="GOA:D7BLP8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLP8"
FT                   /protein_id="ADH91847.1"
FT                   /translation="MKFGILSGSLWGLDTVILGIAFTIIPFLSSPHAALASAAIHDTIA
FT                   ALLLLAFMGVRRRLTDTYNAVKSHSGRAVMIAAILGGPVGMTGYLIAINHIGPGFTAII
FT                   STFYPAVGTFLAYLFLKERMSFKQIIALVVALCAIIAVGWSSSTTAEGSTLIGIIAALA
FT                   CVFGWGSEAVILAWGMRNEAVDNQTALHIRQTTSALTYLLVVIPLMGTLPFISHATFSW
FT                   GTVVIGIAALAGTASYLFYYRAIDTIGASRAMAANISYSAWALLFAFIIFGTIPTAFQM
FT                   ICCVIILCGTTLAATSDWKTIIAPSRLNRSTHQS"
FT   sig_peptide     complement(113249..113356)
FT                   /locus_tag="Arch_0082"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(113353..115164)
FT                   /locus_tag="Arch_0083"
FT   CDS_pept        complement(113353..115164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0083"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="COGs: COG4750 CTP:phosphocholine
FT                   cytidylyltransferase involved in choline phosphorylation
FT                   for cell surface LPS epitopes; InterPro
FT                   IPR000835:IPR002573:IPR011009; KEGG: apv:Apar_1003
FT                   transcriptional regulator, MarR family; PFAM:
FT                   Choline/ethanolamine kinase; regulatory protein MarR; SPTR:
FT                   A7BEG2 Putative uncharacterized protein; PFAM:
FT                   Choline/ethanolamine kinase; Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91848"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLP9"
FT                   /protein_id="ADH91848.1"
FT                   /translation="MRKTLTAAEFDILHVLTGENKTLTQRELASYTGLSLGRVNTTIRE
FT                   LTEQGLIRDRLITDAGRVALTPYKVDNAIIMAAGLSSRFAPISYERPKGTLRVRGEVLI
FT                   ERQIEQLHEAGITDITVVVGYKKEYFFYLAKKYGVKIVVNKEYTTRNNNGSLWLVRDKL
FT                   ARTFICSSDNYFAENPFDSHVYQAYYSAVYVHGQTNEWCIKTGSGGRITGCTIGGENAW
FT                   TMLGHVYFDQQFSEKFCEILEDVYTLPETASKLWESIYLDHIKDLHMVIRKYPDGVINE
FT                   FDSVDELREFDPHFIENVDSEVFDNIASALDCDKSEIRGFEPLKQGLTNLSCRFSVGDK
FT                   HYVYRHPGVGTNKIVDRQAEHTALNAAKKLGLDSTFITGDPHKGWKISQYLPEVRNLDV
FT                   TNDDELEKAMMMARNLHTSDIKLDREFDFIKEAQRYEELLEQFEPIDVPGYAELKEKVF
FT                   RLKEYADADAFPVVPSHNDFFPMNFLVAPSGKIDLIDWEYAGMSDVAADFGTMVVCSEE
FT                   LGDVRADQALSYYFGRTPTAEEHRHFWAYIVFAGWCWYVWALLKEAEGDDVGEWLLTYY
FT                   HYASQYIDAALAAYEFASANTQIESLS"
FT   gene            complement(115282..116376)
FT                   /locus_tag="Arch_0084"
FT   CDS_pept        complement(115282..116376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0084"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: ape:APE_2066.1 glycosyl transferase, group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: C0W8F1
FT                   N-acetylglucosaminyl-phosphatidylinositol biosynthetic
FT                   protein; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91849"
FT                   /db_xref="GOA:D7BLQ0"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLQ0"
FT                   /protein_id="ADH91849.1"
FT                   /translation="MRIALIVNNYPPMVGGIEYHEENLAHSLADLGHDVWVINLAGPTA
FT                   TRRDGSVTVITHQGHFNISDIIRTPGLGTTRKLARFLKAHAIEVVSTHTRFFPMSFVGL
FT                   RAAKRAGIPVIHTEHGSGFVATKNPIIWLGSRTVDLTLGRYTLRHADKVLGVSEQVTTF
FT                   VKKLSGVDASVFYNAITPPQLRPHTPDRSTHLVFVGRMVAGKGWDTFIDAVARLRTEGY
FT                   DIDAEILGDGPQLADAQRIVAERGLEQVISVPGRVAPQEVRKRLRGATLVNPTVLSEGF
FT                   QTTLVEVLAEGGQVVTFPVAGAAMLAERGAPVEICSEKSAEALIAGLRNILAHTRPRAS
FT                   QELITEFTWPRQARVYAHICGSLL"
FT   gene            116530..117795
FT                   /locus_tag="Arch_0085"
FT   CDS_pept        116530..117795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0085"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="InterPro IPR002797; KEGG: apv:Apar_0999
FT                   polysaccharide biosynthesis protein; PFAM: polysaccharide
FT                   biosynthesis protein; SPTR: C0W8F7 Putative uncharacterized
FT                   protein; PFAM: Polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91850"
FT                   /db_xref="GOA:D7BLQ1"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLQ1"
FT                   /protein_id="ADH91850.1"
FT                   /translation="MMRDKNISLRQNMVWNSAGSMTRLACNYLITIAVVRLSSGFDAAG
FT                   SLALAMSISNVIWPLADFRLRTVQITDVHNEHSSGEYVGLRILTSLFAVSVGLIYALVT
FT                   VAWESIFVIFLYCIYTIAVNFIEAFHAIDWRHKRMDISGTSYMLQGVSNLTAFCLVLWG
FT                   TNSLILAIVSLIVTTVLVGALYDMPRSAYFEPITPSIELRSAVKTLLVLSPLVFAQVCS
FT                   AAVLTIPKQHLELILGSSALGIYSSVASPVVIVQMGATYVYSPLMGEFAERFANVKSSG
FT                   LELLRKTAGIVIAATSFVSVTLLVVGDPILKLMFGQQIGEHTYLLQPAILCTLVTAAVW
FT                   FMNDLLLAIRDYRGAFVGNAVAALVAVTISYQCVMRFGMNGVSWVGVIAYGVGLLVMAV
FT                   FFVLDYRKMTDPPVTLPEDLKE"
FT   gene            complement(117864..118712)
FT                   /locus_tag="Arch_0086"
FT   CDS_pept        complement(117864..118712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0086"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="COGs: COG1091 dTDP-4-dehydrorhamnose reductase;
FT                   InterPro IPR005913:IPR016040; KEGG: bcv:Bcav_1209
FT                   dTDP-4-dehydrorhamnose reductase; PFAM:
FT                   dTDP-4-dehydrorhamnose reductase; PRIAM:
FT                   dTDP-4-dehydrorhamnose reductase; SPTR: D0WPJ0
FT                   dTDP-4-dehydrorhamnose reductase; TIGRFAM:
FT                   dTDP-4-dehydrorhamnose reductase; PFAM: RmlD substrate
FT                   binding domain; TIGRFAM: dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91851"
FT                   /db_xref="GOA:D7BLQ2"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLQ2"
FT                   /protein_id="ADH91851.1"
FT                   /translation="MTWMVVGAKGMLGTDLVARIKEDGHDVRAVDIDDIDITKMDSVEQ
FT                   VVQGVDVVVNCAAFTAVDPAEENEGTAFRVNATGPANLARQCAKIGARLVHISTDYVFR
FT                   GDGETPWTEEAPMDPVSAYGRTKAAGEWAVRTYTNDFLIVRTAWLYGKFGNCFPKTMVR
FT                   LSETHETLKVVVDEVGQPTWTVDLADLIVRLVDAKAPSGVYHGTSQGQTSWNGFTKEIM
FT                   RAVGKSPDMVHETTAAAFDRPAKRPSFSALGHDALTAIGVEPIGEWNERWQVAASIVLG
FT                   E"
FT   gene            complement(118915..119082)
FT                   /locus_tag="Arch_0087"
FT   CDS_pept        complement(118915..119082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0087"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0916 putative kynurenine
FT                   3-monooxygenase; SPTR: C1YGQ0 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91852"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLQ3"
FT                   /protein_id="ADH91852.1"
FT                   /translation="MARLTREKRPKRDIKKIYLLAVEGETEKRYFELMPSHLPYKLSLE
FT                   LGATPIHIPL"
FT   gene            complement(119095..120411)
FT                   /locus_tag="Arch_0088"
FT   CDS_pept        complement(119095..120411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0088"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1106 ATPase; KEGG: cef:CE2900 hypothetical
FT                   protein; SPTR: Q8FSZ2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91853"
FT                   /db_xref="GOA:D7BLQ4"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLQ4"
FT                   /protein_id="ADH91853.1"
FT                   /translation="MIIEFTVKNYLSFHEEQSLNMVATREQRYRDRLPYLSKRYRKFIT
FT                   PTASIYGANASGKTNLFRALKCMQELVLKPTSPGEALKYKPFKLDKKSGTEPTEFDLLF
FT                   LADDDIIYRYFLSYTADKIHSEKLWKIMSNGDEQAVFIREGLSVKSDLGPIENAILQGV
FT                   SPTSTIARFASEWGTNTGNLSAIRKVSQWFKRVHFINPTSGNDPIPQGLETLKKAGAWL
FT                   PFIGAGISDVVIRDIDPQPIAIDGLFDDLTEGNRIQANINGKFLEFTRESNGEISGSEI
FT                   SLTHTTSDGRQEAFDWDEESEGTRYIVGTVAPWIQRLLHPSSKGHILIIDELDRSLHTQ
FT                   LAIAFVSIYLRNVHKNSRSQLIFTTHDLMLMDLDIFRRDEIWIVEKSISGGSTLIALTD
FT                   YEGIRADKDVRRSYLDGRFGGVPHVQPDLLSTSIFLEKE"
FT   gene            120519..121136
FT                   /locus_tag="Arch_0089"
FT   CDS_pept        120519..121136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0089"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="COGs: COG1898 dTDP-4-dehydrorhamnose 3 5-epimerase;
FT                   InterPro IPR000888:IPR014710:IPR011051; KEGG: xce:Xcel_2560
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase; PFAM:
FT                   dTDP-4-dehydrorhamnose 35-epimerase related; PRIAM:
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase; SPTR: D0WPJ1
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase; PFAM:
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase; TIGRFAM:
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91854"
FT                   /db_xref="GOA:D7BLQ5"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLQ5"
FT                   /protein_id="ADH91854.1"
FT                   /translation="MLIEPLSIEGAYRITPKQFPDSRGLFLEAFKQQTFVEAVGRELDV
FT                   QQVNTSVSKAGTVRGIHFAEIAPSQAKYVMCPQGALLDFVVDIRVGSPTFGQYESVLLD
FT                   DADRRAIFISEGLGHAFIALEDNTVATYLCSAPYAPGREHGVKPTCSTLGIEWPTVDRH
FT                   GNPMELLLSEKDTAAPGLGTASRMGLLPTYEEAMAFVNSLKK"
FT   gene            121237..123575
FT                   /pseudo
FT                   /locus_tag="Arch_0090"
FT   gene            121541..122697
FT                   /locus_tag="Arch_0091"
FT   CDS_pept        join(121541..121816,121816..122697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Arch_0091"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="InterPro IPR002514; KEGG: kse:Ksed_22010
FT                   transposase; PFAM: transposase IS3/IS911 family protein;
FT                   SPTR: C2BM30 ISMyma01 transposase; manually curated; PFAM:
FT                   Integrase core domain; Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91855"
FT                   /db_xref="GOA:D7BLQ6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLQ6"
FT                   /protein_id="ADH91855.1"
FT                   /translation="MKKFSKHTPEQIVVKLDKARSLKESGSTVAEVCRELGISEATYHR
FT                   WQRQYGDMTRSEARRFKELQEENEKLKRLLGEAELEKSLLRELAEGKILTLARKYEAID
FT                   HALSLGYSVRLACRVVGVSRGAYYNARRHTTGPSATDKHASLRSWLVTFAASHRRWGYR
FT                   RAWVKAREAGFDCGRDVVRRIWRQEGLRVFPRKAPKRRCLPLSTPRVEPAACPGDVWAL
FT                   DFQFDTDYHGKTFKICNVIDEFTREHVGFEVGRSITAVSVIELLSNLAASRGGRPRVLR
FT                   MDNGPEFISHELNKWAAKEGTVEAFIPPGRPWHNGFVESFHNRLRDELLEDEMFDDPAH
FT                   ASHCLRLWSKRYNTCHPHSSLGFVPPAQYAKQWHLTQGGPQAARS"
FT   gene            complement(123598..124464)
FT                   /locus_tag="Arch_0092"
FT   CDS_pept        complement(123598..124464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0092"
FT                   /product="rhamnosyltransferase"
FT                   /note="COGs: COG1216 glycosyltransferase; InterPro
FT                   IPR001173:IPR006446; KEGG: ajs:Ajs_0541
FT                   rhamnosyltransferase; PFAM: glycosyl transferase family 2;
FT                   SPTR: D0WPJ2 Rhamnosyltransferase; TIGRFAM:
FT                   rhamnosyltransferase; PFAM: Glycosyl transferase family 2;
FT                   TIGRFAM: L-rhamnosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91856"
FT                   /db_xref="GOA:D7BLQ7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR006446"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLQ7"
FT                   /protein_id="ADH91856.1"
FT                   /translation="MCERIAAVIVTYHPGDVYPLLARFADQCSAVYVVDNSPTLDTELG
FT                   EACQRTGAILLPLGRNVGIAAAQNIGITRALDDGADAVILSDQDSIPGPRMVADLAVHL
FT                   GPGVGAVGPVPFDGDEPLVYTDHTWGPKRPNNFEIGTDPIEASFLLASGCLIPAHVLRE
FT                   VGLMPAEYFIDHVDLAWSMRARACGYRLLAIPTARLVHSLGDRGIKVKGRKRTIHVHSP
FT                   IRNYYLTRNTIELMRNPDLPATWRFRYGYWITRFAVFTVLTSKDRTERAKLISRGFYDG
FT                   VRRKMGK"
FT   gene            complement(124464..125339)
FT                   /locus_tag="Arch_0093"
FT   CDS_pept        complement(124464..125339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0093"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="COGs: COG1209 dTDP-glucose pyrophosphorylase;
FT                   InterPro IPR005835:IPR005907; KEGG: xce:Xcel_2557
FT                   glucose-1-phosphate thymidylyltransferase; PFAM:
FT                   Nucleotidyl transferase; SPTR: A7B922 Glucose-1-phosphate
FT                   thymidylyltransferase; TIGRFAM: glucose-1-phosphate
FT                   thymidylyltransferase; PFAM: Nucleotidyl transferase;
FT                   TIGRFAM: glucose-1-phosphate thymidylyltransferase, short
FT                   form"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91857"
FT                   /db_xref="GOA:D7BLQ8"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLQ8"
FT                   /protein_id="ADH91857.1"
FT                   /translation="MRGIILAGGSGTRLHPITQGISKQLVPVYDKPMIYYPMTTLMLAG
FT                   IQDILVITTPHDADGFKRLLGDGSQLGVNLSYVQQPEPNGLAQAFVLGADFVGNESAAL
FT                   VLGDNIFYGPGMGTRLRRHVNPNGGAVFAYHVDDPERYGVVEFDSEFRALSIEEKPAQP
FT                   KSNYAVPGLYFYDNDVVEIAKNLKPSPRGEYEITDVNKHYLREGKLTVEVLPRGTAWLD
FT                   TGTFDSLADATSFVRTVEARQGLKIGCPEEVAWRMGFLNDAELAERAEPLRKSGYGEYL
FT                   MRILARGKNA"
FT   gene            complement(125425..126387)
FT                   /locus_tag="Arch_0094"
FT   CDS_pept        complement(125425..126387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0094"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: ccu:Ccur_08310 integral
FT                   membrane protein DUF6; PFAM: protein of unknown function
FT                   DUF6 transmembrane; SPTR: C0W8F3 Integral membrane protein;
FT                   PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91858"
FT                   /db_xref="GOA:D7BLQ9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLQ9"
FT                   /protein_id="ADH91858.1"
FT                   /translation="MWGIFSGMLWGLDTVILSIALATSAFGHLTGSPLVTAALHDSLCA
FT                   LLMLIVMAGSGQLGDTRRGWATSHGKAVSAAALLGGPIGMFGYALAIENLGAGYTAILS
FT                   TFYPALGTFLATGLLKEQMRRRQLLALAVAILAIIVVGSSSLEDAPGSTLLGAIGATMC
FT                   ILGWGSEAVILAWAMRDKGVDNHVALHIRQTTSALAYLLFVIPITGNLDSLSRVMFTPG
FT                   TAIIAGAAVAGTISYLCYYRAIHTIGAARAMAINISYSAWAVIFAFILTAVIPAPIEIA
FT                   GCIVILISTMLAASHNWHEFVPKRYQERRAHRRRPSSKN"
FT   gene            complement(126513..127382)
FT                   /locus_tag="Arch_0095"
FT   CDS_pept        complement(126513..127382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0095"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsa:RSal33209_0014 hypothetical protein; SPTR:
FT                   A9WR40 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91859"
FT                   /db_xref="GOA:D7BLR0"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLR0"
FT                   /protein_id="ADH91859.1"
FT                   /translation="MSFFKRKTAAEKAADEVTKLKDQAAHATGSFFAKVADAYKASRTW
FT                   AEPRLEEAAEKFVPVAQNAVARANVAARDAYVRTRPYVEDAVTKAKPYVNDAVAKAKPY
FT                   VEEAVAKAKPYVDDAQAFVIDSADRVKDDYLPRAKNAANAALAEIKASANEQAEKAVTL
FT                   SKKELKKANKLAKKAEKKAMKLTKKQEKKGRGKKVFGWTLLVGSALGAAYVAWARSKPV
FT                   EDPWAEAYWEDLAVPTDAEAAFESFEDTVETVKEKVEETAEKAVETVEDAKEAVTPRDI
FT                   AERLEEEK"
FT   gene            127588..128118
FT                   /locus_tag="Arch_0096"
FT   CDS_pept        127588..128118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0096"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="COGs: COG0652 Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase) - cyclophilin family; InterPro
FT                   IPR002130:IPR015891; KEGG: bcv:Bcav_0019 peptidylprolyl
FT                   isomerase; PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; PRIAM: Peptidylprolyl isomerase; SPTR:
FT                   D0YP84 Peptidyl-prolyl cis-trans isomerase B; PFAM:
FT                   Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91860"
FT                   /db_xref="GOA:D7BLR1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLR1"
FT                   /protein_id="ADH91860.1"
FT                   /translation="MECMEALMTTSVGEIKIELFPEHAPQTVANFAELAMGKREWTDPA
FT                   TGATSTEPLYNGTIFHRVIDGFMIQGGDPLGTGTGGPGYVFDDEISPELTFTEPYVLAM
FT                   ANAGKRMGKGTNGSQFFITVAPTTWLQGAHTIFGKVVDEESKAVVDKIATTETGPMDRP
FT                   VEPIFIESVTISE"
FT   gene            128136..128768
FT                   /locus_tag="Arch_0097"
FT   CDS_pept        128136..128768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0097"
FT                   /product="Rhomboid family protein"
FT                   /note="COGs: COG0705 membrane protein; InterPro IPR002610;
FT                   KEGG: jde:Jden_0165 rhomboid family protein; PFAM: Rhomboid
FT                   family protein; SPTR: A7BB19 Putative uncharacterized
FT                   protein; PFAM: Rhomboid family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91861"
FT                   /db_xref="GOA:D7BLR2"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLR2"
FT                   /protein_id="ADH91861.1"
FT                   /translation="MAGGEPQPSSFHTHKEKPMSKLNIPPVTAVMSALCIIATLASYAV
FT                   PEVLFSYAFIPLFAEAEPWRFLTGAFLHSGFMHILFNVMALIFLGAELEPALKSGRFAA
FT                   LYLGSAIGGNAAVYAWSAWTGEWNTAAVGASGAIFGLFGALIVLTRALHTDMRGILILL
FT                   GINALIAITTPQISWQAHLGGFLTGIILTGIWWPLHRRRHNQQNHGW"
FT   gene            complement(128819..129088)
FT                   /locus_tag="Arch_0098"
FT   CDS_pept        complement(128819..129088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0098"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="InterPro IPR009619; KEGG: bcv:Bcav_0021 protein of
FT                   unknown function UPF0233; PFAM: protein of unknown function
FT                   UPF0233; SPTR: D0WKX8 Putative cylicin-2; PFAM:
FT                   Uncharacterised protein family (UPF0233)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91862"
FT                   /db_xref="GOA:D7BLR3"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLR3"
FT                   /protein_id="ADH91862.1"
FT                   /translation="MPESKKRKKVEERRIAASRDRQEHPAPEIKRSPKWWAPLMVTLAL
FT                   IGLLVVVMAYVSHGQAPVPGFGNGNLFIGIGLMLVGFLMTMGWK"
FT   gene            129213..130154
FT                   /locus_tag="Arch_0099"
FT   CDS_pept        129213..130154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0099"
FT                   /product="sortase family protein"
FT                   /note="COGs: COG3764 Sortase (surface protein
FT                   transpeptidase); InterPro IPR005754; KEGG: rmu:RMDY18_19620
FT                   sortase; PFAM: peptidase C60 sortase A and B; SPTR: C6R304
FT                   Sortase family protein; TIGRFAM: sortase family protein;
FT                   PFAM: Sortase family; TIGRFAM: LPXTG-site transpeptidase
FT                   (sortase) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91863"
FT                   /db_xref="GOA:D7BLR4"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLR4"
FT                   /protein_id="ADH91863.1"
FT                   /translation="MTHEPETPGEIVPPRRRSALPREARIYTGTQPAVNTDQNLTQARR
FT                   TAKFPPVGVPESQSQPNPPHKKRNILSAIIGVIGELLITFGLIVAGFIGWQLWWTSILA
FT                   NQVQTELLDEFAKKTTAAPTVAAEPAKKDPPPFELNPTHGQMFGVIHFPSFGKSATRSM
FT                   AEGTTNWDILDHGGFGHYEGTAWPGEIGNFSLAAHRRGNGDALMFVEEFKPGDPIIVET
FT                   ETAYYVYKMTDHELVTPDKTRVIQPDPYQAREAEENGTGITAPTKRLITLTTCHPQYNA
FT                   THRWIVHGEFDSWISKSEGMPKELIELNKKEG"
FT   gene            130157..130312
FT                   /locus_tag="Arch_0100"
FT   CDS_pept        130157..130312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0100"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: jde:Jden_0284 hypothetical protein; SPTR:
FT                   C7QZ49 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91864"
FT                   /db_xref="GOA:D7BLR5"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLR5"
FT                   /protein_id="ADH91864.1"
FT                   /translation="MYRALWKILPGPTWFKAIEALLLLAGVVFVLFQYVYPWVYYNTNW
FT                   FDTTVG"
FT   gene            complement(130585..131784)
FT                   /locus_tag="Arch_0101"
FT   CDS_pept        complement(130585..131784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0101"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="InterPro IPR002525:IPR003346; KEGG: mlu:Mlut_12160
FT                   transposase; PFAM: transposase IS116/IS110/IS902 family
FT                   protein; transposase IS111A/IS1328/IS1533; SPTR: C0W956
FT                   Transposase, IS111A/IS1328/IS1533 (Fragment); PFAM:
FT                   Transposase IS116/IS110/IS902 family; Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91865"
FT                   /db_xref="GOA:D7BKC8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D7BKC8"
FT                   /protein_id="ADH91865.1"
FT                   /translation="MRTDRPDIFLGLDVGKTDHWACALTDSGQVLWNKTLPNNEQKLTD
FT                   IYTNLSAKGSVLVVVDQPATIGALAIAVAQHMGIEVAYLPGLTMRRIADLYPGEAKTDE
FT                   KDAFIIADAARSLPHTLRQLTKTDQDEAGLAMLTGFDLDLSRQVNQVSNRIRGLFTQIH
FT                   PELERVLGPRLEHDAILEVLATWPTPQALRKAGRARMDAKLKKHGARRHAAWTEDILTA
FT                   LAKQSVIVTGTEAAGLVIPHLARQLVSLHAQRANVASEVEKIVATHPLYLVLRSMPGIG
FT                   LRTAAVIIAELAGKTFTSSAALASYAGLAPTTRQSGSSIKSERVSHSGNKRLKRALFLS
FT                   AFAVIRTDPVSRAYYDRKRAQGKRHNQAIIALAHRRLTVLYAMLRDGTLYDVPDTALAA
FT                   "
FT   gene            complement(132085..133986)
FT                   /locus_tag="Arch_0102"
FT   CDS_pept        complement(132085..133986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0102"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterProIPR020635:IPR002290:IPR005543:IPR017442:IPR
FT                   005503:IPR000719:IPR011009:IPR017441:IPR008271; KEGG:
FT                   xce:Xcel_0018 serine/threonine protein kinase with PASTA
FT                   sensor(s); PFAM: Serine/threonine-protein kinase-like
FT                   domain; flagellar basal body-associated protein FliL; PASTA
FT                   domain containing protein; SMART: serine/threonine protein
FT                   kinase; Tyrosine-protein kinase, subgroup, catalytic
FT                   domain; PASTA domain containing protein; SPTR: D0WKX3
FT                   Putative serine/threonine protein kinase; PFAM: Protein
FT                   kinase domain; PASTA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91866"
FT                   /db_xref="GOA:D7BLR7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLR7"
FT                   /protein_id="ADH91866.1"
FT                   /translation="MTNIPRMLGGRYEVGDLIGRGGMAQVHIGYDTRLSRTVAIKVLRS
FT                   DHVSDQTFVARFRREAQSAAALNHPAIVAVYDTGEEHITSDEGKTVSLPYIVMEYVKGR
FT                   TVSELLKNGDALPINEAVQIAVGILSALEYSHREGIVHRDIKPGNIMLTHDGKVKVMDF
FT                   GIARALTNSSATMTQTNSVVGTAQYLSPEQARGEVVDSRSDLYSTGCLLYELLTGRPPF
FT                   RGDSAVAVAYQHVSEMPVSPAAIAPDIPDSIDRVVMKSLAKKREDRYQRAIDMRSDLLN
FT                   ALRGGNVSAPASASWSTQVMAAPHVPATTDGAATTVSPALTQTGITPAVEPNKKKNVVM
FT                   IVLAVLLLVLAVAGLAWALTSGGSDDEKATETVTVPDLSGTDQVTARQRLEDAGLVFVL
FT                   GDPQEHKDIPEGQFVSSDPAFGSQVKRGSDVVVSFSAGAGTVAIPDLTGGTFNQDAAKK
FT                   ELEKLGLKVGRVDVKDVPGRAKDTVTETLPAAGQQVAPGTSINIVVASGEILIDESVTS
FT                   KIIGQTREAAEAYLNDTLKISSITVETEENQAFTEGTISRMEPMPGKVPFNTKVTLWVA
FT                   KKPAERVPAPSQPGTGNGNGSGNGGGSHDRPGSNDSNKPRKPGGDQVPAPPEDSERP"
FT   gene            complement(134071..135516)
FT                   /locus_tag="Arch_0103"
FT   CDS_pept        complement(134071..135516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0103"
FT                   /product="penicillin-binding protein transpeptidase"
FT                   /note="COGs: COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2; InterPro
FT                   IPR001460:IPR012338; KEGG: jde:Jden_0172 peptidoglycan
FT                   glycosyltransferase; PFAM: penicillin-binding protein
FT                   transpeptidase; SPTR: D0WKX2 Penicillin-binding protein 2;
FT                   PFAM: Penicillin binding protein transpeptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91867"
FT                   /db_xref="GOA:D7BLR8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLR8"
FT                   /protein_id="ADH91867.1"
FT                   /translation="MNPSIRKLTAIIIVMFLTLMAAISYIQFFKAPELNADARNVRTLW
FT                   REFGTDRGPIIVAGEPIVTSEPFPDEYKFLRTYHQAELYASITGYFSTTFNSMTGLERE
FT                   ENAVLGGSDSSLFSQRIERLITGRQPKGGAVSLTINPQAQKAAWDALGDRRGAVVAIEP
FT                   STGKILALVSKPAYNPNSLASRDSNVANDAWNALNNDPHKPLINRAIGGDLYPPGSVFK
FT                   VITAAAMIEHLGLNAESVVEAPDSFTPAGTSHEIFNPYKEKCGDGSGHVPFITALTESC
FT                   NTPFAIGGTKVGAEKMVDMAKAFGFNQKLSIPLPVTPSQFPYPEDSAALAMDSFGQRDI
FT                   ETSPLAMAMVASAVANNGVLMKPYLVDQTLTADLGVLSETQPSELSTPISPSTADILRT
FT                   MMINVVNHGTGVNAGLKNTQIAGKTGTAEIGTGGDAHAWFIGFDAVEHPQVAVAVVVEE
FT                   GQSGSKVAAPIAQRVFSAVLNRD"
FT   sig_peptide     complement(135409..135516)
FT                   /locus_tag="Arch_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(135513..137006)
FT                   /locus_tag="Arch_0104"
FT   CDS_pept        complement(135513..137006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0104"
FT                   /product="cell cycle protein"
FT                   /note="COGs: COG0772 Bacterial cell division membrane
FT                   protein; InterPro IPR001182; KEGG: bcv:Bcav_0029 cell cycle
FT                   protein; PFAM: cell cycle protein; SPTR: D0WKX1 Cell
FT                   division protein FtsW; PFAM: Cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91868"
FT                   /db_xref="GOA:D7BLR9"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLR9"
FT                   /protein_id="ADH91868.1"
FT                   /translation="MSVVSTRPARSGRNQELGLLILAFVIPLAAWILVHYGVASSHPDD
FT                   VLPPYFGAIAGGGAVFLLACHMVIRRLAPYADPILFPAAVALTGIGLTMIYRIDFQLVN
FT                   RGDPPETRGQLVLTVVAILLLIATVAFLRDHRWLRRITYSSLIAGLVLLLLPLVPVLGV
FT                   EVYGAQLWINILGFSYQPAELAKILLTVFFAGYLVAQRDNLSLAGPKVLGIHFPRLRHS
FT                   MPILVAWLSCMGILALERDFGTALLFFGLFVAMLYVATERTSWIVIGGVLSSLGVYAIV
FT                   QIMPHIQARFTIWLHALDPEVYSAKYGSYQLVQGWFGMASGGLFGTGLGEGSPANSFAA
FT                   NSDFIIASLGEELGLVGLLSLLSLYVLIVTRAMKIGITLRDGFGKLLAAGLGFTIALQC
FT                   FVVVGGITRVIPLTGLAMPFLAKGGSALLTNFIIIGILIRMSDSARRPFTPASTPLSTI
FT                   STGELPQDLQSPPRDDPKTSSEDSLETTAVPRIGGHEIS"
FT   sig_peptide     complement(136884..137006)
FT                   /locus_tag="Arch_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(137003..138322)
FT                   /locus_tag="Arch_0105"
FT   CDS_pept        complement(137003..138322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0105"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="COGs: COG0631 Serine/threonine protein phosphatase;
FT                   InterPro IPR001932:IPR014045; KEGG: bcv:Bcav_0030 protein
FT                   serine/threonine phosphatase; PFAM: Protein phosphatase
FT                   2C-like; SMART: protein phosphatase 2C domain protein;
FT                   SPTR: D0WKX0 Protein phosphatase 2C; PFAM: Protein
FT                   phosphatase 2C"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91869"
FT                   /db_xref="GOA:D7BLS0"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLS0"
FT                   /protein_id="ADH91869.1"
FT                   /translation="MIRFEYAAFSDVGLVRKSNQDAGYASSHLLVLADGMGGAAGGDVA
FT                   SSVVVGQMAQIDDSHQAEDLLPLLKRQLNQAQNELLVRVAENPELAGLGTTCIAILRTA
FT                   NKLGMVHVGDSRAYLLRQGRLTQITRDHTLVQYLVDHGQLSPEEALHHPKRHVIMRNVG
FT                   DASGPVEADSSVREALPGDRWLLSSDGLFDVVSDETIEDTLRSYRDVDECGERLIDLAL
FT                   AGGAPDNVTIVLADVIDDSGTGSSYDRGPLVVGSAAVDRRKPTRAGSSSAGQLAALAAA
FT                   SRPAVAPVEDDDDDAAPPRRRWIARLAAWLVVVVALAVGLGAGYMWTQSRYYVAADQGK
FT                   VVIFKGIPQTVGPLELSEKFEETGIMVKNLNPVARQRLDMPITRSSLEEARQVVKDLAA
FT                   QKLVVQNPVKQPSPFSPSVVPPPGYQIPEQNDPMGSGDSR"
FT   gene            complement(138319..138783)
FT                   /locus_tag="Arch_0106"
FT   CDS_pept        complement(138319..138783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0106"
FT                   /product="FHA domain containing protein"
FT                   /note="COGs: COG1716 FOG: FHA domain; InterPro
FT                   IPR000253:IPR008984; KEGG: jde:Jden_0175 FHA domain
FT                   containing protein; PFAM: Forkhead-associated protein;
FT                   SMART: Forkhead-associated protein; SPTR: D0WKW9 Putative
FT                   FHA domain protein; PFAM: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91870"
FT                   /db_xref="GOA:D7BLS1"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLS1"
FT                   /protein_id="ADH91870.1"
FT                   /translation="MSALVVTLLRFGFLVLVWLLVIFMLVTIRNDIFGTKIRDRARKPS
FT                   AVAQSSREEPVSSLPRHLVVVRGPLTGTALPLGSSSITVGRSPDSALVLDDGYASSRHA
FT                   RFYREGDQWFIEDLNSTNGTWVGTSKIVGPVQLEVGVPVVIGKTSMELRR"
FT   sig_peptide     complement(138715..138783)
FT                   /locus_tag="Arch_0106"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(138780..139478)
FT                   /locus_tag="Arch_0107"
FT   CDS_pept        complement(138780..139478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0107"
FT                   /product="FHA domain containing protein"
FT                   /note="COGs: COG1716 FOG: FHA domain; InterPro
FT                   IPR000253:IPR008984; KEGG: bcv:Bcav_0032 FHA domain
FT                   containing protein; PFAM: Forkhead-associated protein;
FT                   SMART: Forkhead-associated protein; SPTR: C1RFN6 FHA
FT                   domain-containing protein; PFAM: Protein of unknown
FT                   function (DUF2662); FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91871"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLS2"
FT                   /protein_id="ADH91871.1"
FT                   /translation="MGAFDKFEKSVENAVENVFSRAFKSDVKPIELASALKRTMDDRAA
FT                   EVSRDRTVSPNEFTLTLSSHDFAKISEWDEDALRDELVGVATDYACEQAYVFLGPVTIE
FT                   FAESEVQPRGKIEVACHTRRGPVAPATTSEASPQNPIIDVEGQRYILTGAITVIGRGSV
FT                   SDIQVDDAGVSRKHLELRVTPAGVIATDLGSTNGSFVEGHRISAATLVDGNTLTIGRTR
FT                   IMFWTSAEPA"
FT   gene            139703..139789
FT                   /locus_tag="Arch_R0003"
FT   tRNA            139703..139789
FT                   /locus_tag="Arch_R0003"
FT                   /product="tRNA-Leu"
FT   gene            complement(139990..140796)
FT                   /locus_tag="Arch_0108"
FT   CDS_pept        complement(139990..140796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0108"
FT                   /product="protein of unknown function UPF0126"
FT                   /note="COGs: COG2860 membrane protein; InterPro IPR005115;
FT                   KEGG: krh:KRH_07930 hypothetical protein; PFAM: protein of
FT                   unknown function UPF0126; SPTR: B2GKC0 Hypothetical
FT                   membrane protein; PFAM: UPF0126 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91872"
FT                   /db_xref="GOA:D7BLS3"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLS3"
FT                   /protein_id="ADH91872.1"
FT                   /translation="MDPESLFRLVDVLGVIANALIGSALARILGYDLIGFLVLGTGTAL
FT                   GGGITRDVMLGVGFPVALTDPWYLGGAFAASIIAYLIPFEGKWSQRMLSLADVLALGCW
FT                   SATGASKGLSAGLDWIPSIFLGVVTATMGGLLRDVMVNRIPAIFGGSPLYATFSVVAAT
FT                   QMVIFQHYGMYKAGMGSAILMCAVFGLLARKFDWQLPRNAYDLRQYSARLRQLRIKPRH
FT                   AVDSTSPLAESDIAAASTKGVAQAGREFRHKIRPDEPRVPRNLRDT"
FT   gene            complement(140822..141730)
FT                   /locus_tag="Arch_0109"
FT   CDS_pept        complement(140822..141730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0109"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="COGs: COG2110 phosphatase homologous to the
FT                   C-terminal domain of histone macroH2A1; InterPro IPR002589;
FT                   KEGG: sse:Ssed_1314 hypothetical protein; PFAM: Appr-1-p
FT                   processing domain protein; SMART: Appr-1-p processing
FT                   domain protein; SPTR: D0WKT6 Appr-1-p processing enzyme
FT                   family domain protein; PFAM: Macro domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91873"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLS4"
FT                   /protein_id="ADH91873.1"
FT                   /translation="MLLLSDYRQAINLDEPFPEPKNDTRSDYDLLMTALGGITEKHYTG
FT                   TSSLAHLSTDEGLLRWLQSELAVRDPKPLDPISSRAINTLLFRQVGRHGRVEAENLRRV
FT                   SDMIPDCDYGPAPRTVLFRGDMRQLVVDAVVNPAVPDLNGCMVPLHSCLDSMLHEQAGP
FT                   WMRTDTTTIRELNGGKGLEPADAIITRGYRLPAKYVIHTTGPRIKNGKVTKKDRETLFK
FT                   AYWNCMELACAKGDIRSIAFPGISTGYGGFPLEEATQIALTAVERWIYQHDHILDLVVL
FT                   SLRTDSDAEKVLRQLATWIES"
FT   gene            141801..142385
FT                   /locus_tag="Arch_0110"
FT   CDS_pept        141801..142385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0110"
FT                   /product="ribonuclease H"
FT                   /note="COGs: COG0328 Ribonuclease HI; InterPro
FT                   IPR002156:IPR012337; KEGG: mmr:Mmar10_2217 RNase HI; PFAM:
FT                   ribonuclease H; SPTR: D0WKT5 Ribonuclease HI; PFAM: RNase
FT                   H"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91874"
FT                   /db_xref="GOA:D7BLS5"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLS5"
FT                   /protein_id="ADH91874.1"
FT                   /translation="MKFSHQESLFSIFSEIDDDEQSVASASTPRVPAGAVETNVGHPIG
FT                   RPSSSHTLVIATDGACSGNPGPGGWAFVDQTRGYGLSGGAAQTTNNIMELTAMMRALEY
FT                   AGPDVDLLLRVDSKYVIDSMTKWAPGWRKRGWRKADGKPVLNRELIERILNLYEARTGR
FT                   TDVEWVRGHNGDPGNDLADRLAVEQSNAYKK"
FT   gene            142428..144605
FT                   /locus_tag="Arch_0111"
FT   CDS_pept        142428..144605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0111"
FT                   /product="Oligopeptidase B"
FT                   /EC_number="3.4.21.83"
FT                   /note="COGs: COG1770 Protease II; InterPro
FT                   IPR004106:IPR001375:IPR002470; KEGG: bfa:Bfae_03460
FT                   oligopeptidase B; PFAM: peptidase S9 prolyl oligopeptidase
FT                   active site domain protein; peptidase S9A prolyl
FT                   oligopeptidase domain protein beta-propeller; PRIAM:
FT                   Oligopeptidase B; SPTR: D0WKS9 Protease II; PFAM: Prolyl
FT                   oligopeptidase, N-terminal beta-propeller domain; Prolyl
FT                   oligopeptidase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91875"
FT                   /db_xref="GOA:D7BLS6"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLS6"
FT                   /protein_id="ADH91875.1"
FT                   /translation="MSEEMMHAPRLAKNPVTRSFHGDDVVDNYEWIREDSNPAVIAHIE
FT                   AENAWADARTAHLAPLRETLVGEFAGHTKEDDISVPVRDGDYWYWRRTFEGKSYAASYR
FT                   CAAVGDGCGAADIPDVGSVEAELLYDGNVLAEGKEFFSLGIASVSPNGKLLALGVDNAG
FT                   DEQFAVRISRIDCDETVDESLLNMGYGLVWSEDSTRVYYTRNDDAWRSYQVWMHTVGES
FT                   ADQDVLLYQEDDELFWVGIDGSRDGEWLVVQSESKMTAEVRLFATQAPERNFIVSERRS
FT                   GLHYTVEPAGDCLLIVHNRTNVDFDLALAPIGPSEPETWVPLYEALPGQRLAEVVAFRD
FT                   FAVLNMRDGGAMQLRAFPRSVPAEGEGVSGLGVYSGEAGYAGPGAKRETWGTGIVIPTE
FT                   ELATLGFYGNDVWGAREVGFSVESVLTPDTFQRWNLDTGAIVTVKETEVPNYDRSAFVQ
FT                   YREWVDAADGARIPMTIVHRADLVKDSSNAGIIYGYGSYEISNDPWFSPTILSALERGV
FT                   VYAVAHVRGGGEMGRAWYDDGKMLSKRNTFTDFVACARWMAESGLVDAGRLAAEGGSAG
FT                   GLLMGAVANLAPDAFRVVHAIVPFVDALNTILKPELPLTVGEWEEWGNPIESEEVYRYM
FT                   KSYTPYENVAAVEYPAIMASTSLNDIRVSYIEPTKWIQALRDTVTNDEIARPIIQRTEM
FT                   VAGHGGGSGRYKKWEERAAQLAFIFDQIGVK"
FT   gene            144736..145677
FT                   /locus_tag="Arch_0112"
FT   CDS_pept        144736..145677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0112"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR011335; KEGG: bfa:Bfae_23020
FT                   hypothetical protein; SPTR: C2KMY9 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91876"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLS7"
FT                   /protein_id="ADH91876.1"
FT                   /translation="MWRLSTYPHPATFRAAAVCDHEGMHPHIYRAEHILGQVHTRGAAS
FT                   INALCKAGTVVDVGHHRYAFAEELGRGLDARVVYAAENGLLIGCLTACEHWGLWTPPSL
FT                   TTPDTHYIQSRGSNRNQPRTGKVHRQLAHGCFGNHLSPARSSQIISPPNDAIEHVLRYH
FT                   DAETGLIVLESALYQRFIYPNHADAMIGIAQKVKRPILERYELETQSGSETRVRNFLQS
FT                   RQVSVQPQVFIPQLGRVDLLVGTSLIIECDSQEFHSQPLNVAEDRRRDQVALRLGYTVV
FT                   RLSYRDVWFQWEKTQEYISNLLKKRVHRRRIP"
FT   gene            complement(146096..147433)
FT                   /locus_tag="Arch_0113"
FT   CDS_pept        complement(146096..147433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0113"
FT                   /product="MTA/SAH nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /note="COGs: COG0775 Nucleoside phosphorylase; InterPro
FT                   IPR000845:IPR010049; KEGG: krh:KRH_15970
FT                   5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase;
FT                   PFAM: purine or other phosphorylase family 1; PRIAM:
FT                   Adenosylhomocysteine nucleosidase; SPTR: D0WKS8
FT                   Methylthioadenosine nucleosidase/adenosylhomocysteine
FT                   nucleosidase; TIGRFAM: MTA/SAH nucleosidase; PFAM:
FT                   Phosphorylase superfamily; TIGRFAM:
FT                   5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91877"
FT                   /db_xref="GOA:D7BLS8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLS8"
FT                   /protein_id="ADH91877.1"
FT                   /translation="MKHIDALVISAMDEEMAPFLDLVRACNLKPIESPTGTAYQASKGS
FT                   MRMVLMVTRVGMTACASALGWALGHYAPKVIVSIGSAGGLAADSRVGHIVVGADYMNGG
FT                   ADGTAFGYTRGQVPGQPVSFHGDTTMIETIERFVASPESDGLTIRVGSMLSSDAFVTEA
FT                   NVTDTREAFPGALSADMESHAAAQVAHAWGIPFVSIRGISDLCGKPDDQAVSFHAELSE
FT                   VAGAAAKVACFALQNSGYISMARCTTQRFAVPTLTSALFVMLARRYRLPAGDPAILDPE
FT                   AMKTVYEDISRFSADTIRQLIDDMSAGKALAKAEPGSVLTVKDYDRLRAEFIDSVAGAQ
FT                   TGTFAWPPTSQTIIKRFDGYWNEALKAIGLIPRQGRTRGGVKYSPEDYRDAIATYVTNA
FT                   QATGVQPSFAGYSEYVKEAPDMENLPSGAAVRQHFGSWSKALEAAN"
FT   gene            complement(147430..147891)
FT                   /locus_tag="Arch_0114"
FT   CDS_pept        complement(147430..147891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0114"
FT                   /product="quorum-sensing autoinducer 2 (AI-2), LuxS"
FT                   /EC_number="4.4.1.21"
FT                   /note="COGs: COG1854 LuxS protein involved in autoinducer
FT                   AI2 synthesis; InterPro IPR003815:IPR011249; KEGG:
FT                   pac:PPA0450 S-ribosylhomocysteinase; PFAM: LuxS protein;
FT                   PRIAM: S-ribosylhomocysteine lyase; SPTR: D0WKS7
FT                   S-ribosylhomocysteinase LuxS; PFAM: S-Ribosylhomocysteinase
FT                   (LuxS)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91878"
FT                   /db_xref="GOA:D7BLS9"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLS9"
FT                   /protein_id="ADH91878.1"
FT                   /translation="MPHMNVESFNLDHRHVSAPYVRIADVKRLPHGDVLTKYDVRFTQP
FT                   NVAHLDMPAIHSIEHSFAEYARNHADDIVDFSPMGCQTGFYLIRASEPDIPGTLDLIAT
FT                   TFHDILNATSVPAANNIQCGWGANHSLEAAQTAVRAMLAERTTWENVNA"
FT   gene            148131..148382
FT                   /locus_tag="Arch_0115"
FT   CDS_pept        148131..148382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0115"
FT                   /product="glutaredoxin-like protein NrdH"
FT                   /note="COGs: COG0695 Glutaredoxin and related protein;
FT                   InterPro IPR002109:IPR012335:IPR011909:IPR012336; KEGG:
FT                   bcv:Bcav_0095 glutaredoxin-like protein NrdH; PFAM:
FT                   glutaredoxin; SPTR: D0WKQ6 Glutaredoxin; TIGRFAM:
FT                   glutaredoxin-like protein NrdH; PFAM: Glutaredoxin;
FT                   TIGRFAM: Glutaredoxin-like protein NrdH"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91879"
FT                   /db_xref="GOA:D7BLT0"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011909"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLT0"
FT                   /protein_id="ADH91879.1"
FT                   /translation="MSITLYTKPACVQCTATKRALVKHGLDFTEVDLTQHPHALETVKA
FT                   LGYQQAPVVFADGDHWSGYRPDLIKRLAGASAPVALRA"
FT   gene            148417..148818
FT                   /locus_tag="Arch_0116"
FT   CDS_pept        148417..148818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0116"
FT                   /product="NrdI protein"
FT                   /note="COGs: COG1780 Protein involved in ribonucleotide
FT                   reduction; InterPro IPR004465; KEGG: bfa:Bfae_24920
FT                   ribonucleoside-diphosphate reductase 2, operon protein
FT                   NrdI; PFAM: NrdI family protein; SPTR: D0WKQ5 NrdI protein;
FT                   TIGRFAM: NrdI protein; PFAM: NrdI Flavodoxin like; TIGRFAM:
FT                   ribonucleoside-diphosphate reductase 2, operon protein
FT                   nrdI"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91880"
FT                   /db_xref="GOA:D7BLT1"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLT1"
FT                   /protein_id="ADH91880.1"
FT                   /translation="MVYVVYFSSTTENTKRFVEKLGFRADRIPLLPTEKPLVVGEDYVL
FT                   IVPTYGGGNERGAVPKQVIKFLNNEHNRSHIRGVISGGNTNFGEAFGLAGDIISAKTHV
FT                   PHMYRYELLGTPVDVQKVREGLTQWWTGS"
FT   gene            148800..150950
FT                   /locus_tag="Arch_0117"
FT   CDS_pept        148800..150950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0117"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /note="InterProIPR013554:IPR013509:IPR000788:IPR013346:IPR
FT                   008926; KEGG: mtb:TBMG_00917 ribonucleoside-diphosphate
FT                   reductase subunit alpha NrdE; PFAM: ribonucleotide
FT                   reductase large subunit; Ribonucleotide reductase domain
FT                   protein; Ribonucleotide reductase large subunit domain
FT                   protein; SPTR: D0WKQ4 Ribonucleoside-diphosphate reductase,
FT                   alpha subunit; TIGRFAM: ribonucleoside-diphosphate
FT                   reductase, alpha subunit; PFAM: Ribonucleotide reductase
FT                   N-terminal; Ribonucleotide reductase, all-alpha domain;
FT                   Ribonucleotide reductase, barrel domain; TIGRFAM:
FT                   ribonucleoside-diphosphate reductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91881"
FT                   /db_xref="GOA:D7BLT2"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLT2"
FT                   /protein_id="ADH91881.1"
FT                   /translation="MVDRIMTDTGEETVGDGLDYHALNAQLNLYDADGKIQFESDREAA
FT                   RQYFLQHVNRNTVFFHSLEEKLDYLITEGYYEPKVFDAYSDDDVKALYKQAYAHKFRFP
FT                   TFLGAFKYYTSYTLKTFDGKRYLERFEDRVVVVALTLAAGNVELAKNLVDEILTGRFQP
FT                   ATPTFLNAGKKARGELVSCFLLRVEDNMESISRGINSALQLSKRGGGVALNLSNLRELG
FT                   APIKRIENQSSGVNPVMKLLEDAFSYANQLGARQGAGAVYLHAHHPDIMRFLDTKRENA
FT                   DEKIRIKTLSLGVVIPDITFELAKKNADMYLFSPYDVERVYGVPFTEISVTEKYEEMVD
FT                   DRRIRKTKINARQFFQTLAEIQFESGYPYIVYEDTVNRANPIDGRITMSNLCSEILQVS
FT                   EPSRYNADLSYEHVGKDISCNLGSLNIAKTMDSPDFGQTVETAIRALTAVSDQTNIAAV
FT                   PSIERGNDMSHAIGLGQMNLHGYLGREKIFYGSDEALDFTNIYFYTVAYHAIRSSMLIA
FT                   KERGVRFEGFERSAYADGSYFAKYIEREWAPETARVRELFANVHIPTVADWVALRDAVA
FT                   AHGMYNQNLQAVPPTGSISYINHSTSSIHPIVSKIEIRKEGKIGRVYYPAAYLTNDNKE
FT                   YYQDAYEIGPKAIIDTYAAATQHVDQGLSLTLFYPDTVTTRDVNKSYIYAWRKGIKSLY
FT                   YMRIRQAALDGTEVEGCVSCML"
FT   gene            complement(151151..151406)
FT                   /pseudo
FT                   /locus_tag="Arch_0118"
FT   gene            151535..152509
FT                   /locus_tag="Arch_0119"
FT   CDS_pept        151535..152509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0119"
FT                   /product="Ribonucleoside-diphosphate reductase"
FT                   /EC_number="1.17.4.1"
FT                   /note="COGs: COG0208 Ribonucleotide reductase beta subunit;
FT                   InterPro IPR000358:IPR012348:IPR009078; KEGG: mab:MAB_3404c
FT                   ribonucleotide-diphosphate reductase subunit beta; PFAM:
FT                   ribonucleotide reductase; PRIAM: Ribonucleoside-diphosphate
FT                   reductase; SPTR: D0WKN6 Ribonucleoside-diphosphate
FT                   reductase, beta subunit; PFAM: Ribonucleotide reductase,
FT                   small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91882"
FT                   /db_xref="GOA:D7BLT3"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLT3"
FT                   /protein_id="ADH91882.1"
FT                   /translation="MSEKIKLVDSVQAINWNKIIDEKDQEVWDRLTGNFWLPEKIPLSN
FT                   DIQSWNTLKPHEQLMTTRVFTGLTLLDTVQGTVGAISLIPDAITPHEEAVLTNIAFMES
FT                   VHAKSYSSIFSTLISSQEIEETFRWSEENPYLQKKAQIVLDYYRGDDPEKRKVASTMLE
FT                   SFLFYSGFYAPMYWSAHAKLTNTADLIRLIIRDEAVHGYYIGYKYQQAVKRASAERQAE
FT                   LMDYTYSLLEDLYENEEGYTESLYDEMGLTEDVKMFLRYNANKALMNLGYEALFPADQT
FT                   AVNPAILAALSPNADENHDFFSGSGSSYVIGTAEATEDEDWDF"
FT   gene            152460..152690
FT                   /locus_tag="Arch_0120"
FT   CDS_pept        152460..152690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91883"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLT4"
FT                   /protein_id="ADH91883.1"
FT                   /translation="MLLALPKPPKTKTGISEGLEGLAGLNKLLAGARSARSGTAVFYMA
FT                   LLSCVPLIWDFHGVGLGRQGSGLVEDWAARA"
FT   gene            152747..153319
FT                   /locus_tag="Arch_0121"
FT   CDS_pept        152747..153319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0121"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="COGs: COG0394 Protein-tyrosine-phosphatase; InterPro
FT                   IPR017867:IPR000106; KEGG: kra:Krad_3711 protein tyrosine
FT                   phosphatase; PFAM: Protein-tyrosine phosphatase, low
FT                   molecular weight; SMART: Protein-tyrosine phosphatase, low
FT                   molecular weight; SPTR: D0YS62 Low molecular weight
FT                   protein-tyrosine-phosphatase; PFAM: Low molecular weight
FT                   phosphotyrosine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91884"
FT                   /db_xref="GOA:D7BLT5"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLT5"
FT                   /protein_id="ADH91884.1"
FT                   /translation="MKILVVCTGNICRSPMGEIVLRDVAARAGLAVEVSSAGVSAEETG
FT                   NPIDRRAAAVLREKGYDVPRDHYAHQASAAELADADLILAMTTGHARALRRMVLAAGLG
FT                   ADHVERIHLWREFDGTTRVAPRGAFCPGGPLEGQEKVAAGRGSDFYTSNGELDVLDPWY
FT                   GDSSGFYDTLEMAEVGARGIVEWVSRS"
FT   gene            complement(153345..153809)
FT                   /locus_tag="Arch_0122"
FT   CDS_pept        complement(153345..153809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0122"
FT                   /product="protein of unknown function SprT"
FT                   /note="InterPro IPR006640; KEGG: nca:Noca_3805 protein of
FT                   unknown function SprT; SMART: protein of unknown function
FT                   SprT; SPTR: A1SNC0 Putative uncharacterized protein; PFAM:
FT                   SprT-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91885"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLT6"
FT                   /protein_id="ADH91885.1"
FT                   /translation="MNLDDAYRMGRRLMDQHGLAEWTLEFDRAKRRAGATHFAHTKITL
FT                   SRALTEACPETTVRDTILHEIAHAIVGPRHGHDDVWRRTCVKIGGTGAARLEGAPQIPG
FT                   AWVGKCPAGHEIQRHRRPTRPMSCATCQPKRFSAEHQFVWRRRLGAADQA"
FT   gene            153866..154537
FT                   /locus_tag="Arch_0123"
FT   CDS_pept        153866..154537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0123"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsh:Rsph17029_3288 hypothetical protein; SPTR:
FT                   D0WKM7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91886"
FT                   /db_xref="GOA:D7BLT7"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLT7"
FT                   /protein_id="ADH91886.1"
FT                   /translation="MSGTDLVLRMSRAALPANRPIDHARRASAALAAGFLFGAVVGMLL
FT                   FIDEVPLLRMLLVLLPAVAFGLIAAAFWWVWIPARGEPIPVVARVVGTNESTFAREVHS
FT                   GGGRGILVPVVALPVGGGAPFSTMVTVRSAEPPVGALLPLFQVEPGLGELVEGSTTTPA
FT                   QRELIDKIVKRPKLLPNKAEILPVRRGPLERTPLWAAVEWWACAGGAAFAAMLFVGSLR
FT                   G"
FT   sig_peptide     153866..153943
FT                   /locus_tag="Arch_0123"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(155024..155797)
FT                   /locus_tag="Arch_0124"
FT   CDS_pept        complement(155024..155797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0124"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1126 ABC-type polar amino acid transport
FT                   system ATPase component; InterPro
FT                   IPR003593:IPR003439:IPR017871; KEGG: blt:Balat_0551 ATP
FT                   binding protein of ABC transporter; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: A7BC62 Putative
FT                   uncharacterized protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91887"
FT                   /db_xref="GOA:D7BLT8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLT8"
FT                   /protein_id="ADH91887.1"
FT                   /translation="MNTATQPKVHVTNVHKFFGDLHVLKGVSFDVAPGTVTSILGPSGS
FT                   GKSTMLRCINLLETIQAGSIHVDGTLMGYSEKGRKLYELTTKQAAQQRAKIGMVFQRFN
FT                   LFPHKTALENVMEAPVHVLGMAKAEAKKQAEELLTRVGLAERMEHYPAELSGGQQQRVA
FT                   IARALAMKPELMLFDEPTSALDPELVGEVLSVMQDLARDGMTMVVVTHEMGFAREVSDQ
FT                   VIVMDDGKIIEAGSPAEVFDHPTSPRAKEFFSKVL"
FT   gene            complement(155811..156782)
FT                   /locus_tag="Arch_0125"
FT   CDS_pept        complement(155811..156782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0125"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="COGs: COG0765 ABC-type amino acid transport system
FT                   permease component; InterPro IPR000515:IPR010065; KEGG:
FT                   xce:Xcel_0100 polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: D0WQP0 ABC amino
FT                   acid transporter, permease component; TIGRFAM: polar amino
FT                   acid ABC transporter, inner membrane subunit; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component; TIGRFAM: amine acid ABC transporter, permease
FT                   protein, 3-TM region, His/Glu/Gln/Arg/opine family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91888"
FT                   /db_xref="GOA:D7BLT9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLT9"
FT                   /protein_id="ADH91888.1"
FT                   /translation="MPENSSPELIHAVPVRHWGRWISAAVVAVIAYAILNQLIVNPQFQ
FT                   WDVVWANLFKIQIVKAVGWTLALTVAAMVLGIILAVTMAIMRRSENPVLRSVATAYIWF
FT                   FRGTPIYTQLIFWGLIGTLFPTITVGIPGVIDFFTFAPNTIFAERQYTMFLFAVLGLGL
FT                   NEGAYLAEIVRSGLNSVDPGQEEAAKALGMSNGMILRRIVLPQAMRVIVPPTGNETISM
FT                   LKTTSLVTAVPLSLELTHVTNASGFSSFKPIPFLIVAAIWYLVITSVLMVGQYYLEKFY
FT                   GRGAGSGAQTPNARGKKARAGRQAAINASRTTTDDPFAEYTP"
FT   sig_peptide     complement(156711..156782)
FT                   /locus_tag="Arch_0125"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(156788..157693)
FT                   /locus_tag="Arch_0126"
FT   CDS_pept        complement(156788..157693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0126"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="COGs: COG0834 ABC-type amino acid transport/signal
FT                   transduction systems periplasmic component/domain; InterPro
FT                   IPR001320:IPR001638:IPR018313; KEGG: bln:Blon_2021
FT                   extracellular solute-binding protein, family 3; PFAM:
FT                   extracellular solute-binding protein family 3; SMART:
FT                   extracellular solute-binding protein family 3; ionotropic
FT                   glutamate receptor; SPTR: B7GUE2 Extracellular
FT                   solute-binding protein, family 3; PFAM: Bacterial
FT                   extracellular solute-binding proteins, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91889"
FT                   /db_xref="GOA:D7BLU0"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLU0"
FT                   /protein_id="ADH91889.1"
FT                   /translation="MKTLKITAAAAALIFTLGACGSDATSTDADAAATTGDVRATDVSH
FT                   IKKVDEIAALLPESVTADGTLTFGTNAFYAPAEFYAEDGTTLQGFDIDLAHALGQVLGL
FT                   KVSIENAEFAAVIPGIGKTYEAGIAAISVNPERQETVDLHQYYEAGLQWAVPAGNPKKF
FT                   DPADVCGKIIGVQTGTAQDEYLTELNTTDCKDKPVQIQRQAEQPRISLQLAQGQLDAMF
FT                   ADTPVVDFAVLQTNKQIEKIGDPIDVVGLAIATPKGSPTTEAINKALQHLIDTGELAKI
FT                   FTTWGIKDGVATSPMLNPAK"
FT   sig_peptide     complement(157601..157693)
FT                   /locus_tag="Arch_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(157829..161917)
FT                   /locus_tag="Arch_0127"
FT   CDS_pept        complement(157829..161917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0127"
FT                   /product="ATP-dependent helicase HrpA"
FT                   /note="COGs: COG1643 HrpA-like helicase;
FT                   InterProIPR014001:IPR003593:IPR001650:IPR007502:IPR
FT                   011709:IPR014021:IPR010222; KEGG: jde:Jden_0240
FT                   ATP-dependent helicase HrpA; PFAM: helicase-associated
FT                   domain protein; helicase domain protein; protein of unknown
FT                   function DUF1605; SMART: DEAD-like helicase ; AAA ATPase;
FT                   helicase domain protein; SPTR: D0WKL4 ATP-dependent
FT                   helicase HrpA; TIGRFAM: ATP-dependent helicase HrpA; PFAM:
FT                   Helicase conserved C-terminal domain; Helicase associated
FT                   domain (HA2); Domain of unknown function (DUF3418); Domain
FT                   of unknown function (DUF1605); TIGRFAM: ATP-dependent
FT                   helicase HrpA"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91890"
FT                   /db_xref="GOA:D7BLU1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010222"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLU1"
FT                   /protein_id="ADH91890.1"
FT                   /translation="MAKDFRTQFRRRGWRPFSPSQLDARRAVLPAISYPAQLPVSARRE
FT                   DIKAAISASQVVIVAGETGSGKTTQLTKICLELGRGIAGMIGHTQPRRIAARSVASRIC
FT                   DELGVELGGAVGFQVRFTEQVSPSTLVKLMTDGILLAEIQSDPLLRRYDTIIIDEAHER
FT                   SLNIDFLLGYLAQLLPKRPDLKVIITSATIDSQRFAEHFGARMCGGGPGVSAPIVEVSG
FT                   RTFPVEVRYRPLDGIDDAVADSPDLDHSVDQISGIVDAACELMDEGPGDILVFLSGEGE
FT                   IRETQKALRDELGNRFVDPGDHSSVPGAVEVVPLFARLSAAEQQRIFLPHAYRRIVLAT
FT                   NIAETSLTVPGIRYVIDPGTARISRYSPRTKVQRLPIEPISQASANQRSGRCGRVADGI
FT                   AIRLYSEDDFAGRPEFTEPEIQRTSLASVILQMASLGLGTVADFPFIDPPDMKAVRSGV
FT                   QLLEEIGALEPDTRTPVLTKIGHKLARLPIDPRLGRMLLAAVDNGAATEVLVLVAAMSV
FT                   QDVRERPVEFKAQADQLHARFTEPSSDFLAYLNLWRYLRTQQRDLSGSAFRRLCRAEHL
FT                   NWLRFREWQDVVSQLRELAKPLGITLKNIALPTAAQIRQAGEKNNDVSQNRDIVHAVKA
FT                   VGASADAPAADAIHRSLLVGLLSNIGSFDQRKRDYLGARGTHFVMWPGSGLAKRTPDWV
FT                   MAAELVETSRLFARSVAKIDPAWVERAGAHLVKRTYSDPFWSKRDGAAKVHEKVLLYGL
FT                   TVAADRQVLLSSVGTDSARELAREMFIRHALVENQWRTFHQFVKDNRQALADARDVEER
FT                   LRSHGLVADEAAQFVFFDERIPASIVSARHFDSWWKKERHQNPDLLDFTREFLLGETEA
FT                   SDDDFPQQWRQGDITLSISYTFTPGSHADGLTIDVPITLLPQLTDDGFDWLVPGMLDEL
FT                   VVATIRALPKRIRRHLVPAPDVAREIRSLLPAWDSVAHGQPGAPTFEAAFTDAVRKLRS
FT                   IDIDKDAWAEASLPPHLVITFRARSERGAVLDESTSIEHLQRSLAPQTRSAVAQVVKSA
FT                   VAAAVNTPVVDTPALAGTGVPLTTWPAMDSIPEVIETSGAHGHAVRGYPALAEVSAKAG
FT                   TVVELVVRAQPAEQVRDHAAGIVRLLAGELALPDARVSTRWTRRESLAMAASPYKTTQA
FT                   LISDLHIAAVRNLATQWARENKKPLGQLRERTDYEALRTWLKIRVEDEIYRVAQIVVRV
FT                   LETYGEVDSAIRGASSLALINTVTDVRDQVNRLVAPGFIARTPYEYLAHLPRYLAAARI
FT                   RLEKAPTNSADDSLAWQVADISDAIAEEEAAQTMYDPVKAAALVKARWMIEELRVSFFA
FT                   QQLGTSGKVSVQRIRKLVN"
FT   gene            162056..163075
FT                   /locus_tag="Arch_0128"
FT   CDS_pept        162056..163075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0128"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="COGs: COG3021 conserved hypothetical protein;
FT                   InterPro IPR005135; KEGG: bcv:Bcav_0233
FT                   endonuclease/exonuclease/phosphatase; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; SPTR: C5BVQ8
FT                   Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91891"
FT                   /db_xref="GOA:D7BLU2"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLU2"
FT                   /protein_id="ADH91891.1"
FT                   /translation="MKFVWGTLSLAIAAIGILLCRPDLTEYTSTLALSTPLAQIISMRF
FT                   WIGAGLIFSALLLAIFAVVRRKLLNMGRIAGALAAMLAVCGVLQFGVILERGLANPGKL
FT                   GPDHGITATARGNGDITVLTYNTLGGKTTPGQIAQLAEANGADVIVLAETAGDRGHELV
FT                   RLLAKRGLRFQHFDTATSKYDPEFRSTILLISETLGKYEQSDTAPAEAAAVSARPVAGN
FT                   GPEIVGVHPIAPMPRFVDSWRKQTRSVYELCSRPNIIVAGDFNSTIDHQLAQGFTCGDG
FT                   AKDAGSGAVGTWPVNTPATLSAPIDRVLYSGSFRGADAAIVTVGGSDHRGLLVRLSTK"
FT   gene            complement(163206..164315)
FT                   /locus_tag="Arch_0129"
FT   CDS_pept        complement(163206..164315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0129"
FT                   /product="Protein of unknown function DUF2183"
FT                   /note="COGs: COG4850 conserved hypothetical protein;
FT                   InterPro IPR019236; KEGG: cgl:NCgl2176 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2183; SPTR:
FT                   D0WKK5 ABC transporter, ATP-binding protein; PFAM:
FT                   Uncharacterized conserved protein (DUF2183)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91892"
FT                   /db_xref="InterPro:IPR019236"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLU3"
FT                   /protein_id="ADH91892.1"
FT                   /translation="MGFAHMARTIEDSINRRGIVKRRRAGWLPNIIGYTGYGSVSAVRV
FT                   LARAVMADPHAHKKPATLPFLPSLTHTYASQTVSDIATFAAETAAEAERGWRQFFTTQV
FT                   GFLPVTVTIGNQTIHTRTDRSGYLDIIVENHGLEPGWHEALITPAAGESINAPIMIVSP
FT                   DATRGLISDIDDTIVVTWLPRAMLAAWNSFVKHTNTRQAVPGMNSFYRTLLEDSPKAPV
FT                   FYLSTGAWNTYPTFLNFIQKNELPIGPMLFTDWGPTPTGLFRSGQEHKKTQLRNLLIMF
FT                   PNIEWFLVGDDGQNDPLIYDELAREHPSRVRGIALRELNPVEQVLSHGSPEAFGKNRED
FT                   CDSEGDGVPVIRGKDGFALDVAARRGFPR"
FT   gene            complement(164516..165271)
FT                   /locus_tag="Arch_0130"
FT   CDS_pept        complement(164516..165271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0130"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011663:IPR011991; KEGG: mva:Mvan_4015 UbiC
FT                   transcription regulator-associated domain-containing
FT                   protein; PFAM: UbiC transcription regulator-associated
FT                   domain protein; regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH; SPTR: A7BEH3 Putative
FT                   uncharacterized protein; PFAM: Bacterial regulatory
FT                   proteins, gntR family; UTRA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91893"
FT                   /db_xref="GOA:D7BLU4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLU4"
FT                   /protein_id="ADH91893.1"
FT                   /translation="MIHQYQPRIELNRTSDTPLHVQISEPIERAITDGTLAAGTAIENE
FT                   ISMARRLNVSRPTARRAMQTLVEQGLLIRRRGKGTIVAPKPRHRIFKLTSLNEELRGQG
FT                   KHPTTHILTYNVMPASHKMAHQLDCLEGAPILELERLRYRDGVPVAVLYNWMRADLAPS
FT                   FADLEKRGLYELIRDSGITIASTTQSVSAERPSRRHAKLLTIPTRQPVLTINRTAFDEH
FT                   GDIIEWGIHTYRGDLYTYESTVFAQGEQG"
FT   gene            complement(165272..166954)
FT                   /locus_tag="Arch_0131"
FT   CDS_pept        complement(165272..166954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0131"
FT                   /product="phosphoglucomutase, alpha-D-glucose
FT                   phosphate-specific"
FT                   /note="COGs: COG0033 Phosphoglucomutase;
FT                   InterProIPR005844:IPR005845:IPR005846:IPR005843:IPR
FT                   016055:IPR005852:IPR016066; KEGG: xce:Xcel_0168
FT                   phosphoglucomutase, alpha-D-glucose phosphate-specific;
FT                   PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase; SPTR: D0WKG6
FT                   Phosphoglucomutase, alpha-D-glucose phosphate-specific;
FT                   TIGRFAM: phosphoglucomutase, alpha-D-glucose
FT                   phosphate-specific; PFAM:
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain II; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain III;
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I; TIGRFAM: phosphoglucomutase, alpha-D-glucose
FT                   phosphate-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91894"
FT                   /db_xref="GOA:D7BLU5"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR005852"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLU5"
FT                   /protein_id="ADH91894.1"
FT                   /translation="MNERAGTLAQPSDLTDIDALVSAYYDIEPDPSNPAQQVVFGTSGH
FT                   RGSAFDGAFNEAHIVATTQAIVEYRRAHGIDGPLYIGRDTHALSEPAERTALEVLAANN
FT                   VEVRIDARRSWTPTPAVSLAILTANGANTADGVRTSGPGLADGIVVTPSHNPPRDGGFK
FT                   YNPPHGGPADSDATSAIAARANDILRDGWRNVARVNYDLALKAETTRGHDYLSAYVDDL
FT                   QSIIDLDAIRTAGVRIGADPMGGASAEYWGAIAERYGLDLTVVNPTVDPAWPFMTLDWD
FT                   GKIRMDCSSLYAMASLLERMKPGVDGRSPFDIATGNDADSDRHGIVTPDAGLMNPNHYL
FT                   AVAINYLFTHRPQWPANAGVGKTLVSSSLIDRVVGSIGRELIEVPVGFKWFVPGLISGK
FT                   IGFGGEESAGASFLRKDGTVWTTDKDGIIMDLLASEITAITGKSPSQLHRELVETFGSS
FT                   SYARIDAAASKTEKAKLAALAPQDVTATELAGEPITARLVEAPGNGAKIGGLKVTTENA
FT                   WFAARPSGTEDVYKIYAESFHGPEHLVRVQNEAKAVVSAALGA"
FT   gene            complement(166980..169562)
FT                   /locus_tag="Arch_0132"
FT   CDS_pept        complement(166980..169562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG0392 integral membrane protein; InterPro
FT                   IPR005242:IPR018170; KEGG: bcv:Bcav_4032 integral membrane
FT                   protein; PFAM: conserved hypothetical protein; SPTR: D0WKF9
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   protein family (UPF0104); TIGRFAM: conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91895"
FT                   /db_xref="GOA:D7BLU6"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLU6"
FT                   /protein_id="ADH91895.1"
FT                   /translation="MSTPLSSRTVTLVDVPQRWMRQPADLVGAIVALLAIAGVVVLSAY
FT                   ARLTVLGVTNDVRAATSSLIEQLFFVPINVLEGVVSFFLPLALIVEMVFKRRWRTLVTA
FT                   IVANLTAPFLAWLAHTVAAELIYGAGLHGTVSLQTFIHPVPYLAAIAALLTVAGSFQGS
FT                   RLVRWGWILTSLVALLLVLQGKQTLPGSVATILLGVSVALLLRFVIGAPPQRVTGAAFV
FT                   DLVRRAGVDPVEIIRYDSPDSVPVSAWSVEARGPVGYVDSGAIRKLAAMWNDDPAITLP
FT                   SISPSRVVSSLDGHHGHMLATTARHKYPTFKPASVSRVYVVRDASGDIFRVHVLDDDRI
FT                   IVGALADLWRQLRLKITYHGAAHTLQEAAQQHVVMQLAVEHAGVSRETFVSDAHADSSV
FT                   CLVYRIPDAPLLDDVDGEDISDSQLDSLWERLQKAHARGFSHGDLHAGCVHLDNAGLHI
FT                   SHWQDGSLMASETVRLVDLVQGLAMLAGIVGVDRAVSSLIRSVPFERIMSLVPLLQKAI
FT                   LPPRTREDFPKSKDVARIREVLEQRLPDVEPMEPVELKRFSPKTIITVSIGVIAVYLLA
FT                   ASVNFTDLSAALKTANPWWMIVSFTSGLLTYLGAAITLKAYTQERVPLGQSILVQVAAS
FT                   LVTLVAPAGIGPAALNLRFLQKKNVGIAPAVATVTVVQLAQFVTTVIFLILLTLVTGEF
FT                   GALSMPSGSIILGIGVTALILSSVFLIKPLRTWILVKIKPTVEQIWPRLVWLGTHPQRL
FT                   AFGFLGSIIMTIAFVACFGCALAAFGYQLPLVTLAVTYLISNSVGSLVPSPGGIGPVEA
FT                   ALTGGLVLAGIPYSVALSTAVLYRLFTFWGRVPLGWIALQIATKRNYI"
FT   gene            complement(169636..171822)
FT                   /locus_tag="Arch_0133"
FT   CDS_pept        complement(169636..171822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0133"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="COGs: COG2217 Cation transport ATPase;
FT                   InterProIPR006121:IPR008250:IPR005834:IPR006403:IPR
FT                   006416:IPR001757:IPR018303:IPR017969:IPR000150; KEGG:
FT                   jde:Jden_2501 heavy metal translocating P-type ATPase;
FT                   PFAM: E1-E2 ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; SPTR: D0WKF6 Copper-exporting
FT                   ATPase; TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase; Heavy-metal-associated domain; haloacid
FT                   dehalogenase-like hydrolase; TIGRFAM: copper-(or
FT                   silver)-translocating P-type ATPase; heavy metal
FT                   translocating P-type ATPase; ATPase, P-type (transporting),
FT                   HAD superfamily, subfamily IC"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91896"
FT                   /db_xref="GOA:D7BLU7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLU7"
FT                   /protein_id="ADH91896.1"
FT                   /translation="MNIDLKISGMTCASCSARVEKKLNKVPGVNAVVNLATERAHVEFP
FT                   ATLTEADLISVVEKAGYGASVVEEADHTDSAAARSADMRRRFVVSAILSIPIIAISMIP
FT                   AWQFAGWQWAITALGIPVAFWGGWPFHRAAFAAGRHGTSTMDTLVSLGVIASMGWSVWA
FT                   LIFGGAGHIGYTMSMSGMLSLDSHGHTHIYVESAAMIVTFLLLGRWLESRSRRKAGDAL
FT                   RLLLSTGAPVAHLITDSGERQIPAEDLQVGDEFMVYAGQKIPTDGLVVSGSSAIDTSLV
FT                   TGESIPVDIQPGGTVIGATLVTNGSIRVRATRVGKDTTLAHMGRLLEQAQVGKAPIQRL
FT                   ADQIAAVFVPGVLILAALTFIARIVFFNNSTDLALASAITVLVVACPCALGLATPTALL
FT                   VGSGKLSQHGILISGPEALENAHSLTAIALDKTGTLTEGKLAITSVSPAPASFDLLPLL
FT                   AGIERHSRHPLAQAIVAHARERNVTLADVSNVREEAGRGITATWNGTTVYVGNPSWLVR
FT                   NGIPVPQNEPDGTVVAAGTPGTGETPGTYFGHVTLTDTPRAHATESLDALRNRGITPIM
FT                   VTGDNPASAAPIAAALGITEIHAGVLPEDKLALVHSLQASGHKVAMVGDGINDAAALAA
FT                   ADLSIAMGSGTDVAQASADVIIVESRITAIPTMLRIGEKTLRIIKENLAWAFGYNLIAI
FT                   PLAMFGVIAPGLAAIAMASSSVIVVANSLRLRNA"
FT   gene            complement(171819..172046)
FT                   /locus_tag="Arch_0134"
FT   CDS_pept        complement(171819..172046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0134"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="InterPro IPR006121:IPR017969; KEGG: mlu:Mlut_21360
FT                   copper chaperone; PFAM: Heavy metal
FT                   transport/detoxification protein; SPTR: C0W4J0 MerTP family
FT                   Hg2+ permease, binding protein; PFAM:
FT                   Heavy-metal-associated domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91897"
FT                   /db_xref="GOA:D7BLU8"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLU8"
FT                   /protein_id="ADH91897.1"
FT                   /translation="MSHTTLKVSGLTCGHCAQHVTEELTELGVSALNVDLNAGGVSTVT
FT                   FESSEPFTDDTIREAIAEAGDYTVESIETK"
FT   gene            complement(172125..173594)
FT                   /locus_tag="Arch_0135"
FT   CDS_pept        complement(172125..173594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0135"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4046 hypothetical protein; SPTR:
FT                   D0WKF3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91898"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLU9"
FT                   /protein_id="ADH91898.1"
FT                   /translation="MTTTYLVAVSDSQAQSFLSNGYDLVAGFAVDAADVADVTDVSALL
FT                   DLLQLRFPGSPFRDDLPLDILHIPADAFTHARHAVGPLHPQAFRGGVIDYAPYDGSGIA
FT                   EGGGVRTDLLLLDPSRLTAGTRLWRFFPGQAEPELRGVYHGIAFGWENVETGEFVACVP
FT                   SPFAGAVVQREWGDVPCDVEIDGDTPVAVTLIAPFNPEAESGFEDLGNGLWAKRIAYDD
FT                   SMRIYTQLVVAQLSGIPVRIIRAVSSEEHDVMFQIVSLLTDAPYCAEVNFQRWAGGTYT
FT                   ALSLPEHLENQHKQEATPVSWSIEGRPAATAVRSEPFHSHDQNTIVQEAFNLLGQTCPP
FT                   AWTEVAMQAQIIGDSVIYEANAKLEGDQGARLKVVPTAILHYMRQLKKLRIASGEGPFF
FT                   TIVIQAVKDGQGSVSLNAEAQPPYADQVSDEQWEKELEIFRASGHPIPEWLSAKALSLP
FT                   RSGSAFGPGASQKEDMPIDLTADISPAPDEA"
FT   gene            complement(173658..174317)
FT                   /locus_tag="Arch_0136"
FT   CDS_pept        complement(173658..174317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0136"
FT                   /product="SNARE associated Golgi protein-like protein"
FT                   /note="COGs: COG0586 membrane-associated protein; InterPro
FT                   IPR015414; KEGG: sro:Sros_4049 alkaline phosphatase; PFAM:
FT                   SNARE associated Golgi protein; SPTR: C4ELT3
FT                   Uncharacterized membrane-associated protein; PFAM: SNARE
FT                   associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91899"
FT                   /db_xref="GOA:D7BLV0"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLV0"
FT                   /protein_id="ADH91899.1"
FT                   /translation="MSGFLTFLAQGADSQNLSGFAGWAVDLMEKLGGIGVALIIAVENV
FT                   FPPIPSEVVLPLAGFTASKGGSLTFVGAVFWATVGSLVGALILYGIAFLFGRERTRAFL
FT                   NWLPLTKESDVDKTEVFFEKHERPAVFFGRMLPIFRSLISFPAGVVNMPLTLFIVLTTI
FT                   GSLIWNMALISAGFFLGENWAIVEDYVGTASKVMAGIVLIGLVAWVIVRVRSRKKM"
FT   gene            complement(174317..174745)
FT                   /locus_tag="Arch_0137"
FT   CDS_pept        complement(174317..174745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0137"
FT                   /product="membrane protein of unknown function"
FT                   /note="COGs: COG1950 membrane protein; InterPro IPR007165;
FT                   KEGG: bcv:Bcav_3970 membrane protein of unknown function;
FT                   PFAM: membrane protein of unknown function; SPTR: C5C571
FT                   Putative uncharacterized protein; PFAM: Membrane protein of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91900"
FT                   /db_xref="GOA:D7BLV1"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLV1"
FT                   /protein_id="ADH91900.1"
FT                   /translation="MVAPVRLGFMKFLIRIVFNAAALWVATLLFTGITLREPTIEQLSS
FT                   LDPQMRTGVALLVAGAILAIVNSFVRPILKLLALPMYILTLGLFFVVVNGAMLMLTGWI
FT                   SGQVGVGIAVDGFVWALVGGIVISVVNTVLEVLVPGKH"
FT   sig_peptide     complement(174680..174745)
FT                   /locus_tag="Arch_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(174764..175528)
FT                   /locus_tag="Arch_0138"
FT   CDS_pept        complement(174764..175528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: jde:Jden_2483 hypothetical protein; SPTR:
FT                   D0WKD9 Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91901"
FT                   /db_xref="GOA:D7BLV2"
FT                   /db_xref="InterPro:IPR025576"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLV2"
FT                   /protein_id="ADH91901.1"
FT                   /translation="MVKRRGAQWVPNYHGAWAMVAIPPLLGVFESGFVWPHVVLLALWW
FT                   LGYFDFFAIGLWLRSGRKARFWPPVVAYTVPCVALGVVLALWVPFLLVWVAIFAPLVGI
FT                   TFWQSAVRADRSMLNDTVTVAAASLMLPVAAHVGHVSGWSRVWIVTVLVFAYFLGTVFY
FT                   VKTNIRKRSSSVWLGLSVAWHVCGLIFACVCCGFDAGASVSFWHCVVWGLLVVRAVAVP
FT                   LWGARHGWMSAKALGVGEIVASLLVTLTLVIR"
FT   gene            complement(175528..176460)
FT                   /locus_tag="Arch_0139"
FT   CDS_pept        complement(175528..176460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_2625 hypothetical protein; SPTR:
FT                   D0WKD8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91902"
FT                   /db_xref="GOA:D7BLV3"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLV3"
FT                   /protein_id="ADH91902.1"
FT                   /translation="MTINFDQFTPADSATPPPSSQNQGQPQPSRAPFYFLVASASILAL
FT                   VAIIVLFMFTIGQGRYIAQAPTAQEKSHANSQDKAHSPQAPADPHAPHDPGSDSSKAVN
FT                   PAPLQDAVSTSSCDQPNKDTAPFFDYVVAATSAHEWFAPQQKVVTDALATLNQRCRHNV
FT                   PHLLALQQAFVDPQAPPQMNALVKDAAWITRERPAPATAQAPTGRFTTGLQNIHCSIGA
FT                   DGAACTIHSHHWDAGGCGAKPTTFTISSISQGPRISCGSPIVAETSYDYGTALANHGYV
FT                   CSLESVGVSCWSEFTGHGFELSRENFREF"
FT   gene            176601..177329
FT                   /locus_tag="Arch_0140"
FT   CDS_pept        176601..177329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0140"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="COGs: COG0710 3-dehydroquinate dehydratase; InterPro
FT                   IPR001381:IPR013785; KEGG: lmc:Lm4b_00514 3-dehydroquinate
FT                   dehydratase; PFAM: dehydroquinase class I; PRIAM:
FT                   3-dehydroquinate dehydratase; SPTR: D0E052 3-dehydroquinate
FT                   dehydratase, type I; PFAM: Type I 3-dehydroquinase;
FT                   TIGRFAM: 3-dehydroquinate dehydratase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91903"
FT                   /db_xref="GOA:D7BLV4"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLV4"
FT                   /protein_id="ADH91903.1"
FT                   /translation="MIFSRDAQTIIVPVLGTTPAMLVDEVRETQAAGADVIEWRIDMLF
FT                   GDHPNFSFSTLGSEIIPQLLEATDLPILLTIRTANQGGEIRVSEGRYRLLLAEMLDTLL
FT                   QLHVPSERIGVDIEYWHRAAPDLAKRAQELGFTVVVSDHNWLSTPDSDILRIMFDDMLA
FT                   IDGAVAKLVVTPQSDEDVDRLLAVTKDVTSETGRMVISVAMGERGQRARLAGWTYGSVA
FT                   TFAAVSRPSAPGQPHISELR"
FT   gene            complement(177746..178249)
FT                   /locus_tag="Arch_0141"
FT   CDS_pept        complement(177746..178249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0141"
FT                   /product="phosphoribosyltransferase"
FT                   /note="COGs: COG2236 phosphoribosyltransferase; InterPro
FT                   IPR000836; KEGG: bfa:Bfae_22270 predicted
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase;
FT                   SPTR: C7MEM7 Predicted phosphoribosyltransferase; PFAM:
FT                   Phosphoribosyl transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91904"
FT                   /db_xref="GOA:D7BLV5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLV5"
FT                   /protein_id="ADH91904.1"
FT                   /translation="MAYHADTTDLTGKEVLLWDQFGIAMRELAQTIADSGFQPEVIIAI
FT                   ARGGLLPAGALTYALGTKLSDAMNIEFYTDIEQTLPDPILLEPLLDMESIKGKKLLVVD
FT                   DVADSGRTLKMAVDMLADLKADVRSAVIYNKPRSVIAPDYSWKATDKWIVFPWSSEPPV
FT                   TPNK"
FT   gene            178587..179525
FT                   /locus_tag="Arch_0142"
FT   CDS_pept        178587..179525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0142"
FT                   /product="periplasmic solute binding protein"
FT                   /note="COGs: COG0803 ABC-type metal ion transport system
FT                   periplasmic component/surface adhesin; InterPro
FT                   IPR006127:IPR006128:IPR006129; KEGG: cdi:DIP0169
FT                   hypothetical protein; PFAM: periplasmic solute binding
FT                   protein; SPTR: Q6NK68 Putative secreted protein; PFAM:
FT                   Periplasmic solute binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91905"
FT                   /db_xref="GOA:D7BLV6"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLV6"
FT                   /protein_id="ADH91905.1"
FT                   /translation="MKVRSALKAGFTALVASAFLLAGCSSAPAGKADKHLDIFATTGYI
FT                   ADAVANIAPDAHVTTMVGPGGDPHTYQPTTKDIEALQNADVVIWSGLHLEAQMLDKLGS
FT                   LGDKQIAVADTLDEKYLLPWPETDENGHELHDPHIWNNPEAWSLAVQAAADKISEIDPA
FT                   NKATYQKNVAKYREEITKTVAEAKKLLDKVAEPRILISGHDAFNYFGKTFNLEVHATDF
FT                   VSSEAKLSTQEISELAKLIADKKVPVIFLDNLANPQAIKALQEAVHANGWDVKISDKEL
FT                   FADSLGAEKGVDTYLGTLMHNARTISEALSK"
FT   sig_peptide     178587..178682
FT                   /locus_tag="Arch_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            179540..180295
FT                   /locus_tag="Arch_0143"
FT   CDS_pept        179540..180295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0143"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1121 ABC-type Mn/Zn transport systems
FT                   ATPase component; InterPro IPR003593:IPR003439:IPR017871;
FT                   KEGG: cag:Cagg_3554 ABC transporter related; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: B8G9N9 ABC
FT                   transporter related; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91906"
FT                   /db_xref="GOA:D7BLV7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLV7"
FT                   /protein_id="ADH91906.1"
FT                   /translation="MKKDSAGTLACSTSNMSVCYRIDPVLYGVDFEVPQGVVMGIVGPN
FT                   GAGKSTLIKAMLGLVKPLTGSASFFGQPLARVRDRVGYMPQSVSVDWDFPTTVIDVVTM
FT                   GTYGKLGWLRRPGRAERAQALEALEATGIADLASRQIGELSGGQRQRVFLARALVQQPD
FT                   LYFMDEPFQGVDAKSQRAIVEVLHRLRSQGKTVVIVHHDLATVADYCDHVTLLNRHIVA
FT                   AGPCETTLTDANIRTAYKVSDDDEWESLA"
FT   gene            180292..181221
FT                   /locus_tag="Arch_0144"
FT   CDS_pept        180292..181221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0144"
FT                   /product="ABC-3 protein"
FT                   /note="COGs: COG1108 ABC-type Mn2+/Zn2+ transport systems
FT                   permease components; InterPro IPR001626; KEGG: cdi:DIP0171
FT                   hypothetical protein; PFAM: ABC-3 protein; SPTR: C0VY74
FT                   Mn2+, Zn2+ ABC superfamily ATP binding cassette
FT                   transporter, membrane protein; PFAM: ABC 3 transport
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91907"
FT                   /db_xref="GOA:D7BLV8"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLV8"
FT                   /protein_id="ADH91907.1"
FT                   /translation="MSLTEFFSDHTFRMVFFGTMTIGFVAGALGSFAYLRKQSMISDVI
FT                   SHSALPGTLVAFLFSVVIVGSDGRNMLALIVGAVIVGTLAVVFTQWIVNNSKVHVDSAM
FT                   AVTLSLFFGVGMLLMRIVADGTFPGKGGIQDYLFGNASTITKEDLYTSLAVGGMALAIV
FT                   AVFWKEFAVRTFDPVHAHMMGVRGPLIDTLMFGSIVIASVIGVRAVGLVVMIAFVITPP
FT                   AAARQWTSRLGSMVILSGTIGALGSGIGAYLAVSLGKVPTGPMIVIVLSAIFIVSLIFS
FT                   PRRSIIMRALARKKARMELKNQLLGRNA"
FT   gene            181218..182102
FT                   /locus_tag="Arch_0145"
FT   CDS_pept        181218..182102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0145"
FT                   /product="ABC-3 protein"
FT                   /note="COGs: COG1108 ABC-type Mn2+/Zn2+ transport systems
FT                   permease components; InterPro IPR001626; KEGG:
FT                   car:cauri_0331 manganese ABC transport system membrane
FT                   protein; PFAM: ABC-3 protein; SPTR: C3PKJ4 Manganese ABC
FT                   transport system membrane protein; PFAM: ABC 3 transport
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91908"
FT                   /db_xref="GOA:D7BLV9"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLV9"
FT                   /protein_id="ADH91908.1"
FT                   /translation="MSFVVGTSLLAIVTALVCALPGTFIVLRQSSMLVDAMSHAILPGI
FT                   VVGYYVTHDFDSPLLIIGAAVAGLIVVLGNDWLMRSGFVSGDAPQGLVFPMLFSIGVIL
FT                   ISLNFGNIHLDTHMVLAGDLNFAAWHQLMIGGVSYGPIYMYVLLIVLALNAIAMWFMYP
FT                   RLKITSFDPTFSSTIGIRARVVDTAFMFLVAVTVTAAFNAAGAILIVALMIAPAATARL
FT                   VSNSMSHMMIWTMGVAVAGAIIGFWIAYVVHAPTSAAMAVCYGLTFIVILVTTKKRSAL
FT                   RRTNPDRTQRADA"
FT   sig_peptide     181218..181337
FT                   /locus_tag="Arch_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(182052..182729)
FT                   /locus_tag="Arch_0146"
FT   CDS_pept        complement(182052..182729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0146"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="COGs: COG1321 Mn-dependent transcriptional regulator
FT                   protein; InterPro IPR001367:IPR007167:IPR011991:IPR008988;
FT                   KEGG: bfa:Bfae_31300 Mn-dependent transcriptional
FT                   regulator; PFAM: iron dependent repressor; FeoA family
FT                   protein; SMART: iron dependent repressor; SPTR: C7MB03
FT                   Mn-dependent transcriptional regulator; PFAM: FeoA domain;
FT                   Iron dependent repressor, metal binding and dimerisation
FT                   domain; Iron dependent repressor, N-terminal DNA binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91909"
FT                   /db_xref="GOA:D7BLW0"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLW0"
FT                   /protein_id="ADH91909.1"
FT                   /translation="MVVSALSESTQNYIKAIWSLGEWSDEPVTASRLAARAGVKLSTAS
FT                   DAIRKLKDQGLVNHAPYGAVHLTEQGQALAVAMVRRHRLIETFLVEVLGYSWDEVHSEA
FT                   EVLEHAVSDVLVERISAQLGNPDRDPHGDPIPAADGTVVRPQAVLLSSIETGGIFRVER
FT                   ISDADPELLRFVEAQGIAYGSRLEVKPPAPYSESIEVSVDAGAPVLLGIGALRAIWVCP
FT                   TEG"
FT   gene            182848..183429
FT                   /locus_tag="Arch_0147"
FT   CDS_pept        182848..183429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0147"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="COGs: COG0717 Deoxycytidine deaminase; InterPro
FT                   IPR008180:IPR011962; KEGG: bcv:Bcav_3823 deoxycytidine
FT                   triphosphate deaminase; PFAM: deoxyUTP pyrophosphatase;
FT                   SPTR: C5C4E1 Deoxycytidine triphosphate deaminase; TIGRFAM:
FT                   deoxycytidine triphosphate deaminase; PFAM:
FT                   2'-deoxycytidine 5'-triphosphate deaminase (DCD); TIGRFAM:
FT                   deoxycytidine triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91910"
FT                   /db_xref="GOA:D7BLW1"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLW1"
FT                   /protein_id="ADH91910.1"
FT                   /translation="MLLSDRDIAQYVESGRIALDPWDPAMIQPSSVDVHLDRFFRLFDN
FT                   HKYNVIDPAAEQAEMTRLVEVDSDGAFVLHPGEFVLGSTFEEVTLGDDVAARLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFSGHVTLELSNTATMPIKLYPGMKVGQLCFFQLSSPAREPYG
FT                   AGANGSRYQGQRGPTASRSHLNFHRVDVTR"
FT   gene            183482..186328
FT                   /locus_tag="Arch_0148"
FT   CDS_pept        183482..186328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0148"
FT                   /product="multisubunit sodium/proton antiporter, MrpB
FT                   subunit; multisubunit sodium/proton antiporter, MrpA
FT                   subunit"
FT                   /note="COGs: COG1009 NADH:ubiquinone oxidoreductase subunit
FT                   5 (chain L)/Multisubunit Na+/H+ antiporter MnhA subunit;
FT                   InterPro IPR001750:IPR007182:IPR003916; KEGG: bcv:Bcav_3818
FT                   NADH dehydrogenase (quinone); PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); Na+/H+
FT                   antiporter MnhB subunit-related protein; SPTR: C5C4D6 NADH
FT                   dehydrogenase (Quinone); PFAM:
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains;
FT                   Domain related to MnhB subunit of Na+/H+ antiporter;
FT                   2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91911"
FT                   /db_xref="GOA:D7BLW2"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLW2"
FT                   /protein_id="ADH91911.1"
FT                   /translation="MLWVLAFFVVGALGAPRLMRAGRLGFLVLAVIPAGAFAWLVVQGP
FT                   RIVAGSVVTESVPWVPQMHVSVDVRIDALSWVLGLIVTGVGSLVLVYCARYFSPNAQGL
FT                   GRFAGVFVAFSGAMLGLVTTDNTLVLYMFWELTTVFSYLLIGHNFSASGSRRAAGQAII
FT                   VTTAGGLAMLAGIVMLGQVPGGSYRLSHLVAAGGELSATHGVLVSSAVVLVLVGALSKS
FT                   ALVPFHFWLPAAMAAPTPVSAYLHAAAMVKAGVYLIARLAPGFSHLDSWRYLVVSAGLT
FT                   TLIVGGFRAMKQFDLKLVLAFGTVSQLGLIIVLVGYGTSAALLAGLALLVAHSLFKSAL
FT                   FLSVGSVDWSTGTRDLRELSGVGRKCPKVAVGAALAGGSMMGLPLTAGFVAKEAALEGL
FT                   LHGSSVDTFTWVMIAIGSAFTVAYTLRFWWGAFATKKGVDPTGTKDASWLMTLPILILA
FT                   TLGIIAGIGASVVERVLIQHATLIPGNPGHLAVFAGFHAAFAITCAIVAGGIGLFVLTK
FT                   RHAAAMHRYDVPLSADAVYRWMIGKLEVLSGWATALTQRGSLPAYISMIVMFILVTVPL
FT                   AFWWGGVGVIRGVRWWDTWAQAGVVLITIVAAVAAARARRRLKAVMLMGVSGYGVALIY
FT                   ELYGAPDLALTQVLVETMSLVVFILVLRKLPVYFSSRPVRTMRWVRITLAVLFGILMSV
FT                   FAWLVAGARTTQPISRLFHDEAYAYGYGKNIVNVTLVDIRAWDTLGEMSVLVACGIGIS
FT                   SLLFIRDREGRVDRFRNIIFPDGSKHAHAGNRVWLAASRLQDSRYHSVIVELGTRLIFH
FT                   AILIASLFFLFSGHNLPGGGFAGGLLAGIALVLRYVAGGRYELGAAVPLHPGHLMGSGM
FT                   VIAAVDALVPIACGGTVLQTAAFEFVLPAFGHVKLATALFFDIGVYIAVVGLVLDIVRS
FT                   LGAEIDRHAEDTMAKEAH"
FT   sig_peptide     183482..183544
FT                   /locus_tag="Arch_0148"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            186328..186786
FT                   /locus_tag="Arch_0149"
FT   CDS_pept        186328..186786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0149"
FT                   /product="multisubunit sodium/proton antiporter, MrpC
FT                   subunit"
FT                   /note="COGs: COG1006 Multisubunit Na+/H+ antiporter MnhC
FT                   subunit; InterPro IPR001133; KEGG: bcv:Bcav_3817
FT                   NADH-ubiquinone oxidoreductase chain 4L; PFAM:
FT                   NADH-ubiquinone oxidoreductase chain 4L; SPTR: C5C4D5
FT                   NADH-ubiquinone oxidoreductase chain 4L; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 4L;
FT                   2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91912"
FT                   /db_xref="GOA:D7BLW3"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLW3"
FT                   /protein_id="ADH91912.1"
FT                   /translation="MESSLALIILAGVLMAVGVYLVLERSLARVIIGLSAITNSVNIVF
FT                   LIAGGASGEPPLVGGAAPEKMADPLVQAMMLTAIVLSLGLTAFLLSVGYRSWQLHGNDE
FT                   VQDDLEDQRLARRSEAAKIAERADKPERIEVDAEAARDETESFEGERV"
FT   sig_peptide     186328..186411
FT                   /locus_tag="Arch_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            186783..188336
FT                   /locus_tag="Arch_0150"
FT   CDS_pept        186783..188336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0150"
FT                   /product="multisubunit sodium/proton antiporter, MrpD
FT                   subunit"
FT                   /note="COGs: COG0651 Formate hydrogenlyase subunit
FT                   3/Multisubunit Na+/H+ antiporter MnhD subunit; InterPro
FT                   IPR001750:IPR003918; KEGG: bcv:Bcav_3816 NADH dehydrogenase
FT                   (quinone); PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   SPTR: C5C4D4 NADH dehydrogenase (Quinone); PFAM:
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain N; 2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91913"
FT                   /db_xref="GOA:D7BLW4"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLW4"
FT                   /protein_id="ADH91913.1"
FT                   /translation="MNPNVLVALPVVVPILGAGLSLASASFRRLQGWISVSILSIVLVV
FT                   DGMLVVLAGSGPLVLDIGGWASPVGISLVADRLSAIMLLTSVAVTLSVLIYSVAQGVAD
FT                   GDDAAPIAVYHPAFLLLSAGVSNAFLSGDLFNIYVGFELLLMASFVLITLGGTRDRIRS
FT                   GTVYIVVSLMSSVVLLIAIALVYASAGTVNLAQLALRLPDVDPGVRLGIQTLLLIGFGI
FT                   KAAVFPLSAWLPDSYPTAPAPVTAVFAGLLTKVGIYTMIRTQTLLFPSNRLDVMLGVFA
FT                   IVTMLAGIFGAVAQQDIKRLLSFTLVSHIGYMLWGISTSTDDGLGAGIYYAVHHITVQT
FT                   ALFLVVGLIERRGGTTSLVKLGSLAKLAPALAVIYFIPALNLAGIPPLSGFFGKIGLMQ
FT                   ASVDRAWGIDWWLIGAGIITSLLTLYAVTRAWNMTFWQEAPQPLESKPIPRGMMLSATV
FT                   LVGLTIGISIGAGPITAYTHDAAAELNARMPYISAVLPDAERGTGQSPHVTEQKEVPHE
FT                   "
FT   sig_peptide     186783..186857
FT                   /locus_tag="Arch_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            188329..188940
FT                   /locus_tag="Arch_0151"
FT   CDS_pept        188329..188940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0151"
FT                   /product="multisubunit sodium/proton antiporter, MrpE
FT                   subunit"
FT                   /note="COGs: COG1863 Multisubunit Na+/H+ antiporter MnhE
FT                   subunit; InterPro IPR002758; KEGG: jde:Jden_2436
FT                   multisubunit Na+/H+ antiporter MnhE subunit-like protein;
FT                   PFAM: cation antiporter; SPTR: D1BFC8 Multisubunit Na+/H+
FT                   antiporter, MnhE subunit; PFAM: Na+/H+ ion antiporter
FT                   subunit; 2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91914"
FT                   /db_xref="GOA:D7BLW5"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLW5"
FT                   /protein_id="ADH91914.1"
FT                   /translation="MNKRSSRSVRHAVLQSERFPHASMGLLIGLIFVWVMLWGEFTVGN
FT                   VVAGFLLALFVTTVAPFPSAPFDGRFRPWGVILLVLFVAWEMMQATWQIAWFVICGSRP
FT                   HPAVIKVHLKSKSDIYIATVAGVTGLIPGTVVIDTNREESTIYVHIFDCRLAGGTDAAR
FT                   ESILIVEERILRAFASHDELVSAGYIPGPSRTYGRLEDQA"
FT   gene            188937..189197
FT                   /locus_tag="Arch_0152"
FT   CDS_pept        188937..189197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0152"
FT                   /product="multisubunit sodium/proton antiporter, MrpF
FT                   subunit"
FT                   /note="InterPro IPR007208; KEGG: xce:Xcel_3183 multiple
FT                   resistance and pH regulation protein F; PFAM: multiple
FT                   resistance and pH regulation protein F; SPTR: D1C0I0
FT                   Multiple resistance and pH regulation protein F; PFAM:
FT                   Multiple resistance and pH regulation protein F (MrpF /
FT                   PhaF); 2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91915"
FT                   /db_xref="GOA:D7BLW6"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLW6"
FT                   /protein_id="ADH91915.1"
FT                   /translation="MMWVIGASAVVELIAIALLLWRLGRGPTTLDRVVTLDMITSAVVG
FT                   GIAILFAFTRRTDLLPVFVVLSLVGFVGSTVAARNATEERQ"
FT   gene            189194..189553
FT                   /locus_tag="Arch_0153"
FT   CDS_pept        189194..189553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0153"
FT                   /product="multisubunit sodium/proton antiporter, MrpG
FT                   subunit"
FT                   /note="COGs: COG1320 Multisubunit Na+/H+ antiporter MnhG
FT                   subunit; InterPro IPR005133; KEGG: bcv:Bcav_3813 monovalent
FT                   cation/proton antiporter, MnhG/PhaG subunit; PFAM: Na+/H+
FT                   antiporter subunit; SPTR: C5C4D1 Monovalent cation/proton
FT                   antiporter, MnhG/PhaG subunit; TIGRFAM: monovalent
FT                   cation/proton antiporter, MnhG/PhaG subunit; PFAM: Na+/H+
FT                   antiporter subunit; TIGRFAM: monovalent cation/proton
FT                   antiporter, MnhG/PhaG subunit; 2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91916"
FT                   /db_xref="GOA:D7BLW7"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLW7"
FT                   /protein_id="ADH91916.1"
FT                   /translation="MIAFMDWLGVSLIFIGSLLTLIAAIGAVRLPDVLSLQHIATKPQV
FT                   MSLMLFMIGVMLVVRDSTVTWTLLAVIAFQLVTSPISAHVISRAAYRTHKVDNSRFDVD
FT                   DLDQDLRSGWDLTVD"
FT   sig_peptide     189194..189265
FT                   /locus_tag="Arch_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            189596..189847
FT                   /locus_tag="Arch_0154"
FT   CDS_pept        189596..189847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_3867 hypothetical protein; SPTR:
FT                   D0WKC7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91917"
FT                   /db_xref="GOA:D7BLW8"
FT                   /db_xref="InterPro:IPR025329"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLW8"
FT                   /protein_id="ADH91917.1"
FT                   /translation="MNLGYRLLSLATGAVAGMVARQVVTVIWEKGFGQTAPSGDETDVD
FT                   LPLAQIATFAAVTAGVTAYVNEAMQRKTAQWYGETPHQ"
FT   sig_peptide     189596..189679
FT                   /locus_tag="Arch_0154"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            190061..191131
FT                   /locus_tag="Arch_0155"
FT   CDS_pept        190061..191131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0155"
FT                   /product="ABC transporter, periplasmic binding protein,
FT                   thiB subfamily"
FT                   /note="COGs: COG4143 ABC-type thiamine transport system
FT                   periplasmic component; InterPro IPR006059:IPR005948; KEGG:
FT                   bcv:Bcav_3809 ABC transporter, periplasmic binding protein,
FT                   ThiB subfamily; PFAM: extracellular solute-binding protein
FT                   family 1; SPTR: C0W4A6 ABC superfamily ATP binding cassette
FT                   transporter periplasmic-binding protein; TIGRFAM: ABC
FT                   transporter, periplasmic binding protein, thiB subfamily;
FT                   PFAM: Bacterial extracellular solute-binding protein;
FT                   TIGRFAM: ABC transporter periplasmic binding protein, thiB
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91918"
FT                   /db_xref="GOA:D7BLW9"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLW9"
FT                   /protein_id="ADH91918.1"
FT                   /translation="MKTRKFGLALVTAAALALSACTSSVPAKKAEEPAKEEKKAEVVKV
FT                   VTNGSFTLPDDVLAEFTKKSGFKVELLNGEESGTLESKIILTKNKPVGDVVIGLTANNV
FT                   AQVAEAGVFDSTVKVAGPAGADKYTVKGAEGAIAVDRSDACFNYDIAYFKDKGLTPPAG
FT                   LEDLVKPEYKNLTVIQDPSKSDTGFALLASTISTFGEEGYVDYWKKLLANGTKVDASWK
FT                   DAYQVDFTAGEGKGAYPIVMSYASSPFWTITKAGDSSTTANVAGGCYPVVEYAGVLKGA
FT                   KNTEGAKKFLEWISSPEMQTVIAKENVTYPIDESAQLPKGMAEFAPRPDAVKPLEPKMI
FT                   VESKEKWITSVTELFS"
FT   sig_peptide     190061..190141
FT                   /locus_tag="Arch_0155"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            191128..192939
FT                   /locus_tag="Arch_0156"
FT   CDS_pept        191128..192939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0156"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1178 ABC-type Fe3+ transport system
FT                   permease component; InterPro IPR000515; KEGG: bcv:Bcav_3808
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: C5C4C6
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91919"
FT                   /db_xref="GOA:D7BLX0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLX0"
FT                   /protein_id="ADH91919.1"
FT                   /translation="MMKHPAQRPLILWALCALGPALFLALFFFAPVADLLSLGVDELAG
FT                   SWAESGVSGLIDQLSRARAFEALLTTLGLAFAGTILSIAVGIPAAYVVYRIRFRGQTIV
FT                   RFLIVFPFVLPTIAVATAFRALYDSAGLFGGLGLAGSPVLIVLAMMFFNISVIVRTVGA
FT                   SWSTLNPNHEAAARTLGASPARAFLTVTWPRLAPAVYSASTLVFLYCSTSYSLVMILGS
FT                   TRTHTLETEIYRQTSQFLNLGTAALLSLVQVIVVVIALIISHYVSKKATVADSYSRFIA
FT                   APPRITTRQIPLVAGVLGIVTALIILPIVQVLIRSLRRNGEFTLQNYTDLFRSGAARSV
FT                   DFPIATTIGQSLEAAVYATVIAVVVGATVSLLVTRKLRIHHETWQKITGIYDALFIFPV
FT                   GISSVTLGFGMLVALGGSLAFISESPLLLPLAQALVALPILIRTIVPMLMRTNRKLYGP
FT                   ALTLGASPLRAFFTVEGPTLMRALGVAAGFAFAISIGEFSATSFLVLQREPTLPVMIYH
FT                   LIGRAGATDQGMAYAGTVFLCAITAIVMLIVEKLSAVGAGVGAGAAVGAGAGATTGANH
FT                   STHADAGATTLSLPLTTKQPATTKEPR"
FT   sig_peptide     191128..191271
FT                   /locus_tag="Arch_0156"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            192936..193583
FT                   /locus_tag="Arch_0157"
FT   CDS_pept        192936..193583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0157"
FT                   /product="ABC transporter related protein"
FT                   /EC_number="3.6.3.25"
FT                   /note="COGs: COG3842 ABC-type spermidine/putrescine
FT                   transport systems ATPase components; InterPro
FT                   IPR003593:IPR003439:IPR017871; KEGG: mlu:Mlut_19480
FT                   ABC-type spermidine/putrescine transport system, ATPase
FT                   component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: C5C6U1 ABC-type spermidine/putrescine
FT                   transport system, ATPase component; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91920"
FT                   /db_xref="GOA:D7BLX1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLX1"
FT                   /protein_id="ADH91920.1"
FT                   /translation="MSAISVSHVNLTYPNGYHALRDLSIDVEHGQTVALLGASGSGKST
FT                   LLRAIAGLEPISSGTISIGGTNMAGVPTHRRHVGMVFQDGQLFPHRNVERNISYGLEMA
FT                   GMKRSEREARVADMLELVGLAGFGQRPVGTLSGGQAQRVALARSLAPRPQVLLLDEPLS
FT                   ALDKELRERLAVDVRQILRNSQMTAIFVTHDPDEATIVADRVLRMAEGAFVS"
FT   gene            complement(193718..195124)
FT                   /locus_tag="Arch_0158"
FT   CDS_pept        complement(193718..195124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0158"
FT                   /product="Glycoside hydrolase, family 20, catalytic core"
FT                   /note="COGs: COG3525 N-acetyl-beta-hexosaminidase; InterPro
FT                   IPR015883:IPR013781:IPR017853:IPR001540; KEGG: sco:SCO4860
FT                   secreted hydrolase; PFAM: Glycoside hydrolase, family 20,
FT                   catalytic core; SPTR: C8P1S6 Lacto-N-biosidase; PFAM:
FT                   Glycosyl hydrolase family 20, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91921"
FT                   /db_xref="GOA:D7BLX2"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLX2"
FT                   /protein_id="ADH91921.1"
FT                   /translation="MGVWVPTTTVAVVSDLAFRHEGERLASELGDRGVAAQVDEAPGVA
FT                   LRVILQVAAEDLATPETATVVVDESTIVVTASAPVGIFRATRRILAAFDETGSVPCGEF
FT                   EVSPLVAERGLHIDAARKYVDAEWMKDRIREAAAIGLNVIQWHFSENEGFRLESEAFPQ
FT                   IVSEHRITRDEAREILALARDLYVEIIPSLDMPGHLRKALASFPHLQLPPADLAPDAEP
FT                   LAIPDTGHALNIALPEALDFARELIDDFADLFAGCRSWHLGGDEFVDFARISEYPMLAE
FT                   AAREKFGADANGFDLLTDFVNQIGAYVKSLGFTPRVWNDGMLRGNVVGLDPDIVLTWWT
FT                   NWHPDMRPVADALEANYRIVNFNDSLFYYVLGENAGYRYPTAERIINANWHPGFFPQLP
FT                   PRVSTSSNAMRTVDQTIQEIPTIGGAYPEQLVGAFFSIWADRADAQTQEEVAAGIREPL
FT                   REFAARCWAS"
FT   gene            complement(195124..196035)
FT                   /locus_tag="Arch_0159"
FT   CDS_pept        complement(195124..196035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0159"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0395 ABC-type sugar transport system
FT                   permease component; InterPro IPR000515; KEGG:
FT                   bfa:Bfae_10970 carbohydrate ABC transporter membrane
FT                   protein; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: C7MBH2 Carbohydrate ABC
FT                   transporter membrane protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91922"
FT                   /db_xref="GOA:D7BLX3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLX3"
FT                   /protein_id="ADH91922.1"
FT                   /translation="MSMSMSTNTSPDFVRHDRAYRSRGSSDIMKPSLAGLIGKYVMLFA
FT                   VLAVMVFPFLWQLSTSFKGATENIYDFPPTIFPEAPTLDNYAEVFRTIPVLNYAWHSLL
FT                   VGVGTVVSNVIFATLGGYALGCLKFKGKGLIMAIFFSTLLLPGEVTLTSQYLTVKALGM
FT                   ANTLWGVFLPGAISAINVLLIAAACRMIPPDVLDAATIDGATTWQRLRHIVWPNIRGMV
FT                   SVIALFAFIGAWDDFLWPLVVLSDPAKYTLTVGMQYLNSNFAANPRVIAAGTMIALVPI
FT                   IILFATLQKQFFKGVEEGGVKQ"
FT   gene            complement(196032..197021)
FT                   /locus_tag="Arch_0160"
FT   CDS_pept        complement(196032..197021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0160"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG:
FT                   bfa:Bfae_10960 carbohydrate ABC transporter membrane
FT                   protein; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: C7MBH1 Carbohydrate ABC
FT                   transporter membrane protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91923"
FT                   /db_xref="GOA:D7BLX4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLX4"
FT                   /protein_id="ADH91923.1"
FT                   /translation="MRRQKWYTPYLLTLPGVIWVLVFALWPFLNTVALAFTDARPLRPA
FT                   NFVGLQNFENLFSDERFIYALTTSLVYVVVCVPLLTFLPLLLALLVHNKIPGIGFFRTT
FT                   FYFPVIASAVVVAIVWEFLFSGNGTINEALKFFGMIDRPVEFLSDRWLLIGAAIGLTVW
FT                   KGLGYYMVVYLAALGNVGRDLHEAAALDGAGRWRRFWSVTVPGVRGPMMLVSVLICVAA
FT                   MRVFTELYVLSNGSGGPGGRAMSVVMLIQSAGKGLNGHVGYASAISLVLFALTLIPLLI
FT                   VGISNNGDMIRDMLAARRMRKAHKAALRHAKETALVTTGTITEEGMSA"
FT   sig_peptide     complement(196917..197021)
FT                   /locus_tag="Arch_0160"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(197053..198342)
FT                   /locus_tag="Arch_0161"
FT   CDS_pept        complement(197053..198342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0161"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   pac:PPA1454 solute-binding protein of transport system;
FT                   PFAM: extracellular solute-binding protein family 1; SPTR:
FT                   Q6A7R3 Solute-binding protein of transport system; PFAM:
FT                   Bacterial extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91924"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLX5"
FT                   /protein_id="ADH91924.1"
FT                   /translation="MKIRSASIGLLAATALLLSACTGGSATDTAKESSKDGKLSGEISF
FT                   QTWSLKNDKFTPYFEKLIADFEKANPGTKIKWIDQPGDGYEDKVLQQAESGELPDVVNL
FT                   PPEYAYALASVDKLVDLKKESKAISEYVPGGVDAYAFDGIEGAYGFPWYLGTELNYWNT
FT                   ELLQKAGLQEPPATYKDLWDVAGKLGESGIQTISDLPSPKGLQIMVSDAGGHLDIIKDG
FT                   KFVFNTPEAEAIINTYVELYKKGAISPEALQNAGTANANVNNFNKGTAAWTTAGPNYID
FT                   KDVAVNAPTLLPKIKVTAGFGNPPLFVQGISVSKDSKNPELAMKFAEFVTNTKNQIEFV
FT                   KLAVGFFPGTIAANADPSSFAIKAEHEQQKVATDLAAKQMDKAKMTGDSKFTTEMETFA
FT                   KQQIALAVKGEITAKEALDKAVEHAQQNLK"
FT   sig_peptide     complement(198268..198342)
FT                   /locus_tag="Arch_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(198866..200197)
FT                   /locus_tag="Arch_0162"
FT   CDS_pept        complement(198866..200197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1085 Galactose-1-phosphate
FT                   uridylyltransferase; InterPro IPR011146:IPR000169; KEGG:
FT                   cef:CE1985 hypothetical protein; SPTR: D0WKB8
FT                   UTP--hexose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91925"
FT                   /db_xref="InterPro:IPR032576"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLX6"
FT                   /protein_id="ADH91925.1"
FT                   /translation="MVDTYSFPPPITKMADGTIKQINPFSGTEVWTIPGRANRPIEITH
FT                   TDVRPIDPNRLGHSCAFCTQRILETPPEKARIVRKRDDAVVYRGTNVDMLTREWEFRRI
FT                   PNLFEILSFDYWAKNYDYRLPASARGRLEAYMADPAGRSHVMKVLRMKLRNTYTDDEFG
FT                   ALTDQDIVELAYPLFGGGHDLIVARRHFVDGATDTSQLASAGTLTPQEHEWYIRLTVDA
FT                   MHDLYQQNRYARYVQVFQNWLKPAGASFDHLHKQLVAIDQRSVNGKLEVERVRQNPNLY
FT                   NEAAVDYAGYHNLVLAENRHAVAIAGFGHRYPTLEVWSKSPVCQPWEHSDDERRGMSDL
FT                   IHAMHAATGADVPTNEEWHCKPIDADVSMPWKVLIKWRVSTLAGFEGGTKIYVNTIDPW
FT                   ALRDRVVPRLLELRAEGAIAHNISIASECSNEPNSLKYNPNLAF"
FT   gene            200287..201588
FT                   /locus_tag="Arch_0163"
FT   CDS_pept        200287..201588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0163"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COGs: COG2814 Arabinose efflux permease; InterPro
FT                   IPR011701:IPR016196:IPR001958; KEGG: kse:Ksed_04650
FT                   arabinose efflux permease family protein; PFAM: major
FT                   facilitator superfamily MFS_1; SPTR: C5VDV5 Permease, major
FT                   facilitator family; PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91926"
FT                   /db_xref="GOA:D7BLX7"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLX7"
FT                   /protein_id="ADH91926.1"
FT                   /translation="MEKVRLPREIWVIVAASVAISLGYGIVAPVLPRFAIQFGVTTTAA
FT                   TLVVSAFAFTRLAFAPAAGRLSGRLGERRMYLLGIFIVAISSAASSVSQEYWHLLVLRG
FT                   MGGFGSVMFSVAAMSLVIQLAPADARGRASAAFGGGYLVGNIAGPALGALIAPLGYRWP
FT                   FLIYAVMLLISMAIVAYEIPADGHRRRKLREVWFKKNAHKTQPPADSFPEVAAAAAVGA
FT                   PDGRSVMSVSEAFQNPRFPLVLLTAFVQGWANMGMRVAVVPLLAGTIVAGPSWLPAGPW
FT                   LAGGAMTAFAMGNVVSLLRAGRWTDVYGRRVVVLWGLLVSGVFTIALGFSVTSVSFLLM
FT                   CFFGGLGGGFIQPAQQGAMADIVGDRQGGRVVSFFQQFNDFGTILGPIIAGLIIDYSGY
FT                   LTAYIVGGSVLILAAFAWIFFDSKETDALQAAQK"
FT   sig_peptide     200287..200418
FT                   /locus_tag="Arch_0163"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            201643..202644
FT                   /locus_tag="Arch_0164"
FT   CDS_pept        201643..202644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0164"
FT                   /product="Methicillin resistance protein"
FT                   /note="COGs: COG2348 Uncharacterized protein involved in
FT                   methicillin resistance; InterPro IPR003447:IPR016181; KEGG:
FT                   apr:Apre_0286 methicillin resistance protein; PFAM:
FT                   Methicillin resistance protein; SPTR: C7RFS6 Methicillin
FT                   resistance protein; PFAM: FemAB family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91927"
FT                   /db_xref="GOA:D7BLX8"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLX8"
FT                   /protein_id="ADH91927.1"
FT                   /translation="MLLDINDPVLTERFDSFIATSPYGNLLQTRAWAQVKAGWDSHYFY
FT                   HETDGEIDATLSVLSVMDSRFGGRLYYAPRGPVCDLNRIDAVTQLITEAEEYAREHEGF
FT                   LLRVDPGVPDDEALRETYATAGFPIARDPGNTTQPLMSLVLEINGRTPEQLLADLSKNT
FT                   RKNVRKSYRLGVTNRVGGREDLPEFYRLFEMMNKHHGISYRPYEYFERLYDAFEDHVRL
FT                   SFSMYEGRAITTSFLVTFGRTANALYGADSHEFQIGQSYQINYEEISYAAEQGCDFYDM
FT                   GGIFHTDEENGLYHFKRKFTEDNVINWIGNIDRVVDQEKYDKFHELTGRKEN"
FT   gene            202644..203822
FT                   /locus_tag="Arch_0165"
FT   CDS_pept        202644..203822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0165"
FT                   /product="protein of unknown function DUF201"
FT                   /note="COGs: COG3919 ATP-grasp protein; InterPro
FT                   IPR003806:IPR011761:IPR005479; KEGG: apr:Apre_1663 putative
FT                   ATP-grasp protein; PFAM: protein of unknown function
FT                   DUF201; SPTR: C7RES1 Putative ATP-grasp protein; PFAM:
FT                   Carbamoyl-phosphate synthase L chain, ATP binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91928"
FT                   /db_xref="GOA:D7BLX9"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLX9"
FT                   /protein_id="ADH91928.1"
FT                   /translation="MTTALVVLGTDENSYTHARSYHEAFGRKAIVCGTGVLAPFYRTKI
FT                   ADVHTVSGFSSDRNVFAQLLNERWEQREAGVDAFMIVAPTEEYLHLLYESLELLTFTPI
FT                   LPYPERDLGVRLMDKSYFYARMEECGITVPKTNIATPDNVDDAVLDGEQFIKADDYETF
FT                   NSFDFPEKHKGFHARNTDEARGYLRAVFASGFTGNMLVQTYISGDNTQEFSVNGYRGTN
FT                   GDIVFVQSRSVLTDMRPMWVGNHLLLTDTDRGDLQGACRTAVEHLEYRGFFNIDFKVDA
FT                   ATDVPYMLEMNTRLGRSSYYGVLNGVNFVQCAIEDSEGRGMPDFERRPFSWITAHRAQV
FT                   VNQLSGAALEYFMEPERYANTGNALDYAVDDDPARVARITRLRDDIGRNLGW"
FT   gene            203987..204418
FT                   /locus_tag="Arch_0166"
FT   CDS_pept        203987..204418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0166"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="COGs: COG0662 Mannose-6-phosphate isomerase;
FT                   InterPro IPR013096:IPR014710:IPR011051; KEGG: sub:SUB0906
FT                   hypothetical protein; PFAM: Cupin 2 conserved barrel domain
FT                   protein; SPTR: A8U7G9 Putative uncharacterized protein;
FT                   PFAM: Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91929"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLY0"
FT                   /protein_id="ADH91929.1"
FT                   /translation="MAEYAGQFDDQGTKPYVVDIEKATLDNTTFRTTMWTGEKLQLTVM
FT                   EIPVGECIGLEVHHGIDQFLRIEAGEGLCQMGPAEDDLNFERKVADDDAIFVPAGMWHN
FT                   VTNTGDEALKLYTIYAGPDHVAGTVHPTKADAEADPNED"
FT   gene            complement(204573..206642)
FT                   /locus_tag="Arch_0167"
FT   CDS_pept        complement(204573..206642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0167"
FT                   /product="Prolyl oligopeptidase"
FT                   /EC_number="3.4.21.26"
FT                   /note="COGs: COG1505 Serine protease of the peptidase
FT                   family S9A; InterPro IPR001375:IPR004106:IPR002470; KEGG:
FT                   sml:Smlt4084 putative exported oligopeptidase; PFAM:
FT                   peptidase S9 prolyl oligopeptidase active site domain
FT                   protein; PRIAM: Prolyl oligopeptidase; SPTR: B2FHW1
FT                   Putative exported oligoPEPTIDASE; PFAM: Prolyl
FT                   oligopeptidase, N-terminal beta-propeller domain; Prolyl
FT                   oligopeptidase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91930"
FT                   /db_xref="GOA:D7BLY1"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLY1"
FT                   /protein_id="ADH91930.1"
FT                   /translation="MTMNDPYLHLEELNDANMAWASGLSDATIARFGGPEFSQRQQELD
FT                   TILSAKDKLIVAAKRGDYAYNFYVDGEHPRGLWRRTLFTDYLAYVSPETEPEWDVLVDV
FT                   DALGEQEAWVFGGAQLLYPTYDRALISLHPGGSDTNVVREFDLATRTFVDPSDAFIKPE
FT                   SKGNMTWIDRDTVLIAADFGPDSLTASGYPISARVWKRGEDLAHACEIIRGEYDDVIVS
FT                   AAYDHTPGYEKILAYRATDFRTEELWDVDLQSVVNNAEVIATPIKLPGSAMVSTIRDWA
FT                   VLELRYPWSVDDQTYSAGSLLTLPYAAALAGPSASDIHVLYQPSETSSLLSMSPVADGI
FT                   VFTTLDNVQQRFWFAYDSDSSWETCELHPDIPQFSTVSIAAVDAETSNNVWVTASGFLQ
FT                   PTTLFYATVSPGELPLTQLRQAPQRFNTDGLDVRQRWATSDDGTQIPYFVVGPTVALDG
FT                   KQPTRTLLDGYGGFEVSRLPSYNVTYGKLWLERGYVYALSNIRGGGEFGPRWHQAALRE
FT                   NRHKAYEDHAAVARDLVESGITTVPQLAATGGSNGGMLMGNMYTTYPDHFGAIVCRVPL
FT                   LDMKRFSHLLAGASWMEEYGNPDTDDWEYLKAYSPYHNVGTGPYPPILITTSTRDDRVH
FT                   PGHARKFFQKIHDAGFTAYYHENTEGGHAGAADIKQTAQVMALIISFLDQTLAK"
FT   gene            206847..208703
FT                   /locus_tag="Arch_0168"
FT   CDS_pept        206847..208703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0168"
FT                   /product="chaperone protein DnaK"
FT                   /note="COGs: COG0443 Molecular chaperone; InterPro
FT                   IPR013126:IPR012725:IPR001023:IPR018181; KEGG:
FT                   bcv:Bcav_3709 chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; SPTR: D1BKD0 Chaperone protein DnaK; TIGRFAM:
FT                   chaperone protein DnaK; PFAM: Hsp70 protein; TIGRFAM:
FT                   chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91931"
FT                   /db_xref="GOA:D7BLY2"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLY2"
FT                   /protein_id="ADH91931.1"
FT                   /translation="MARAVGIDLGTTNSVVTVLEGGEPTVIANAEGQRTTPSVVGFSKT
FT                   GEVLVGEIAKRQAVNNVERTISSVKRHMGDDWTVEIDDKKYTPQQISAFILQKLKKDAE
FT                   AYLGDTVTDAVITVPAYFNDAQRQATKDAGQIAGLNVQRIVNEPTAAALAYGLEKGNED
FT                   ELILVFDLGGGTFDVSLLEVGKDEDGFSTIQVRATSGDNKLGGDDWDQRIIDWLVTQVK
FT                   NNHGVDLSKDKVALQRLKEAAEQAKKELSSATSTNITLQYLSMSENGPLHLDEKLTRAA
FT                   FEEMTKDLLERTKAPFKKVIEDADVTISEIDHIVLVGGSTRMPAVTEVVKQLTGGKEPN
FT                   KGVNPDEVVAVGAALQAGVLSGDRTDVLLIDVTPLSLGIETLGGRMTTLIERNTAIPTK
FT                   SSQVFSTAEDNQPSVLIQVYQGERPFARDNKLLGTFELGGIAPAPRGRPQIDVTFDIDA
FT                   NGIVHVSAKDLGTGKEQSVTITGGSALSKEDIERMVKEAEEHAVEDEKRKEEADVRNSG
FT                   EQLVYSIESVLKDNADKLDDAVTTEVRTAVDALKEALKGEDVAAIKTATEELNTKAQKI
FT                   GEALYAQAQAEQAAGAAPEGSAPQADDDVIDAEIVDEKNDSK"
FT   sig_peptide     206847..206936
FT                   /locus_tag="Arch_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            208792..209361
FT                   /locus_tag="Arch_0169"
FT   CDS_pept        208792..209361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0169"
FT                   /product="GrpE protein"
FT                   /note="COGs: COG0576 Molecular chaperone GrpE (heat shock
FT                   protein); InterPro IPR000740:IPR009012; KEGG: bcv:Bcav_3708
FT                   GrpE protein; PFAM: GrpE protein; SPTR: D0WLG4 Protein
FT                   GrpE; PFAM: GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91932"
FT                   /db_xref="GOA:D7BLY3"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLY3"
FT                   /protein_id="ADH91932.1"
FT                   /translation="MMDEENTPLQPEEPVTPETDAADQEVGKTAQEDGEPTISEADQAL
FT                   LKVAELEEQLARRNADLYNLRQEYNGYVKRSKADGLVQYDAGIAKVLDTLLPVLDDIML
FT                   ARQHDDLTGPTGTILEKLEATLSTNFKMERFGAEGDVFDPNLHEALMATPSADVTEEQV
FT                   GQLIQPGYMVDGRVIRPARVGVFKPE"
FT   gene            209408..210403
FT                   /locus_tag="Arch_0170"
FT   CDS_pept        209408..210403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0170"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="COGs: COG0484 DnaJ-class molecular chaperone with
FT                   C-terminal Zn finger domain; InterPro
FT                   IPR001623:IPR002939:IPR008971:IPR003095; KEGG:
FT                   bcv:Bcav_3707 chaperone DnaJ domain protein; PFAM: heat
FT                   shock protein DnaJ domain protein; chaperone DnaJ domain
FT                   protein; SMART: heat shock protein DnaJ domain protein;
FT                   SPTR: D0WLG5 DnaJ protein; PFAM: DnaJ domain; DnaJ C
FT                   terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91933"
FT                   /db_xref="GOA:D7BLY4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLY4"
FT                   /protein_id="ADH91933.1"
FT                   /translation="MASQDWMNKDFYQALGVSKTASAEEIKSAYRKLARKYHPDRNPGD
FT                   TAAEAKFKEISEAYGVLKDDQERKQYDAIRSMSGGARFTPGSGGFEDIFSGMFNQGRSQ
FT                   SGYSTMGDAPGFEDILKNMFGQGAPQPNGAGGFGGFGGFGKRGPERGGDIKAKAQLTFR
FT                   QAVDGATITLNINGKPITARIPKGVTDGQKIRLKGKGHPGTNGGANGDLLVTVSVENHP
FT                   VYELRGHDLYVNVPISFDEALLGAIIDVPMLNGDCVKVKIPQGSTTGKTMRVRGKGLDG
FT                   ANGKVGDMYVKLTINVPGEVSDEARRAVEAYRNATTDIDPRADFIKMTRI"
FT   sig_peptide     209408..209476
FT                   /locus_tag="Arch_0170"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            210478..211122
FT                   /locus_tag="Arch_0171"
FT   CDS_pept        210478..211122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0171"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="InterPro IPR000551:IPR009061; KEGG: bfa:Bfae_12190
FT                   predicted transcriptional regulator; PFAM: regulatory
FT                   protein MerR; SMART: regulatory protein MerR; SPTR: D0WLG6
FT                   Heat shock regulator protein HspR; PFAM: MerR family
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91934"
FT                   /db_xref="GOA:D7BLY5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLY5"
FT                   /protein_id="ADH91934.1"
FT                   /translation="MAKVSKTAPILTVSVAAELAGMHAQTVRQYDRLGLVVAKRTRGGG
FT                   RRYSLNDVDRLTEIQRLSQDEGINLAGISRIFELRDELEKIVRAKNAMEKQLMRLRLAY
FT                   AEMEKHIQSQRERQERVFAVDSSGEVTASASLELLRRQLYAAREDERQRSSRNAAHQHG
FT                   SSHAALVPQSSTDWLVALIEQHVRQEMNAYEPVTDDYIDLEELDTYMKTRD"
FT   gene            211122..211769
FT                   /locus_tag="Arch_0172"
FT   CDS_pept        211122..211769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0172"
FT                   /product="NUDIX hydrolase"
FT                   /note="InterPro IPR000086:IPR015797:IPR020084:IPR000059;
FT                   KEGG: nca:Noca_0342 NUDIX hydrolase; PFAM: NUDIX hydrolase;
FT                   SPTR: A1SDK1 NUDIX hydrolase; PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91935"
FT                   /db_xref="GOA:D7BLY6"
FT                   /db_xref="InterPro:IPR000059"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLY6"
FT                   /protein_id="ADH91935.1"
FT                   /translation="MSMISALRGQLTSAEQWPEYDLVSGDYVPLVSAVGNRRLAAVMIA
FT                   LNDRGTQSGAGPIEILLTRRAAHMRHHPGQISFPGGGQDGAETPAQTAVRETAEEVGIP
FT                   AEKLDILGALPALHAPRTNHWVVPVVSRVTGTPSLVLNSDEVASVHWVDVLALADPHHR
FT                   VTWRRSHYSGPGFLVDGKLVWGFTATLCDQLLDRAGLALAWDSRRVIDVDAG"
FT   gene            complement(211766..212167)
FT                   /locus_tag="Arch_0173"
FT   CDS_pept        complement(211766..212167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GL12096 gene product from transcript
FT                   GL12096-RA; SPTR: B3CIR0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91936"
FT                   /db_xref="InterPro:IPR024266"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLY7"
FT                   /protein_id="ADH91936.1"
FT                   /translation="MTELHIRQLSPEAQDQIISGVTYAEQHGLLADISCIDQEFARLRS
FT                   LGEIPTPQMRLNLGAALGYIIQQHTNMQWASVTDGTTSVVVLVGSLGEQQVIIYPFDVV
FT                   ERRWNNPEPNVFANYYDDVIATLHTTREN"
FT   gene            212378..215428
FT                   /locus_tag="Arch_0174"
FT   CDS_pept        212378..215428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0174"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="COGs: COG2374 extracellular nuclease; InterPro
FT                   IPR005135:IPR019931; KEGG: cgb:cg2868 extracellular
FT                   nuclease; PFAM: Endonuclease/exonuclease/phosphatase; SPTR:
FT                   C0WGX8 Endonuclease/exonuclease/phosphatase; TIGRFAM:
FT                   LPXTG-motif cell wall anchor domain protein; PFAM:
FT                   Endonuclease/Exonuclease/phosphatase family; TIGRFAM:
FT                   LPXTG-motif cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91937"
FT                   /db_xref="GOA:D7BLY8"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR036415"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLY8"
FT                   /protein_id="ADH91937.1"
FT                   /translation="MIVAPMVALPMMALPAQATTANDDVVISEVYVKGDTKDGKYYDFV
FT                   ELYNPTNKKISLTNYSVEYFSSKGKGTGAVKLLGDIAPKGHFLILGNGKNPNQKLQQDA
FT                   KGKLNMAVASGSVKLTKDGATEVDLFGWGAPRLFEKVALNKKTDAATSYQRTNPDKDTN
FT                   DNSVDFTVAEATPTFTGGDAKLADNPVPPVDKPAQPGGDSGERTTPAPEAPADPAPAGQ
FT                   KLAIADIQGTGSESPHKGKEVTTTGVVTAVYKYGFYGFYMQTPGDDKTPDASDGIFVYS
FT                   PKENSVKFADIAVGKQVEVTGTVDEYYGLTQIKHKSLTVLPDAPEKVKPVVLNKIPDGD
FT                   EAREKLEGMLVKVTGKYTVSSNYNTNRHGTLDLAPGESPFRNPSDVTADKAQWPMIKEK
FT                   NERERIALDDGSSVDYTKKDKKAWTHYDSPVPYLDVNNPLRVGTVVTLPQEMILDYRSN
FT                   QTNKDTYEKCWSLQPTKPLSDKKDLANKEWTNWVQFTSTRQDAPQFTEGNLSITSFNVL
FT                   NYFTTLGEEFKCKGYSSHDGIQLTSNNTCNARGAASQKAFEMQQSKIVKAINALDSSIV
FT                   GLEEIENSVKFGKDRDTALNALVAALNKDAGREKWVAVKSPAADKLPALDKQDFIRLAF
FT                   IYQKDKVKTVGESEVLIDGKQWAYARQPLAQKFVALENGKESGKPFVIVVNHLKSKGSD
FT                   KDPGHPDDGFQGNNNHLRVLQVTEMAQWVAKKFADEPVFILGDLNSYTFEDPLMTLEKE
FT                   FGYTSIAQKTGIKNHSYQYGGLVGSLDHALGNPAAMAMVKAADVWNVNAMEPLAFEYSR
FT                   YNYNINYKNLFDAASPFRSSDHDPIKVAIETREKKAEEPKTVSPGATAVMPHADDPAAC
FT                   KVKPFVTVTPVDGVTYSITVDGKEIQPRDTDANTFEYDYGKTVVVTAKLADGYTLAEGA
FT                   QTTWTWTAPSLEELKCVIPQTELTPATTKPAETKKTGTAAQDSQKQTEPTQQVTGLAKT
FT                   GASVLVITGVALLLIVGGTVLTRRRQK"
FT   sig_peptide     212378..212446
FT                   /locus_tag="Arch_0174"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(215497..215994)
FT                   /locus_tag="Arch_0175"
FT   CDS_pept        complement(215497..215994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0175"
FT                   /product="ybaK/ebsC protein"
FT                   /note="COGs: COG2606 conserved hypothetical protein;
FT                   InterPro IPR007214:IPR004369; KEGG: blj:BLD_0228
FT                   hypothetical protein; PFAM: YbaK/prolyl-tRNA synthetase
FT                   associated region; SPTR: B3DQS8 Putative uncharacterized
FT                   protein ebsC; TIGRFAM: ybaK/ebsC protein; PFAM: YbaK /
FT                   prolyl-tRNA synthetases associated domain; TIGRFAM:
FT                   ybaK/ebsC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91938"
FT                   /db_xref="GOA:D7BLY9"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLY9"
FT                   /protein_id="ADH91938.1"
FT                   /translation="MASKKKSGHAGTPALNVLEKSGVEFKVYEYEHSTHMDKGYALDTA
FT                   SVLGISPNAVFKTLMVESGRDSFVGVVPASSRLNLKALAKLAGVKSVAMMDPQQAEKLT
FT                   GYVTGGISPLGQKKRSPIFLDASALELDMILVSGGKRDISVGIAPADLVTVCDAVVGPI
FT                   AE"
FT   gene            216009..216464
FT                   /locus_tag="Arch_0176"
FT   CDS_pept        216009..216464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0176"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="InterPro IPR000182:IPR016181; KEGG: psa:PST_1793
FT                   hypothetical protein; PFAM: GCN5-related
FT                   N-acetyltransferase; SPTR: C2ARL2 Acetyltransferase,
FT                   N-acetylglutamate synthase; PFAM: Acetyltransferase (GNAT)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91939"
FT                   /db_xref="GOA:D7BLZ0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLZ0"
FT                   /protein_id="ADH91939.1"
FT                   /translation="MSQDIRFYLRPAARVDAVALHGLRTALFAEITPDDVRDTAADLDE
FT                   LIAILTDPGSTSIWVADVDDELAGYARADALGAGHERMIALNEIGVRADLRRHGLGTKL
FT                   MYAAIGDMPAYAQGTRTDAETAGKEAEREFFVAHGFTLTEQAGRYIR"
FT   gene            complement(216461..216976)
FT                   /locus_tag="Arch_0177"
FT   CDS_pept        complement(216461..216976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0177"
FT                   /product="TspO and MBR like protein"
FT                   /note="COGs: COG3476 Tryptophan-rich sensory protein
FT                   (mitochondrial benzodiazepine receptor homolog); InterPro
FT                   IPR004307; KEGG: art:Arth_1976 TspO and MBR like proteins;
FT                   PFAM: TspO/MBR family protein; SPTR: A0JWD7 TspO and MBR
FT                   like proteins; PFAM: TspO/MBR family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91940"
FT                   /db_xref="GOA:D7BLZ1"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLZ1"
FT                   /protein_id="ADH91940.1"
FT                   /translation="MSFIKNFAKTSAVTGLAASLASYATNTETLWNKTQQKPSWQPPEI
FT                   AFPIAWSALYSAIAAASAYVLTELDKQRIAAGDDSEKIAAIDQERRRFKRALAANLVLN
FT                   ATWSVLYWNVRNQWLAAGEVALLAASSSYLTHRAWKVSRLAGVGLAPYAAWTLFATALN
FT                   TEIARLNS"
FT   sig_peptide     complement(216905..216976)
FT                   /locus_tag="Arch_0177"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            217145..218203
FT                   /locus_tag="Arch_0178"
FT   CDS_pept        217145..218203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0178"
FT                   /product="Glutamyl/glutaminyl-tRNA synthetase, class Ic,
FT                   catalytic domain protein"
FT                   /note="COGs: COG0008 Glutamyl- and glutaminyl-tRNA
FT                   synthetase; InterPro
FT                   IPR020058:IPR014729:IPR020060:IPR001412; KEGG:
FT                   mgi:Mflv_1233 glutamyl-Q tRNA(Asp) synthetase; PFAM:
FT                   Glutamyl/glutaminyl-tRNA synthetase, class Ic, catalytic
FT                   domain; SPTR: D0WLH0 Glutamate--tRNA ligase; PFAM: tRNA
FT                   synthetases class I (E and Q), catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91941"
FT                   /db_xref="GOA:D7BLZ2"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLZ2"
FT                   /protein_id="ADH91941.1"
FT                   /translation="MLGEKKSAGKGRFAPSPTGDFHIGNLRTALLAWAFARHDGRTFHM
FT                   RIEDLDERSRPEYVTRQLEDLTKIGVTWDGPELFQSKRLERYEEVFSGLASQDWLYECF
FT                   CTRKELANVVSAPHQPPGSYPGTCRNLTADEREQRRARFNGTNRGAAYRLKTRENSGSV
FT                   HDRQCGAYQGAIDDLVVRRGDGIFSYNFVSVVDDGDYGVDQIVRGDDLLPSTPRQVYLQ
FT                   HVLGYQTPEYAHVPLVLNTAGARLAKRDGAVTLRQLGECGWDVSDIVELLAGSLGIRHD
FT                   LTDREGDPLVDRVADQVADPLVDQPGIIPRSGIRSADEFLKHFDPDLLPRTPWHLDVEK
FT                   LEKGPAAYYNER"
FT   gene            complement(218644..218838)
FT                   /locus_tag="Arch_0179"
FT   CDS_pept        complement(218644..218838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: car:cauri_1311 hypothetical protein; SPTR:
FT                   C6RBR2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91942"
FT                   /db_xref="InterPro:IPR028037"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLZ3"
FT                   /protein_id="ADH91942.1"
FT                   /translation="MSIFDKAKEALNSNKDILKSDKAEEISDMVLDKAEDAAKKVAGEK
FT                   HSDKISQVRGTLDSKIGNE"
FT   gene            219597..222206
FT                   /locus_tag="Arch_0180"
FT   CDS_pept        219597..222206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0180"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="COGs: COG0542 ATPase with chaperone activity
FT                   ATP-binding subunit;
FT                   InterProIPR003593:IPR004176:IPR003959:IPR013093:IPR
FT                   019489:IPR017730:IPR001270:IPR018368; KEGG: bcv:Bcav_3653
FT                   ATP-dependent chaperone ClpB; PFAM: ATPase AAA-2 domain
FT                   protein; AAA ATPase central domain protein; Clp domain
FT                   protein; Clp ATPase-like; SMART: AAA ATPase; SPTR: D0WLI6
FT                   ATP-dependent chaperone protein ClpB; TIGRFAM:
FT                   ATP-dependent chaperone ClpB; PFAM: AAA domain (Cdc48
FT                   subfamily); C-terminal, D2-small domain, of ClpB protein;
FT                   Clp amino terminal domain; ATPase family associated with
FT                   various cellular activities (AAA); TIGRFAM: ATP-dependent
FT                   chaperone ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91943"
FT                   /db_xref="GOA:D7BLZ4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLZ4"
FT                   /protein_id="ADH91943.1"
FT                   /translation="MDKFTTKSQEALADAIEMATRAGNPHVEPAHLLTSLVTQTGGVAR
FT                   ALLDAVGADAAQISQRAKAHVATLPGMQGQSAAQPQASRQLSLVLSDAGKEATALGDAY
FT                   ISTEHLLLALANSQSAAGDILRSAGANRDQLNAALPNVRGNQRVTSPDPEGTFKALEKY
FT                   GSDLTQMARDGKLDPVIGRDSEIRRVVQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQRI
FT                   VDGDVPESLRGKRLISLDISAMVAGAKYRGEFEERLKAVLQEIKDSDGEVVTFIDELHT
FT                   VVGAGGGADGAMDAGNMLKPMLARGELRLVGATTLDEYREHIEKDPALERRFQQIFVGE
FT                   PSVEDTVAILRGIAPKYEAHHKVTISDGALVAAATLSDRYISGRQLPDKAIDLVDEAAS
FT                   RLRMELDSSPEEIDVLQRQVDRLKMEKSYLEETDDQSDLAAQDRLERLVAELADKSEEL
FT                   AALNARWEAEKAGRNKVGDLRVRLDELRTELEKAIREGRYEDAGRLQNGDIPQVEAQIA
FT                   AGEADEQQPSDTPPMIAEKVDADGIAEVIASWTGIPVGRLIQGETEKLLTMEEHIGQRL
FT                   IGQRAAVRSVSDAVRRSRAGVADPNRPTGSFLFLGPTGVGKTELAKSLADFLFDDERAM
FT                   VRIDMSEYSEKHSVARLVGAPPGYVGYEEGGQLTEAVRRRPYGVVLLDEVEKAHPEVFD
FT                   ILLQVLDDGRLTDGQGRTVDFRNTILILTSNLGSQFLTSGDLTAEEKRAAVMNAVHGNF
FT                   KPEFINRLDDLIIFDPLSVEDIEKIVDLQVAQLANRLASRRISLDVTRAATSMLTLDGY
FT                   DPAYGARPLRRLIQREIGDQLARMILAGEVEDGTTVVVDAKENETFEGDHRLTLHAA"
FT   gene            222237..223733
FT                   /locus_tag="Arch_0181"
FT   CDS_pept        222237..223733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0181"
FT                   /product="amino acid permease-associated region"
FT                   /note="COGs: COG1113 Gamma-aminobutyrate permease and
FT                   related permease; InterPro IPR004841:IPR002293:IPR004840;
FT                   KEGG: sen:SACE_2119 amino acid permease-associated region;
FT                   PFAM: amino acid permease-associated region; SPTR: C2KT84
FT                   APC family amino acid-polyamine-organocation transporter;
FT                   PFAM: Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91944"
FT                   /db_xref="GOA:D7BLZ5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLZ5"
FT                   /protein_id="ADH91944.1"
FT                   /translation="MRENAGKLVSMAHNENSAGAPAGTTIPAGQTPPQAHTQLKRGLTS
FT                   AQVSMIGLSGALGTGLFLGSGSVISFAGPATVFAYMIAGLIALTVVWALAEMVSVHPVP
FT                   GGHGTVAASYLGPLGGYVTRWNFAVTVLIAVGAEVTASATYLQFWFPQLPLWAGTVLCS
FT                   LFIIGLNLFSVHLYGSSEYWFSMIKVVAIVVFILLGVALIVGAVPGVEAVGTSNLTEHG
FT                   GFMPLGFGGVLAAICLAVFSFGGIENVSVGAAESEDPEINVPKAAHAMIWRLLIFYVFA
FT                   ILVVLMLQPWVETAASHGTINESPFVRALELTGVAGAAHIMNAVLIIAALSAANGCLYS
FT                   SSRMIHSLAVDRQAPSWAAVTANNGSPRRALVIAMVGMVIAAVLAITSPAHAFMWLYGC
FT                   ATIGILTTWVMTMITHWEFRKKRAARGLPLAPRRLWAAKVVVPVVVASAVAIFIGLYWL
FT                   LPVVWYAGVPYLAVLIGSFFIVRTVHPMHVRDLLEEELAR"
FT   gene            complement(224065..225144)
FT                   /locus_tag="Arch_0182"
FT   CDS_pept        complement(224065..225144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0182"
FT                   /product="Myo-inositol-1-phosphate synthase"
FT                   /note="COGs: COG1260 Myo-inositol-1-phosphate synthase;
FT                   InterPro IPR002587:IPR013021:IPR016040; KEGG: cef:CE2831
FT                   hypothetical protein; PFAM: Myo-inositol-1-phosphate
FT                   synthase; Myo-inositol-1-phosphate synthase GAPDH domain
FT                   protein; SPTR: Q8FLN7 Putative uncharacterized protein;
FT                   PFAM: Myo-inositol-1-phosphate synthase; TIGRFAM: inositol
FT                   1-phosphate synthase, Actinobacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91945"
FT                   /db_xref="GOA:D7BLZ6"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLZ6"
FT                   /protein_id="ADH91945.1"
FT                   /translation="MAKIRVGIVGVGNCASSLVQGVEFYKDADPNVPIPGLMHVNFGGY
FT                   HVGDVEFVAAFDVDSKKVGIDLADAIFASENNTMKFADVPQTGVTVLRGRTLDGLGDYY
FT                   RDTIEESSELEVDVVAELKAARVDVLISYLPVGSEEADKFYAQCAINAGCGFVNCLPVF
FT                   IASTEEWTKKFEDAGLPIVGDDIKSQFGATISHRDLVALMESRGVRIDRTYQLNVGGNM
FT                   DFKNMLQRNRLESKKISKTNAVTSNMSGAVNDHDIHVGPSDYVPWLEDRKFAFVRVEGT
FT                   TFGEVPIQIEYKLEVWDSPNSAGIVIDALRACKIALDRGIAGNLLSTSSYLMKSPKEQL
FT                   RDSEARERLEEYIRGERER"
FT   sig_peptide     complement(225064..225144)
FT                   /locus_tag="Arch_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            225487..226308
FT                   /locus_tag="Arch_0183"
FT   CDS_pept        225487..226308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0183"
FT                   /product="beta-lactamase"
FT                   /note="COGs: COG1680 Beta-lactamase class C and other
FT                   penicillin binding protein; InterPro IPR001466:IPR012338;
FT                   KEGG: nfa:nfa16050 hypothetical protein; PFAM:
FT                   beta-lactamase; SPTR: D0WLK5 Beta-lactamase; PFAM:
FT                   Beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91946"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLZ7"
FT                   /protein_id="ADH91946.1"
FT                   /translation="MYEDFLPADAFTFDRAYMTLSCDTQTQALTVHGIAGDPDDVFPLA
FT                   SVTKPIVAWSALVAVEQGVLDLDVPAGPEGSTVRHLLAHASGVPAAQGAPIAAPATRRI
FT                   YSNYGFDLLGEAVERATSTPIHEWVATSIFVPLGMDSAEIHGSVAFGGRASLDSLARFA
FT                   GELLAPSLISHDLAAAAFTPQFDGLSGVLPGFGRQKNNVWGLGLEIRGEKSPHWTGADF
FT                   SPRTFGHFGQSGSFVWVDPQVNKAGVFLGTKPFGEEHAAIWPALTDQMRAA"
FT   gene            complement(226370..227179)
FT                   /locus_tag="Arch_0184"
FT   CDS_pept        complement(226370..227179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0184"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /note="COGs: COG0708 Exonuclease III; InterPro
FT                   IPR005135:IPR004808; KEGG: jde:Jden_2428
FT                   exodeoxyribonuclease III Xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; SPTR: D0WLN3
FT                   Exodeoxyribonuclease III; TIGRFAM: exodeoxyribonuclease III
FT                   Xth; PFAM: Endonuclease/Exonuclease/phosphatase family;
FT                   TIGRFAM: exodeoxyribonuclease III; exodeoxyribonuclease III
FT                   (xth)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91947"
FT                   /db_xref="GOA:D7BLZ8"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLZ8"
FT                   /protein_id="ADH91947.1"
FT                   /translation="MKIATWNINSARARADRILDVLTRHDLDALALQEIKCKPEQFPAA
FT                   DIEAAGYEVAAHGLNQWNGVAIISRVGLEDVRREFPGQPGFVKGEPEGGRSFIPGPAEA
FT                   RAIGARVGGIDLWSLYVPNGRATGDPHYHYKLEFLRRLRDFAEGQMRDDDAAQLALVGD
FT                   WNVIPTDADVWDPAAMEDGIYLTEPERAAFHAFADAGMVELSRQYATNYTFWDYQKLRF
FT                   PKNEGMRIDYVYASPALAARSIDGTIDRDERKGKGASDHVPVIIEFE"
FT   gene            227216..227983
FT                   /locus_tag="Arch_0185"
FT   CDS_pept        227216..227983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0185"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG0300 Short-chain dehydrogenase of various
FT                   substrate specificities; InterPro
FT                   IPR002198:IPR016040:IPR002347; KEGG: bcv:Bcav_3647
FT                   short-chain dehydrogenase/reductase SDR; PFAM: short-chain
FT                   dehydrogenase/reductase SDR; SPTR: D0WLN7 Oxidoreductase,
FT                   short-chain dehydrogenase/reductase family; PFAM: short
FT                   chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91948"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BLZ9"
FT                   /protein_id="ADH91948.1"
FT                   /translation="MGRALVTGASSGLGRAFVEELAGSGHDVVLVARDRARLEALAAAV
FT                   RGRFGVRAEVLVADLSVDDDVALVSRRLADEVEPVTLLVNNAGFGLGQDFVAGSLDREL
FT                   FGLDVMVRAVLVLSHAAARAMRARGRGAIINVASMTSLTAQGTYSAHKAWVRTFSEGLA
FT                   VELAGSGVTVTVVNPGLIRTEFHERSHVDSSQWPSVVFASPERVARDALAAARGGRVEV
FT                   TPTVIYKAASVALRHAPRWLVRRVAGPGLSGRE"
FT   gene            228023..228410
FT                   /pseudo
FT                   /locus_tag="Arch_0186"
FT   gene            228442..228846
FT                   /locus_tag="Arch_0187"
FT   CDS_pept        228442..228846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0187"
FT                   /product="NUDIX hydrolase"
FT                   /note="InterPro IPR000086:IPR015797:IPR020476; KEGG:
FT                   cgb:cg1303 NTP pyrophosphohydrolase; PFAM: NUDIX hydrolase;
FT                   SPTR: Q8NR99 NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes; PFAM: NUDIX domain; TIGRFAM: mutator
FT                   mutT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91949"
FT                   /db_xref="GOA:D7BM00"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM00"
FT                   /protein_id="ADH91949.1"
FT                   /translation="MSKKLIHVVGAVFEREGKIMAAQRGPGRALEGFWEFPGGKIEPGE
FT                   APEETLARELREELLTDAEVGPFVARSEFDYDFGTVRLDAYFCTIVGQEPTLTEHQEIR
FT                   WLGAEDLFSVEWAPADVPIIKALKDQLESK"
FT   gene            228849..229414
FT                   /pseudo
FT                   /locus_tag="Arch_0188"
FT   gene            229453..229902
FT                   /locus_tag="Arch_0189"
FT   CDS_pept        229453..229902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0189"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_3646 orotate
FT                   phosphoribosyltransferase; SPTR: C0VYD8 Orotate
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91950"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM01"
FT                   /protein_id="ADH91950.1"
FT                   /translation="MFSNDPQKTALAGLLRAATRETAPETLAAIRALLHSHDAAVLAGH
FT                   VMLDLLEENGYGPLDIDAIGATPADLPLALAIQHAAASRGMQYDAFTIAGTSLIGPDLD
FT                   GRRVVVIKIFDDETVPAKLAVEATSALVGRDFAAYQPTDLEPNHE"
FT   sig_peptide     229453..229539
FT                   /locus_tag="Arch_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            229895..230575
FT                   /locus_tag="Arch_0190"
FT   CDS_pept        229895..230575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0190"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="COGs: COG0566 rRNA methylase; InterPro IPR001537;
FT                   KEGG: kra:Krad_4172 tRNA/rRNA methyltransferase (SpoU);
FT                   PFAM: tRNA/rRNA methyltransferase (SpoU); SPTR: D0WLP3 RNA
FT                   methyltransferase, TrmH family; PFAM: SpoU rRNA Methylase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91951"
FT                   /db_xref="GOA:D7BM02"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM02"
FT                   /protein_id="ADH91951.1"
FT                   /translation="MNDTDFEYWGNGEKPGGINGVGPWEGPLPTEPHYDPELLANGDRR
FT                   NVADKYRYWSVDAIRDDLAKTSTKLHIAIENLEHDLNIGSIVRTGNAFNVSGVHIVGKK
FT                   KWNRRGALVTDRYLNVHHHAEVSSLVEWARENDYQLVAVDNMEGSTPIAETALPERAVL
FT                   IFGQESNGLSAELLAAADSAVYIPQYGSTRSMNVAAAAAISMHMWIMQHGPRNAPAPES
FT                   RPVL"
FT   gene            complement(230694..231485)
FT                   /locus_tag="Arch_0191"
FT   CDS_pept        complement(230694..231485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gbr:Gbro_1394 hypothetical protein; SPTR:
FT                   D0YUD4 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF559)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91952"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM03"
FT                   /protein_id="ADH91952.1"
FT                   /translation="MKGIYSYQDLRTMGYSRRTIDRFTETGLLERVTRGWFATPDTDPT
FT                   IKAAFGSGGRLTCISACRLLNLWIPPQEDVGLHIAFHPRRGNISPPKNAIIHRTLFPKH
FT                   LPHLHISDVLIDLIRCRYPETVLIILESAICKKLVSFDEAWELIKHARKENRGTLRKLS
FT                   AKSESGSETRVRLFLIQHKFSVKEQVQIAGVGRVDLLVGNTIIECDGRRYHIAESTFEQ
FT                   DHRRDLAAQHAGYRVIRLSYQQVWMDWARTQEMLLAILRTD"
FT   gene            231814..232836
FT                   /locus_tag="Arch_0192"
FT   CDS_pept        231814..232836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0192"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /note="COGs: COG0191 Fructose/tagatose bisphosphate
FT                   aldolase; InterPro IPR000771:IPR013785:IPR006411; KEGG:
FT                   xce:Xcel_3142 fructose-bisphosphate aldolase, class II;
FT                   PFAM: ketose-bisphosphate aldolase class-II; SPTR: C0VYF0
FT                   Fructose-bisphosphate aldolase; TIGRFAM:
FT                   fructose-bisphosphate aldolase, class II;
FT                   ketose-bisphosphate aldolase; PFAM: Fructose-bisphosphate
FT                   aldolase class-II; TIGRFAM: ketose-bisphosphate aldolases;
FT                   fructose-bisphosphate aldolase, class II, yeast/E. coli
FT                   subtype"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91953"
FT                   /db_xref="GOA:D7BM04"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM04"
FT                   /protein_id="ADH91953.1"
FT                   /translation="MAIATPEVYNEMLDRAKSGKFAYPAINVTSSQTLTAAIQGFAEAE
FT                   SDGIIQVSVGGAEYWSGSTVKDRVAGSLAMAAYAREIAKNYDVTIALHTDHCAKQNIDS
FT                   WVRPLLELEAEEVKAGRLPFFQSHMWDGSAVPLAENLEIAQELLDLSVKANTILEVEIG
FT                   VVGGEEDGVVGEINEKLYTTAEDGLKTVEALGLGEKGRYMTALTFGNVHGVYKPGHVKL
FT                   RPEILGEIQDEVGAKVGKESPFDLVMHGGSGSTAEEIATAVRNGVIKMNVDTDTQYAFT
FT                   RPVAEWMMRNFDGVLKIDGEVGNKKQYDPRAWGKAAEAGMAARVVEACERLGSVGQKMR
FT                   "
FT   gene            233063..233596
FT                   /locus_tag="Arch_0193"
FT   CDS_pept        233063..233596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0193"
FT                   /product="glycoside hydrolase family 2 sugar binding
FT                   protein"
FT                   /note="InterPro IPR006104; KEGG: bcv:Bcav_4017 hypothetical
FT                   protein; PFAM: glycoside hydrolase family 2 sugar binding;
FT                   SPTR: C0W1A2 Putative uncharacterized protein; PFAM:
FT                   Glycosyl hydrolases family 2, sugar binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91954"
FT                   /db_xref="GOA:D7BM05"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR025150"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM05"
FT                   /protein_id="ADH91954.1"
FT                   /translation="MRFGSDCQLCAAVGPVFYVNGIEPEWVYYCVCQETNLANQFIAQL
FT                   STGFVDPFWENNAGGGFISGDPFIVYPAPGGHVWESLRHHTSLNGEWRFRLHPTAQIDE
FT                   SREWETITLPCHWASRYRATGCLVPNVATREIQVSWAESIDDISVEGVEIVAFNVKEKI
FT                   LTINAGTFVQYKEV"
FT   gene            233816..235135
FT                   /locus_tag="Arch_0194"
FT   CDS_pept        233816..235135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0194"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   pac:PPA2295 solute-binding lipoprotein; PFAM: extracellular
FT                   solute-binding protein family 1; SPTR: C0W274 ABC
FT                   superfamily ATP binding cassette transporter,
FT                   solute-binding lipoprotein; PFAM: Bacterial extracellular
FT                   solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91955"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM06"
FT                   /protein_id="ADH91955.1"
FT                   /translation="MTLSHRSKVAAVLATASLAVAGLAGCSSDSDAKEPSASKGKSDAK
FT                   IEYVHRLPDGEGMVKVQEIVDRWNKDHPDMTVKATKFDGKASDLFQKLQKDVATDTAPC
FT                   LAQLGYSEVPEAFVKGMVEDVTKQAEKYKKNFSGAYGQMAAGGKVVGLPQDTGPLVYFY
FT                   DKAEFDALGLSVPTTVEELKETAKKAAEKGKFILNFEPDEAAHWLSAQAAAVGDPWFST
FT                   EGGKWKVNAQNKGSEVVANFWQELIDANAVGTINRWDDAYTKALTDKKIIGNIGAAWEA
FT                   GFMLDPVVPEGKEGTWQVALLPNFGEGVKSGPDGGSGVAVMKGCKFIDEAMEFNNWFNT
FT                   QTADLATQGLVVAAKGDVVTPEKIKRQFGGQDVFAELAKANESLNADFQYIPGFSAVGQ
FT                   KMVDTAANIIDSKGKIADIFAAAQEEAVKTLKNLKLPVVE"
FT   sig_peptide     233816..233911
FT                   /locus_tag="Arch_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            235193..236161
FT                   /locus_tag="Arch_0195"
FT   CDS_pept        235193..236161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0195"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG: blo:BL1639
FT                   permease of ABC transporter for sugars; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: C0W275 Sugar ABC superfamily ATP binding
FT                   cassette transporter, permease; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91956"
FT                   /db_xref="GOA:D7BM07"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM07"
FT                   /protein_id="ADH91956.1"
FT                   /translation="MTTAVKTDSSETTAVAIPRHRRTRERHEARTGWIFMLPFVLGFTL
FT                   VFLLPIGASVYSSFFQEVSDGGGLYGGSELVKEFVGLENYYNTVANDRFWLGILRVILY
FT                   TLIQVPVMIFVGLALALVLDSMLVRHVGIYRLGYFLPFAIPGIVAAIIWLYIYTPEISP
FT                   LVSVLNWFGLDVDFMSKNIIFFSMANMTTWTYTGYNMLIFLAALQAIPAELEEAARLDG
FT                   ATGFQVVTKVKVPMVRGAVLLSVLLSIVGTIQLFNEPAVLSTVNRWMGADYTPMMMAYN
FT                   TMIGQITPSGDGPAAATSIVMAVIAGVLAVAYALIEKKVND"
FT   gene            236161..237072
FT                   /locus_tag="Arch_0196"
FT   CDS_pept        236161..237072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0196"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0395 ABC-type sugar transport system
FT                   permease component; InterPro IPR000515; KEGG: pac:PPA2293
FT                   binding-protein-dependent transport system; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: C0W276 Sugar ABC superfamily ATP binding
FT                   cassette transporter, membrane protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91957"
FT                   /db_xref="GOA:D7BM08"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM08"
FT                   /protein_id="ADH91957.1"
FT                   /translation="MSKIMKQKLADGTEYVPSREGIPARSIAPSSVARWVTGAVLFLVL
FT                   VYFLFPVYWVIVASTKTNSQLVSTNGFWFDDINVLKNHETLMVWTRGMFWRWVFNSLLY
FT                   STVAGVVGTLISVMAGYATAKFKFPGKGVTMGVIMSGLLMPAALLTIPLYIIFHHIGIT
FT                   NTMWAIIIPACVSPFGVFLGRVYAQTSVPTELIEAARIDGASEARIFFTMVLRLLAPAM
FT                   VTIFLFIFVGTWNNFLLPLMMVTADEIKPVTLGLYGMMSYFAPEKGAVMLGALLGVLPL
FT                   IVLFLALQKYWQSGLAAGSVKG"
FT   gene            complement(237149..237688)
FT                   /locus_tag="Arch_0197"
FT   CDS_pept        complement(237149..237688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0197"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa51010 hypothetical protein; SPTR:
FT                   C1RFL0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91958"
FT                   /db_xref="GOA:D7BM09"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM09"
FT                   /protein_id="ADH91958.1"
FT                   /translation="MLETTCETNAKRSAVTQAALYGLGTFAYYACPDVIRSRTARGVTK
FT                   TLAILASSGVATYLHVRDDMAEESADIIDAEDVFATDPRTSDAPANASAADSSETGVDD
FT                   PAELAPDALTMKQNIALAAIALGAVLPASIWLSVKAERAIFNRGERRRQKGKRFAHSRF
FT                   AIVAGIASGVLTYVSD"
FT   gene            complement(237688..238488)
FT                   /locus_tag="Arch_0198"
FT   CDS_pept        complement(237688..238488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0198"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pac:PPA1774 hypothetical protein; SPTR: D0WP61
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91959"
FT                   /db_xref="GOA:D7BM10"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM10"
FT                   /protein_id="ADH91959.1"
FT                   /translation="MSLSRKVAVIAMCASVLVLSSCKVDAALGIHPDKSTLAAVEFHDS
FT                   DGLMKSAGFGDCSSLFDDILRQVKSSPDIKNIPLPSQDEIDKARDAIEITDIAKGDEFA
FT                   CRISWDAPQNSGERNLVTETDSTFIVKSDAKLPPEATSFIKMAETFIDLRVIIAMPGDI
FT                   IRADRALIDGNRAIFTSLDSLTSGPLYVEGKKTGDADFSRIFEPAEISGGIPWWGWIAI
FT                   GVGITGLIIILTLVFTRKKPVADEPLPYGFTPLEQPESTEKDVL"
FT   sig_peptide     complement(238411..238488)
FT                   /locus_tag="Arch_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(238622..239605)
FT                   /locus_tag="Arch_0199"
FT   CDS_pept        complement(238622..239605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0199"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pac:PPA1774 hypothetical protein; SPTR: D0WLQ6
FT                   Acidic proline-rich protein PRP33"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91960"
FT                   /db_xref="GOA:D7BM11"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM11"
FT                   /protein_id="ADH91960.1"
FT                   /translation="MVMTSQKRIARVKAVAIAAVALCAFSACHTDVGVGVKSDGSIKSV
FT                   VTLNDSEGKLKAIGLGSSCEELASGVKTQIGITGGTFDVKDKSKEGKLSCEFTAESGKN
FT                   MVDGKTLTETDKTFILSTQKASTAVPKEQLSMLKNFGKFTLTISMPGDIVKAEGAKIDG
FT                   NLAMFSDLEKLATGFSVEGYKVGSGSIDDAKLGAAHSGIPTWVWIVSGTAIIALIVVLI
FT                   VMFTRKKKTATPAESESPATTPLPEEVMPEAPAGNMAKAEETPTADAPVAEETPTADAP
FT                   TMEETPAVEGMPAEAEPQPSMEDIMEDGLNKPGVQAGNIDDEPQMK"
FT   sig_peptide     complement(239492..239605)
FT                   /locus_tag="Arch_0199"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            239913..241763
FT                   /locus_tag="Arch_0200"
FT   CDS_pept        239913..241763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0200"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="COGs: COG1274 Phosphoenolpyruvate carboxykinase
FT                   (GTP); InterPro IPR008209:IPR008210:IPR013035:IPR018091;
FT                   KEGG: tcu:Tcur_2819 phosphoenolpyruvate carboxykinase
FT                   (GTP); PFAM: phosphoenolpyruvate carboxykinase (GTP);
FT                   PRIAM: Phosphoenolpyruvate carboxykinase (GTP); SPTR:
FT                   A7BA26 Putative uncharacterized protein; PFAM:
FT                   Phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91961"
FT                   /db_xref="GOA:D7BM12"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM12"
FT                   /protein_id="ADH91961.1"
FT                   /translation="MTDMYTVEAVREGAPSVAPADLIEWVTEVANLTQPKNIEWVDGSQ
FT                   EEWDRLTSMMVESGMFTRLNPEKRPNSFLARSLPSDVARVESRTFICSEKEEDAGPTNH
FT                   WADPKEMKETLLGEKGVFRGAMRGRTMYVIPFSMGPLGGPISQLGIELTDSPYVVVNMR
FT                   IMTRMGIKALELIGEGKPWVPAVHSVGSPLEEGQEDTSWPCNDEKYITHFPETNEIWSF
FT                   GSGYGGNALLGKKCFALRIASTMARRDTWMAEHMLILRLTNEKTGQQFHVTAAFPSACG
FT                   KTNLAMLQPTIEGYKVETVGDDIAWMRPGADGRLRAINPEAGFFGVAPGTSYKTNPMAM
FT                   ETMKANTIFTNVALTDDGDVWWEGIDGETPEHLIDWHGNDWTPESGENAAHPNSRFTTP
FT                   ASQCPIICPDWEAPEGVAIDAILFGGRRATNVPLVAEQYTPAHGVFIGANVSSEVTAAA
FT                   LDVKAGALRHDPFAMLPFCGYNMADYWGHWLDMQEELGEKFPKVYQVNWFRKDANGKFL
FT                   WPGYGDNARVLDWIVRRVAGEVEAIEGMTGLYPHREDFNLEGAGVSEEDWNAMYTLDPE
FT                   AWEAETVDTEEYFAKFGDKVPEALVEELKALRERIAAAKN"
FT   gene            241972..242871
FT                   /locus_tag="Arch_0201"
FT   CDS_pept        241972..242871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0201"
FT                   /product="Phosphoribosylaminoimidazolesuccinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="COGs: COG0152
FT                   Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
FT                   synthase; InterPro IPR001636:IPR013816:IPR010916; KEGG:
FT                   mlu:Mlut_18500
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase; PRIAM:
FT                   Phosphoribosylaminoimidazolesuccinocarboxamide synthase;
FT                   SPTR: D0WLR3 Phosphoribosylaminoimidazolesuccinocarboxamide
FT                   synthase; PFAM: SAICAR synthetase; TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91962"
FT                   /db_xref="GOA:D7BM13"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM13"
FT                   /protein_id="ADH91962.1"
FT                   /translation="MAAFAGGISIPGWSRIYAGKVRDMYIPIDQQWHAGVETMLVVASD
FT                   RISVRDRVVPTIIPDKGELLTTLALWWFERLEDIVHTHVTNARVPAEVAGRAMIVRRLR
FT                   MYPIECTVAGYMTDSLFSDYTANGSVNGIDLPAGLREGDRLPSPIFLPARKGAVGADDV
FT                   DITFDDFAYVVGVDVARHIRATAIDIYNRGHEYCERAGIVLAACKLEFGRSTDAGDDVI
FT                   VLGDEALTPDSSTMWLAADYEPGRSQTSMGKQFVRRWLMNSGWDRDAGTPPPPLPQHLV
FT                   DATRERYRTVVDLLTSSD"
FT   gene            243001..244338
FT                   /locus_tag="Arch_0202"
FT   CDS_pept        243001..244338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0202"
FT                   /product="Glutamate dehydrogenase (NADP(+))"
FT                   /EC_number="1.4.1.4"
FT                   /note="COGs: COG0334 Glutamate dehydrogenase/leucine
FT                   dehydrogenase;
FT                   InterProIPR006097:IPR006096:IPR016040:IPR014362:IPR 006095;
FT                   KEGG: jde:Jden_2359 glutamate dehydrogenase (NADP(+));
FT                   PFAM: Glu/Leu/Phe/Val dehydrogenase ; Glu/Leu/Phe/Val
FT                   dehydrogenase dimerisation region; PRIAM: Glutamate
FT                   dehydrogenase (NADP(+)); SPTR: C0W243 Glutamate
FT                   dehydrogenase; PFAM: Glutamate/Leucine/Phenylalanine/Valine
FT                   dehydrogenase; Glu/Leu/Phe/Val dehydrogenase, dimerisation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91963"
FT                   /db_xref="GOA:D7BM14"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM14"
FT                   /protein_id="ADH91963.1"
FT                   /translation="MDRHIEEVYEESLRRNPTQPEFQQAVREVIETVEPLLVARKDYRD
FT                   AAILARVVEPERQIMFRVAWENDQNQVCVNRGYRIQFNSALGPYKGGLRFHKSVTLSVV
FT                   KFLGFEQIFKNALTGQGIGGGKGGSDFDPHGKSDNEVMRFCQAFMTELSRHIGADIDVP
FT                   AGDIGVGAREIGYLFGQYKRLSNRNEAGVLTGKGLNWGGSLARTEATGYGLVTFAQAML
FT                   GERGEDMEGARVIVSGSGNVATYAIEKAQALGAKPISISDSSGAVYDPDGIDVALLKHV
FT                   KQVERGRVSDYAERRPNAQFLAGENVWGIAGDIALPCATQNEMSESDVATLAGNGVKLI
FT                   AEGANMPLTPEAIAAAQNSHILYAPGKASNAGGVATSALEMQQNAGLTRWPFHKVESRL
FT                   DQIMLDIHRECLETAAEFGKPGDYLVGANIAGFRKVADAMLDQGII"
FT   gene            244508..246778
FT                   /locus_tag="Arch_0203"
FT   CDS_pept        244508..246778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0203"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="COGs: COG0737 5'-nucleotidase/2' 3'-cyclic
FT                   phosphodiesterase and related esterase; InterPro
FT                   IPR004843:IPR008334:IPR019931:IPR006179; KEGG: cjk:jk1044
FT                   putative 5'-nucleotidase family protein; PFAM:
FT                   5'-Nucleotidase domain protein; metallophosphoesterase;
FT                   SPTR: Q4JVE9 Putative 5'-nucleotidase family protein;
FT                   TIGRFAM: LPXTG-motif cell wall anchor domain protein; PFAM:
FT                   Calcineurin-like phosphoesterase; 5'-nucleotidase,
FT                   C-terminal domain; TIGRFAM: LPXTG-motif cell wall anchor
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91964"
FT                   /db_xref="GOA:D7BM15"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM15"
FT                   /protein_id="ADH91964.1"
FT                   /translation="MKRRFYARATVSTLSALALGTLGMTSVTTAFGVDTPEKAATEETE
FT                   AAKEAPAAEGDKVIDFAVISDLHGHIENAASLAFEINKMREANADTHFISAGDNVGGSA
FT                   YVSAVAKDEPTIEILKAMKLEVSAAGNHEFDQGAKDLAERIVPHFGDIPILAANAEGGN
FT                   EAFKKDYVIKDYNGVKVAYIGTVTQGMPALVSPLAIEGITFKDPVETTNRIAEQLKDGK
FT                   AENGEADVVVALMHEDLAYVKKLNKYVDLGFGGHSHNGQKDTTASGAAVCEPWNYGQSK
FT                   TKDGDKSIENYSFVKAQIKIGADKKVTSSCDIVNVPKPTKQVPNKKNPKVMDTVLDTEH
FT                   PNQDQVIKALYDEAAAKAKELGSAPVGYLSGDAKRATTGKDENRGTESPANNLIAEAFY
FT                   QYGQTMNTKPAFGIMNAGGVRTDFIYKANTTDNPKDEDGLLTVGESNSVQPFGNAYAMI
FT                   DLTGEQVYTMLEQQWKAEGSRRPVLNLGLSANVKYVFNPEAEQGKRILAVYVDDKLVPR
FT                   DASTTYTIASNNFLLVGGDDFPVFKEGKNFIDTGVIDNAAFNKYVEKFQKDNPLKVDYT
FT                   QRSFGVVMPKDVKPGETFTVKLSGLSHTSDEPKPETVTISIDGLGEWNAKVDTTPEATP
FT                   IDGTGKAEVSITLPATTKAGKYTLKIATKGGEGSDSTIVYTDAITVPGADEAGTTPDGQ
FT                   DGKADAGKDGKTGAGKDGKTDADKNAKGKQLAKTGADGITTGLAGAMILLLVGATMASR
FT                   KRA"
FT   sig_peptide     244508..244603
FT                   /locus_tag="Arch_0203"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            246866..247252
FT                   /locus_tag="Arch_0204"
FT   CDS_pept        246866..247252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_3525 hypothetical protein; SPTR:
FT                   C5C2S3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91965"
FT                   /db_xref="InterPro:IPR041629"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM16"
FT                   /protein_id="ADH91965.1"
FT                   /translation="MASGGHCRLYDGDMKRRIDPATGIAIIKKYAAEEELSVSEQRTAA
FT                   RFALEEFAERHPGRSVEIRIPWAGAVQAIAGPVHTRGTPPNVVEMDTDTWLALAVGKPT
FT                   NGIVRANGSRSDLTQYLPLFGQHN"
FT   gene            complement(247385..247621)
FT                   /locus_tag="Arch_0205"
FT   CDS_pept        complement(247385..247621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kra:Krad_4039 hypothetical protein; SPTR:
FT                   D0WLU3 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF3073)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91966"
FT                   /db_xref="InterPro:IPR021426"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM17"
FT                   /protein_id="ADH91966.1"
FT                   /translation="MGRGRQRAKQRKVARDLKYFSPETDYAALERELIAKSSASSADDA
FT                   ADSSDGDWSEYDSYDVPPAEDDWDESDWIPSHR"
FT   gene            247979..248170
FT                   /locus_tag="Arch_0206"
FT   CDS_pept        247979..248170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0206"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="InterPro IPR000551:IPR010093:IPR009061; KEGG:
FT                   jde:Jden_2349 DNA binding domain protein, excisionase
FT                   family; PFAM: regulatory protein MerR; SPTR: C7R2J2 DNA
FT                   binding domain protein, excisionase family; TIGRFAM: DNA
FT                   binding domain protein, excisionase family; PFAM: MerR
FT                   family regulatory protein; TIGRFAM: DNA binding domain,
FT                   excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91967"
FT                   /db_xref="GOA:D7BM18"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM18"
FT                   /protein_id="ADH91967.1"
FT                   /translation="MTEFDTELMTPAEVAALFRVDPKTVARWSDSGKIPSIRTLGGHRR
FT                   FRRSDIVAILENNTTEVD"
FT   gene            complement(248266..248616)
FT                   /locus_tag="Arch_0207"
FT   CDS_pept        complement(248266..248616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0207"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_3513 hypothetical protein; SPTR:
FT                   D0WLU4 Putative membrane protein; PFAM: Protein of unknown
FT                   function (DUF3618)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91968"
FT                   /db_xref="GOA:D7BM19"
FT                   /db_xref="InterPro:IPR022062"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM19"
FT                   /protein_id="ADH91968.1"
FT                   /translation="MSKVNESARVAANSKMASDYEAPVGVEDNRSAEEVQRDIERVREE
FT                   LTATVNELAAKLDPQVLKEDMKAAAAEKIEAGKAKAQALAHDAAAGDTKAIGIIAGVAL
FT                   GVAALVVRKFMK"
FT   gene            complement(248613..249056)
FT                   /locus_tag="Arch_0208"
FT   CDS_pept        complement(248613..249056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0208"
FT                   /product="protein of unknown function DUF1469"
FT                   /note="InterPro IPR009937; KEGG: bcv:Bcav_3512 protein of
FT                   unknown function DUF1469; PFAM: protein of unknown function
FT                   DUF1469; SPTR: C0VYT0 Putative uncharacterized protein;
FT                   PFAM: Protein of unknown function (DUF1469)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91969"
FT                   /db_xref="GOA:D7BM20"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM20"
FT                   /protein_id="ADH91969.1"
FT                   /translation="MATEQTDQVKMLNDRGMASKPSGGSIGELVAKITSQFSALVRDEI
FT                   KYTGIQAKTKVKRLGVGGVLLAVAGVLSLYMLGLLFAGVAWAFAVIVPVWAGYLITAGI
FT                   LLVIIALLALFGKMSLDKAAAAKIDPKGGIEKNVEAIMKGFEK"
FT   gene            complement(249172..251025)
FT                   /locus_tag="Arch_0209"
FT   CDS_pept        complement(249172..251025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0209"
FT                   /product="virulence factor MVIN family protein"
FT                   /note="COGs: COG0728 membrane protein putative virulence
FT                   factor; InterPro IPR004268; KEGG: bcv:Bcav_4210 integral
FT                   membrane protein MviN; PFAM: virulence factor MVIN family
FT                   protein; SPTR: D0WQR9 Integral membrane protein MviN; PFAM:
FT                   MviN-like protein; TIGRFAM: integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91970"
FT                   /db_xref="GOA:D7BM21"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM21"
FT                   /protein_id="ADH91970.1"
FT                   /translation="MHFQRFRPRHGEGRTPHTATWSVSSARGTTPVDARAVTDAIAPAG
FT                   ETDSDSQAGVPAPAPAPAKISAARSSLIMFLGTLTSRALGMVRSPILLGAVVGVSTPVA
FT                   NSFDIANNVPNLLYGIIAGGLVNAVLVPAIVRATAKSRAEGAIFINKLLTFSFVSLGLL
FT                   TIAITLAAPIIVNFYASTMSPDWYRLTVIFSFWCLPQIFFYGLYAVLGQILNAYERFGP
FT                   YMWSPALNNVVAIGGLLLMLWLFGPEDSTAPSSVADWAGAPTIILAGFSTLGIVTQALI
FT                   LFWPLHRLGIRYRPDFGWRNSGLGDVGRAGSWVLALMVTGMIPIMILLNVAAGATQRAL
FT                   NAGQDTTEVAGNFMYTIAYALYSLPASLVTVSIVTAVFPRMSRAAATADFGAVKADIST
FT                   AIRTVGVFNVLASAVIFVLSVPVAKVVTPTSTPNEAWVLALVLCSLTLGLVFSAADTVL
FT                   VKVFYALEDTRTAFLTILPFQIVTPLFFYMMSFTRPEFTVVGMCLAMSLENAAMCAVHA
FT                   YVLRRRLGGIDGLRIVVAHVKLGVFGLVVAVLGFVIMLGFGFGATAESVSWAITAIIVT
FT                   GSVMSLTYVALLWASGMPEGEILLRPVRGILRKAVRTLVRR"
FT   sig_peptide     complement(250918..251025)
FT                   /locus_tag="Arch_0209"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(251327..251400)
FT                   /locus_tag="Arch_R0004"
FT   tRNA            complement(251327..251400)
FT                   /locus_tag="Arch_R0004"
FT                   /product="tRNA-Asp"
FT   gene            complement(251459..251534)
FT                   /locus_tag="Arch_R0005"
FT   tRNA            complement(251459..251534)
FT                   /locus_tag="Arch_R0005"
FT                   /product="tRNA-Phe"
FT   gene            complement(251569..251645)
FT                   /locus_tag="Arch_R0006"
FT   tRNA            complement(251569..251645)
FT                   /locus_tag="Arch_R0006"
FT                   /product="tRNA-Asp"
FT   gene            complement(251688..251760)
FT                   /locus_tag="Arch_R0007"
FT   tRNA            complement(251688..251760)
FT                   /locus_tag="Arch_R0007"
FT                   /product="tRNA-Glu"
FT   gene            251932..253557
FT                   /locus_tag="Arch_0210"
FT   CDS_pept        251932..253557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0210"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="COGs: COG0668 Small-conductance mechanosensitive
FT                   channel; InterPro IPR006685:IPR010920:IPR018062; KEGG:
FT                   cmi:CMM_1076 putative small-conductance mechanosensitive
FT                   channel; PFAM: MscS Mechanosensitive ion channel; SPTR:
FT                   D0WM12 Mechanosensitive ion channel family protein; PFAM:
FT                   Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91971"
FT                   /db_xref="GOA:D7BM22"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM22"
FT                   /protein_id="ADH91971.1"
FT                   /translation="MAVSNLPHVLAQILAQTTDPAEPSAPTTPAVEKAEAVVEVTVDVL
FT                   SFLAGTVIGMVAGVIATIIGMALSHIFARRYKYYAPIHTAIRKPVGLMLATLGAWIGFG
FT                   VASDNIDPAHAPDWLAWLEHGFLILFIVASAASIVAFVNGLVKAVYLRMEVSSTERASR
FT                   VETQVQVIHRVVSAVIWVLAFGAILLTFPAARTAGTSLLASAGLISVVAGLAAQSVLGN
FT                   VFAGLQLAFSDSMRVGDIVFYNGSTTTVEEITLTYVVLAVWDGRRIMVPSSKMTTEPFE
FT                   NWTRRAPEMMGTVEWHVDWAIPVRQARKQLDHLLHSTDLWDGRTGVLQVAEAINGTILM
FT                   RAIVSAHNSGTLIDLKNYLREAMVQWIQDEAPQAIPHYRRIVDEAPDFRAATDTTAALV
FT                   DKRVSQTPPPAFEPEPSVVETASTTVISRKELEEFARTPLAERVGDKDFTMGPLPDFTV
FT                   TPGTVAPGTVEPGIVTPAVMPEEPAGYQSAIFHGSEEAKKRAEQYAGPGDDVYEERNRK
FT                   IEQTANMAKVEDTEAEAEPEKEEK"
FT   gene            253558..254001
FT                   /locus_tag="Arch_0211"
FT   CDS_pept        253558..254001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0211"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /EC_number="1.8.4.12"
FT                   /note="COGs: COG0229 Conserved domain frequently associated
FT                   with peptide methionine sulfoxide reductase; InterPro
FT                   IPR002579:IPR011057; KEGG: bcv:Bcav_3481
FT                   methionine-R-sulfoxide reductase; PFAM: Methionine
FT                   sulfoxide reductase B; PRIAM: Peptide-methionine
FT                   (R)-S-oxide reductase; SPTR: D1BE41 Methionine-R-sulfoxide
FT                   reductase; TIGRFAM: methionine-R-sulfoxide reductase; PFAM:
FT                   SelR domain; TIGRFAM: methionine-R-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91972"
FT                   /db_xref="GOA:D7BM23"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM23"
FT                   /protein_id="ADH91972.1"
FT                   /translation="MAFADETPKYTEKIEYKLNKSPEEWRNLLSDMEFFVLREAGTERP
FT                   GTGELLHENRAGMYHCRACDAELFSSETKFDSHCGWPSFYDPDEKGAVVYIEDRTLAPR
FT                   IRNEVRCATCGSHLGHVFNDSPQTPTGLRYCMNSVSLRFEPGK"
FT   gene            254001..254771
FT                   /locus_tag="Arch_0212"
FT   CDS_pept        254001..254771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0212"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="COGs: COG3568 Metal-dependent hydrolase; InterPro
FT                   IPR005135; KEGG: mkm:Mkms_0980
FT                   endonuclease/exonuclease/phosphatase; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; SPTR: Q1BDF7
FT                   Endonuclease/exonuclease/phosphatase; PFAM:
FT                   Endonuclease/Exonuclease/phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91973"
FT                   /db_xref="GOA:D7BM24"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM24"
FT                   /protein_id="ADH91973.1"
FT                   /translation="MATVRCVTFNLEHGRPAREGIDDYFSRALAQLRDVDAGVVLVQEA
FT                   DGAARDWVTHSGGGHVHDIASFLGMNWVYAPSAFGYGVGVLSRFPIVAARYLRLPPVVR
FT                   PVYRKPNGKIHVRWPEPRVALYALLDSGSHPLIVGTTHLDIDQQAAPHQLRITATGFSR
FT                   VADHWGIDSSSSSFLLTGDLNMRPDAVESALAEVPVGIAAPRNVLATGLTYPHNEPRWQ
FT                   IDHVLGYRINAIYSEVLSTSISDHAGLVADIQPF"
FT   gene            254783..255646
FT                   /locus_tag="Arch_0213"
FT   CDS_pept        254783..255646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0213"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="COGs: COG5006 permease DMT superfamily protein;
FT                   InterPro IPR000620; KEGG: bcv:Bcav_3478 protein of unknown
FT                   function DUF6 transmembrane; PFAM: protein of unknown
FT                   function DUF6 transmembrane; SPTR: C0W5Q8 Integral membrane
FT                   protein; PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91974"
FT                   /db_xref="GOA:D7BM25"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM25"
FT                   /protein_id="ADH91974.1"
FT                   /translation="MPRETTDSWAWAPVILLTTAAIQYTGATIAIGLFSTVAVTAVAWG
FT                   RGFFGALMLLAWRRPRLQLGTVEGRRNLAVSALYGVSIVSTNVIFYWALARIPLGTTVA
FT                   LEFLGPVILAAVIGTGWQVRVGIALAATGVFLISWVGVDMAEPGVAAGVAIAILAGLTW
FT                   ATYMYVGRRIAVTGNGLDSLAIGMFMGSLVWFPVAAPYVAPIFTDPHVLGLVVLVGLLS
FT                   SVTPYAMDTVIMKRISAPTFALLNSLLPATSLLVGLVILRQIPTVGELIGLGLITAAVA
FT                   LVGMRR"
FT   gene            complement(255805..255881)
FT                   /locus_tag="Arch_R0008"
FT   tRNA            complement(255805..255881)
FT                   /locus_tag="Arch_R0008"
FT                   /product="tRNA-Lys"
FT   gene            256162..256761
FT                   /locus_tag="Arch_0214"
FT   CDS_pept        256162..256761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_3430 hypothetical protein; SPTR:
FT                   D0WM32 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91975"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM26"
FT                   /protein_id="ADH91975.1"
FT                   /translation="MNSSFRRPAQLRPEQLEVLEGDVNIEARLELAYTTARALVSLDQP
FT                   GDPDVVERVHDLIDNEGIDVVAESWMDAPATSLPGILWRGFLLREWIRRFPEDAKMRYA
FT                   AALAAGVESEGVPTLEQAKAEWDSVFSIDSSRKIVDVLRDSARLTDFLARVEPLWIETD
FT                   EHPLATEVTRRSTAMKRTSDEFREVGKELKLASGLI"
FT   gene            257240..258331
FT                   /locus_tag="Arch_0215"
FT   CDS_pept        257240..258331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0215"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /note="COGs: COG0226 ABC-type phosphate transport system
FT                   periplasmic component; InterPro IPR006059:IPR005673; KEGG:
FT                   jde:Jden_2082 phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; SPTR: D1BD79
FT                   Phosphate-binding protein; TIGRFAM: phosphate ABC
FT                   transporter, periplasmic phosphate-binding protein;
FT                   TIGRFAM: phosphate ABC transporter, phosphate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91976"
FT                   /db_xref="GOA:D7BM27"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM27"
FT                   /protein_id="ADH91976.1"
FT                   /translation="MRKKRSYASLAAMSALALGLTACSGMPERDGKDSDVSTNKGSING
FT                   SGASSQVNAQQAWRDNYSASSGFTINYDPTGSGTGREQFIAGKTAFAGTDSVLTPEEVA
FT                   AATSRCNGTEPLELPLYISPIALAFNLDGITSLNLTADLIAHIFNGTITTWNDPKIAAI
FT                   NPGVKLPEIPIIPVNRADDSGTTKNFQKYLVEAAGKAWPHKPEETWPISGTQSAEKTSG
FT                   VVNLVKSTPGAITYADAAQIAGLGSVAVQVNGKFLPYSPGAAAAIVDGSGLDDDATERR
FT                   ITFALKRDGSVADAYPIVMISYLVACTDYSQPGTAEAVKGYLTYVASAEGQEKAAAAKG
FT                   GNAPISQQLRERVTTAINLISTN"
FT   sig_peptide     257240..257332
FT                   /locus_tag="Arch_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            258343..259242
FT                   /locus_tag="Arch_0216"
FT   CDS_pept        258343..259242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0216"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="COGs: COG0573 ABC-type phosphate transport system
FT                   permease component; InterPro IPR000515:IPR011864; KEGG:
FT                   bcv:Bcav_3425 phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: D1BD78 Phosphate
FT                   ABC transporter membrane protein; TIGRFAM: phosphate ABC
FT                   transporter, inner membrane subunit PstC; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component; TIGRFAM: phosphate ABC transporter, permease
FT                   protein PstC"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91977"
FT                   /db_xref="GOA:D7BM28"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM28"
FT                   /protein_id="ADH91977.1"
FT                   /translation="MSNAYTKRADRLFSGSARTAAFAILALLGAVAIFLIISSQNALLT
FT                   SSDTIRESVSFARGMNFWEFAAAAVFGTLLAAVIALAIAVPFAVAIALFISHYAPRKFA
FT                   AIFGYVIDLLAAIPSVVFGLWGMWTLEPFLRPIFFLIPGFIPPARNILMGGIVLAIMIL
FT                   PIITSLCREVFLQTPRLHEEAALGLGATRWEMIRMVVLPYGRSGIVSASMLGLGRALGE
FT                   TMALLMVLSPGLLINFNIASPGQHSTIASQIALRFPEASGLSSDFLIALGLILFIITFA
FT                   VNFMARAIVARKTIGAQA"
FT   sig_peptide     258343..258477
FT                   /locus_tag="Arch_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            259239..260156
FT                   /locus_tag="Arch_0217"
FT   CDS_pept        259239..260156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0217"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="COGs: COG0581 ABC-type phosphate transport system
FT                   permease component; InterPro IPR000515:IPR005672; KEGG:
FT                   bcv:Bcav_3424 phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: C5C241 Phosphate
FT                   ABC transporter, inner membrane subunit PstA; TIGRFAM:
FT                   phosphate ABC transporter, inner membrane subunit PstA;
FT                   PFAM: Binding-protein-dependent transport system inner
FT                   membrane component; TIGRFAM: phosphate ABC transporter,
FT                   permease protein PstA"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91978"
FT                   /db_xref="GOA:D7BM29"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM29"
FT                   /protein_id="ADH91978.1"
FT                   /translation="MSTIASTPANKQNARTIQERTLKRRRYTDKIATIGMYATFAAAVV
FT                   PLVSLLYTVVTEGWARLTQSGFLTHTTFGSSNLDATVGAGHALLGTLMITGVTALIAIP
FT                   LGVLCAVYLVEYGRGKFAKTITFLVDVMTGIPSIVAGLFAAAAIPMINYAIFGHTEFKN
FT                   GFMGAIALVVLMTPIVIRNTEEMLRLVPNELREASYALGVTKAATIVKVVLRTSLSGII
FT                   SGIVIAIARVIGESAPLLITAGTTDVYNLNLFHGQMLTLPVYVYNEYTRGNQTTAWAGA
FT                   LLLILIVLILNLAARVIARRFAHV"
FT   gene            260216..261073
FT                   /locus_tag="Arch_0218"
FT   CDS_pept        260216..261073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0218"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /EC_number="3.6.3.27"
FT                   /note="COGs: COG1117 ABC-type phosphate transport system
FT                   ATPase component;
FT                   InterProIPR003593:IPR003439:IPR015850:IPR005670:IPR 017871;
FT                   KEGG: jde:Jden_2079 phosphate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: C7R0Z3 Phosphate ABC transporter, ATPase subunit;
FT                   TIGRFAM: phosphate ABC transporter, ATPase subunit; PFAM:
FT                   ABC transporter; TIGRFAM: phosphate ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91979"
FT                   /db_xref="GOA:D7BM30"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM30"
FT                   /protein_id="ADH91979.1"
FT                   /translation="MTTCILTPRSAAPKIPDMLDSAGSSAEHDGIHVRDLNIYYGDFLA
FT                   VRGVNVDIAPQSITALIGPSGCGKSTFLRSLNRMHEVVPGARVDGTVVIGGENIYGVGV
FT                   DPVAVRSRVGMVFQRPNPFPTMSIADNVLAGIRLNNRKISANEAEEIVETSLRGANLWN
FT                   EVKDRLGRPGASLSGGQQQRLCIARAIAVKPDVLLMDEPCSALDPISTLAIEDLMQELQ
FT                   SDYTIVIVTHNMQQAARVSQKTGFFNIGGSGQPGQLVEYNDTEVIFSNPAHEETEAYVS
FT                   GRFG"
FT   gene            complement(261175..262188)
FT                   /locus_tag="Arch_0219"
FT   CDS_pept        complement(261175..262188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0219"
FT                   /product="phosphate transporter"
FT                   /note="COGs: COG0306 Phosphate/sulphate permease; InterPro
FT                   IPR001204; KEGG: bcv:Bcav_3421 phosphate transporter; PFAM:
FT                   phosphate transporter; SPTR: C0VYU7 PiT family inorganic
FT                   phosphate transporter; PFAM: Phosphate transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91980"
FT                   /db_xref="GOA:D7BM31"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM31"
FT                   /protein_id="ADH91980.1"
FT                   /translation="MLDPTFLIVVLVILIAFAFDFTNGFHDAANAIATSVATRALAPRT
FT                   ALIMAAVMNFVGALLGTGVAETIGSGIVDIEAVPNQLVALFVVLSGLVGAVIWNLITWW
FT                   LGLPSSSSHALIGGLAGAGVAASISVQWSVIGEKVVLPMFISPFVGFILAYILMSIVMR
FT                   VFANYAYRPTMRKFRYAQTLSAAATALGHGLQDAQKTMGVVVLALVAGGFHEGHEVPLW
FT                   VKIGAAAAISMGTYSGGWRIMKTLGSKIIDLDPSQGFVAESVASSVLYTTAFVYHAPIS
FT                   TTHTITSAIMGAGATKRLSAVRWNVTKSIVGAWFLTMPAAAIVSALFYAVFHFIFI"
FT   sig_peptide     complement(262096..262188)
FT                   /locus_tag="Arch_0219"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(262188..262814)
FT                   /locus_tag="Arch_0220"
FT   CDS_pept        complement(262188..262814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0220"
FT                   /product="Putitive phosphate transport regulator"
FT                   /note="COGs: COG1392 Phosphate transport regulator (distant
FT                   homolog of PhoU); InterPro IPR018445; KEGG: xce:Xcel_0299
FT                   protein of unknown function DUF47; PFAM: Putitive phosphate
FT                   transport regulator; SPTR: D0WM40 Putative Pit accessory
FT                   protein; PFAM: Protein of unknown function DUF47; TIGRFAM:
FT                   conserved hypothetical protein TIGR00153"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91981"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM32"
FT                   /protein_id="ADH91981.1"
FT                   /translation="MSLSKFAPGKAVLEMFAKQANHIVSAAEILARMGGADRSTRKELN
FT                   KKLHEVENLADDGTHDVLQKVAHSFVLPYDREDVYALVSTVDDIVDLIDEAGDNMVLYR
FT                   IGHLPEKALELIEIINKCAVITNEAMKEIASMGDHTKKFWMEINQLENQGDIVYRKLMR
FT                   EIFADDDANAMEVLKIKFVVDALEAAIDSFETLAVSIEGIAIKES"
FT   gene            263074..264516
FT                   /locus_tag="Arch_0221"
FT   CDS_pept        263074..264516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0221"
FT                   /product="amino acid carrier protein"
FT                   /note="COGs: COG1115 Na+/alanine symporter; InterPro
FT                   IPR001463; KEGG: jde:Jden_1694 amino acid carrier protein;
FT                   PFAM: sodium:alanine symporter; SPTR: C0U4P6 Amino acid
FT                   carrier protein; TIGRFAM: amino acid carrier protein; PFAM:
FT                   Sodium:alanine symporter family; TIGRFAM: amino acid
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91982"
FT                   /db_xref="GOA:D7BM33"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM33"
FT                   /protein_id="ADH91982.1"
FT                   /translation="MAVFTDMQQFMEAATQWLGGVNDWLYYWIMIGALVGTGVIFTVRT
FT                   RFAQLRHFAGMARYLLHSRQGANGGISSFQAFAMGMSTRIGIGNITGIALAMVLGGPGS
FT                   LFWMWVVALVGMATGFAEATLAQIFKFRHRDGTFRGGPASYIMDGMKSRGLAVVFASAM
FT                   VFCMFVAMPMVQANTIAQVFVGAHGVAPWVIGLVIAGLTSLVLFGGVRRVAQATEVISP
FT                   LMALFYMCVAVIIIALNISQVPQFFSDVFASAFGAQQAFVGTGSAFVAAVLNGTRRGLF
FT                   SNEAGMGTAPNAAATATVDHPVQQGLIQAFGVFLDTVLICTATGFIISTTGAIDYASVT
FT                   PDDAAHITTDAITGTLGSWMAWPVSIMIFFFGFSSILGAYAYGEANLVFLKKSRPLELF
FT                   SRAVLVVFTFVGSVLALTFVWTVMDTAMFVVTLLNLVALHGLSPWVAALLRDYENQTIR
FT                   GLKPVFRAKNADLPGEIPSDVW"
FT   gene            complement(264616..265476)
FT                   /locus_tag="Arch_0222"
FT   CDS_pept        complement(264616..265476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bfa:Bfae_23020 hypothetical protein; SPTR:
FT                   C2KMY9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91983"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM34"
FT                   /protein_id="ADH91983.1"
FT                   /translation="MYQHVFRKDSPTAQHIIGNYSLKNAEKRGLIIPVGHRWYSTEPLT
FT                   GVEKIACENGLLIGCLSALKLYGLWVPFDRSTHFITAPNGSKPKISQCSLHRPRARTRL
FT                   ANHEIPTRAQSLVVPLQDAIEQALYYHEDETGLIILDSALNKGFINPYFADVAIANVQS
FT                   RKRRVLNRYVTESQSGSETRVRNFLQSHNYKVQTQVFIDGIGRVDLLVGDSLIIECDST
FT                   TFHSQPLNVTTDRERDLQAHLHGFARIRLSYQQIWHQWEDTKKRLSMCLSTGLHRKPPR
FT                   SLLDP"
FT   gene            266121..266957
FT                   /locus_tag="Arch_0223"
FT   CDS_pept        266121..266957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_3418 hypothetical protein; SPTR:
FT                   C5C235 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91984"
FT                   /db_xref="GOA:D7BM35"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM35"
FT                   /protein_id="ADH91984.1"
FT                   /translation="MAPMSPREPFLWKNSDVSIEDQQVTGTALVPVPVNTPLTEIMERR
FT                   AAYARALLGIYGATSLAVGAVFGPYAIAAAVAIMSGLLIAGWPYLLGLPNKVIPQVFLS
FT                   LLALALIVTALFGTLAHSTIVAAVGVIGAFVAEMFRGHGRARLIEQLSGGFAGAVVLVS
FT                   GSLWIHALRSHGKNVVIVAAVSLAIVALMHAFDSRAARVAGFVNGVAFAMGFGYVTRLP
FT                   YESAALIGLAAAGAYLLTSRAVENLPRPSPALNGVARAMIPLLAVGVVGFVVAAQL"
FT   gene            266971..267564
FT                   /locus_tag="Arch_0224"
FT   CDS_pept        266971..267564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0224"
FT                   /product="Domain of unknown function DUF1794"
FT                   /note="InterPro IPR014878; KEGG: bcv:Bcav_3416 domain of
FT                   unknown function DUF1794; PFAM: Domain of unknown function
FT                   DUF1794; SPTR: D0WM44 Putative uncharacterized protein;
FT                   PFAM: Domain of unknown function (DUF1794)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91985"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR014878"
FT                   /db_xref="InterPro:IPR022939"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM36"
FT                   /protein_id="ADH91985.1"
FT                   /translation="MAIRLPENLVPENTPLAWMIDSWVGGGILEYENVDPAAYVHELRF
FT                   DASDGGPYLKVTSKVWLANEPASIVDKEAPGQVTYDQLSKADLWMQHTGFVRVNPEGAK
FT                   REDGSVELEAMLASPVGVSHAWVGLINGPRLQMVTDSVMRSGSGAQIDAAKVMAGSVAS
FT                   DLFYAVDMAAFGAELRSYMAGRLSRTFDGSVDPA"
FT   gene            267561..268661
FT                   /locus_tag="Arch_0225"
FT   CDS_pept        267561..268661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0225"
FT                   /product="folate-binding protein YgfZ"
FT                   /note="COGs: COG0354 aminomethyltransferase related to
FT                   GcvT; InterPro IPR006222:IPR017703; KEGG: xce:Xcel_3028
FT                   folate-binding protein YgfZ; PFAM: glycine cleavage T
FT                   protein (aminomethyl transferase); SPTR: C0W5Y9 Glycine
FT                   cleavage T protein (Aminomethyl transferase); TIGRFAM:
FT                   folate-binding protein YgfZ; PFAM: Aminomethyltransferase
FT                   folate-binding domain; Glycine cleavage T-protein
FT                   C-terminal barrel domain; TIGRFAM: folate-binding protein
FT                   YgfZ"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91986"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM37"
FT                   /protein_id="ADH91986.1"
FT                   /translation="MSAIFDNDELVPSHFGNPFAEEQGLRAGRAFSLLDWDVVRVAGAD
FT                   CARLLHVISSRDFERVAPGTSTEMLVLDANGHVAHAAGAVVADDAIWLLTDRGLGQALV
FT                   DHIVKMRFMMRVEADVVDAVAVGALVDVPGSVCDVALAVWQDPWPVTAPGGAHYGVADE
FT                   DHPAFGRTCFVAIAPRDAQDSVVSAFKAAGFAPAGKIAWEAARVADWRPSFSHEGAQGV
FT                   LPHEVDWLRTAVHTAKGCYPGQETVAKLVNLGKPPRRLAFLYLEGGEELPPVGCEVTLD
FT                   SRVAGVVTSVARSADDGPIALALLKRNVPADAVVTVGDFVASQVEIVKREGKSSISPEV
FT                   RPGTGLNSRRLGGPAPAMSSKSLGGK"
FT   gene            268661..269125
FT                   /locus_tag="Arch_0226"
FT   CDS_pept        268661..269125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0226"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="COGs: COG1490 D-Tyr-tRNAtyr deacylase; InterPro
FT                   IPR003732; KEGG: xce:Xcel_3022 D-tyrosyl-tRNA(Tyr)
FT                   deacylase; PFAM: D-tyrosyl-tRNA(Tyr) deacylase; SPTR:
FT                   D0WM48 D-tyrosyl-tRNA(Tyr) deacylase; TIGRFAM:
FT                   D-tyrosyl-tRNA(Tyr) deacylase; PFAM: D-Tyr-tRNA(Tyr)
FT                   deacylase; TIGRFAM: D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91987"
FT                   /db_xref="GOA:D7BM38"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM38"
FT                   /protein_id="ADH91987.1"
FT                   /translation="MRAVIQRVERASVTVTDDDGNPSVVGKINTGLAVLVGVTHTDTAA
FT                   QVEKLARKIAQLKILRNPEGADGPKDRVSALEAGAGVLLVSQFTLYADARKGTKPSWSH
FT                   AAPGDVAELLFNQLVDAVRGYGLEVHTGEFGAMMAVELVNDGPLTIILDI"
FT   gene            269213..271834
FT                   /locus_tag="Arch_0227"
FT   CDS_pept        269213..271834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0227"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="COGs: COG0542 ATPase with chaperone activity
FT                   ATP-binding subunit;
FT                   InterProIPR003593:IPR004176:IPR003959:IPR001943:IPR
FT                   013093:IPR019489:IPR001270:IPR018368; KEGG: xce:Xcel_0363
FT                   ATPase AAA-2 domain protein; PFAM: ATPase AAA-2 domain
FT                   protein; Clp domain protein; AAA ATPase central domain
FT                   protein; UvrB/UvrC protein; Clp ATPase-like; SMART: AAA
FT                   ATPase; SPTR: D0WM50 Negative regulator of genetic
FT                   competence ClpC/MecB; PFAM: AAA domain (Cdc48 subfamily);
FT                   Clp amino terminal domain; C-terminal, D2-small domain, of
FT                   ClpB protein; ATPase family associated with various
FT                   cellular activities (AAA); UvrB/uvrC motif"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91988"
FT                   /db_xref="GOA:D7BM39"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM39"
FT                   /protein_id="ADH91988.1"
FT                   /translation="MFERFTDRARRVIVLAQEEARNLKHNYLGTEHILLGLIKEGEGVA
FT                   AKALEALGVSFDAVRDQVVEIIGEGQEQPSGHIPFTPRAKKVLEYAMREGLQLGHSYIG
FT                   TEHLLLGLCREQEGVAAQVLVKLDADLPKVRQQVTQLLSGYQGKEAVGVGGGGPREGVK
FT                   AGSTILDQFGRNLTQSARENKLDPVIGRHMETQRVMQVLSRRNKNNPVLIGEPGVGKTA
FT                   VVEGLAQAIAHGDVPETLKDKQLYSLDMGSLVAGSRYRGDFEERMKKILKEINTRGDIV
FT                   LFIDEIHTLVGAGAAEGALDAASLLKPMMARGELQVIGATTLDEYRKHIEKDAALERRF
FT                   QPIQVEQPSVKETIAILEGLRDRYEAFHRVTITDEALEAAATMADRYINDRFLPDKAID
FT                   LIDEAGARLAIRKMTAPPELRELDEEIADVKRQKEAAIDGQDFEKAAALRDQEQQLTEK
FT                   RAERDKAWREGDLDVVAVVDEDLISEVLSMATGIPVFKLTEAESAKLLRMEEELHKRVI
FT                   GQSEAVTALSQAIRRTRAGLKDPNRPGGSFIFAGPTGVGKTELAKALAEFLFGDEDALI
FT                   TLDMSEFQEKHTVSRLFGAPPGYVGYDEGGQLTEKVRRKPFSVVLFDEVEKAHQDLFNS
FT                   LLQILEEGRLTDSQGRVVDFKNTVIIMTTNLGTKDIAKGVATGFQFDGDQTSSYERMKL
FT                   RVNDELKNHFRPEFLNRVDDIIVFPQLQKPEILQIVDLMIAKLGARLADQGMGIVLTDK
FT                   AKNLLADRGYDPVLGARPLRRAIQRDIEDELSEKLLFGEFRSGQTIVVDVNEDNIPMSF
FT                   TFTGQDSDYRLPEGVQPAPEAAEINGLAQPTTIVPEGDAAEDAEGASDVHRPDPGTSTL
FT                   ES"
FT   gene            272469..274094
FT                   /locus_tag="Arch_0228"
FT   CDS_pept        272469..274094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0228"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="InterPro IPR019931; KEGG: cdi:DIP0235 putative
FT                   fimbrial subunit; SPTR: Q6NK05 Putative fimbrial subunit;
FT                   TIGRFAM: LPXTG-motif cell wall anchor domain protein;
FT                   TIGRFAM: LPXTG-motif cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91989"
FT                   /db_xref="GOA:D7BM40"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="InterPro:IPR032334"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM40"
FT                   /protein_id="ADH91989.1"
FT                   /translation="MFNKLRKMAVVAVTAGALMLGGVGAAYAVPDSIVDADATGSIYLT
FT                   KYDDAAGKKDADGTKQNVAATPIIGIEFTLTPITGIDFSKNEDLKKAAALDAAKLAAGE
FT                   LPEGINLDKAQASVEVTAEGGKIHWRGLKVGAYLLQETKSKAADGKTYKAAAPSIVFIP
FT                   TTDPKNQTSWIMDEEGNDKYAVYVYPKNSLDENVKKVVDKDVHAGGDVTFSVEASMPSP
FT                   NKDEKINDFAFYDKLDPALDINGKDNDVTVQVGDKTLAKGQHFTVTIKDGTQDELWVVL
FT                   TPAGLEEATNAKATNAGAKAVMTFKAKVLKAAVVPNQAQVYKNTGKGEGTVKPGETPKE
FT                   PWEKTNTTVSAWGKIKIQKKDEAGNALDGAVFELYQCGADKNGKPTVTGNPIKVGEKTE
FT                   FTDQGKKDGIIEIDGIHVTDVADNGTVKLPEYCIVEKKAPAKYELRHDPIKVNVALGGI
FT                   TKATEKFEYDVNGVLTSYSNSGPLTELFTMDGSTINVATDVVNIPVKPKLPMTGGAGVA
FT                   LFGFLGLAIIGGGVYAAKRNTKKA"
FT   sig_peptide     272469..272552
FT                   /locus_tag="Arch_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            274291..275289
FT                   /locus_tag="Arch_0229"
FT   CDS_pept        274291..275289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0229"
FT                   /product="sortase family protein"
FT                   /note="COGs: COG3764 Sortase (surface protein
FT                   transpeptidase); InterPro IPR005754; KEGG: cjk:jk1700
FT                   putative fimbrial associated sortase-like protein; PFAM:
FT                   peptidase C60 sortase A and B; SPTR: Q4JTI0 Putative
FT                   fimbrial associated sortase-like protein; TIGRFAM: sortase
FT                   family protein; PFAM: Sortase family; TIGRFAM: LPXTG-site
FT                   transpeptidase (sortase) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91990"
FT                   /db_xref="GOA:D7BM41"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM41"
FT                   /protein_id="ADH91990.1"
FT                   /translation="MHNTQATVEPKLERQAEVPARLKKNGMLMPIFVVLIGITVLLYPV
FT                   IATQWNNIQQQEVASEYKSFVKEADTSELEASLERAHEYNKNRTVGPILDPWTARLSDD
FT                   NEPFKEYLHQLDLSGTMARIVIPSIHVDLPVFHGTRPDTLEQGVGHLFGTDLPIGGKNT
FT                   HSVLTGHTGLQTATLFDNLKNVKEGDSIYIDVYGQKLRYVVYGTEVVLPEDAQNLYKVE
FT                   GKDLLTLITCTPYGINSHRLLVHAERAPMDEQAAQELDEASGFTLQWWMWLFIAGAVLA
FT                   MLALIWYVRKSRRQVDDAVVAPEPATTAGTTTASDSDQFNDIIFGTQGEHE"
FT   gene            275286..276005
FT                   /locus_tag="Arch_0230"
FT   CDS_pept        275286..276005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0230"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdi:DIP2223 potential surface-anchored
FT                   protein; SPTR: C0WGP1 Surface anchored protein; TIGRFAM:
FT                   LPXTG-motif cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91991"
FT                   /db_xref="GOA:D7BM42"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM42"
FT                   /protein_id="ADH91991.1"
FT                   /translation="MRTSKGLATGSLVLVSALGLTVGTQAAYAQPVIGDTENVPAQVSC
FT                   ESTSLTITLPKPNPFDQPSPGDLPEPTGAGFKITVQQVKGVDLTSFAGWDGIDKMTTDE
FT                   AKARGFVGEPHVGLTNAQASVSFKGLPIGLYMVSGVAPEDPHYKLSHLDPFLVSVPLGA
FT                   GDTWDCAVNIQAKTHYSAEPKPVPTPPTPTPPEPPQPPRPPLSHTGAAVMALGGASLAL
FT                   LGTGTMLVRVRREKEVK"
FT   sig_peptide     275286..275372
FT                   /locus_tag="Arch_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            276007..280086
FT                   /locus_tag="Arch_0231"
FT   CDS_pept        276007..280086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0231"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="InterPro IPR001899:IPR019931; KEGG: cjk:jk1702
FT                   putative surface-anchored protein; SPTR: C2BJ20 Possible
FT                   surface-anchored protein; TIGRFAM: LPXTG-motif cell wall
FT                   anchor domain protein; TIGRFAM: LPXTG-motif cell wall
FT                   anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91992"
FT                   /db_xref="GOA:D7BM43"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM43"
FT                   /protein_id="ADH91992.1"
FT                   /translation="MLSRVNRLMSAVAVATLAACLAVGALPALSILPNASAANISPTAP
FT                   ATASTASADSDFTSSTVATQTEGNVANDSTIAHNKVVLELNKATVVDGVVAIERTEPGK
FT                   EFLGHGSALVNGGELSEEAVASAPVLDKRGVRIAVKLPDGWATSDKLELGYKTFGPDAG
FT                   AEWKTINDGAQVFALRDDVSNAVEVADPTQRFNESITTKSNDVQVPSKDYFNNGKCSKS
FT                   WVGDVYFFAPANINTDKIIIKRPTEYNLYVPPTYQFNADTPNIKVAEFERMYHQAYGPV
FT                   WADIRRADVTVRAIDDKTLEVQVQGGIKIEKGEYVKLTNIFSFCSAGSPGAKNLSIEMH
FT                   GQTQKGGFCEDRARYTFPARPLHAYSYLTPIMQDASGNLVNRDKTTEKFDRGKSLKEIA
FT                   ELQGKNDPKRVFYAPWRDEYKNLDVYSKDSDKFLKEYALRHVPYRDPQGRMIDGAKVVS
FT                   RQGKRELTDEERRNGINVYVNESKPNGQIRWKSYIARQNNGTGQFERLGGPQAETGWIV
FT                   NALAFNPQDNWLYGISQGRLGEDWGRRSNQTIQSDETEFRPVITGDDPCFPAGHLLQIH
FT                   PVTGEVFNLGRVTAGVDNFMTGYAFQGQKQRYWPNDLWGGINVGGIDTEGNYYVANASR
FT                   SGSGAVYKVNLKNVTAEVTKNANKWLRTPAIRYTDDWNLVHDRSGRAWSEDWTPLFVPE
FT                   KTECKPDTGTPCKQRQAGNYMWGISNGWNSQGRVYIERISADDGNLQRWDVTALRTYAG
FT                   QSLPVGNQWGRAWSFGNGMLGFATSSSRASDKVVRIKVTNPESESPSFELISVNANAQP
FT                   SYNSNGTSAVNFEENIVDLKLKKSRKDFVDTNGVNRVQWDLEVKNVSESAASSGFTVFD
FT                   TIPASYRVVRVQAEEKVFDTNSSTSIVGPWSVYLKKGDQGHDVLEGSHGALQAGKTVKL
FT                   TIIAEPRSDQNLPIECIENVAGVIGIDRDPSTVNANEFGKTMEGVIDKYGDWLKLNGGI
FT                   FGDLVSDQQCRPTIVVKKQIVEDGKITDEAAGGWAFSAQSDKDNLDLEGQEGFGKESTK
FT                   VTASEGVEKGTVIWRPKENGQFKLTITEKMTDEQTAAGYAIRPQENGGDARNARNAICK
FT                   VTVKDGKKLAQPEMVKVEDHPDAPGFAFSFGDQTMFPRGMNVKTEQRVECTVQNEIANH
FT                   QIFVRKEAYDPQQSDKIGTLPDLGGAEFAVYELSESVSTKPRPKSWEEWQKYIVKAGDG
FT                   STEKPVEIKDYRTPIPVKVGKSYIVVETKAPTDKDGRPYSLRPAPIPFTVTTAHGEDAT
FT                   HKRPFSIQMENDLLATASWKNENGNSQKAAMYVTVADVHTGTLPRTGGAGVAWLGGIGG
FT                   LLVLAGLTWAQRKQRS"
FT   sig_peptide     276007..276165
FT                   /locus_tag="Arch_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            280428..281627
FT                   /locus_tag="Arch_0232"
FT   CDS_pept        280428..281627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0232"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="InterPro IPR002525:IPR003346; KEGG: mlu:Mlut_12160
FT                   transposase; PFAM: transposase IS116/IS110/IS902 family
FT                   protein; transposase IS111A/IS1328/IS1533; SPTR: C0W956
FT                   Transposase, IS111A/IS1328/IS1533 (Fragment); PFAM:
FT                   Transposase IS116/IS110/IS902 family; Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91993"
FT                   /db_xref="GOA:D7BM44"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM44"
FT                   /protein_id="ADH91993.1"
FT                   /translation="MRTDRPDIFLGLDVGKTDHWACALTDSGQVLWNKTLPNNEQKLTD
FT                   IYTNLSAKGSVLVVVDQPATIGALAIAVAQHMGIEVAYLPGLTMRRIADLYPGEAKTDE
FT                   KDAFIIADAARSLPHTLRQLTKTDQDEAGLAMLTGFDLDLSRQVNQVSNRIRGLFTQIH
FT                   PELERVLGPRLEHDAILEVLATWPTPQALRKAGRARMDAKLKKHGARRHAAWTEDILTA
FT                   LAKQSVIVTGTEAAGLVIPHLARQLVSLHAQRANVASEVEKIVAPHPLYLVLRSMPGIG
FT                   LRTAAVIIAELAGKTFTSSAALASYAGLAPTTRQSGSSIKSERVSHSGNKRLKRALFLS
FT                   AFAVIRTDPVSRAYYDRKRAQGKRHNQAIIALAHRRLTVLYAMLRDGTLYDVPDTALAA
FT                   "
FT   gene            282164..282832
FT                   /locus_tag="Arch_0233"
FT   CDS_pept        282164..282832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amu:Amuc_0584 outer membrane autotransporter
FT                   barrel domain protein; SPTR: B6B0M8 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91994"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM45"
FT                   /protein_id="ADH91994.1"
FT                   /translation="MQKTKRITVAGLSAIISLSIFGAMPAAHASQLVVDSNKVVGAEMF
FT                   RRSVSQEITTSPTILGLTDKNKNSLSILGIGKDGYARTIDRTDNGFGGGVGLSNSLNLL
FT                   PTDRISISEDGKQAEIITASGEVLGHFEDPTLSVGGKEVPGEFFYENGSLVTYADSAHS
FT                   FVFYEKSCWQGTTAKWTWRVAGTLICGATGVVTVIGGGVCGLAWAGAEDAMNINKRACK
FT                   "
FT   sig_peptide     282164..282250
FT                   /locus_tag="Arch_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            282829..283062
FT                   /locus_tag="Arch_0234"
FT   CDS_pept        282829..283062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsh:Rsph17029_0016 hypothetical protein; SPTR:
FT                   A0Z0M5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91995"
FT                   /db_xref="GOA:D7BM46"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM46"
FT                   /protein_id="ADH91995.1"
FT                   /translation="MTDKENSRKRICRLWLTMSAAWPAGYFLSAFLRSIVGKVSFEAAF
FT                   RAGMESFILNGIPTFCVFTVIFIALVRWLGKD"
FT   gene            complement(283153..283581)
FT                   /pseudo
FT                   /locus_tag="Arch_0235"
FT   gene            complement(283582..283701)
FT                   /pseudo
FT                   /locus_tag="Arch_0236"
FT   gene            283728..284100
FT                   /pseudo
FT                   /locus_tag="Arch_0237"
FT   gene            complement(284311..285642)
FT                   /locus_tag="Arch_0238"
FT   CDS_pept        complement(284311..285642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0238"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /note="COGs: COG2056 permease; InterPro IPR018461; KEGG:
FT                   cdi:DIP1661 hypothetical protein; PFAM: Na+/H+ antiporter
FT                   NhaC-like; SPTR: C0W230 NhaC family sodium:proton (Na+:H+)
FT                   antiporter; PFAM: Na+/H+ antiporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91996"
FT                   /db_xref="GOA:D7BM47"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="InterPro:IPR032813"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM47"
FT                   /protein_id="ADH91996.1"
FT                   /translation="MNAVLIAVVSMLLLALTRVHVVIALFVGALVGGFTAGLGLDGTML
FT                   AFQDGLGAGAKIALSYGLLGAFAMAVAQSGLPDLLASWLISRTNKGSTTVVKYGLLGGI
FT                   LMMAVFSQNLIPVHIAFIPILIPPLIPVFNRLRLDRRVVASIMTFGLVTTYMFLPLGFG
FT                   SVFLNDILLGNIKSAGLDTSGINVMAAMAIPALGMLAGLLIAVGFSYRKPRDYGEDEVV
FT                   VATTLQPHVSTRNGIVALVAVLVTFGTQLMLGWLGYDADALLLGSLLGLSVFLITGTLK
FT                   LRQADVAFTNGMKMMAVIGFTMISAQGFASVMNATGDVESLVEAASALVAGNKALAAVA
FT                   MLIVGLVVTLGIGSSFSTLPIITTIYVPLCMSLGFSPLATVAIIGTAGALGDAGSPASD
FT                   STLGPTSGLNVDGKHDHIRDSVIPTFLHFNIPLLVAGWIAAMVL"
FT   sig_peptide     complement(285571..285642)
FT                   /locus_tag="Arch_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            285898..288645
FT                   /locus_tag="Arch_0239"
FT   CDS_pept        285898..288645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0239"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="COGs: COG0737 5'-nucleotidase/2' 3'-cyclic
FT                   phosphodiesterase and related esterase; InterPro
FT                   IPR004843:IPR008334:IPR019931:IPR006179; KEGG: cgt:cgR_0412
FT                   hypothetical protein; PFAM: 5'-Nucleotidase domain protein;
FT                   metallophosphoesterase; SPTR: D0WQ91 5-nucleotidase;
FT                   TIGRFAM: LPXTG-motif cell wall anchor domain protein; PFAM:
FT                   5'-nucleotidase, C-terminal domain; TIGRFAM: LPXTG-motif
FT                   cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91997"
FT                   /db_xref="GOA:D7BM48"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM48"
FT                   /protein_id="ADH91997.1"
FT                   /translation="MKSPMKRAAIGAVAAASLIMAPMSAWAAEEGTPTVDAATSETVEK
FT                   ATEGAGEAAGVEKADEKTGDKAEAGEPAKEDKAEGAEKPVADAEKKADDKAKEDPKKDE
FT                   PKKELTPEEQKKAELKAKQEEQRKKLVEETKAKTEAALKKAKEEAEKAKAEGIVTLNLF
FT                   NLTDIHGHIEAQPKINKDKTFGGYTESGLASVKCYIDQAKKSNPNTQFTLLGDNIGASP
FT                   FTSGSANDNPTIEALNAMDVFASTIGNHEFDKGIKVLQERFNGSKDYTKVAFPYLGANV
FT                   EGLDGLDKDGYKIWETNGVKVAFIGAIENDVATKLPIGTVDTLKFKEAAPVINDIAAKL
FT                   KDGNAENGEADIVVAMYDNDVLQSYPNMSANVDVIMGGDTHKPYFGYDANPQKNDKGET
FT                   VGKAITTKDGHPITATASGSFTDNLSNVVVKYDTKQKKVIESYAQKITATEVMACGEDP
FT                   TVKDIVAKAAEAAAPKKKEVISKGTGNFYRGVHKLTENDSLDAGSNRGTESTIGGLIAD
FT                   AMKDTFTTLDGKPVDIGIINAGGIRADLEPKDGVVTVGDVFAFMPFSNEVSYATLTGAQ
FT                   VKTLLEQQWKSLEPNEKGEKSTRPMLKLGLSSNVKYSFDYADKTKGAGNRVTSILVNSE
FT                   PLDMNKQYIVGSVSFLMTGGDSFDILKDDAVKASYRVITKGLDRDFMAEYLKKHQDVKP
FT                   RDHKSSIGVSLSDLKKNGNAVSAQVELRGLSFSQEGEAKVKNVTVEFGGKAVQHEVNNT
FT                   IVDANATNYEAIITADGVGYTGKFAISADTQCADKAATVHVPLIVKNEAGTELVSAKQG
FT                   IGVNVNCATGEVTASNGFGDKAAGNQKPDDSANGDNSKGNSSTGESSKGDSSKSKQSSD
FT                   MHKSAQKSAPKGKLAQTGATVGILAGIAVLTLLGGLVLVRRRQK"
FT   sig_peptide     285898..285978
FT                   /locus_tag="Arch_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            288894..291632
FT                   /locus_tag="Arch_0240"
FT   CDS_pept        288894..291632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0240"
FT                   /product="pyruvate, phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="COGs: COG0574 Phosphoenolpyruvate synthase/pyruvate
FT                   phosphate dikinase;
FT                   InterProIPR002192:IPR008279:IPR000121:IPR013815:IPR
FT                   013816:IPR015813:IPR010121:IPR018274; KEGG: tfu:Tfu_0863
FT                   pyruvate phosphate dikinase; PFAM: pyruvate phosphate
FT                   dikinase PEP/pyruvate-binding; PEP-utilising protein mobile
FT                   region; PEP-utilizing protein; PRIAM: Pyruvate, phosphate
FT                   dikinase; SPTR: D0WM96 Pyruvate, phosphate dikinase;
FT                   TIGRFAM: pyruvate, phosphate dikinase; PFAM: PEP-utilising
FT                   enzyme, TIM barrel domain; PEP-utilising enzyme, mobile
FT                   domain; Pyruvate phosphate dikinase, PEP/pyruvate binding
FT                   domain; TIGRFAM: pyruvate, phosphate dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91998"
FT                   /db_xref="GOA:D7BM49"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM49"
FT                   /protein_id="ADH91998.1"
FT                   /translation="MTKYVYNFTEGDKDQKDLLGGKGANLAEMTKLGLPVPPGFTITTD
FT                   TCRYYLAQGGVPEELKGQVTEAIAHVEDVMGKKLGDPGDPLLMSVRSGAKFSMPGMMET
FT                   VLNIGLNDQSVEGLAAVGNERFAWDSYRRLIQMFGKTVMDIDGDLFANALHDLQERHGY
FT                   AGDLDMTTDDLKELVATFKEIFKAETGQDFPQDPREQLNLAVVAVFNSWNTDRARIYRR
FT                   REHIPNDLGTAVNVQTMVFGNMGEGSGTGVCFTRDPSTGDSGVYGDYLENAQGEDVVAG
FT                   IRNTLSLADLERLDKTSYDELVGIMKKLENHYRDLCDIEFTIQQGKLWMLQTRVGKRTA
FT                   AAAFRIAKQLVEEGLITEDEAVTRVTGEQLTSLLFPQFDKKAPKHLLTRGMAASPGAAV
FT                   GEIVLNNEQAKARVAAGASVILVRRETNPDDLEGMVAASGVLTARGGKTSHAAVVARGM
FT                   GRCCVVGADQLLVEEVAGTVSIKGSDKVFQAGDIISIDGTTGEVFEGAVDVTSSPVMTY
FT                   IAEGLEAGLAVSDDDDTKDLVRAVDLILTRADNARALLVRANADTPEDAQRAREFGAQG
FT                   IGLCRTEHMFLGDRRKLIETVILAKTDEAKQAAFDALLPLQKGDFLGIFEAMDGLPVTV
FT                   RLIDPPLHEFLPDLTALSVELAVKASKGEKISEEEHALLEAVKSNHEQNPMLGLRGVRL
FT                   GLKLPGLITMQVRAIAEATAELKKAGKDPKPEIMVPLIGSSREMQIVRDMAEEVLAEVS
FT                   AEHGIELDLPIGNMIELPRAAMSADTIAAESDFFSFGTNDLTQTTWGFSRDDVESTFFN
FT                   EYFDYGVFGISPFESIDVHGVGAVVEMGVERGRSTKPGLKMGVCGEHGGDPASIHFFAE
FT                   IGLNYVSCSPFRVPVARLEAGRAAISNESPRSAGGAANRTA"
FT   gene            291821..293614
FT                   /locus_tag="Arch_0241"
FT   CDS_pept        291821..293614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0241"
FT                   /product="acyltransferase 3"
FT                   /note="COGs: COG1835 acyltransferase; InterPro
FT                   IPR002656:IPR013830; KEGG: lxx:Lxx20050 lipopolysaccharide
FT                   modification acyltransferase; PFAM: acyltransferase 3;
FT                   SPTR: C0W6X9 Lipopolysaccharide modification
FT                   acyltransferase; PFAM: Acyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADH91999"
FT                   /db_xref="GOA:D7BM50"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM50"
FT                   /protein_id="ADH91999.1"
FT                   /translation="MTNERIGYISGLDGLRAIAAMIVVLYHLVPGIAEAGYIGVDMFFV
FT                   ISGFLITALLVKEKEARGKISVRSFWVRRIRRLLPAVAVATLGSLALARIFGGDTLTQL
FT                   RWQAIGSLTGTYNWLQISHASSYFDKQSPLLLSNMWSLAVEQQFYIVWPPIVILLLVCT
FT                   VVEIRIVCALLLGIGSIVLHALTVGADPTSAYVSTFSHSFGLMFGAALALALPGLLTGS
FT                   RAGTKAIWGWISWLSLLAIVVLSFILTDSHYMYPWGMVAFSILMVGTIRGLLPDASGFG
FT                   TRSLRAVLETPPLVWIGHRSYGIYLWHWPLHVIGFYHSPMAAVPTALIVLMLSIALADV
FT                   SYRYIETPIRTHGFLGWLRTMPPLHKKKAAGIVLAALVTGTAVAGFITEHATSSGQQLI
FT                   IDAEKQAKEQQSTPAPPPLSEPRDTPENPKRPVLPNVVGENVTVIGDSVTVAATPALQE
FT                   KLPGIVVNSEVSRSIKQFPTIAAQMAQENQLRPYVVIALGTNGAITEEDAQAILNAVGP
FT                   DRRIVLVTASAPEYATWVPVSNSTMREMARKNPDRVVIADWQSIALAHPDLLAGDQIHP
FT                   GTEGSALFANEVFQALHRFQK"
FT   gene            293724..295010
FT                   /locus_tag="Arch_0242"
FT   CDS_pept        293724..295010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0242"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xce:Xcel_3007 hypothetical protein; SPTR:
FT                   A7BBM1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92000"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM51"
FT                   /protein_id="ADH92000.1"
FT                   /translation="MALYALENGKLVEAPGNAGASGKLADVIVDAVQSQTLALVQHPLF
FT                   PIGYVTNRESHDPVQSLIALDATKRVITIEVLRHLNSETLLHATSRSGYFATLNRQQLA
FT                   EIYPGTEQDFAHRWSLFLENTSPAQKPTARLYLFCLSIDEAVKNSLCGLGVEAKLVLPY
FT                   EGLSGTLIEVAEAASYGTNILAKAPQPWMIEAPQPAEPAAPQTHTVDQSLWNIEGWADR
FT                   SGVAPLPYHQREAQESPRVVLPEPEIDPIVSATEEPAQAKESLPQRREDTAIMLAELTD
FT                   PPHKLGRRARRRAAWNSDQPMATPASPESSDSPDTAIIPSIKPAFPIQPPAPRRGKSLY
FT                   EQMMDHKKRAEQRLWDESAPNDFSEKLLISERDSAAESSRAVELAAENDQTALPDWMAA
FT                   TERILYPPTPPKQAQADRVTRRSRRRRQA"
FT   gene            complement(295007..296035)
FT                   /locus_tag="Arch_0243"
FT   CDS_pept        complement(295007..296035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0243"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COGs: COG2267 Lysophospholipase; InterPro IPR000073;
FT                   KEGG: jde:Jden_2115 hypothetical protein; PFAM: alpha/beta
FT                   hydrolase fold; SPTR: D0WMB4 Hydrolase, alpha/beta fold
FT                   family domain protein; PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92001"
FT                   /db_xref="GOA:D7BM52"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM52"
FT                   /protein_id="ADH92001.1"
FT                   /translation="MTTWHEDILGVGFSYTTLELHPDEQGEAYATLIRYLPQEDQEAGE
FT                   RPDPAFAFIAIHGWNDYFYQTELARTITSLGGQFYAIDLRRYGRSHREGQLWGYVDDLS
FT                   TYDEDLHAALDVIFDTHGYSIPLVMYGHSTGGLTAALWADRHPGALAGLILNSPWLEFQ
FT                   GSTLMRQIGQPLIDALAYLSPTTIIPTADNGFYQRVLTGWTDADGDMPPHTPGDPFFEG
FT                   GWNPDDRYRHFPSFPVRAGWLSAVLAGHYRISEGLELDTPVLVVTSARSIAAEEWSDEL
FT                   RTGDAVLDVTQMWKRLPTLAQSVTLAKVDGAIHDVLFSRAEVRRVAYDHISRWIRGFIV
FT                   GN"
FT   gene            complement(296094..298475)
FT                   /locus_tag="Arch_0244"
FT   CDS_pept        complement(296094..298475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0244"
FT                   /product="PKD domain containing protein"
FT                   /note="InterProIPR000601:IPR001087:IPR013831:IPR002035:IPR
FT                   013830; KEGG: pac:PPA1665 hypothetical protein; PFAM: PKD
FT                   domain containing protein; lipolytic protein G-D-S-L
FT                   family; SMART: PKD domain containing protein; SPTR: C0VY99
FT                   Putative uncharacterized protein; PFAM: GDSL-like
FT                   Lipase/Acylhydrolase; PKD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92002"
FT                   /db_xref="GOA:D7BM53"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037460"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM53"
FT                   /protein_id="ADH92002.1"
FT                   /translation="MQSLRKTCATATAALLLSLSLATPALATEPTPPANQEKYVTLSLI
FT                   GDSYTAGNGAGLYYGPKESYRSMRNWGHVYADKLNKQGVHTTVHNLAHSGVTTDMVLKD
FT                   QISKVPTDTDIVLFTVGGNDIKFADIVTGCFGDPLFLGSYAKCTKAMDFANENLDATFK
FT                   RVKSILTDLSKRLTPNAQIVLVGYPLLSTPLEHIWSKNGFWSFSSGEKFDAAKAVRDFG
FT                   VKAAEKQAELIDSWNSDPALQHVTFVPTHAKFAEHEPDPRLLHKNPRRWLNELFETEGK
FT                   QNDKGEIESTTALKDYVHFYHPNITGHEEIGKLVYEKIGVPSSARDKESYARPIDLTFV
FT                   VESSDDTKAKLPEIKKQMRRIAQQTFDAAKENGNENPQKNTRFSLVTYSNAQPPARVDA
FT                   PTSLEGEVAPATEPAEADDKKAVSEKAEAEPQPEAVAKKKHKEKQDEPTVTFGELKDIL
FT                   SQVSALDTTAAPLSDFFAATEKAVKNTGWRQEARKIVVVISDAETTQSEADVAKKVEEL
FT                   LLKAFAANTAELNLIDLDKDRTETMASLFTRTGGRIQLLGDLRPLILEAPTAKLGMLSI
FT                   QKVGTSIEFNADGSLSPNSDIVRYEWDFNGDGQTDESTTEPKVTHTYSAEYSGQVSVKV
FT                   VDQDDQFAIASINIAITRDGDSIAEPHDNCPTVPNEDQLDTDKDGIGDACDPTPLGDAP
FT                   KAMTEPETSKLFAENGTGETTTRNVTQTQQDPTPVTQPAASSQMLSQTGATILGWIIGA
FT                   LILVALGGAGMAFARRQSAKAAAKMQADAAQTRAGDAPQA"
FT   sig_peptide     complement(298395..298475)
FT                   /locus_tag="Arch_0244"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(298479..298949)
FT                   /locus_tag="Arch_0245"
FT   CDS_pept        complement(298479..298949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0245"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4344 protein kinase; SPTR: Q5ZP17
FT                   CcV1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92003"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM54"
FT                   /protein_id="ADH92003.1"
FT                   /translation="MSPDQSSFSSSSKPRKRWKRTALGALVLSCAGVGLLGFGNQTGVF
FT                   GPTSSMKHLLDEKLAQPSELGISTEKYSHSPRPGLFEKAAPEDVTYEFLTTSNDVDFLA
FT                   LKEIARRDGWVDDTSASGINTWYANKTTATKPTVRLSITKISYRIVVKLSYY"
FT   sig_peptide     complement(298812..298949)
FT                   /locus_tag="Arch_0245"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            299155..300684
FT                   /locus_tag="Arch_0246"
FT   CDS_pept        299155..300684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0246"
FT                   /product="NLP/P60 protein"
FT                   /note="COGs: COG0791 Cell wall-associated hydrolase
FT                   (invasion-associated protein); InterPro IPR000064; KEGG:
FT                   blt:Balat_0454 cell wall-associated hydrolase; PFAM:
FT                   NLP/P60 protein; SPTR: D0WMB9 Putative NLP/P60 family
FT                   protein; PFAM: NlpC/P60 family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92004"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM55"
FT                   /protein_id="ADH92004.1"
FT                   /translation="MKKRVYGCAASISALALILTSSSAFAAPVTDDDIRGSKAAEETAK
FT                   MSIADAELELARLAGESTRLEQEAAAAQVENIRAQAQLSDAIASAIASQGKANKAREDV
FT                   DHAKNQLGSISQAMYKDSAANITSSFYLLGADTFHEANKRNRAFDAIANQADNKVKHFA
FT                   ALEEIAKVLQNKADKAAKDQIAVADGVAQAEQKSNAIAQKAQQQVAMAKARRSELVTVL
FT                   AHQRGTSEALEAQRLADIEADRAARSEAAAAALVAGANADRFQEAAELAQKNAQEANAS
FT                   LASVKANLAEAEKSGNQSAIALAKDAVDKAQKASETLAANQKIVEERAAAERAAAERAE
FT                   AERRAKEAREREEAERARQEAARKAAEEQAAREREAAAAAAQRPAPAPAPAPARTSRNI
FT                   GQQLVDFGRQYLGVPYVWGGSTTAGWDCSGFMQFIFNHHGYNVPRVSNQYAHQGYRQVS
FT                   PSEALPGDVVLWPGHVGMYSGNGMHIAAYNPAMGTQEGPVYGSPIYLRVAE"
FT   sig_peptide     299155..299232
FT                   /locus_tag="Arch_0246"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(301016..301519)
FT                   /locus_tag="Arch_0247"
FT   CDS_pept        complement(301016..301519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0247"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="COGs: COG0221 Inorganic pyrophosphatase; InterPro
FT                   IPR008162; KEGG: bcv:Bcav_0696 inorganic diphosphatase;
FT                   PFAM: Inorganic pyrophosphatase; PRIAM: Inorganic
FT                   diphosphatase; SPTR: D0WMC4 Inorganic diphosphatase; PFAM:
FT                   Inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92005"
FT                   /db_xref="GOA:D7BM56"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM56"
FT                   /protein_id="ADH92005.1"
FT                   /translation="MEFDVTIEIPKGNRNKYEVDHETGRIRLDRMLFTSTRYPDDYGFI
FT                   DNTLGEDGDPLDALVLLDEPTFPGCVIRCRALGMFRMSDEAGGDDKVLCVPSADQRASW
FT                   RTEIEDVSEFHRLEIQHFFEVYKDLEPGKSVEGAHWVGREAAEEEIRASFKRAEDTGYY
FT                   DHAH"
FT   gene            301605..302966
FT                   /locus_tag="Arch_0248"
FT   CDS_pept        301605..302966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0248"
FT                   /product="D-alanyl-D-alaninecarboxypeptidase/
FT                   D-alanyl-D-alanine-endopeptidase"
FT                   /note="COGs: COG2027 D-alanyl-D-alanine carboxypeptidase
FT                   (penicillin-binding protein 4); InterPro
FT                   IPR000667:IPR012338; KEGG: xce:Xcel_2996
FT                   D-alanyl-D-alaninecarboxypeptidase/D-alanyl-D-al
FT                   anine-endopeptidase; PFAM: peptidase S13 D-Ala-D-Ala
FT                   carboxypeptidase C; SPTR: D0WMC5 D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; TIGRFAM:
FT                   D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; PFAM:
FT                   D-Ala-D-Ala carboxypeptidase 3 (S13) family; TIGRFAM:
FT                   D-alanyl-D-alanine carboxypeptidase, serine-type, PBP4
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92006"
FT                   /db_xref="GOA:D7BM57"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM57"
FT                   /protein_id="ADH92006.1"
FT                   /translation="MKKVKIGISAVLALIGVYILGDAWDVVPGLFTTKPPLSVPEPYPQ
FT                   VSEPHVTNPKIPNFATLPELDSAQVRTIMEEFRTDERLSGVSSYAVIDPLSGKTVASHN
FT                   EAKSLRPASTLKYVTAVAALTTLGPNATLDTSVTRVGRDVYLVGGGDVMLAAGDGQPSA
FT                   VAGRSGLADMARQVAQKLQKAKVSEITVHVDSSRYAQPVYHPSVVAEENTEFVMPLYPV
FT                   AVDRGRVDSEFVEQPDVRALDAFAERLREQGISVTVGGRKVAPKDSQELVRVHSAPVRE
FT                   LVDVMMVESDNTLAEVLGHEVAIALGESADFSGASAAVKGALRSADFDVTGLVIDDNSG
FT                   LSEHNRVPVRLLGDILRRVWACDGCDVNALGAALPVGSLQGTLKDRFWDSPAQGLVRAK
FT                   TGTLSTTTALAGFVSTRSGHPLIFVSIVTDHKENDQLTVRAVIDDALAKLVSQV"
FT   sig_peptide     301605..301673
FT                   /locus_tag="Arch_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            303028..303894
FT                   /locus_tag="Arch_0249"
FT   CDS_pept        303028..303894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG5282 conserved hypothetical protein;
FT                   InterPro IPR018766; KEGG: rsa:RSal33209_3221 putative
FT                   cytoplasmic protein; PFAM: Protein of unknown function
FT                   DUF2342; SPTR: D0WMC6 Putative uncharacterized protein;
FT                   TIGRFAM: conserved hypothetical protein; PFAM:
FT                   Uncharacterised conserved protein (DUF2342); TIGRFAM:
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92007"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM58"
FT                   /protein_id="ADH92007.1"
FT                   /translation="MNTVKLLARLVAGSGPAMSVTAAQAVVNDLRQGAKRAPRIVKKIS
FT                   GLSADGVRVKIVDRAGWAQGAVASIQQMLRGVDAAVDFKDYQLGGAMSVLAAKVLGQWD
FT                   PYVVDPRVYLVAPNVAQFQRQYDLDRRDVALWVAVHELTHAAQFAAAPWLAPYIAERAA
FT                   FVLEIDNAIPPEPVLDELTAVMSLLEGHATFVMDRVPLAIMPSRSRLVRAMAARRAAGG
FT                   FIAKKLSQALGMAKKSQQYVQGSDFVTAVVGKVGIEGLNKAWEGEKNLPTLHELTHPAE
FT                   WIDRVVK"
FT   sig_peptide     303028..303102
FT                   /locus_tag="Arch_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            303891..304976
FT                   /locus_tag="Arch_0250"
FT   CDS_pept        303891..304976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0250"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="COGs: COG0037 ATPase of the PP-loop superfamily
FT                   protein implicated in cell cycle control; InterPro
FT                   IPR011063:IPR014729:IPR012795; KEGG: bcv:Bcav_0700
FT                   tRNA(Ile)-lysidine synthetase; PFAM: PP-loop domain
FT                   protein; SPTR: D0WMC7 tRNA(Ile)-lysidine synthase; TIGRFAM:
FT                   tRNA(Ile)-lysidine synthetase; PFAM: PP-loop family;
FT                   TIGRFAM: tRNA(Ile)-lysidine synthetase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92008"
FT                   /db_xref="GOA:D7BM59"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM59"
FT                   /protein_id="ADH92008.1"
FT                   /translation="MSRPHRFVNATRRALKEALEHCSDRVVLVGVSGGSDSMALAATLA
FT                   FVAPKLGILVHAVCVDHGIRPESVQEAAFVRDILRKRGVPVEVCRVDVDGSSGPEGNAR
FT                   EARYDAIATYARSLGNAAGPAVVFLGHTQNDQAETVLMGFARGSGAKSIAGMPAVGHLP
FT                   LHRDVPMQRPFLEFTRDELRTVCSELDVPWVDDPSNDLDGPWTCSDGSPLRRSAVRHRI
FT                   LPELQDVLGSGTIGAIARTASMLQADNAALEHYARIELERVCTSRNPITLDCESLKDVP
FT                   EAVRRRTLKYAVEESGVRGGELVYWHIAGLDKLVTEHINKRGLDLPGVRAWRERNLLRL
FT                   EPGAQSTSTANTAAQAPMEDT"
FT   gene            304973..307216
FT                   /locus_tag="Arch_0251"
FT   CDS_pept        304973..307216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0251"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="COGs: COG0465 ATP-dependent Zn protease;
FT                   InterProIPR003593:IPR011546:IPR003959:IPR000642:IPR
FT                   005936:IPR003960; KEGG: cms:CMS_0099 cell division protein
FT                   FtsH-like protein; PFAM: peptidase M41; AAA ATPase central
FT                   domain protein; peptidase M41 FtsH extracellular; PRIAM:
FT                   Microtubule-severing ATPase; SMART: AAA ATPase; SPTR:
FT                   D0WMC9 Putative cell division protein; TIGRFAM:
FT                   ATP-dependent metalloprotease FtsH; PFAM: Peptidase family
FT                   M41; ATPase family associated with various cellular
FT                   activities (AAA); TIGRFAM: ATP-dependent metalloprotease
FT                   FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92009"
FT                   /db_xref="GOA:D7BM60"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM60"
FT                   /protein_id="ADH92009.1"
FT                   /translation="MSTPEKESPQSEQRRKLEDFNSAGRRNRRGRKKETDESRKRDPKS
FT                   WRARWEEAKRMAEEADKKANNKNRDKDGKKKSPFKSAVSFIAVALLIGSGLFWFFAPGG
FT                   FTSVKTSEGISILQDADRAKERIEVTDGSQIVRIWLDKEFTPRDLEGKKGSPTKKVQFQ
FT                   FVSAEAKKIQDLVASAKAKNGYNSIVPQQSFLGSIFSLMFPLLLLFALLMWMLPKIQQG
FT                   SMGSFGRVKKDGLDEDRPSVTFTDVAGADEAVEELQEIEEFIDHPDKFRKMGAKIPRGV
FT                   LLYGPPGTGKTLLAKAVAGEAGVPFFHISASEFVEMFVGVGASRVRDLFTKAKKLAPAI
FT                   IFVDEIDAVGRNRGQGMGGGNDEREQTLNQLLVEMDGFDERANVIVIAATNRPDVLDPA
FT                   LLRPGRFDRQIAVDAPDLKGRAAILKVHAEGKPLAEGIELESIARRTPGFAGAELANLL
FT                   NEAALLATRRGHDKIGEDDLDEAIDRVIAGPQRRTHVMNAEEKRMTAYHEGGHAVAAAA
FT                   LHHSDPVTKVTILPRGRALGYTMVMPTEDKYSVSRNELLDQLVYAMGGRVAEEIVFHDP
FT                   STGASNDIQKATDIARKMVMEYGMSSTVGSVRLVPNESDPMTRFGGGGSREYSDELARV
FT                   IDAEVRDLVEAAHQEAWALMMENRHVLDALSAALLEKETILEKELAEIFKDIVKAPKRE
FT                   LWLSSPHRPVSDLPPVPLPEVKKEEARAGEETTVVQPEVDPMDSPQGPEVTDE"
FT   gene            307209..307802
FT                   /locus_tag="Arch_0252"
FT   CDS_pept        307209..307802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0252"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="COGs: COG0302 GTP cyclohydrolase I; InterPro
FT                   IPR020602:IPR001474:IPR018234; KEGG: art:Arth_0152 GTP
FT                   cyclohydrolase; PFAM: GTP cyclohydrolase I/Nitrile
FT                   oxidoreductase; PRIAM: GTP cyclohydrolase I; SPTR: C0W610
FT                   GTP cyclohydrolase I; TIGRFAM: GTP cyclohydrolase I; PFAM:
FT                   GTP cyclohydrolase I; TIGRFAM: GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92010"
FT                   /db_xref="GOA:D7BM61"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM61"
FT                   /protein_id="ADH92010.1"
FT                   /translation="MSDLPKLHIGHYDEEAVVDAIKRLLIAVGEDPNRDGLLDTPDRMG
FT                   RAYKEMFAGLGEDPADVLNTTFDIRHEELVLVRDISMYSMCEHHLLPFHGVAHIGYIPG
FT                   PDGLVTGLSKLARLVEGFARRPQVQERLTSQIVDAIMERLNAQGAIVVVEAEHLCMSMR
FT                   GVKKPGSHTVTSAVRGKLRETATRAEAMSLIMSK"
FT   gene            307813..308625
FT                   /locus_tag="Arch_0253"
FT   CDS_pept        307813..308625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0253"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="COGs: COG0294 Dihydropteroate synthase; InterPro
FT                   IPR000489:IPR006390:IPR011005; KEGG: krh:KRH_19260
FT                   dihydropteroate synthase; PFAM: dihydropteroate synthase
FT                   DHPS; PRIAM: Dihydropteroate synthase; SPTR: D0WMD1
FT                   Dihydropteroate synthase; TIGRFAM: dihydropteroate
FT                   synthase; PFAM: Pterin binding enzyme; TIGRFAM:
FT                   dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92011"
FT                   /db_xref="GOA:D7BM62"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM62"
FT                   /protein_id="ADH92011.1"
FT                   /translation="MHIMGIVNVTPDSFSDGGKWATPETAIQHGTELMDAGATILDIGG
FT                   ESTRPGARALEWDEEWERIANVIEELSRIGQERGVAVSVDTYHAETARRSVEAGASIVN
FT                   DVTGGNGDPAMLATVAKLDCDYILQHSRGTAETMNSLATYTNIVDEVVSELVAARERAL
FT                   AAGIDAERIILDPGLGFAKMGDDDWNVLGGIDRVIELGHRVLVGASRKRFIGHLVGENQ
FT                   AHRDLSTAVISGFLAEHGVWAARVHNVDASSVVLATLEKIQQHSKKTQ"
FT   gene            308635..309510
FT                   /locus_tag="Arch_0254"
FT   CDS_pept        308635..309510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0254"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="COGs: COG0801 7
FT                   8-dihydro-6-hydroxymethylpterin-pyrophosphokinase; InterPro
FT                   IPR006157:IPR000550:IPR006156; KEGG: blo:BL1685 SulD; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK;
FT                   dihydroneopterin aldolase; SPTR: D0WMD2
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   diphosphokinase; TIGRFAM:2-amino-4-hydroxy-6-
FT                   hydroxymethyldihydropteridine pyrophosphokinase;
FT                   dihydroneopterin aldolase; PFAM: Dihydroneopterin aldolase;
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK);
FT                   TIGRFAM: dihydroneopterin aldolase; FolB domain;
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92012"
FT                   /db_xref="GOA:D7BM63"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM63"
FT                   /protein_id="ADH92012.1"
FT                   /translation="MGMTDSIRLVGVRALGTHGVLVEEHSEPQEFVVDVDLLVDTEIAA
FT                   HTDNIADTISYAEVADKIVAVIQGEHCDLIETLAHRIMAAIMEPRIISAEIVVHKPQAP
FT                   IPHQFADVSVSILREGPLFKEELRTYVIAIGSNQDNPEEHVRQAIAELSDFGEWVDDVS
FT                   SLYRSTPLLAPGQDPQPDYINAVVSINSPTPPMAMLNFLTMVEEAHGRVRDERWGARTL
FT                   DLDIVNVSGVESDYPVLTLPHPRAHERRFVLEPWLEIDPQATLNGQPVAELLAGVNDQH
FT                   VVKVGFGDAR"
FT   gene            309500..309982
FT                   /locus_tag="Arch_0255"
FT   CDS_pept        309500..309982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xce:Xcel_2983 hypothetical protein; SPTR:
FT                   D1BZ92 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF3180)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92013"
FT                   /db_xref="GOA:D7BM64"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM64"
FT                   /protein_id="ADH92013.1"
FT                   /translation="MPDNPESKIQPTSWLLLFAIFGVVGVTSFFVTDAWLSYGLAPVLV
FT                   PAMTFLIPLFVAAFILWQGWRVRSYRQGRRMLNMLTAARIWLLSQAVSRTGAITGGVCA
FT                   GIVASYAGYSHSNVMVSQAITIGLAGLASIAMAVAGLVAELWCKNDDEATPPGATA"
FT   gene            310127..310615
FT                   /locus_tag="Arch_0256"
FT   CDS_pept        310127..310615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0256"
FT                   /product="membrane-flanked domain protein"
FT                   /note="COGs: COG3402 conserved hypothetical protein;
FT                   InterPro IPR005182; KEGG: rsa:RSal33209_3209 permease;
FT                   PFAM: membrane-flanked domain; SPTR: A9WUQ5 Permease; PFAM:
FT                   Bacterial membrane flanked domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92014"
FT                   /db_xref="GOA:D7BM65"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM65"
FT                   /protein_id="ADH92014.1"
FT                   /translation="MVSTEFTPVDPAFVKVTFVRHIIIWLLIAVSVVSTYFTLLPDVEG
FT                   WWAIALWIICGLLVIVAVWDVWLALRRAKALGYVELEDELLIRKGIMFQEVTMVPYGRM
FT                   QQVNLGTGPLLTKFGLASVKLVTASASSNASIPGLPLAEAERLREKLTRLGQTKLEGL"
FT   gene            310615..312165
FT                   /locus_tag="Arch_0257"
FT   CDS_pept        310615..312165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0257"
FT                   /product="membrane-flanked domain protein"
FT                   /note="COGs: COG3428 membrane protein; InterPro IPR005182;
FT                   KEGG: bcv:Bcav_0708 membrane-flanked domain protein; PFAM:
FT                   membrane-flanked domain; SPTR: C5BYL1 Membrane-flanked
FT                   domain protein; PFAM: Bacterial membrane flanked domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92015"
FT                   /db_xref="GOA:D7BM66"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="InterPro:IPR014529"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM66"
FT                   /protein_id="ADH92015.1"
FT                   /translation="MAEKTDKQKLGESSVPQGAWRKFHKVTPLADAGTTWLALGAFIAV
FT                   IIAQIVENQVNDLGFYIELITPTRVLIGVGILLGLTAIFVGVSAVMWRHKSYAIVPSGV
FT                   HYRNGIVMKKYQHVRWDRVQSVEVEQRLFARIFGFGAVKVDAAGFAEDPVELGLLPLDQ
FT                   CRVLREEILASLAKARGGVLTEVSIADDDATAPHQPLDPQSSAPATQPAISDQMVYHLP
FT                   TKRLIPSTILTGSALFSIAGVILAAVWKFVFESGFSVAFLFFIAGTVVNSIKYISGSFN
FT                   TKVFLAENGLKIRHGLTKLVTRSLPPTRIHAVSIKQPLLWRRFDWWQVTVTIAGSSLED
FT                   MTDNASNVIVPCGSRAEVIRVVSTIFPTLGTDDDARLMDELMYRKGKAHFLETPPKRVR
FT                   WIDPIAGTVGAFYANVRVFAIRRGRLWRSVQLIFQDHTQSVAIQQGPLQRWLRLASVHV
FT                   HMLVGPVHGIVKNFDIDQMHELVLRQNALTKQAREIEVSETIDEWKARLNLVGDVRGE"
FT   gene            312149..313036
FT                   /locus_tag="Arch_0258"
FT   CDS_pept        312149..313036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0258"
FT                   /product="Putative oxidoreductase/dehydrogenase,
FT                   Rossmann-like domain protein"
FT                   /note="COGs: COG5495 conserved hypothetical protein;
FT                   InterPro IPR019665:IPR018931:IPR016040; KEGG: bcv:Bcav_0716
FT                   pantoate/beta-alanine ligase; PFAM: Putative
FT                   oxidoreductase/dehydrogenase, Rossmann-like domain; Domain
FT                   of unknown function DUF2520; SPTR: C5BYL9
FT                   Pantoate/beta-alanine ligase; PFAM: Domain of unknown
FT                   function (DUF2520); Rossmann-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92016"
FT                   /db_xref="GOA:D7BM67"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM67"
FT                   /protein_id="ADH92016.1"
FT                   /translation="MFVENKTGRMGIGVVSAGKVGAALGSALRAAGHQIVGAYATSEAS
FT                   VDRVETMLPGVPVLDVRTIVERSEVVLLAVPDDELAGIVDGLAAVGAWHPGQLVVHVAG
FT                   RFGTDVLAPAVAQGVLGIAIHPAMTFTGTTLDVARLQGCPFAVTAPAMLQPIGLALVAD
FT                   MGGEGFVIAEGDRGVYHAALAHGANHVVTVIAQSIRLLKSIGLENEYLRPLITAAIEGA
FT                   LSSGEALQTGPVVRGDAGTVAEHVETLDTIAEEEPDLADIPSTYRALADATAQRALARR
FT                   VITEESFKAIRSKL"
FT   gene            313077..313904
FT                   /locus_tag="Arch_0259"
FT   CDS_pept        313077..313904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0259"
FT                   /product="pantoate/beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="COGs: COG0414 Panthothenate synthetase; InterPro
FT                   IPR003721:IPR014729:IPR004821; KEGG: ace:Acel_0211
FT                   pantothenate synthetase; PFAM: Pantoate-beta-alanine
FT                   ligase; SPTR: D0WLV2 Pantoate--beta-alanine ligase;
FT                   TIGRFAM: pantoate/beta-alanine ligase;
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   Pantoate-beta-alanine ligase; TIGRFAM:
FT                   pantoate--beta-alanine ligase; cytidyltransferase-related
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92017"
FT                   /db_xref="GOA:D7BM68"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM68"
FT                   /protein_id="ADH92017.1"
FT                   /translation="MIIATTPAQLAAALEPLHGDIGLVMTMGALHDGHLSLVEAARRES
FT                   DHVVVSIYVNPLQFGPGEDFEAYPRDLEGDVAKLEGVDVVFAPTDESIYPRTLLVRIDP
FT                   GPVATILEGKTRPTHFAGVLQIVHKVFNLVRPHAAWFGQKDAQQLALIKTMVADLNMPL
FT                   EIKSVPIKREATGLAMSSRNTYLSATEKQQALGLSQALAAGKRVADADGTAAQTLAAAR
FT                   ESIAHAPGVKLDYLELVDRDTFMQLDGRGNGLLVTAAWVGKTRLIDNLEVVIG"
FT   gene            313897..314352
FT                   /locus_tag="Arch_0260"
FT   CDS_pept        313897..314352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0260"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="COGs: COG0853 Aspartate 1-decarboxylase; InterPro
FT                   IPR003190:IPR009010; KEGG: jde:Jden_2095 aspartate
FT                   1-decarboxylase; PFAM: aspartate decarboxylase; PRIAM:
FT                   Aspartate 1-decarboxylase; SPTR: D0WLV3 Aspartate
FT                   1-decarboxylase; TIGRFAM: aspartate 1-decarboxylase; PFAM:
FT                   Aspartate decarboxylase; TIGRFAM:
FT                   L-aspartate-alpha-decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92018"
FT                   /db_xref="GOA:D7BM69"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM69"
FT                   /protein_id="ADH92018.1"
FT                   /translation="MANTRLRRMVTGKIHRATVTGADLHYVGSVTIDADLLDAADILPG
FT                   ESVDIVDVNNGNRLTTYTIPGERGKGDIILNGAAAHKVSPGDLVIIMCYSLLDDESART
FT                   IDPRVVLVDEHNRITNLSNEPGQVPEGTVGLSSSGVPFAQVRAGRNE"
FT   gene            314416..316005
FT                   /locus_tag="Arch_0261"
FT   CDS_pept        314416..316005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0261"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="COGs: COG1190 Lysyl-tRNA synthetase (class II);
FT                   InterProIPR004365:IPR004364:IPR012340:IPR006195:IPR
FT                   002313:IPR016027:IPR018149; KEGG: jde:Jden_2092 lysyl-tRNA
FT                   synthetase; PFAM: tRNA synthetase class II (D K and N);
FT                   nucleic acid binding OB-fold tRNA/helicase-type; PRIAM:
FT                   Lysine--tRNA ligase; SPTR: D0WLW0 Lysine--tRNA ligase;
FT                   TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA synthetases
FT                   class II (D, K and N); OB-fold nucleic acid binding domain;
FT                   TIGRFAM: lysyl-tRNA synthetase, eukaryotic and
FT                   non-spirochete bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92019"
FT                   /db_xref="GOA:D7BM70"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM70"
FT                   /protein_id="ADH92019.1"
FT                   /translation="MNTNENIAEEIVDDTPEQIQVRKEKRARLLAEGRQAYAAELPLDS
FT                   TIVDVREGYVVADVDADGNVVEPPAGTARVLVPGEETEDMVGIAGRVMFMRPSGKIAFV
FT                   VLQDGAGTRIQVIFSLANVGKEALDALKADVDLGDFIFVNGHVGTSKRGELSVFAHVWE
FT                   MASKAIRPLPKTFTTADGQEMALSEESRVRARHLDLITRQGARDMIRIRAKVMRSLRDT
FT                   FDAERFIELETPILQVLHGGAAARPFTTHINAYDQDLYLRIATELYLKRAVVGGVERVY
FT                   EIGKNFRNEGADSSHSPEFTALEAYEAYGTYDSMARLTRDLVQNAARDVFGSTTVTLAD
FT                   GTEYDLGGEWDTITLYESLSEAVGEEVTVETPREHLVKIAEKYGVKVKDYAVAGKIAED
FT                   IWEELVGDKLWAPTFVRDFPEDTSPLTRNHRTKPGLTEKWDLYIRGVETATAYSELADP
FT                   VIQRERLTAQSLDAANGDPEAMQLDEDFIEAMEQGFPPAGGMGMGIDRLLMALTGLGIR
FT                   ETITFPFVKPRG"
FT   gene            complement(316580..318103)
FT                   /locus_tag="Arch_0262"
FT   CDS_pept        complement(316580..318103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0262"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="COGs: COG0554 Glycerol kinase; InterPro
FT                   IPR018484:IPR018485:IPR005999:IPR018483; KEGG: pac:PPA2304
FT                   glycerol kinase 2; PFAM: Carbohydrate kinase, FGGY-like;
FT                   SPTR: C0VYK7 Glycerol kinase 2; TIGRFAM: glycerol kinase;
FT                   PFAM: FGGY family of carbohydrate kinases, N-terminal
FT                   domain; FGGY family of carbohydrate kinases, C-terminal
FT                   domain; TIGRFAM: glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92020"
FT                   /db_xref="GOA:D7BM71"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM71"
FT                   /protein_id="ADH92020.1"
FT                   /translation="MTEKKYVIAIDQGTTSSRAIIFNHSGEIVSIGQKEHEQIFPKAGW
FT                   VEHNPIEIRNNIRQVIGEALAKADINRHEIASVGITNQRETAVVWDKTTGEPIYNAIVW
FT                   QDTRTDKIVRELAGEEGLDKYKETCGLPLATYFSGPKVKWILDNVEGAREKAEAGDLLF
FT                   GNTDCWVLWNLTGGPNGGVHVTDVTNASRTMLMDVRKLQWDEGICADMGIPMSMLPEIR
FT                   SSSEVYGKAAKNSLLIDTPIAGILGDQQAATFGQACFEKGMAKNTYGTGCFMLINTGNE
FT                   AVTSENGLLTTVCYKIGEQEAVYALEGSIAVTGSLVQWLRDNLGIISTAPEIEALAETV
FT                   EDNGGVYFVPAFSGLFAPYWKDDARGAIVGLTRYNNKGHLARAVLEATAFQTAEVLEAM
FT                   NADADAALAQLRVDGGMTANDTLMQFQADLLGVEVVVPEVAETTALGAAYAAGIAVGFW
FT                   SGEDDVVANWKEAKRFTPKMDKEERDRQMRLWKKAVTRTFDWVDEDTTH"
FT   gene            complement(318173..318919)
FT                   /locus_tag="Arch_0263"
FT   CDS_pept        complement(318173..318919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0263"
FT                   /product="major intrinsic protein"
FT                   /note="COGs: COG0580 Glycerol uptake facilitator and
FT                   related permease (Major Intrinsic Protein Family); InterPro
FT                   IPR000425; KEGG: jde:Jden_0486 major intrinsic protein;
FT                   PFAM: major intrinsic protein; SPTR: C2KN37 MIP family
FT                   major intrinsic protein channel protein; PFAM: Major
FT                   intrinsic protein; TIGRFAM: MIP family channel proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92021"
FT                   /db_xref="GOA:D7BM72"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM72"
FT                   /protein_id="ADH92021.1"
FT                   /translation="MSLLEVFISETIGTALLITLGVGVVATTLLTKSKGKGTGWLLINF
FT                   GWGFAVMIGVYGAWKTGGHLNPAVTLGIAATGAEEFVPGVAITAASILTYIAGQMVGAM
FT                   IGATLAWLAFKDHYNAHENQAEILGTFATGPEIRNYTSNVITEAIGTFVLLTWVILSGA
FT                   TPTELGPLAVALVIVSIGASLGGPTGYAINPARDLGPRIMHAILPIKGKGGSDWAYSWV
FT                   PIVGPIIGGVLAGLIFGANTLNLAGL"
FT   gene            complement(319140..319802)
FT                   /locus_tag="Arch_0264"
FT   CDS_pept        complement(319140..319802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0264"
FT                   /product="ATP-binding protein"
FT                   /note="COGs: COG0572 Uridine kinase; KEGG: bcv:Bcav_3297
FT                   ATP-binding protein; SPTR: C5C1D0 ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92022"
FT                   /db_xref="GOA:D7BM73"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM73"
FT                   /protein_id="ADH92022.1"
FT                   /translation="MSTPLSNDGLFDLPDSAQRVPHAKVILVTGPSGSGKTRFASRTGL
FT                   PVVSLDDFYYDGDRPGLPRRHGMVDWDSPSTWDREGSVNALVELCTKDETTVPIYDMPS
FT                   SKRVSDRILRMDGRRIVLAEGIFAAEIVDDLKKEGILADALCIARPRVQTFWFRLMRDL
FT                   DEARKPLPNLLRRGIAHFFHEPQMYRDLEAKGARKVSYTEAQEVLTQMLAAQRWSIQ"
FT   gene            complement(319881..321140)
FT                   /locus_tag="Arch_0265"
FT   CDS_pept        complement(319881..321140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0265"
FT                   /product="glycerol-3-phosphate dehydrogenase, anaerobic, C
FT                   subunit"
FT                   /note="COGs: COG0247 Fe-S oxidoreductase;
FT                   InterProIPR001450:IPR004017:IPR012285:IPR017896:IPR
FT                   017753:IPR009051:IPR017900; KEGG: pac:PPA2248
FT                   sn-glycerol-3-phosphate dehydrogenase subunit C; PFAM:
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein;
FT                   protein of unknown function DUF224 cysteine-rich region
FT                   domain protein; SPTR: C2BV29 sn-glycerol-3-phosphate
FT                   dehydrogenase subunit C; TIGRFAM: glycerol-3-phosphate
FT                   dehydrogenase, anaerobic, C subunit; PFAM: Cysteine-rich
FT                   domain; TIGRFAM: glycerol-3-phosphate dehydrogenase,
FT                   anaerobic, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92023"
FT                   /db_xref="GOA:D7BM74"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017753"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM74"
FT                   /protein_id="ADH92023.1"
FT                   /translation="MSLEYAKASLARMSLDSCVKCTICESQCPVIRSTDLFTGPKFVGP
FT                   QAERFRAGASVDVSLDYCSGCGICTTSCPQGVKIAEINAQARAVMKADHMPLRDRIIPE
FT                   TILEGMLLTPVAPIANAVLKNKPIRTVIEKVVGVHRDAPMPKARMQTFHGWYKKHKRQR
FT                   DAKLGADYVAPRGPVVFFHGCAGGYFEVETSKATVEVLEYLGFEVLVPKQGCCGLAHQS
FT                   NGLFDRAESQVKKLARQLAEAGDDLTIIGSSGSCAGMLRHEAHEIMGVDDPVVMDVGKR
FT                   MVELSEFMLELIDNNNFPVEDLKRWDVTIPYHQPCQVKSQGIGMPAIRMMETIPGVTVV
FT                   ESGQPCCGIAGTYGLKKEKYEIAQRVGKPLFDMVKDTNPNLAACETDTCRWQIAKGTGA
FT                   KVVHPIQIIHQALGLGSVLK"
FT   gene            complement(321137..322336)
FT                   /locus_tag="Arch_0266"
FT   CDS_pept        complement(321137..322336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0266"
FT                   /product="glycerol-3-phosphate dehydrogenase, anaerobic, B
FT                   subunit"
FT                   /note="COGs: COG3075 Anaerobic glycerol-3-phosphate
FT                   dehydrogenase; InterPro IPR003953:IPR009158; KEGG:
FT                   pac:PPA2249 anaerobic glycerol-3-phosphate dehydrogenase
FT                   subunit B; PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; PRIAM: Glycerol-3-phosphate
FT                   dehydrogenase; SPTR: D0YR90 Glycerol-3-phosphate
FT                   dehydrogenase, anaerobic, B subunit; TIGRFAM:
FT                   glycerol-3-phosphate dehydrogenase, anaerobic, B subunit;
FT                   PFAM: FAD binding domain; TIGRFAM: glycerol-3-phosphate
FT                   dehydrogenase, anaerobic, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92024"
FT                   /db_xref="GOA:D7BM75"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR009158"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM75"
FT                   /protein_id="ADH92024.1"
FT                   /translation="MKIVVVGAGLAGLSAAMMLTEAGHRVEIVSKGIGGLLLSTGGLDV
FT                   AGWNADGTPVSQPFEAVESYAGSEHPYAKIGAESVRKGIGWLSSRTPAFHFPAGDETNA
FT                   LIPTPVGAVRPMLGLHSTMVGLENGQKIAVVGIKQFKDFPAQFIADNLSRSPYVDVQAR
FT                   AVEISMNIRSHEADSAGTNIARFLDTSEGQTAFVDALRGKVEPDEIVLLPAVLGLDPRT
FT                   FGVLSDALGVRLSEVPVAPPSIPGRRINDALVAAAKASRVDLSNNAQVIGCEHENGRIT
FT                   AVHIQRAGRVTVSKVDAVIHAGGGFESGSLTRSPEGDIRERAFDLPVRETADIFASGVR
FT                   VDASMHPVDESGAVVFQNMYLAGSIIGGSHAPVEKSGEGIALGSAWAAAHAAMSEGENR
FT                   "
FT   sig_peptide     complement(322271..322336)
FT                   /locus_tag="Arch_0266"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(322333..324030)
FT                   /locus_tag="Arch_0267"
FT   CDS_pept        complement(322333..324030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0267"
FT                   /product="glycerol-3-phosphate dehydrogenase, anaerobic, A
FT                   subunit"
FT                   /note="COGs: COG0578 Glycerol-3-phosphate dehydrogenase;
FT                   InterPro IPR006076:IPR007419:IPR017752:IPR000447; KEGG:
FT                   pac:PPA2250 anaerobic glycerol-3-phosphate dehydrogenase
FT                   subunit A; PFAM: FAD dependent oxidoreductase; BFD domain
FT                   protein [2Fe-2S]-binding domain protein; SPTR: D0YR89
FT                   Glycerol-3-phosphate dehydrogenase, anaerobic, A subunit;
FT                   TIGRFAM: glycerol-3-phosphate dehydrogenase, anaerobic, A
FT                   subunit; PFAM: BFD-like [2Fe-2S] binding domain; FAD
FT                   dependent oxidoreductase; TIGRFAM: glycerol-3-phosphate
FT                   dehydrogenase, anaerobic, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92025"
FT                   /db_xref="GOA:D7BM76"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017752"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM76"
FT                   /protein_id="ADH92025.1"
FT                   /translation="MKTLSTDVVVIGGGATGAGILRDLAMRGFHAIMLERADVAQGTSG
FT                   RFHGLLHSGGRYVVSDPRSATECAEENVIMRKIHADAVEETGGLFVVTPEDPLDFSDKF
FT                   IQGARDTGVPCEEISIAEALRMEPRLNPGIKRAFAVEDGAVDGWRMCWGLIESARSLGS
FT                   LALTYHKATKINNESGAVSSVIAHNERTGEDVQIDCRAVINAAGPWAGQVAAMAGAHGV
FT                   DVVPGRGIMIAMNHRLSHRVINRCIHPADGDIIVPAHTVSIIGTTDKAVADPDFLEIEH
FT                   DEVIQMLEAGEVLIPGFKNSRAVHVWAGARPLVKDSRVSASDTRHMSRGMAIIDHGERD
FT                   GISGMFTIAGGKLTTYRLMAKNVVDALMEHWGENRPCVTETEAVPSAAGKRTHRNSDRL
FT                   AKVEATRDHDPVLCECELVTRSMIEDQLEQQPEANLDDVRRQTRLGMGPCQGTFCAMRA
FT                   AGVMHDVYRKKSDDPVASADRTSTMLRLFTTNRFDGVYPLLYGEQMREAALNQWILQGT
FT                   LDIDHLPEPSAESKKSTGDLALVHGRPVPPKTEVVGARPWGQKEGDLR"
FT   gene            324215..325165
FT                   /locus_tag="Arch_0268"
FT   CDS_pept        324215..325165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0268"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="COGs: COG2390 Transcriptional regulator contains
FT                   sigma factor-related N-terminal domain; InterPro
FT                   IPR007324:IPR009057; KEGG: bcv:Bcav_3288 transcriptional
FT                   regulator, DeoR family; PFAM: putative sugar-binding domain
FT                   protein; SPTR: D0YR88 Sugar-binding family transcriptional
FT                   regulator; PFAM: Sigma-70, region 4; Putative sugar-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92026"
FT                   /db_xref="GOA:D7BM77"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM77"
FT                   /protein_id="ADH92026.1"
FT                   /translation="MSERVSTAYEAAMMHYVQGETMETIARRLNVSRSTVSRLIKSARD
FT                   EGLVQITLHPPQEVASTIATWISEAYGVRTHVVPVPFQSNEARRLNAVAQMAGVLISNA
FT                   MEPNTVIGVAWGNTVSAIADHLVPRQAAGSVVVQLNGAANPSTTGIPYAGAIMEAFGRA
FT                   HGSMVQHFSVPAFFDFTSTKEALWRERSIASVRKLQASADVAVFGVGSVSGQNISLVYS
FT                   GGYLSPEDLMTIKDDGVVGDVCTVLLRADGTWRDLPINERASGPTPDELMQIGRRLCVV
FT                   SGVDKVVATRAALRAGVVTDLIIDEDAAARLREIS"
FT   gene            complement(325168..326058)
FT                   /locus_tag="Arch_0269"
FT   CDS_pept        complement(325168..326058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0269"
FT                   /product="HhH-GPD family protein"
FT                   /note="COGs: COG1194 A/G-specific DNA glycosylase;
FT                   InterProIPR003265:IPR003583:IPR003651:IPR011257:IPR 004036;
FT                   KEGG: bcv:Bcav_3282 HhH-GPD family protein; PFAM: HhH-GPD
FT                   family protein; iron-sulfur cluster loop; SMART: HhH-GPD
FT                   family protein; Helix-hairpin-helix DNA-binding class 1;
FT                   SPTR: D0WM02 A/G-specific adenine glycosylase; PFAM:
FT                   HhH-GPD superfamily base excision DNA repair protein;
FT                   Helix-hairpin-helix motif; TIGRFAM: A/G-specific adenine
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92027"
FT                   /db_xref="GOA:D7BM78"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM78"
FT                   /protein_id="ADH92027.1"
FT                   /translation="MTNLNPNLLYTELTEWFACNARPLPWRETRDPWAILLCEVMSQQT
FT                   PVARVEPTWYAWLERWPTPADLAAASPADVLLAWDRMGYPRRALRLRECAQAITERFDG
FT                   QVPRTRDDLLSLPGIGPYTADAVLAFAYEDYSVVLDTNIRRVLARWHGEALPAPAQTKA
FT                   ELARATSLVPTNPQKAWRWNASIMEFGALICTARNAKCVECPVVDTCGWKNAGYPSDSY
FT                   ASTRTPQKWAGTNRQARGAIMAVFRTNPHESYAESVLEELSKLPSERFVPALESLKTDK
FT                   LVTQADDGRLHLPAA"
FT   gene            complement(326055..326597)
FT                   /locus_tag="Arch_0270"
FT   CDS_pept        complement(326055..326597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0270"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647:IPR012287:IPR009057; KEGG:
FT                   cur:cur_0019 TetR family transcriptional regulator; PFAM:
FT                   regulatory protein TetR; SPTR: C5VFG3 Transcriptional
FT                   regulator, TetR family; PFAM: Bacterial regulatory
FT                   proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92028"
FT                   /db_xref="GOA:D7BM79"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041479"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM79"
FT                   /protein_id="ADH92028.1"
FT                   /translation="MRTSKKAEVLDSIVAIIEESGVAGVTYDAVSARSGMSKSGLIYHF
FT                   PTREAMLRDVHDFMAQRWEEGLLEALGDDDAGSADAKLRANLRVSQNAATRAELMMTID
FT                   ASSDPEMYALWAEKLDRWTCSARDIATDKRACQAYLVQLIADGLWAHDYINGRHLSSEQ
FT                   RAVLVEAAIALIPTDAS"
FT   gene            complement(326584..328104)
FT                   /locus_tag="Arch_0271"
FT   CDS_pept        complement(326584..328104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0271"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COGs: COG2814 Arabinose efflux permease; InterPro
FT                   IPR011701:IPR016196; KEGG: cgt:cgR_2515 hypothetical
FT                   protein; PFAM: major facilitator superfamily MFS_1; SPTR:
FT                   A4QH10 Putative uncharacterized protein; PFAM: Major
FT                   Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92029"
FT                   /db_xref="GOA:D7BM80"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM80"
FT                   /protein_id="ADH92029.1"
FT                   /translation="MPDVSSSPVSGVVPAPHPAPSSAMSARRKWLFLGVLSSGLFLVGV
FT                   DNSVLYTALPELRRVLHTTELQGLWIINAYPLVLAGLLLGTGTLGDKIGHRRMWMIGLV
FT                   VFMFASLGAAFAPGPWWLIAARAFLGFGAATLMPATLALIRTTFRDPRQLATAIGIWAA
FT                   TSTLGAAAGPVIGGFLLEHFWWGSIFLINIPIAVGAFVATLMIAPPNEANPAKHWDVVS
FT                   SVYAMLAMLGMVMFIKEISSYQNLWVVCGSLAAAVCGGVAFKLRQDKLREPLLEFDIFR
FT                   SWMFTAGVIAAGMTLFIIGGAELMTTQRFQLSVGFTPLQAGMLVAVAAISSFFMSAIGG
FT                   AIVHIVGFRTLISGGLITSTVGLSAMYVGVANHALWVTITGLAFTGAGVGLVMSVSSTA
FT                   IIGSAPRSRAGMAAAVEEVSYELGTVISVAIVGSLLPFFYRLNVPSEIGGSIHDALAHP
FT                   TLSNVAKAGYDAAYLDMILLMIAVTIFATAVTAYALRGNPKETAYAHE"
FT   gene            complement(328135..329454)
FT                   /locus_tag="Arch_0272"
FT   CDS_pept        complement(328135..329454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0272"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701:IPR016196:IPR005829; KEGG:
FT                   smt:Smal_1070 major facilitator superfamily MFS_1; PFAM:
FT                   major facilitator superfamily MFS_1; SPTR: D0XPS3 Major
FT                   facilitator superfamily MFS_1; PFAM: Sugar (and other)
FT                   transporter; Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92030"
FT                   /db_xref="GOA:D7BM81"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM81"
FT                   /protein_id="ADH92030.1"
FT                   /translation="MQIRQVDCLIVKQSEKPTARQRRVSMLIAASGTIIEWFDFSLFFY
FT                   LASSLSHTFYPNSRMSMLIVLATGAVGFVFRPLGAIVFGHIGDTRGRTTALITSALLMA
FT                   ISMAGIALMPGYVTIGVWGGIAVLALRALAGFSVGAEYTGIMVYLMETAKPERRGFAAS
FT                   WAAANSEVGALLAVGSAAIVTNMVGAEALHDWGWRIPFAIGAVLAAGMIPLRRFMVESP
FT                   VAFESKDDRAPLTYTLQEQKLPIAVSFLISTVGSATYFLTITYIPTYIESVHGADSSSA
FT                   LNLGVIAAIAAIVVTPFIGILSDRIGRRWAFGTTLITVVVLAVPGYTLLGSKETATLAF
FT                   AAVLLAIPAAAWSAIAAAAIPEQFAARGRFSGMALGYNVATVLFGGLTPFVVSWLSDYF
FT                   ADPLAPAYYASIVTIIAGTPTVILLVDRVRDRQRSRSRAS"
FT   gene            329631..330779
FT                   /locus_tag="Arch_0273"
FT   CDS_pept        329631..330779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG4637 ATPase; KEGG: aav:Aave_2264
FT                   hypothetical protein; SPTR: B5W7M4 SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92031"
FT                   /db_xref="GOA:D7BM82"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM82"
FT                   /protein_id="ADH92031.1"
FT                   /translation="MRISQVRVKNWRNFRDIEFSLDRRLFIVGANATGKSNLLDVFRFL
FT                   KDIATPGGGLTNAVERRGGLKTIRNLNTRNYNKGQIEIAVKLQDGEDVWSYTLAIIKEQ
FT                   AGLMRPIVVHEIVKHNDITLLERPNTADDRDPELLTQTHLEQIASNSEFRNVAQLFANA
FT                   NYFNPSPQNIRYSERGMRRVSANGDGLIAEMNDTRQRDRDSRLNKIQQALAIAVPEFQS
FT                   LDLEVDASGQPHLVAGFKHWRAQPAKQRESEFSDGTVRLIALLWAVLSQPKSDGTLLLE
FT                   EPEISLNREIVKRLPSMLASAQRGKNMQVVMTTHSPDLLDDEGLDPSEVLVLTVGDQYT
FT                   EARKLSECDREMKLLQAGFSTSDVVSTLINPSIGSEINGFVV"
FT   gene            330783..331367
FT                   /locus_tag="Arch_0274"
FT   CDS_pept        330783..331367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_4079 hypothetical protein; SPTR:
FT                   B5W7M3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92032"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM83"
FT                   /protein_id="ADH92032.1"
FT                   /translation="MKVNFACEGESDRPFLVSVIRATGNEVGEKIVKRGCVNLDNAIPQ
FT                   YAQAASYFPGELWLVVRDADGQCPVELRGRLNPAGVPDTFLLRIAVNMIESWMLADEDA
FT                   AENFFGVSKGMIQSARNAKDPKRALLNACQHGKYKKRFKDRLFNSSGNAGPEFIPIYEE
FT                   FAANHWDANRARKCDESLDRAMRALEAHVSF"
FT   gene            331564..332508
FT                   /locus_tag="Arch_0275"
FT   CDS_pept        331564..332508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_0468 hypothetical protein; SPTR:
FT                   D0WMD9 Putative uncharacterized protein (Fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92033"
FT                   /db_xref="GOA:D7BM84"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM84"
FT                   /protein_id="ADH92033.1"
FT                   /translation="MRSSGRSAGRPAASNDARRQGQRPGAAFHAARPANERSKKPRPQP
FT                   QPAAMRGRNQRSHPRMPRSTTTQSGAMRDRNRVLRARRAQAAAAAQRRRMLKLGGSIAG
FT                   FIILLVAVVGLVIFSLKKIEEHATPPDPAAAFDPIPCEMDMVAADISHTGSIAGQPVAV
FT                   NVTVKNARSSVPCVMKTSLQDFKVTITTGDLKVFDSETCEAGIAAPRLLLDKDVASEQT
FT                   FTWNGQYSGKICSTTGPASPGTYVARAFYQGKELTSKGYVFELGGASAPAKSEPTPEES
FT                   APAKEGEAPVSDAQTPPAEGQTSPAEGQAEGED"
FT   gene            complement(332564..333940)
FT                   /locus_tag="Arch_0276"
FT   CDS_pept        complement(332564..333940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0276"
FT                   /product="DNA repair protein RadA"
FT                   /note="COGs: COG1066 ATP-dependent serine protease;
FT                   InterPro IPR003593:IPR004504:IPR020568; KEGG: bcv:Bcav_3279
FT                   DNA repair protein RadA; SMART: AAA ATPase; SPTR: C0W0Q9
FT                   DNA repair protein radA; TIGRFAM: DNA repair protein RadA;
FT                   PFAM: KaiC; Lon protease (S16) C-terminal proteolytic
FT                   domain; TIGRFAM: DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92034"
FT                   /db_xref="GOA:D7BM85"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM85"
FT                   /protein_id="ADH92034.1"
FT                   /translation="MAKSKALFVCSECGWTTSKWVGRCGECQQWGTVMESGGTSGAHAV
FT                   TPLIPHTPAQPITDVGTQASVKAPTGVGELDRVLGGGIVPGVVILLAGEPGVGKSTLLL
FT                   DVAAKAAQEAQREKKKPVLYVTGEESASQVRSRAERIGALHPHLLLAAEADLSRVLGHV
FT                   ESSKPSLLIVDSVQTIADPTVEGAAGGVAQVRAVTAALVNLAKSSDLPVIVVGHVTKDG
FT                   SIAGPRVLEHLVDVVCQFEGDRHSRLRMVRAVKNRYGATDEVGCFELIDSGIRGLADPS
FT                   GLFLSARNLTVPGTCVTITLEGRRPMPVEVQALRVPAGGPPRRTTSGVDSSRVSMMIAV
FT                   LQSRLGIAYDRSDIFVSTVGGAKANEPSVDIATALALASAAADLPLAPGVIACGEVSLT
FT                   GELRPVVGLQQRLNEAARLGFKIAIVPQNADGIKAPDNLTIRKVSDVKEAVNAVLPPAS
FT                   "
FT   gene            complement(333978..334646)
FT                   /locus_tag="Arch_0277"
FT   CDS_pept        complement(333978..334646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0277"
FT                   /product="TrkA-N domain protein"
FT                   /note="COGs: COG0569 K+ transport systems NAD-binding
FT                   component; InterPro IPR003148:IPR006037:IPR016040; KEGG:
FT                   bcv:Bcav_3270 TrkA-N domain protein; PFAM: TrkA-N domain
FT                   protein; TrkA-C domain protein; SPTR: D0WME1 Trk-type K+
FT                   transport system, NAD-binding component; PFAM: TrkA-N
FT                   domain; TrkA-C domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92035"
FT                   /db_xref="GOA:D7BM86"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM86"
FT                   /protein_id="ADH92035.1"
FT                   /translation="MARVANESPDAVLVIGLGRFGSAIAVTLDKLGRDVLAVESDPDLA
FT                   QQWSHRFRVVEADARSSEALHQLGAQDFQIAVVGVGTSLEASVLITANLVDMGMREIWA
FT                   KATSREHGTILRRIGANHVVYPEYDAGQRVAHMVSGKMLDYIEMEDQFTIVKMLPPKDM
FT                   IGFTLDQSRVRERFGVTVIGVKSHGQPFEYARPETLVSSGDTLIVSGEPALLESFANRL
FT                   "
FT   gene            complement(334724..336169)
FT                   /locus_tag="Arch_0278"
FT   CDS_pept        complement(334724..336169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0278"
FT                   /product="H(+)-transporting two-sector ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /note="COGs: COG0168 Trk-type K+ transport systems membrane
FT                   components; InterPro IPR003445; KEGG: bcv:Bcav_3269
FT                   H(+)-transporting two-sector ATPase; PFAM: cation
FT                   transporter; PRIAM: H(+)-transporting two-sector ATPase;
FT                   SPTR: C5C1A2 H(+)-transporting two-sector ATPase; PFAM:
FT                   Cation transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92036"
FT                   /db_xref="GOA:D7BM87"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM87"
FT                   /protein_id="ADH92036.1"
FT                   /translation="MAHGVPPRSSSAGRGRFDVRMSLGPDSDSGVHGHSLRNYINSLAR
FT                   RSPARLAMLVFGALIFAVTLLLMVPFSSTTPGSSSFTDALFTATSAVCVTGLTVVDTAT
FT                   HWTAFGHIVLALGIQIGGLGVMVIASILALAVSRHLGLTQRMLAATETKSRLGDVGALL
FT                   KAVIATSLVAESVLTLVFLGSFVGIDPSFVSALGHSLFMAVSTFNNAGFVILEDGLGQF
FT                   VGDWAVSLPIIIGTIIGAVGFPVTLNVAQNLRHPRNWTLHSKLTLVTYGILLGISIVMI
FT                   ALLEWNNPATLGGLNGAERTLATLFHATTPRSSGLSTLDVGDMNQSTWFFIDMMMFIGG
FT                   GSASTGGGIKVTTFAVLALAILAEARGDRDTEAFGKRIPADVVRLAISATFLGAFMVGA
FT                   ATLIIMQLTDFSLSHVLFEVISAFATCGLSTGITSALPESAKIVLIVLMYLGRVGTMTL
FT                   AAALALRNRRRVIRLPQERPVIG"
FT   gene            336451..336666
FT                   /locus_tag="Arch_0279"
FT   CDS_pept        336451..336666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0279"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="InterPro IPR010093:IPR009061:IPR000843; KEGG:
FT                   bcv:Bcav_3263 excision promoter, Xis; SPTR: D0WME4 Putative
FT                   excisionase; TIGRFAM: DNA binding domain protein,
FT                   excisionase family; TIGRFAM: DNA binding domain,
FT                   excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92037"
FT                   /db_xref="GOA:D7BM88"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM88"
FT                   /protein_id="ADH92037.1"
FT                   /translation="MAHLPSSTPQFFTVAEVADMTRVSRMTVYRMVHSGELPAVRVGNS
FT                   YRVPKSAVDQLLTGGAAGDFREATGF"
FT   gene            337136..337612
FT                   /locus_tag="Arch_0280"
FT   CDS_pept        337136..337612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0280"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="InterPro IPR000835:IPR011991; KEGG: bcv:Bcav_3256
FT                   transcriptional regulator, MarR family; PFAM: regulatory
FT                   protein MarR; SMART: regulatory protein MarR; SPTR: D1BBA8
FT                   Transcriptional regulator, MarR family; PFAM: MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92038"
FT                   /db_xref="GOA:D7BM89"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM89"
FT                   /protein_id="ADH92038.1"
FT                   /translation="MTTTRWLDGEEQQAWRNFLRGQATIHDAINHDGVEEFGLALHEYE
FT                   VLVRLAEAPEHQSRMSALATGLVHSRSRLTHTVARLERAGYVQRFQCPHDRRGIFCRLT
FT                   DEGLVKLEESAPQHVTSLRAHFLDKITREELLTIGEIFSKLIDDEETETRVCSE"
FT   gene            337662..338324
FT                   /locus_tag="Arch_0281"
FT   CDS_pept        337662..338324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0281"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="COGs: COG0406 Fructose-2 6-bisphosphatase; InterPro
FT                   IPR013078; KEGG: tcu:Tcur_4432 phosphoglycerate mutase;
FT                   PFAM: Phosphoglycerate mutase; SPTR: D0WME6
FT                   Phosphoglycerate mutase family protein; PFAM:
FT                   Phosphoglycerate mutase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92039"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM90"
FT                   /protein_id="ADH92039.1"
FT                   /translation="MDITTIHLVRHGEVDNPEGVLYGRRPGYHLTPLGHSMAEKLGEAF
FT                   AEHDVRLVVTSPLERAIETGTPTARAFGLDIVTDERVIEADNKFEGLDVNSDRWQLARP
FT                   KYWPWYINPLEPSWGEPYTDIVARMSAAISDALTKAEGGEAVIVSHQLPIWTMRRFIER
FT                   LPLAHDPRKRECSLASVTSLTFVGRQLISLDYWEPVADILGQAQDMVPGTSKAQTKM"
FT   gene            complement(338528..338923)
FT                   /locus_tag="Arch_0282"
FT   CDS_pept        complement(338528..338923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xce:Xcel_0448 hypothetical protein; SPTR:
FT                   D0WMF2 Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92040"
FT                   /db_xref="GOA:D7BM91"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM91"
FT                   /protein_id="ADH92040.1"
FT                   /translation="MILSAIALHIYTFIDVLRTDRSQLPARLPKVAWAVLTLIVPILGP
FT                   LLWLFFKNQHLFRSGTTFSAEAFGGAFGSKQRSSGPVAPDDDPEFLARLEAQNRRRAYE
FT                   ENKRKETGEAEETTVEDTDEDGGLYGR"
FT   sig_peptide     complement(338822..338923)
FT                   /locus_tag="Arch_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(338980..339858)
FT                   /locus_tag="Arch_0283"
FT   CDS_pept        complement(338980..339858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0283"
FT                   /product="1,4-dihydroxy-2-naphthoateoctaprenyltransferase"
FT                   /note="COGs: COG1575 1 4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase; InterPro IPR000537:IPR004657; KEGG:
FT                   kra:Krad_0635 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase; PFAM: UbiA prenyltransferase; SPTR:
FT                   A7BBS9 Putative uncharacterized protein; TIGRFAM:
FT                   1,4-dihydroxy-2-naphthoate octaprenyltransferase; PFAM:
FT                   UbiA prenyltransferase family; TIGRFAM:
FT                   1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92041"
FT                   /db_xref="GOA:D7BM92"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM92"
FT                   /protein_id="ADH92041.1"
FT                   /translation="MATVNDWLEGARVRTLPAAVSPVIIGAGIASADGGFSWIRTLLAA
FT                   FVALAFQVGVNFANDYSDGVRGTDDLRQGPPRLTGGGTVAPRVVLQIALGFFAAACVAG
FT                   LVLVALSGHWWLIGLGAGAAAAAWFYTGGKHPYGYMGLGEVFVMVFFGWMATVGTAYVQ
FT                   TGSAPWYAWAAGTGVGLIACALLMVNNIRDIPTDSVTGKHTLAVRMGDRAARYSFVGML
FT                   VGAVALMVWLMVAFHGISGLAFLLVGMLAISPIKVVLSSAAGRSLIPALKHTGIFELNY
FT                   AILLCAGFVLS"
FT   sig_peptide     complement(339763..339858)
FT                   /locus_tag="Arch_0283"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(339845..340984)
FT                   /locus_tag="Arch_0284"
FT   CDS_pept        complement(339845..340984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0284"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG0318 Acyl-CoA synthetase
FT                   (AMP-forming)/AMP-acid ligase II; InterPro IPR000873; KEGG:
FT                   bcv:Bcav_3247 O-succinylbenzoic acid--CoA ligase; PFAM:
FT                   AMP-dependent synthetase and ligase; SPTR: D0WMF4
FT                   O-succinylbenzoate--CoA ligase; PFAM: AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92042"
FT                   /db_xref="GOA:D7BM93"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM93"
FT                   /protein_id="ADH92042.1"
FT                   /translation="MPEYPVRVIVCDGSEFADVVDHVRLALTGQAVPPLFVVGPQVDPI
FT                   EAAAEIAAQGYPVNTGVLMRTSGSTSGTGTIIALSWDSLVASANATHTALAGPGPWLAD
FT                   LPLHHIAGFQTIVRSVLAECEPLHTKLEQLLTAPITHHPTYCSIVPTQLVRILDHLEHF
FT                   PAARHVTFLVGGAATSSELLERAQAAGLTVHTSYGMTETCGGCVYDGRPIGDAAITLGT
FT                   DGAIVITGSLVRLGSAENAHGQRTHRTRDLGIFGPDGRLSVLGRIDDAITTGGLTIVPR
FT                   LVEESLAAAAHSTAIVVGVPDATWGEAAIALIDPWPENITEQQLRDHVKHALGTGWQPQ
FT                   HVLPLTTIGFNAWPLTQSGKIDRRAIRNATHVYFSGGNS"
FT   gene            complement(340977..341966)
FT                   /locus_tag="Arch_0285"
FT   CDS_pept        complement(340977..341966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0285"
FT                   /product="naphthoate synthase"
FT                   /EC_number="4.1.3.36"
FT                   /note="COGs: COG0447 Dihydroxynaphthoic acid synthase;
FT                   InterPro IPR001753:IPR010198:IPR018376; KEGG: xce:Xcel_0455
FT                   naphthoate synthase; PFAM: Enoyl-CoA hydratase/isomerase;
FT                   SPTR: C0W0R8 Naphthoate synthase; TIGRFAM: naphthoate
FT                   synthase; PFAM: Enoyl-CoA hydratase/isomerase family;
FT                   TIGRFAM: naphthoate synthase (dihydroxynaphthoic acid
FT                   synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92043"
FT                   /db_xref="GOA:D7BM94"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM94"
FT                   /protein_id="ADH92043.1"
FT                   /translation="MTISPLPASVSDIFDPRRWRSVEGFPDSDVTYHRGVEREFDSAGA
FT                   VVSERDLPVVRIAFNRPEVRNAFRPETVDQLYRAIDHARLTGQVGCVILTGNGPSTKDG
FT                   GWAFCSGGDQRIRGRDGYRYDGGGDDPTANKATRDSIEPARAGRLHILEVQRLMRTSGM
FT                   VFIGAISGWATGGGHSLNVLCDLSIASLEHARFMQVDANVGSFDAGYGSALLARQIGDK
FT                   RAREIFFLAREYSAQDAERWGVVNEAVAHADLETTALEYARILGTKSPQALRMLKFAFN
FT                   LADDGLAGQQVFAGETTRLAYMTAEAQEGRDAFLEKRAPQWDEFPFYA"
FT   gene            complement(341971..342588)
FT                   /locus_tag="Arch_0286"
FT   CDS_pept        complement(341971..342588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0286"
FT                   /product="Methyltransferase type 11"
FT                   /note="InterPro IPR013216; KEGG: bcv:Bcav_2129
FT                   methyltransferase type 12; PFAM: Methyltransferase type 11;
FT                   SPTR: C4DS37 Methyltransferase family protein; PFAM:
FT                   Thiopurine S-methyltransferase (TPMT)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92044"
FT                   /db_xref="GOA:D7BM95"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM95"
FT                   /protein_id="ADH92044.1"
FT                   /translation="MGDKLGGMDAKHWEEKYAATERLWSGEPNSIIASHVLPWAPGMAL
FT                   DVGCGEGRDAVWLAQRGWRVRGIDFSETAISRMADATAESGVADAVEGFVGDACAVIAE
FT                   HGWRDHDLATVSFIQSADLPRILECVSSTIVPGGRMLVAAHAFALPWHPDTFVPWSASD
FT                   VIAAVDLPDFEVEKSSRVETLLAARGVTRVDDVVVFRRRMAE"
FT   gene            342613..343596
FT                   /locus_tag="Arch_0287"
FT   CDS_pept        342613..343596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0287"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="COGs: COG4948 L-alanine-DL-glutamate epimerase;
FT                   InterPro IPR013342; KEGG: nca:Noca_0509 O-succinylbenzoate
FT                   synthase; PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; SPTR: A1SE16 Mandelate racemase/muconate
FT                   lactonizing enzyme, C-terminal domain protein; PFAM:
FT                   Mandelate racemase / muconate lactonizing enzyme,
FT                   C-terminal domain; TIGRFAM: o-succinylbenzoic acid (OSB)
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92045"
FT                   /db_xref="GOA:D7BM96"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="InterPro:IPR041338"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM96"
FT                   /protein_id="ADH92045.1"
FT                   /translation="MDVYIYSSPLHTRFRGLTVRDGLLLRGPAGWGEASPFWDYGPTYS
FT                   AAWLRAGIEAATCGFPAALRGSIPVNVTVPATDPERAARIVTRGTCATAKVKVAEPGQS
FT                   LADDLSRVAAVRDALGASGKIRIDVNGAWSVADALAAIPALDRAAGGLEYVEQPVADVA
FT                   DLARVRRKSTVRIAADESIRRASDPLHVKRLNAADVIVVKNQPLGGVRAALAIAAEIGL
FT                   PVVVSSALESSIGIRAGLAFAAALPELEFACGLATVQLLTADPVADSLLPVAGEIAVRD
FT                   VVPADLPAPDPQLAARWEQRLAQMWDYCGVDATYTLHTDAYVRSPQ"
FT   gene            343593..345215
FT                   /locus_tag="Arch_0288"
FT   CDS_pept        343593..345215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0288"
FT                   /product="2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid
FT                   synthase"
FT                   /note="COGs: COG1165 2-succinyl-6-hydroxy-2
FT                   4-cyclohexadiene-1-carboxylate synthase; InterPro
FT                   IPR012001; KEGG: pac:PPA0903 menaquinone biosynthesis
FT                   protein; PFAM: thiamine pyrophosphate protein TPP binding
FT                   domain protein;
FT                   PRIAM:2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
FT                   ene-1-carboxylic-acidsynthase; SPTR: Q6A9B0
FT                   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-
FT                   carboxylate synthase; PFAM: Thiamine pyrophosphate enzyme,
FT                   N-terminal TPP binding domain; Thiamine pyrophosphate
FT                   enzyme, C-terminal TPP binding domain; TIGRFAM:
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92046"
FT                   /db_xref="GOA:D7BM97"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM97"
FT                   /protein_id="ADH92046.1"
FT                   /translation="MSDSASTARVLVSHLVACGVRTFVLCPGSRSAPLAYALYDAERAG
FT                   AVRLHIETDERVAGFAALGSGSVGELAAVVTTSGSAVANLHPAVEEAFYGGVPMIVVSC
FT                   DRPEHMRGVRASQTTDHRAVLAGSVRHFRELPAGAPPKNLGGLVQRAVRAARGAGNGTV
FT                   PGPVHFNVGFVEPLMPDQPWKTVGADIAQAQRGMERGSGERCVVVAGTTRNRKLDPALF
FT                   AGIPILAEPSAALRAHPNAINAHPILLGTDLRAQITRAIVIGHPTLTREISGLLADPVV
FT                   DVVVLDDAPTYADVAGNARIVNLAGLAGECEPNEAWLNTWRIASVAADNWLMRHCAGLD
FT                   FCSIARDVSTLSGHTELVLGASTIIRDVNLYAPVPARPVHANRGLAGIDGTMSTGIGIG
FT                   IATGRPVRVVLGDLTFIHDLGALVRTASQAHVDLDVVILDDSGGSLFATLEYGAGDRDA
FT                   YDRVFRTAKEIDVRAYAAAVGADYAPVSERKELRTALEQAPRGTRIIHVKLGACEMQAD
FT                   RARRAALRDSIRDHVHLGLNSIQ"
FT   sig_peptide     343593..343703
FT                   /locus_tag="Arch_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            345297..346964
FT                   /locus_tag="Arch_0289"
FT   CDS_pept        345297..346964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0289"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="COGs: COG0265 Trypsin-like serine protease typically
FT                   periplasmic contain C-terminal PDZ domain; InterPro
FT                   IPR001478:IPR001254:IPR009003:IPR001940; KEGG:
FT                   bcv:Bcav_3234 2-alkenal reductase; PFAM: peptidase S1 and
FT                   S6 chymotrypsin/Hap; PDZ/DHR/GLGF domain protein; SMART:
FT                   PDZ/DHR/GLGF domain protein; SPTR: C5C0T2 2-alkenal
FT                   reductase; PFAM: Trypsin; PDZ domain (Also known as DHR or
FT                   GLGF)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92047"
FT                   /db_xref="GOA:D7BM98"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM98"
FT                   /protein_id="ADH92047.1"
FT                   /translation="MEQNNTPRPAEGSTPERETVAHLQMPTNNSPAAPSPQPEPGETTP
FT                   ARETMRLPKHSASVEQDLWNTSAAAEPAMPKPVASEPAVTPTEPMVAPAEPALPEPVTE
FT                   PVAAPVEPTLPATETMPEAEQAPVEEQSPATEPMPKTAAPMPEMAAPMPESVPAEEPTP
FT                   TAMPAEEPTNFQPIYAPASTVAPKPKKRRPGWFAVFAGMTAAALAGGVIGFTATQYYNP
FT                   GGVRPSSMTAHEETKGTTKPVNSTVGAADWEAVAKEVGDTVVSLDVSTDNGQSQGSGVI
FT                   ISKDGHILTNNHVVAGANEIFVRFSDGRVFEGHVMGTDEATDLAVVKIKDAPKDIAVAQ
FT                   LGDSSTVKVGQAVAAIGNPMGLNSTLTTGVVSALDRPTQADRAGAVTNAIQIDAAINPG
FT                   NSGGPVFDQQGKVIGIASSIITVKTGFNGQSAGSIGLGFAIPVNLAKNISKQLVEKGSA
FT                   EHAYLGVSISNGLAKFDETRRTAAVVKTVEPETPAAKAGIKEGDNIVEIDGKKVSTATA
FT                   LTGFVRQYRAGDVITVKFERGGKLMETNVTLATRPDPR"
FT   gene            complement(347139..348458)
FT                   /locus_tag="Arch_0290"
FT   CDS_pept        complement(347139..348458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0290"
FT                   /product="isochorismate synthase"
FT                   /note="COGs: COG1169 Isochorismate synthase; InterPro
FT                   IPR015890:IPR005801:IPR004561; KEGG: bcv:Bcav_3233
FT                   isochorismate synthase; PFAM: Chorismate binding-like;
FT                   SPTR: C5C0T1 Isochorismate synthase; TIGRFAM: isochorismate
FT                   synthase; PFAM: chorismate binding enzyme; TIGRFAM:
FT                   isochorismate synthases"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92048"
FT                   /db_xref="GOA:D7BM99"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:D7BM99"
FT                   /protein_id="ADH92048.1"
FT                   /translation="MFTIPHLRAQTTRLPRTPELTRLLPASRGQIAWLRDGRGFVAAGQ
FT                   AARFDRGAGGEGGASASAGSAGSGARENGRRFAIASQWWNAVKDAAEIRDDVRVAGSGL
FT                   VAFGSFSFSPVSTAGSSLIVPQVIVGLGGAAGTEAFLTLIGPDDQDVFETLTPEARTLL
FT                   DAVLVDTEPEYAPIGAVRAEPTIDAAGYRERVERILAQINAGSVEKVVFARQLDIVADS
FT                   PIDERSLLHHLAEQYPQCWVFGIDGLIGATPEMLAETDSGTVVTRVLAGTFPRGVYADD
FT                   ALLSSPKNLHEHAVAVDSALESLSKIGTVEAGEPFVLHLPNVSHLATDIRTTLGYSADV
FT                   LQVAGALHPTAALGGQPREMALDLIAELEDDRDRFGAPVGWIGSDGSGQWCVALRCVRI
FT                   DGDLSARAWAGGGIMGDSQPDEEFTETEAKFAPILGAFGA"
FT   gene            348497..349237
FT                   /locus_tag="Arch_0291"
FT   CDS_pept        348497..349237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0291"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR004033;
FT                   KEGG: bcv:Bcav_3232 ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase; SPTR:
FT                   D1BBC6 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
FT                   /demethylmenaquinone methyltransferase; TIGRFAM:
FT                   ubiquinone/menaquinone biosynthesis methyltransferase;
FT                   PFAM: ubiE/COQ5 methyltransferase family; TIGRFAM:
FT                   ubiquinone/menaquinone biosynthesis methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92049"
FT                   /db_xref="GOA:D7BMA0"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMA0"
FT                   /protein_id="ADH92049.1"
FT                   /translation="MKTPLSHTTQPSDESSQYRAQLDKKPTDVSHMFDDVAEHYDITNT
FT                   VLTGGLVHVWRRVTREAVGGAPGVSVLDVACGTGASAAGYAADGADVIGCDFSPGMVAR
FT                   GLELHPDLDLRVGDATNLEFPDETFDVVTISYGLRNVVDAPGALREMLRVTKRGGKIVI
FT                   AEFSRPTNSLFRSTYFGFMRVGMPVLSRLFSSDAPAYDYLRESIEAWYTQDELAEVLQE
FT                   AGWRSVEFKNLTNGIVALHRAVRP"
FT   gene            349422..350705
FT                   /locus_tag="Arch_0292"
FT   CDS_pept        349422..350705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0292"
FT                   /product="geranylgeranyl reductase"
FT                   /note="COGs: COG0644 Dehydrogenase (flavoprotein); InterPro
FT                   IPR006076:IPR011777:IPR003042; KEGG: bcv:Bcav_3230
FT                   geranylgeranyl reductase; PFAM: FAD dependent
FT                   oxidoreductase; SPTR: D0WMG0 Putative monooxygenase,
FT                   FAD-binding; TIGRFAM: geranylgeranyl reductase; manually
FT                   curated; PFAM: FAD binding domain; TIGRFAM: geranylgeranyl
FT                   reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92050"
FT                   /db_xref="GOA:D7BMA1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMA1"
FT                   /protein_id="ADH92050.1"
FT                   /translation="MSRPEHADVVVVGAGPGGSATAHYLAQNGVDVLVLEKATFPRDKV
FT                   CGDGLTPRAVAELIRMGISMREEDGWVRNWGVRGYGAGHVIEVPWPELASVPNFGSGMP
FT                   RKDLDHLLIKHAVASGARLREGVTVLGPVIHEKSGRVIGVRARNTADGAKGEEFTILAR
FT                   FVVDCGGVAARLAIATGREKAMNRPMGVAHRTYFRSPLAQTDMMESQLELWGGKPGESE
FT                   LLPGYAWMFAVGDGLVNVGLGSLSSTAQPTGVDYRDVFAKWIANTPPEWELTPENQVGR
FT                   LRGAALPMAFNRKPHYANGLALVGDAGGMVSPFNGEGIAYALASGRMVADSIAQALIRP
FT                   TLGAQDRVMAQYPRELRDELGGYYTLGRIFASLIERPEIMHVCVKYGLPRPTLMKLVMK
FT                   LLSDSYDRHDGDWMDKVITSLTKVVPKA"
FT   gene            350797..351156
FT                   /locus_tag="Arch_0293"
FT   CDS_pept        350797..351156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0293"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 3"
FT                   /note="COGs: COG0838 NADH:ubiquinone oxidoreductase subunit
FT                   3 (chain A); InterPro IPR000440; KEGG: bcv:Bcav_3229
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 3; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 3; SPTR:
FT                   D0WMG1 NADH dehydrogenase I, A subunit; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase, chain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92051"
FT                   /db_xref="GOA:D7BMA2"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMA2"
FT                   /protein_id="ADH92051.1"
FT                   /translation="MNPYVPLLIMIAVASLVAVGGLAVSAILGPKRYNRVKVANYECGL
FT                   EPTPSAGASGRFPIKYFLTAMTFIIFDIEVVFLYPWAVSAGRLGLASLIAIASFVFLIT
FT                   IPFIYEWRRGGLDWE"
FT   sig_peptide     350797..350874
FT                   /locus_tag="Arch_0293"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            351160..351717
FT                   /locus_tag="Arch_0294"
FT   CDS_pept        351160..351717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0294"
FT                   /product="NADH-quinone oxidoreductase, B subunit"
FT                   /EC_number="1.6.99.5"
FT                   /EC_number="1.6.5.3"
FT                   /note="COGs: COG0377 NADH:ubiquinone oxidoreductase 20 kD
FT                   subunit and related Fe-S oxidoreductase; InterPro
FT                   IPR006137:IPR006138; KEGG: sgr:SGR_2983 NADH dehydrogenase
FT                   subunit B; PFAM: NADH ubiquinone oxidoreductase 20 kDa
FT                   subunit; PRIAM: NADH dehydrogenase (quinone); SPTR: A7BBW8
FT                   Putative uncharacterized protein; TIGRFAM: NADH-quinone
FT                   oxidoreductase, B subunit; PFAM: NADH ubiquinone
FT                   oxidoreductase, 20 Kd subunit; TIGRFAM: NADH-quinone
FT                   oxidoreductase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92052"
FT                   /db_xref="GOA:D7BMA3"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMA3"
FT                   /protein_id="ADH92052.1"
FT                   /translation="MGLEEKVPAGIGLTTVEALAGWAQQRSPWPVTMGLACCAIEMMSF
FT                   GATRFDASRIGMEVFRASPRHADIMIVSGRVSHKMAPVVRNIYDQMPDPKWVISMGACA
FT                   SSGGVFNNYAIVQGIDHIVPVDIYLPGCPPRPEMLINAVFELRNNVMKNRPLGEHRKEV
FT                   ARKAEAAALAALPLESQKGLLA"
FT   gene            351714..352412
FT                   /locus_tag="Arch_0295"
FT   CDS_pept        351714..352412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0295"
FT                   /product="NADH (or F420H2) dehydrogenase, subunit C"
FT                   /note="COGs: COG0852 NADH:ubiquinone oxidoreductase 27 kD
FT                   subunit; InterPro IPR001268:IPR010218; KEGG: sco:SCO4564
FT                   NADH dehydrogenase subunit C; PFAM: NADH dehydrogenase
FT                   (ubiquinone) 30 kDa subunit; SPTR: D0WMG3 NADH
FT                   dehydrogenase I, C subunit; TIGRFAM: NADH (or F420H2)
FT                   dehydrogenase, subunit C; PFAM: Respiratory-chain NADH
FT                   dehydrogenase, 30 Kd subunit; TIGRFAM: NADH (or F420H2)
FT                   dehydrogenase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92053"
FT                   /db_xref="GOA:D7BMA4"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMA4"
FT                   /protein_id="ADH92053.1"
FT                   /translation="MNNHGSVTQGETGAEHITTRKGMWGVKNGADTTGFGGQENVVTIA
FT                   APAHRPYGGWFDEVVDIIGELAMADGLQPEDVIEKVTTQYGELVIFIKREHLVRVARYL
FT                   RDDQDLRFELCLGVSAVHYPEDRGRELHGFYTFFSITHNRSLSLDVAAPESDPHIPSIV
FT                   SVYPGNDWPEREAWDLMGIVFDGHPGLTRSVMPDDWVGHPQRKDYPLGGIPVEYKGAVI
FT                   PPPDTRREYN"
FT   gene            352412..353761
FT                   /locus_tag="Arch_0296"
FT   CDS_pept        352412..353761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0296"
FT                   /product="NADH dehydrogenase I, D subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="COGs: COG0649 NADH:ubiquinone oxidoreductase 49 kD
FT                   subunit 7; InterPro IPR001135:IPR010219:IPR014029; KEGG:
FT                   bcv:Bcav_3226 NADH dehydrogenase I, D subunit; PFAM:
FT                   NADH-ubiquinone oxidoreductase chain 49kDa; PRIAM: NADH
FT                   dehydrogenase (quinone); SPTR: D0WMG4 NADH dehydrogenase, D
FT                   subunit; TIGRFAM: NADH dehydrogenase I, D subunit; PFAM:
FT                   Respiratory-chain NADH dehydrogenase, 49 Kd subunit;
FT                   TIGRFAM: NADH dehydrogenase I, D subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92054"
FT                   /db_xref="GOA:D7BMA5"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMA5"
FT                   /protein_id="ADH92054.1"
FT                   /translation="MTTSMPHATRGINEEEAENFTSFDAVGGDWADIAREAEQVGEEHI
FT                   VVNLGPVHPSTHGVLRVQVELDGENVKEVRAATGFLHTGIEKNMEYRTWTQGVAFCTRM
FT                   DYVAPIFQEVAYCLGIEKMLGIADQVPERAQAIRVLLMELTRISSHLVGIGSGGNELGA
FT                   TTMLTLTFRAREDILRLLEDVTGLRMNHEYIRPGGVLNDIPEGFTDYCRELLPKIRLTI
FT                   SEMQDLTMKNPIFLDRHVNVGVSPLSSMMALSMTGPSVRAAGIPWDLRKTQPYCGYEKY
FT                   EFDVPVADKADAYNRIDVKFRECYESLRICYQVLDELDKTAGQPVMVGDKKIAWPAQLS
FT                   IAGDGQGSTPEHVREIMTESMESLIHHFKLVTEGFRVPPGQSFTMVEHPKGVFGVHLVS
FT                   DGGTRPYRAHFRDPGFNNLQSLSMMAEGGMLADLVVSLAGVDPVMGGVDR"
FT   gene            353761..354441
FT                   /locus_tag="Arch_0297"
FT   CDS_pept        353761..354441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0297"
FT                   /product="NADH-quinone oxidoreductase, E subunit"
FT                   /note="COGs: COG1905 NADH:ubiquinone oxidoreductase 24 kD
FT                   subunit; InterPro IPR002023:IPR005113:IPR012336; KEGG:
FT                   xce:Xcel_0473 NADH-quinone oxidoreductase, E subunit; PFAM:
FT                   NADH dehydrogenase (ubiquinone) 24 kDa subunit; SPTR:
FT                   D0WMG5 NADH dehydrogenase I, E subunit; TIGRFAM:
FT                   NADH-quinone oxidoreductase, E subunit; PFAM:
FT                   Respiratory-chain NADH dehydrogenase 24 Kd subunit;
FT                   TIGRFAM: NADH-quinone oxidoreductase, E subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92055"
FT                   /db_xref="GOA:D7BMA6"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMA6"
FT                   /protein_id="ADH92055.1"
FT                   /translation="MSTPYEPQVEEKFRQDAAAIIARYPQSRSAIMPLLHLVQSVDGFC
FT                   SPRGITLVADILGLTRAQVSAVATFYSQYRRHPNGEYNVGVCTNALCAVMGGDLIWDEL
FT                   SEYVGVGHDETTQDGKITLEQLECNAGCDYAPVVMVNWEFFDNQTPETAKKIVDDIRAG
FT                   HDIHPTRGPEKVHTFKEISRVLAGFEDGHVNEGPAAGDASLRGLKIARAHDWTAPRAEG
FT                   GNAQ"
FT   gene            354438..355763
FT                   /locus_tag="Arch_0298"
FT   CDS_pept        354438..355763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0298"
FT                   /product="NADH-quinone oxidoreductase, F subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="COGs: COG1894 NADH:ubiquinone oxidoreductase
FT                   NADH-binding (51 kD) subunit;
FT                   InterProIPR011538:IPR019554:IPR019575:IPR011537:IPR 001949;
FT                   KEGG: bcv:Bcav_3224 NADH-quinone oxidoreductase, F subunit;
FT                   PFAM: Respiratory-chain NADH dehydrogenase domain 51 kDa
FT                   subunit; Soluble ligand binding domain; NADH ubiquinone
FT                   oxidoreductase, F subunit, iron sulphur binding; PRIAM:
FT                   NADH dehydrogenase (quinone); SPTR: D0WMG6 NADH
FT                   oxidoreductase, F subunit; TIGRFAM: NADH-quinone
FT                   oxidoreductase, F subunit; PFAM: NADH-ubiquinone
FT                   oxidoreductase-F iron-sulfur binding region;
FT                   Respiratory-chain NADH dehydrogenase 51 Kd subunit; SLBB
FT                   domain; TIGRFAM: NADH-quinone oxidoreductase, F subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92056"
FT                   /db_xref="GOA:D7BMA7"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMA7"
FT                   /protein_id="ADH92056.1"
FT                   /translation="MTAFRAPGTLSPVLTNNWDTERPWTLDGYRATGGYQAIARAWDIN
FT                   QEKGALTNLIKESGLRGRGGAGFPTGLKWSFLPPEDGGPRYLVVNADESEPGTCKDIPF
FT                   LMANPHLLIEGMAICLMAIGGHDGFIYLRGEVVHVYRRLLAAVREAKEAGIIGTGCGPN
FT                   GDYDINITVHAGAGAYICGEETALLDSLEGFRGQPRLKPPFPAVAGLYARPTVVNNVES
FT                   IASVPGIINNGAEWFTAMGAGTKNSPGHGIFSLSGHVKNPGQFEAPFGITMRELLDMAG
FT                   GIREGHELKFFAIGGSSAPLFTPEHLDVPLGYEEVAQAGSMLATRAIQIFDETVSVVRV
FT                   VSRWTDFYQHESCGKCTPCREGTFWMRQIMHRFEAGQGTEADIDLLYDVASNIAGRSFC
FT                   ALGDAAATPIRSAIDLFRSEFEDACRMPVAEQYPIVKSAVFK"
FT   gene            355776..358373
FT                   /locus_tag="Arch_0299"
FT   CDS_pept        355776..358373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0299"
FT                   /product="NADH-quinone oxidoreductase, chain G"
FT                   /note="COGs: COG1034 NADH dehydrogenase/NADH:ubiquinone
FT                   oxidoreductase 75 kD subunit (chain G);
FT                   InterProIPR001041:IPR019574:IPR006656:IPR010228:IPR 000283;
FT                   KEGG: xce:Xcel_0475 NADH-quinone oxidoreductase, chain G;
FT                   PFAM: NADH:ubiquinone oxidoreductase, subunit G,
FT                   iron-sulphur binding; ferredoxin; molybdopterin
FT                   oxidoreductase; SPTR: D0WMG7 NADH dehydrogenase, G subunit;
FT                   TIGRFAM: NADH-quinone oxidoreductase, chain G; PFAM: 2Fe-2S
FT                   iron-sulfur cluster binding domain; Molybdopterin
FT                   oxidoreductase; NADH-ubiquinone oxidoreductase-G
FT                   iron-sulfur binding region; TIGRFAM: NADH-quinone
FT                   oxidoreductase, chain G"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92057"
FT                   /db_xref="GOA:D7BMA8"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMA8"
FT                   /protein_id="ADH92057.1"
FT                   /translation="MTTQVPAPEELVTLTVDGREVSVPKGTLIIRAAEKVGVHIPRFCD
FT                   HPLLKPAAACRQCLVEVAAPGRDGTVAKMPKPQPACAVAVSPGMEVFSAETSEVAKKAQ
FT                   HGVMEFLLINHPMDCPVCDKGGECPLQNQAMTDGRTKSRFVDIKRTYPKPISISANILL
FT                   DRDRCILCQRCTRFSQQIAGDPFIQLQGRSGGSAGMEVHGLHGSQIGNFDAGVLDFDSS
FT                   ANGSSVAALNSYSGPAGESGLAVGYAAGPVEAGEMDATGAPFSSYFSGNVIQICPVGAL
FT                   TSVSYRFRARPFDLVSVPSVTEHDASGSALRVDYRRGTVVRRLALEDMDVNEDWITDKD
FT                   RFAFRWQNGADRLVYPRLKGVDPSEPVSWAEALQAAADGLKAAQKKGVGLITGGRLTLE
FT                   DAYAYSKFARLVLGTNNIDFRTRRHSAEEDAFLASRIAGTELDVTYADIEHANHVLIVG
FT                   LEAEEEIGSVFLRLRKAALEKKNAHVTVLSAYQTRGTSKMMARFLPTTPGTEAEVLDAI
FT                   NEHASDEFADTFRDLAVSDTVILVGERTADSAGALSAVIRLAKRTGAKLAWIPRRAGDR
FT                   GALDAGAVPHLLPGGRQVSDAAARVDLASAWGVANLPEKRGLATEEILSAAAAGELGAV
FT                   ILGGVELSDLPGDARKALDKVFVVQLDVRATDNTEYADVLFPVAPPAEKGGTFVNWEGR
FT                   LRPFGQTLVSTNVPDRKVLHELAAEFSVDLGLSTLADAVNEWATMRHWDGERGEEPTVS
FT                   PKPAPMVAPGQAVLASWKLMLDSGALQSHEPHLARTARRAVALMSATTASNAGITDQVT
FT                   IVGPAGKLTLDTVVVPMPDAVVWVPQNSAECRISSLGSAAGDIVRIEATEVTK"
FT   gene            358370..359704
FT                   /locus_tag="Arch_0300"
FT   CDS_pept        358370..359704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0300"
FT                   /product="respiratory-chain NADH dehydrogenase subunit 1"
FT                   /note="COGs: COG1005 NADH:ubiquinone oxidoreductase subunit
FT                   1 (chain H); InterPro IPR001694:IPR018086; KEGG:
FT                   bcv:Bcav_3222 NADH dehydrogenase (quinone); PFAM:
FT                   respiratory-chain NADH dehydrogenase subunit 1; SPTR:
FT                   D0WMG8 NADH dehydrogenase I, H subunit; PFAM: NADH
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92058"
FT                   /db_xref="GOA:D7BMA9"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMA9"
FT                   /protein_id="ADH92058.1"
FT                   /translation="MNPIFTQVAADFSHDTWWMSVIKALFIVVFLIFSVIFALWFERRL
FT                   IARFQNRVGPNTVGPFGLGQSFPDALKLLLKEDFWLAGAEKVVYLVAPVITAICAFSAM
FT                   AVIPMGPEVSIFGIHTPLQLTDSPVAMLFVLAVAALGEYGMVFGGWSAKSTLPLYGSVR
FT                   SATQMISYELAQGLSLVTIFLAAATMSTSGIVQAQQDLWNVVTLLPAFLVFLVTMFGET
FT                   NRLPFDLPEAEGEIVAGPHTEYSSMKFAWYYLGEYVNMFNVSMLAVTLFFGGWRSGPIL
FT                   TYLGGLIGFDPNVGWFPMLVFIVKVWIFIAIFIWVRATLLRFRYDQFMKLGWKGLIPSA
FT                   LIWLAIVLVIHGYKMVTPEFDDRWPTIILSTGFAAIMLIWALVRDDETVPQAQLIAERE
FT                   SQEFDGFEDGYPVPPLPGQHLPPSPRAARRIAQSASTTLEEAKND"
FT   sig_peptide     358370..358441
FT                   /locus_tag="Arch_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            359697..360380
FT                   /locus_tag="Arch_0301"
FT   CDS_pept        359697..360380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0301"
FT                   /product="NADH-quinone oxidoreductase, chain I"
FT                   /note="COGs: COG1143 Formate hydrogenlyase subunit
FT                   6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I);
FT                   InterProIPR001450:IPR017896:IPR010226:IPR009051:IPR 017900;
FT                   KEGG: bcv:Bcav_3221 NADH-quinone oxidoreductase, chain I;
FT                   PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain protein;
FT                   SPTR: D0WMG9 NADH-quinone oxidoreductase subunit I;
FT                   TIGRFAM: NADH-quinone oxidoreductase, chain I; PFAM: 4Fe-4S
FT                   binding domain; TIGRFAM: NADH-quinone oxidoreductase, chain
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92059"
FT                   /db_xref="GOA:D7BMB0"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMB0"
FT                   /protein_id="ADH92059.1"
FT                   /translation="MTDKEFAQPDESLYSPNKKGILGRALAPVAGFGVTFSTLFRPAVT
FT                   EQYLPHKPEQKTPPRPRYHGMHRLNRYADGLEKCIGCELCAWACPADAIYVEAASNKPG
FT                   EQYSPGERYGRVYQINYLRCIFCSYCIQACPTRALTMSTEYEVADQSRESLIYEKQDIL
FT                   VPLAEGMLSTPHPMAEGTTDANYYKGEITGPTHDQVEWVKNARPEDPTIRTASVSSAPQ
FT                   KEGQI"
FT   gene            360380..361372
FT                   /locus_tag="Arch_0302"
FT   CDS_pept        360380..361372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0302"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6"
FT                   /note="COGs: COG0839 NADH:ubiquinone oxidoreductase subunit
FT                   6 (chain J); InterPro IPR001457; KEGG: bcv:Bcav_3220
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 6; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 6; SPTR:
FT                   D0WMH0 NADH dehydrogenase; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 6"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92060"
FT                   /db_xref="GOA:D7BMB1"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMB1"
FT                   /protein_id="ADH92060.1"
FT                   /translation="MHTETLTIGMGETILFSVTAVGMVALAIFGLLITRKAVLTTLSVI
FT                   GVMVGFAVLYTALEAPFMGVVQVVVYTGAILMMFLFVLMLIGVDSADSGHETLKVQRPV
FT                   AILGGVGIALILIGVAFGAHAPAGIGLEQANAVTNPVGVATLIFSSSVLTLQLTGTLLI
FT                   VAALGAMTLTHRDRVKERITQEELAHKRMQEFTQAGVHVGQKPPPGVYAESNSSANPAL
FT                   TVGGQPLEESTSHVLHIRHQVRSLTEVSPATVKRVMTEGIHGPATYGVTSRAHVPGMPG
FT                   ESAPDHDAALKRLGKSESADVTPDAIPDAETLKRETEITVENTEKSEDN"
FT   sig_peptide     360380..360460
FT                   /locus_tag="Arch_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            361372..361671
FT                   /locus_tag="Arch_0303"
FT   CDS_pept        361372..361671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0303"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="COGs: COG0713 NADH:ubiquinone oxidoreductase subunit
FT                   11 or 4L (chain K); InterPro IPR001133; KEGG: sro:Sros_0594
FT                   NADH-ubiquinone oxidoreductase chain 4L; PFAM:
FT                   NADH-ubiquinone oxidoreductase chain 4L; SPTR: D0WMH1 NADH
FT                   dehydrogenase I, K subunit; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92061"
FT                   /db_xref="GOA:D7BMB2"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMB2"
FT                   /protein_id="ADH92061.1"
FT                   /translation="MTLMFYIALAAVLFAIGAATVLTRRNGVIALLGIELMLSACNLAF
FT                   ITFSRMHGNLEGQQFAFFVMVVAAAEVVVGLAIIVSIFRTRRSASLDGANLMKH"
FT   sig_peptide     361372..361425
FT                   /locus_tag="Arch_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            361691..363616
FT                   /locus_tag="Arch_0304"
FT   CDS_pept        361691..363616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0304"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /note="COGs: COG1009 NADH:ubiquinone oxidoreductase subunit
FT                   5 (chain L)/Multisubunit Na+/H+ antiporter MnhA subunit;
FT                   InterProIPR001516:IPR001750:IPR003945:IPR003916:IPR 018393;
FT                   KEGG: bcv:Bcav_3218 proton-translocating NADH-quinone
FT                   oxidoreductase, chain L; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); NADH-Ubiquinone
FT                   oxidoreductase (complex I) chain 5/L domain protein; SPTR:
FT                   D0WMH2 NADH-quinone oxidoreductase, L subunit; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain L;
FT                   manually curated; PFAM: NADH-Ubiquinone/plastoquinone
FT                   (complex I), various chains; NADH-Ubiquinone oxidoreductase
FT                   (complex I), chain 5 N-terminus; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain L"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92062"
FT                   /db_xref="GOA:D7BMB3"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMB3"
FT                   /protein_id="ADH92062.1"
FT                   /translation="MFTLTALAQAQQATGAASMIWLAVAIPLISCGLLLIAGRKADSWG
FT                   HWLGTLASAGSFVVGLLATLQLLGMDATQRVVETTLYTWVPADALTVDFGTRADPLSLT
FT                   FVLLVTFVGTLIHIYSISYMEHDTDRRRFFAYLNLFIASMLLLVLGNSYLVLFFGWEGV
FT                   GLASYLLISFWNHVPAYATAGKKAFVMNRVGDLGMLIAMMAMVANVGSVKFTDVAAAAP
FT                   ELSTATATFIGLFLLVAACGKSAQFPLQAWLGDAMAGPTPVSALIHAATMVTAGVYLMV
FT                   RSGAIYAVAPTAALVVSIIGLITLIFGAIVGAAKDDMKKVLAASTMSQIGYMMLAATMG
FT                   PIGAAFAIFHLVTHGFFKANMFLGAGAVMHAMNDDVNIRGFGGLSRHMKITFATFLTGY
FT                   LAIIGFPFLSGYFSKDKIIEVAFSGHGVQPWIFGTITVLVAGLTAFYMSRVFFAIFLGK
FT                   ERWDHSEKHPHDPSPFMWIPMAILALGSLGLGAVLNYTGFLTWLEPAIGHGEHPHPVLP
FT                   IWAITVLTLVVVAAGVGVAWKLYVASDIPKLAPEGNVLIRAARADLYQDAFNENVFMKP
FT                   GIAVMAGTDVADHTIVDGAFEGLGKATVASGSVIGKLQTGYVRSYASWIMVGVVLALAL
FT                   VAQAAL"
FT   sig_peptide     361691..361765
FT                   /locus_tag="Arch_0304"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            363636..365168
FT                   /locus_tag="Arch_0305"
FT   CDS_pept        363636..365168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0305"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /note="COGs: COG1008 NADH:ubiquinone oxidoreductase subunit
FT                   4 (chain M); InterPro IPR001750:IPR010227:IPR003918; KEGG:
FT                   bcv:Bcav_3217 proton-translocating NADH-quinone
FT                   oxidoreductase, chain M; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); SPTR: D0WMH3
FT                   NADH-quinone oxidoreductase, M subunit; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain M;
FT                   PFAM: NADH-Ubiquinone/plastoquinone (complex I), various
FT                   chains; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain M"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92063"
FT                   /db_xref="GOA:D7BMB4"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMB4"
FT                   /protein_id="ADH92063.1"
FT                   /translation="MNIIEATAPWLTILVAIPFFAGLLLWLVAPLRAFARHFALAVSVL
FT                   VFVGFVAAMVTSFDVAQAGATQLHESYPWIPQIGASFTWGINGMGAVMIGLATVLVPFV
FT                   IVAEWDDFGSADDAGYFAWVLVLEAIMIGLFAARDVFLFYVLFEAMIVPVYFMIGRYGG
FT                   VGRARAAMKFLLFSLAGGLIMLAGVIAIYAYGQGGEGAFLLDSLRGALHLSDTAELWIF
FT                   LSFFIAFAIKAPMWPVHTWLPDTAVSASTGTSTLLVGILDKLGTFGMIAICLPLFPRTA
FT                   TAIAPIVLVLAVISILWGAIMAISSDNLLRLVAYTSVSHFGFIVMGVFSGSKLAMSGAI
FT                   LYMVAHGIGTAALFLIVGFLERRGKSYLISSYGGWQRVTPLIAGTFLVAGLATIALPGL
FT                   SGFIPEYLVLMGTFTLWPAVAMVAAIGVVLASIYILLPYQRTFTGPKPDVEVKDLGMRE
FT                   KTVVAGLIAFMLALGFYPAPVLDIVTPVADNATIIPVAMNDNGSASTEGSTK"
FT   sig_peptide     363636..363740
FT                   /locus_tag="Arch_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            365165..366766
FT                   /locus_tag="Arch_0306"
FT   CDS_pept        365165..366766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0306"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain N"
FT                   /note="COGs: COG1007 NADH:ubiquinone oxidoreductase subunit
FT                   2 (chain N); InterPro IPR001750:IPR010096; KEGG:
FT                   bcv:Bcav_3216 proton-translocating NADH-quinone
FT                   oxidoreductase, chain N; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); SPTR: D0WMH4
FT                   NADH-quinone oxidoreductase, N subunit; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain N;
FT                   PFAM: NADH-Ubiquinone/plastoquinone (complex I), various
FT                   chains; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain N"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92064"
FT                   /db_xref="GOA:D7BMB5"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMB5"
FT                   /protein_id="ADH92064.1"
FT                   /translation="MNLTINWLAIIPLAIVLGAGVVGTLLEAFLPRNIRRAVQIALSLL
FT                   ALGSAFVAIIWRWSDLAGAKTPGMLRPLSFSKGAAFSGVSLVEDGFSILGQTVIVVCAF
FT                   LSFMLIADRTSLRDGSFAASAATRPGSAAEQESTEAGREQTEIFPLALFATGGMMAFVS
FT                   AFDLLSLFIALELLSLPLYVLSATARRRRLLSQEAALKYFLLGAFSSAIFLMGAAFIYG
FT                   ATGTLSFYGVAVLAQKQQIIALFLAIGVILLVVGLLFKVGAAPFHSWTPDVYQGAPTPI
FT                   TAFMAAGTKTAAFIAMVRVFVWIVMAVPDTFRIFMWIIIIATVVIGTVMGLVQTDIKRL
FT                   LAYSSIAHAGFILIAVKATLAHVQGIQLAALNSIVFYLLAYGLATVGAFGVVTLIRSKD
FT                   SEGNILGEATSLSNWAGLGKRSPFLASAMVIFLLSFAGIPLTAGFIGKFEAFATGIAAG
FT                   DVVLVVIAIIASVATAFFYFRLIQLMFFTEAEEDTIEIATSEGLSVVAISVALAGTIVL
FT                   GIFPSPILEFIAGTFQ"
FT   gene            366763..367779
FT                   /locus_tag="Arch_0307"
FT   CDS_pept        366763..367779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0307"
FT                   /product="Polyprenyl synthetase"
FT                   /note="COGs: COG0142 Geranylgeranyl pyrophosphate synthase;
FT                   InterPro IPR000092:IPR008949; KEGG: bcv:Bcav_3215
FT                   polyprenyl synthetase; PFAM: Polyprenyl synthetase; SPTR:
FT                   D0WMH5 Trans-hexaprenyltranstransferase; PFAM: Polyprenyl
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92065"
FT                   /db_xref="GOA:D7BMB6"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMB6"
FT                   /protein_id="ADH92065.1"
FT                   /translation="MSLISNLFDQQSANLVEELTSRMGEVEAQLRLAVQVDDLVVDEAT
FT                   SHLAKAGGKRLRPALCLLTAQLGPRPASPDVLDSAVVVELTHLATLYHDDVMDEAPLRR
FT                   GVPSAQYVYGNSSAILAGDVLFARASGIVAKLGPEAVLLHAETFERLCMGQLHETIGPR
FT                   EGEDPIQHHIQVLADKTGSLIAASGRYGVLYSGGDPALAEEIAQFGDKVGVAFQIADDV
FT                   IDLVSDPEVTGKTPGTDLLEGVPTMPTLLLRKHAAEGTLDETGQRILTFLDHTDLTEGN
FT                   NLDTVVELLRNHSVVDETRTLAHQWVNDALTHLSAIPQGPVRNALETFARAMVDRLA"
FT   gene            367884..370691
FT                   /locus_tag="Arch_0308"
FT   CDS_pept        367884..370691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0308"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="COGs: COG0653 Preprotein translocase subunit SecA
FT                   (ATPase RNA helicase);
FT                   InterProIPR011115:IPR011130:IPR001650:IPR011116:IPR
FT                   014018:IPR000185; KEGG: bcv:Bcav_1246 preprotein
FT                   translocase, SecA subunit; PFAM: SecA DEAD domain protein;
FT                   SecA preprotein cross-linking region; helicase domain
FT                   protein; SecA Wing and Scaffold; SPTR: D0WRM7 Preprotein
FT                   translocase, SecA subunit; TIGRFAM: preprotein translocase,
FT                   SecA subunit; PFAM: SecA DEAD-like domain; SecA preprotein
FT                   cross-linking domain; SecA Wing and Scaffold domain;
FT                   TIGRFAM: preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92066"
FT                   /db_xref="GOA:D7BMB7"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMB7"
FT                   /protein_id="ADH92066.1"
FT                   /translation="MRNLLNKLLRAGEGRILKKLTAITKQVNLLEDVYKEMSDDELKGI
FT                   TAEFRERLAQGETLDELMPDAFAAVREASVRTLGQRHYDVQLMGGAALHLGNIAEMKTG
FT                   EGKTLVATLAAYLNALSGDGVHVVTVNDYLASYQSELMGRVFRFLGMTTGCILEGQTPD
FT                   ERRQQYAADITYGTNNQFGFDYLRDNMAMNESEMVQRGHNFAIVDEVDSILIDEARTPL
FT                   IISGQADGDANRWYVAFADAVGKMRRDEDYEVDEKKRNAGILEPGIDKVEDLLGIDNLY
FT                   ESVNTPLIGYLNNAIKAKELFHRDKDYIVRDGEVMIVDEHTGRVLPGRRYNDGMHQAIE
FT                   AKEGVEIKAENQTLASITLQNYFRMYNKLSGMTGTAETEAEEFASTYDIGVVPIPTNRP
FT                   VARIDQRDIVYATAELKFAAIVEDIKERFAEGQPVLVGTASVENSELLSMLLKKARIPH
FT                   EVLNAKQHEREASVVAMAGRKHAVTVATNMAGRGTDIMLGGNAEHIAVEMMSKLGLDPE
FT                   ENSEEYEERWPEILQAAKDQVSAEHDEVTELGGLYVLGSERHESRRIDNQLRGRAGRQG
FT                   DPGESRFYLSLDDDLLRLFGSTIVNTLRNSAQEEPLDFKMMNSAIQKAQAQLDGRNAEQ
FT                   RKNVLKYDDVMNDQRTVVYTERRRILGGDDVENQIQNFMDFVVDDIVSANTDGPSDDWD
FT                   LDMLWADMRRYFKPSFTPEEFIEEHGDQKLLSAEMLRDEFNQDIHAQYEEREEELGAEQ
FT                   MRNIERQVLLQTLDRNWREHLYEMDYLKEGIGLRAMAQRNPLVEYKQEGYQMFQSMNDQ
FT                   IRGETVAFLMGFELPSERLAREAAEAAEVMAGQESLMSAQAVSRAAAAAAAKSETTKAA
FT                   TEKILGLKRPQASTKMTYTSSAKDGSGEARATNEQGREVHEQTTAGSAGQQMNRAQRRA
FT                   AKKNK"
FT   gene            370807..372063
FT                   /locus_tag="Arch_0309"
FT   CDS_pept        370807..372063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0309"
FT                   /product="deoxyribonuclease/rho motif-related TRAM"
FT                   /note="COGs: COG2265 SAM-dependent methyltransferase
FT                   related to tRNA (uracil-5-)-methyltransferase; InterPro
FT                   IPR002792:IPR010280:IPR016027; KEGG: xce:Xcel_1914
FT                   deoxyribonuclease/rho motif-related TRAM; PFAM:
FT                   deoxyribonuclease/rho motif-related TRAM;
FT                   (Uracil-5)-methyltransferase; SPTR: D0WQH6 23S rRNA
FT                   methyltransferase/RumA; PFAM: tRNA
FT                   (Uracil-5-)-methyltransferase; TRAM domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92067"
FT                   /db_xref="GOA:D7BMB8"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMB8"
FT                   /protein_id="ADH92067.1"
FT                   /translation="MLNVGSYVDLEITDVAYGGECVAHHDGVPVFVRGAILGERVIAEV
FT                   TKVQAHGCRAIVRDVQEAAPTRIAHPWPLGSVGATGAADYGHMTLAGQHDMISRMLEGQ
FT                   LRQFGGESMLAQFTGMLEVESAEGGRDGSLDGAPGSEGWHYRTRIDVLKLDTGVGMHVM
FT                   RTNDLVPLERIPLAVRAMEKLDVFGTAWDGHVPFKKRMRLVAPSGGEPLAVIDGVAFCE
FT                   PGRRIGSDIHEIVTYRGQLYDYTINVNSFWQIHEYAPSSLVAHVFDALGVELGDTLVDL
FT                   YSGSGLFSLVGANIVGPGGRVLAFEGDERATSYAQQNLRSVPWASAQAATIDAENIRSL
FT                   TDGADIVIADPPRAGLGVDAAMMLAQSDARRIALVSCDSASMARDVSALLHAGRRLESF
FT                   AAVDIFPNTHFVETVCVVS"
FT   gene            complement(372158..372571)
FT                   /locus_tag="Arch_0310"
FT   CDS_pept        complement(372158..372571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0310"
FT                   /product="PilT protein domain protein"
FT                   /note="COGs: COG1487 nucleic acid-binding protein contains
FT                   PIN domain; InterPro IPR002716; KEGG: xce:Xcel_1526 PilT
FT                   protein domain protein; PFAM: PilT protein domain protein;
FT                   SPTR: D1BS64 PilT protein domain protein; PFAM: PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92068"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMB9"
FT                   /protein_id="ADH92068.1"
FT                   /translation="MKYLLDTNVVSALRRPDKNPQVAQWAHNIPQTDCYISSLTVAEIG
FT                   RGIRAIAKRDIQQAQILSRWFEHDLLPTFDGRILSFDLAASLRFNTFEVPEKAPIDDAY
FT                   IAAIADAHHLLLVSRNEKHVKPLHVPVLNPWES"
FT   gene            complement(372568..372804)
FT                   /locus_tag="Arch_0311"
FT   CDS_pept        complement(372568..372804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mtc:MT2002 hypothetical protein; SPTR: Q8VJT9
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92069"
FT                   /db_xref="GOA:D7BMC0"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMC0"
FT                   /protein_id="ADH92069.1"
FT                   /translation="MEQLLIRDLPTGTKQALKNLAAHKGTSMEAEARAILRSALNAKSR
FT                   SICEALAQKEPDLSEDFIFDPGRNGVGMREIVL"
FT   gene            complement(372980..373552)
FT                   /locus_tag="Arch_0312"
FT   CDS_pept        complement(372980..373552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_1253 hypothetical protein; SPTR:
FT                   D0WRM8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92070"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMC1"
FT                   /protein_id="ADH92070.1"
FT                   /translation="MTSVLSEVTSEPRALRFVPVSQENRPDFQRVPTVSVMERRATPPV
FT                   TSPERPFDRIAIRLSCTERVDDEDDRFSLDHPLPDSVIPAPKFAARVIGQAIEVLLGHR
FT                   PVRQLQSWLAPGVYRHLCSRAGLNARIAGAAPHTTPPLIRRLHVTHPRRRVAEVGIVIH
FT                   DGFRIRAAALRLEIFRERWQVTALEIA"
FT   gene            complement(373552..373941)
FT                   /locus_tag="Arch_0313"
FT   CDS_pept        complement(373552..373941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0313"
FT                   /product="Peptidoglycan-binding lysin domain protein"
FT                   /note="InterPro IPR018392:IPR002482; KEGG: tte:TTE1337 LysM
FT                   repeat-containing protein; PFAM: Peptidoglycan-binding
FT                   lysin domain; SMART: Peptidoglycan-binding LysM; SPTR:
FT                   Q8RA91 LysM-repeat proteins and domains; PFAM: LysM domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92071"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMC2"
FT                   /protein_id="ADH92071.1"
FT                   /translation="MIAAVGSPKARRIAIGTLLLLPTPAYAAPLSDSTPVVVTSEFGRQ
FT                   IQRTPDSLRAHITKPRVLDEQTSIFTIQPGDSLWSIAEKIAPYSSPTETASLVKRIVAA
FT                   NPQISDPQLLYPGQQIILPPVERTL"
FT   sig_peptide     complement(373861..373941)
FT                   /locus_tag="Arch_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            374201..374827
FT                   /locus_tag="Arch_0314"
FT   CDS_pept        374201..374827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0314"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: art:Arth_2703 hypothetical protein; SPTR:
FT                   A0JYG2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92072"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMC3"
FT                   /protein_id="ADH92072.1"
FT                   /translation="MKEGKPGTGIVDNLLGRKNNCHIFIGMSWRTIIESIGARIENEER
FT                   AAMLEEVEDLTDAEHAGVYLHERLRGSLGRFVAVSLEKAQLSGTLEESGKDWFVLKGMQ
FT                   GSDIVVLSAVKGVSGLSLAIGEKSRYSRTLNSVLRRLIGEYVIINRLSHPMSGRLCSVG
FT                   VDYIVLEASEQREWAHGYSCRINKRNPTTDLYMPLWQVQTVSDGA"
FT   gene            complement(374845..375057)
FT                   /locus_tag="Arch_0315"
FT   CDS_pept        complement(374845..375057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0315"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="InterPro IPR000551:IPR010093:IPR009061; KEGG:
FT                   jde:Jden_1818 DNA binding domain protein, excisionase
FT                   family; PFAM: regulatory protein MerR; SPTR: D0WRN3 DNA
FT                   binding domain, excisionase family protein; TIGRFAM: DNA
FT                   binding domain protein, excisionase family; TIGRFAM: DNA
FT                   binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92073"
FT                   /db_xref="GOA:D7BMC4"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMC4"
FT                   /protein_id="ADH92073.1"
FT                   /translation="MQKFLTIADVAESLCVSAGQVRTLIKNGEIPAIQVGGRGQWRISE
FT                   TALDDYIQSGYEKTRQKISAGEFDD"
FT   gene            375167..375751
FT                   /locus_tag="Arch_0316"
FT   CDS_pept        375167..375751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0316"
FT                   /product="SAF domain protein"
FT                   /note="InterPro IPR013974; KEGG: bfa:Bfae_20550 SAF
FT                   domain-containing protein; PFAM: SAF domain protein; SPTR:
FT                   C7ME55 SAF domain-containing protein; PFAM: SAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92074"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMC5"
FT                   /protein_id="ADH92074.1"
FT                   /translation="MVSFAKLIRKARDPRLLLGMVLVIGGGTAGALLMSEPDSVLVPQA
FT                   TTDVAAGDTLDKNNFTLVQMPRDIAHSYVHGLDFAPGSITQRSLSAGEFLPENAVGKKN
FT                   VGIDIAVPVAVPQSSALKPGTTINVWRVPRDKDAHSEIIARDAIFVGVEERKVIADGKK
FT                   FVNIRVNSGGVANIVEALGRGDGFVVVGSGS"
FT   sig_peptide     375167..375319
FT                   /locus_tag="Arch_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            375748..376938
FT                   /locus_tag="Arch_0317"
FT   CDS_pept        375748..376938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0317"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_1258 ATPase involved in chromosome
FT                   partitioning; SPTR: C2BSE5 ATPase involved in chromosome
FT                   partitioning family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92075"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMC6"
FT                   /protein_id="ADH92075.1"
FT                   /translation="MSAITCLPSRLDTDVISELTHTGDASLVVRRCADMAEVLAAARAR
FT                   IASVAIIAEDVDFLDVTLLSDLRQYLAVAIVVGTGSTRSIDVRSLGSVEVFSPHAADIA
FT                   NRIRASVGSHEYVPSFLDDDADRDVSKGAFVAFWGPFGSHGRSCLVRDSAAILSKEHDV
FT                   IVVDADSMAPSLAQVFDVDESSDLIGLARMIDQGRKIELELCVTRPVSSFGNVRLVTGM
FT                   NTGQRWREVSRPVADRLWPLLSSGSDLVLADVTGGMDERAERVDRWALSRSAMDSADAL
FT                   IHVASATPSGLRRLIEHFDELRDREPGRDAIVLTGVRSSALGVGLLAQARDVLDTVGIG
FT                   DVPVFGVREERSILDKALIDAQAVPYARPKCGYTKDVGRICEWIKDRMRVCASISH"
FT   gene            376917..377366
FT                   /locus_tag="Arch_0318"
FT   CDS_pept        376917..377366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0318"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_1260 hypothetical protein; SPTR:
FT                   C5C1Q2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92076"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMC7"
FT                   /protein_id="ADH92076.1"
FT                   /translation="MRIYIPLILSDLAAEQIDVRRVHAVTPALCAAVPDEDAEGYEYMA
FT                   TLAAADDSLRLIGQNPDTERRRVVAVAEVPDTAVAVAVDAQLPTEMDLFSQVRWKNVES
FT                   FHIDLPGSEDLVERAIAGDEDAFMATGDIELLWFDITERLRLTDH"
FT   gene            complement(377352..380411)
FT                   /locus_tag="Arch_0319"
FT   CDS_pept        complement(377352..380411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0319"
FT                   /product="SMC domain protein"
FT                   /note="COGs: COG0419 ATPase involved in DNA repair;
FT                   InterPro IPR001412:IPR003395; KEGG: cms:CMS_2145 putative
FT                   nuclease; PFAM: SMC domain protein; SPTR: D0WRP2 Putative
FT                   nuclease sbcCD subunit C; TIGRFAM: DNA sulfur modification
FT                   protein DndD; exonuclease SbcC"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92077"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMC8"
FT                   /protein_id="ADH92077.1"
FT                   /translation="MLFRRLEIDSVGPFAGHHVIDLDSLTAGGLFLLEGPTGSGKSSLI
FT                   DAIVFALYGETAGAESDYSRIRSTYADPATPSRVELVFTVGAGTFKVTRTPRWNKPKRG
FT                   GGTTPVSEKATLIRLSEAAVEQELWDSGEVLATKSSDVGIELGSILPLSRAQFVQTVVL
FT                   PQGQFADFLRLKSEDRSQLLETLFNTRLYRDFATRLHRKMSDASQGVAEKRTAITHAVS
FT                   GWLGNSAVSELKDEFLELDSQLTEPDDSRLVDRVESCLSELHERHGVLSQQLAESASVL
FT                   QKAQAWSEEQHALADNLKRRSQLLLQKTECEAQAEDIDVVRQRVARHHQAVIPAERYSV
FT                   LLNLEKRLKKREEVTRSAFRALPESNFPTLGGLDPATCDITQTLTELHQAEEQLRESLT
FT                   YLRMMREREETTVIQEHELHKRQEELAESLKKLETIQERQDRIPEELVKQEAQQATAEK
FT                   HAQQLPAIDSEISTLTEKLARTTEHDALREHIHHAEISHAELVEANTNAHAHFVLINSR
FT                   WIASQAAILSAELEENQPCPVCGSAAHPAPAQPTDEHASKSDVEQAQEELNRVRVQLEQ
FT                   SSSNISALRARSAALLDQLGELTHESITSSLNALQDQKDEAQVAQSSLEKLRSTISALR
FT                   HEKEEAGSRYARLEAECQGLRERITEEEHAIATAREEVAKAQGDASSISALISATEENS
FT                   ATIARCSDALKAYEAAQADVIQAQATLSVALKDASLNLEEVQAATLKPSEAESLTASIQ
FT                   NFESAWARIHGQLESPELSALTGEETAHVDEADTAAKVAQETHSDLASQEAIMKEGIKV
FT                   ATASGKMISTAVTDWAHELQKIGPLVRLDQLAQAGKASRTNVSLQVWVLMRRFDMVIDR
FT                   ANAYLSRFSHGRYELIRSEARENERRTGLGLSIIDYDARGEGESEIRSTRSLSGGETFY
FT                   TALSLALGLTEVVQEENGGIRIDTLMIDEGFGTLSSEILDDVMSTLSELAKEGRKVGII
FT                   SHVDELKSRVPNQVRITPSKGKGSTLSVIS"
FT   gene            complement(380401..381588)
FT                   /locus_tag="Arch_0320"
FT   CDS_pept        complement(380401..381588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0320"
FT                   /product="nuclease SbcCD, D subunit"
FT                   /note="COGs: COG0420 DNA repair exonuclease; InterPro
FT                   IPR004843:IPR004593; KEGG: cmi:CMM_0677 putative dsDNA
FT                   exonuclease subunit; PFAM: metallophosphoesterase; SPTR:
FT                   D1BIQ6 Exodeoxyribonuclease I subunit D; TIGRFAM: nuclease
FT                   SbcCD, D subunit; PFAM: Calcineurin-like phosphoesterase;
FT                   Type 5 capsule protein repressor C terminal; TIGRFAM:
FT                   exonuclease SbcD"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92078"
FT                   /db_xref="GOA:D7BMC9"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMC9"
FT                   /protein_id="ADH92078.1"
FT                   /translation="MKFLHTSDWHFGRTLHGSDLTAAFEMWADHVVDLAVSHDLDAVLV
FT                   SGDVFDRGIPPVAMVKLLSTTLERLAGHTAVVLISGNHDAPTRLGFTSGLLRSGISIVS
FT                   DPRECGMPIEIMRDGELVGRVYALPYLDPDVDRVRLAEDPDKPLERSHEAVVGAALDLV
FT                   RRDITDRGTRVPHVIMAHEFVVGGEPSDSERDIHVGGVDSVPSGLFDLQGDSGSLIDYV
FT                   ALGHLHRPQKVCDRPLMRYAGSPIAFSFSEEHHHKSSVLVTIDEPGAIPAVEIIPAPVF
FT                   RPLVTLEGTMDELLSSTYAAYHNHFVRIIVTDVDRPERMLARLRVQFPHTLEARHNAPF
FT                   TQVEAHETSISKVNPVDILAEFFASSGGRELTPEEHDLITKEWDSFMMERKEDAL"
FT   gene            381713..383152
FT                   /locus_tag="Arch_0321"
FT   CDS_pept        381713..383152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0321"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cdi:DIP2121 hypothetical protein; SPTR: D0WPQ4
FT                   PAS/PAC domain protein; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92079"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMD0"
FT                   /protein_id="ADH92079.1"
FT                   /translation="MKPEPTGEIQEITPQELFFSTTDPKGVIKLSNEVFTRLSRYDAEQ
FT                   LRGAPHNIVRHPDMPASIFKLIWDTLEAGKPFAAYMLNLAGDGSEYDVFATITPLPNGG
FT                   YLSVRAKPMREETFAQIRAVYAKILSHEQNLIAGGMNRRQAAEAALPYVNQALAEAGIG
FT                   SYEDFQTEALPAETAKRETEENTFPHRAGESQLHEMLAAVRKEHETLDAWMKHQDDLVK
FT                   LGERLAAVVAHVRTDMDTVAAAAHEFTALGEGNPALHTALEPLFVWNRMQGVVGTYLTN
FT                   LIAKIDALESHIAHTRFRIALSRLHTNMCGVFIAELIDTGYDAKIGVPGLAPGFVTRDV
FT                   FAEADNETEEQREIRERLESLEMLSTVLTADVEALQEHAQTYRELAGDIAHYLDQVLHA
FT                   VAIPRQLLQLWQMSAADLNLPELNLSVDATVARSIDHAEVSLERLTAFQQELGNVSDVE
FT                   NYDALSQIVLEIHAKVLVMIG"
FT   gene            complement(383206..384024)
FT                   /locus_tag="Arch_0322"
FT   CDS_pept        complement(383206..384024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0322"
FT                   /product="CAMP factor family protein"
FT                   /note="InterPro IPR010860; KEGG: pac:PPA2108 cAMP factor;
FT                   PFAM: CAMP factor family protein; SPTR: D0YTE8 Camp3; PFAM:
FT                   CAMP factor (Cfa)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92080"
FT                   /db_xref="InterPro:IPR010860"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMD1"
FT                   /protein_id="ADH92080.1"
FT                   /translation="MLKPLASLALSISLIAPVMAGPVAETSSLNFNTSANVSVVSAHVT
FT                   PTEPAAPIGKTEAKEKAADVDTVIAEIKEIGATSRPDIKWGKEFEGLFKTLYELKDELI
FT                   AISTGNVPAFDTTTILSRAKLAAKIGQAINTGATTLRDKVQAAHVKIGFAVTRSIIRLT
FT                   NLSSTEAQLNESTEELGNILTEVADYPDLTPEDNATIYVRNELTQKIWKTRWNRDTNIL
FT                   RKKSFATYNKLNRNITKAVGIELGPRSTVKQVREAVTALDNAYKEALAGK"
FT   sig_peptide     complement(383899..384024)
FT                   /locus_tag="Arch_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(384404..384808)
FT                   /locus_tag="Arch_0323"
FT   CDS_pept        complement(384404..384808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0323"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kse:Ksed_18100 hypothetical protein; SPTR:
FT                   C7NJC7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92081"
FT                   /db_xref="GOA:D7BMD2"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMD2"
FT                   /protein_id="ADH92081.1"
FT                   /translation="MQQPFAFTIQAFIFTAFLTITIFGNPLIRYFLNRIHILPQETPPT
FT                   SDQNSKTEVFKGGRWIGILERVAIYACIIFSFPSGIAMVLAIKGLGRYPELHNEKHHHV
FT                   GELFIIGTFTSALWALTWAGIAHTLIAFID"
FT   gene            384926..385558
FT                   /locus_tag="Arch_0324"
FT   CDS_pept        384926..385558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP0512c hypothetical protein; SPTR:
FT                   Q743S9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92082"
FT                   /db_xref="InterPro:IPR032580"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMD3"
FT                   /protein_id="ADH92082.1"
FT                   /translation="MVEKYIAVIGDMVDSRGVNRVSSHHALTDSLARVDAGSVQSLHPT
FT                   VGDEIQGVFATIGDAFRAMHQCRIELMIRGADIRWGIGYGEIVTIDPKLDIQDGSGWWN
FT                   AREALNQLVSVEEKAGWSNIRTYFYTEEKERSSFGQWILPLSHMIDVHMTRLNPSTSTT
FT                   LRGVLRGDSNQQVARRLKISPAANSMRVNDNDLRPLAAAMKSLWELP"
FT   gene            386417..386737
FT                   /pseudo
FT                   /locus_tag="Arch_0325"
FT   gene            complement(386808..387836)
FT                   /locus_tag="Arch_0326"
FT   CDS_pept        complement(386808..387836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0326"
FT                   /product="GTPase EngC"
FT                   /note="COGs: COG1162 GTPase; InterPro IPR010914:IPR004881;
FT                   KEGG: jde:Jden_1813 GTPase EngC; PFAM: GTPase EngC; SPTR:
FT                   C0W8L7 Possible GTP-binding protein; PFAM: Protein of
FT                   unknown function, DUF258; TIGRFAM: ribosome small
FT                   subunit-dependent GTPase A"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92083"
FT                   /db_xref="GOA:D7BMD4"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMD4"
FT                   /protein_id="ADH92083.1"
FT                   /translation="MSRRDIGTDDHRVKVRPGKRSRPRTKIRPDYSDARRGRVFRVDRG
FT                   RYHVRMVDDSCEVIAVKARELGRRGIVVGDLCAMVGDLSGRKDTLARIAHVDERETVLR
FT                   RVGEEGEAAGNERVIVANADQLVIVTALAQPEPRTGMIDRCVVAAYDAGMDVVLVLTKA
FT                   DLASPDALRAMYELMGLDVIVTQVLGDDADSDAGLAQLREKLSGRVSVLVGHSGVGKST
FT                   LINALIPEASRETGHVNEVTGRGRHTSTSAMAFDYAGGGTVIDTPGVRTFGLAHVTPDG
FT                   LLRGFPDLEDISDECPRGCNHEDGVIDCALDDPELVTPDSVLAARVDSFRRLLASRAKQ
FT                   EW"
FT   gene            complement(387833..389218)
FT                   /locus_tag="Arch_0327"
FT   CDS_pept        complement(387833..389218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0327"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="COGs: COG0128 5-enolpyruvylshikimate-3-phosphate
FT                   synthase; InterPro IPR001986:IPR006264:IPR013792:IPR016228;
FT                   KEGG: bfa:Bfae_19470 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); PRIAM:
FT                   3-phosphoshikimate 1-carboxyvinyltransferase; SPTR: C7MDV5
FT                   3-phosphoshikimate 1-carboxyvinyltransferase; TIGRFAM:
FT                   3-phosphoshikimate 1-carboxyvinyltransferase; PFAM: EPSP
FT                   synthase (3-phosphoshikimate 1-carboxyvinyltransferase);
FT                   TIGRFAM: 3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92084"
FT                   /db_xref="GOA:D7BMD5"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMD5"
FT                   /protein_id="ADH92084.1"
FT                   /translation="MEPGDSWWNAPYLPRTEKIHGNVRIPGSKSLTARWLVLAAIGLNP
FT                   VRLAGALDSEDTRAMGNALVALGAGIEWHKNWCHVTPIPRDTNGVITVRGGAYINAGQA
FT                   GTVMRFILPLAAMAHGDVTVTCADNARHRPIAGLLSALTQLGVNYTCARDVAEGTGGGF
FT                   PLTIHGRGPLRGGEVSVDAAASSQFVSALLLAGPLMERGITVRNCADTLPSTPHISMTI
FT                   DTLRKAGINAAGTGETWHVPHGSPNRKHITIEPDLSNAGPFLAAALVTGGRVRIENWPK
FT                   KSQQPGMAYLDIFRNAGATFTWETNGPLTHLICQGHRTIWATHKDMGDLGELVPTVAAV
FT                   LAFSDGVSGLSNIGHLRGHETDRIAALTETLSAIGTQPEYDPHSETLWLRRFDARYTTT
FT                   DIDSHADHRIATFGAILGLRIKGLRVANMEATAKTFPTFIELWERLVADSRSYWARKRK
FT                   ENT"
FT   gene            complement(389218..389730)
FT                   /locus_tag="Arch_0328"
FT   CDS_pept        complement(389218..389730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0328"
FT                   /product="DoxX family protein"
FT                   /note="KEGG: bcv:Bcav_1264 DoxX family protein; SPTR:
FT                   D0WRQ0 DoxX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92085"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMD6"
FT                   /protein_id="ADH92085.1"
FT                   /translation="MTLVNKLARPLLAAPFIATGLDALTKPEGHREPARKLWALAQKFG
FT                   IDEKLGISEPTDATLDLVTRASGAVVTLAGAQLARSRAPRSAALILGLTQIPLALANNP
FT                   VWEKKPYAARKKDVSGLLAAAGLIGGALIASTDRSGKPSLGWRAARLGEKAVGGAQQRI
FT                   EQITPGR"
FT   gene            complement(389798..390601)
FT                   /locus_tag="Arch_0329"
FT   CDS_pept        complement(389798..390601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0329"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="COGs: COG2186 Transcriptional regulators; InterPro
FT                   IPR011991:IPR000524:IPR011711; KEGG: bcv:Bcav_3776
FT                   regulatory protein GntR HTH; PFAM: regulatory protein GntR
FT                   HTH; GntR domain protein; SMART: regulatory protein GntR
FT                   HTH; SPTR: D0WKM6 Transcriptional regulator, GntR family;
FT                   PFAM: Bacterial regulatory proteins, gntR family; FCD
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92086"
FT                   /db_xref="GOA:D7BMD7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMD7"
FT                   /protein_id="ADH92086.1"
FT                   /translation="MNNAQHNLVFVTIKPMLSDKSMQAILGKYGSAQTADSPQIGTVMR
FT                   STATMDAIKGYILNHNLKPGDPLPTEAELCADLGVSRSSVREAFRQLTALDIVTVHQGR
FT                   GSFVGSMSLEPLVQTLILRNALDQSSGKASLRQVVSTRQVLDLGIAEDVVRQFSGTHNP
FT                   KLHALVATMVERAKAGKTYLDEDIAFHEALTEFAGDSLISQLISAMWLVHQAFIPSLET
FT                   PAADELIATAKAHQAMLEAAEAGDIDAYKAAVCSHYGPLAKIIDL"
FT   gene            390649..391566
FT                   /locus_tag="Arch_0330"
FT   CDS_pept        390649..391566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0330"
FT                   /product="ROK family protein"
FT                   /note="COGs: COG1940 Transcriptional regulator/sugar
FT                   kinase; InterPro IPR000600; KEGG: bln:Blon_0644 ROK family
FT                   protein; PFAM: ROK family protein; SPTR: A7BBZ4 Putative
FT                   uncharacterized protein; PFAM: ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92087"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMD8"
FT                   /protein_id="ADH92087.1"
FT                   /translation="MVLLSLDIGGTKVGWAIITGEPGELSVSERGSIPTQAFDGGPRVA
FT                   QRICDLVAELDRVEIDGVAVASAGVVDPTTGAIVSATGTMPGWGGTPLGDLLRETTGKP
FT                   VWAINDVHAHGLGEAVLGAGRGFRSVMACAVGTGIGGAHIVDGQIVFGDHYLAGHFGHI
FT                   HHHFAAGQPCSCGREGHIEAICSGSGITSWFNSRSTDLTVANGRELQELAESGNELAAL
FT                   TFTQSAYALGEVLGSLANSIDPSVVVLSGSMTRSGENWWNEVRRGYRASAMDFVANVDL
FT                   RNGELGSDAPLFGAALYYYSRENN"
FT   gene            391566..392249
FT                   /locus_tag="Arch_0331"
FT   CDS_pept        391566..392249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0331"
FT                   /product="N-acylglucosamine-6-phosphate 2-epimerase"
FT                   /EC_number="5.1.3.9"
FT                   /note="COGs: COG3010 Putative
FT                   N-acetylmannosamine-6-phosphate epimerase; InterPro
FT                   IPR013785:IPR007260:IPR011060; KEGG: bln:Blon_2402
FT                   N-acetylmannosamine-6-phosphate 2-epimerase; PFAM: putative
FT                   N-acetylmannosamine-6-phosphate epimerase; PRIAM:
FT                   N-acylglucosamine-6-phosphate 2-epimerase; SPTR: A7BBZ5
FT                   Putative uncharacterized protein; PFAM: Putative
FT                   N-acetylmannosamine-6-phosphate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92088"
FT                   /db_xref="GOA:D7BMD9"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMD9"
FT                   /protein_id="ADH92088.1"
FT                   /translation="MNHLIESLRGTVIVSVQAYPGEPMRHPETMAQMARAAEIGGTSAI
FT                   RCQGLADISAIKGRVKIPVIGLWKEGDEGVYITPTLRHARACSMAGADIVAIDATGRPR
FT                   PDGLTYGQTVAELKKDGILVMADCGSFDDAQRAVDAGTDIISTTLSGYTGDRPKTPGPD
FT                   FELLAQMLDAFPDVPVICEGRVHTPQHAQQVLEAGAFAAVVGTGITHPTSITSWFVDAA
FT                   AKAHK"
FT   gene            392292..393068
FT                   /locus_tag="Arch_0332"
FT   CDS_pept        392292..393068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0332"
FT                   /product="glucosamine/galactosamine-6-phosphate isomerase"
FT                   /EC_number="3.5.99.6"
FT                   /note="COGs: COG0363
FT                   6-phosphogluconolactonase/Glucosamine-6-phosphate
FT                   isomerase/deaminase; InterPro IPR018321:IPR006148; KEGG:
FT                   xce:Xcel_1049 glucosamine-6-phosphate isomerase; PFAM:
FT                   glucosamine/galactosamine-6-phosphate isomerase; SPTR:
FT                   D0WNV6 Glucosamine-6-phosphate deaminase; PFAM:
FT                   Glucosamine-6-phosphate
FT                   isomerases/6-phosphogluconolactonase; TIGRFAM:
FT                   glucosamine-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92089"
FT                   /db_xref="GOA:D7BME0"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D7BME0"
FT                   /protein_id="ADH92089.1"
FT                   /translation="MYVGIFKDEETLAKAAADYLITKLNESDRKVVGVATGSTPLPLYK
FT                   ELRDAHAAGTFSLEGFKAFALDEYIGIDENHPERYRNVLRAELVGDERTGLREEDLNTP
FT                   NGSAEDPYEAARAYDRSIKDSGGIVVQILGIGSDGHIGFNEPSGALTSRTHVEALTART
FT                   REDNARFFDDDLAKVPSQCITQGLGTIMECGCPLLIATGAGKADAVRELVEGGVSAKWP
FT                   ATILQMHQETVVFLDEAAASKLELKDYYVERWESLR"
FT   gene            393065..394225
FT                   /locus_tag="Arch_0333"
FT   CDS_pept        393065..394225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0333"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="COGs: COG1820 N-acetylglucosamine-6-phosphate
FT                   deacetylase; InterPro IPR006680; KEGG: xce:Xcel_2442
FT                   N-acetylglucosamine-6-phosphate deacetylase; PFAM:
FT                   amidohydrolase; PRIAM: N-acetylglucosamine-6-phosphate
FT                   deacetylase; SPTR: D0WNV7 N-acetylglucosamine-6-phosphate
FT                   deacetylase; PFAM: Amidohydrolase family; TIGRFAM:
FT                   N-acetylglucosamine-6-phosphate deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92090"
FT                   /db_xref="GOA:D7BME1"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7BME1"
FT                   /protein_id="ADH92090.1"
FT                   /translation="MSTYTGKVLNGFGELVGSGLEVDGSGVVVNILPVTETLPEGWITP
FT                   GLIDIHNHGGGGASFPDDTTPEGTATAVEAHRCMGTTALVASTVSLIDPLPAIRNLVLA
FT                   CESGDLIGIHLEGPYISKHKCGAQNPAAIRNPDLDELRSWLEAGKGWIKTMTIAPEVEN
FT                   AYGAACMLLDHGALPSWGHTSGTSATARDLIERTTEYGRSIGIDVPQTATHLFNAMPTL
FT                   AHREPGPVRELIKAATRGDAVVELVADTVHVNADLVGDVVAVIENSGQKAGVAWVTDAM
FT                   AGAGMADGDYVLGSQAVTIEGGVARLTEGGAIAGGTSRLAEQIARMVGGGHTTMESAVR
FT                   CCVAGPAHALGLDGSEAGVTLDFVVGQKANFVVFTEDLAMETFQRV"
FT   gene            394358..394963
FT                   /locus_tag="Arch_0334"
FT   CDS_pept        394358..394963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0334"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="COGs: COG1595 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24 homolog;
FT                   InterProIPR000838:IPR007627:IPR013249:IPR014293:IPR
FT                   014284:IPR013325:IPR013324; KEGG: bcv:Bcav_1265 RNA
FT                   polymerase, sigma-24 subunit, ECF subfamily; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; SPTR:
FT                   D0WRQ2 RNA polymerase sigma-70 factor; TIGRFAM: RNA
FT                   polymerase sigma-70 factor; RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70, region 4; Sigma-70 region
FT                   2; TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
FT                   RNA polymerase sigma-70 factor, TIGR02947 family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92091"
FT                   /db_xref="GOA:D7BME2"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014293"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D7BME2"
FT                   /protein_id="ADH92091.1"
FT                   /translation="MEIDQRPAHEPEQLSQQFEELALPLLDQLYGAALRLTRNPQDAED
FT                   LVQETYAKAFAAFHQFTPGTNVKAWLYRILNNAFISNYRKAQRRPKEAESDQVEDWQEY
FT                   SAASHDSRGLVSAEAEALENLPDSEIKDALDQLSDDRRTVVYLADVEGFSYQEIADIVG
FT                   VPIGTVMSRLHRGRTQLREILRDYALQLGYKVKQKAGE"
FT   gene            394965..395246
FT                   /locus_tag="Arch_0335"
FT   CDS_pept        394965..395246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0335"
FT                   /product="anti-sigma factor"
FT                   /note="InterPro IPR014295; KEGG: cdi:DIP0710 putative anti
FT                   sigma factor; SPTR: D0WRQ3 Anti-sigma factor RshA; TIGRFAM:
FT                   anti-sigma factor; TIGRFAM: anti-sigma factor, TIGR02949
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92092"
FT                   /db_xref="UniProtKB/TrEMBL:D7BME3"
FT                   /protein_id="ADH92092.1"
FT                   /translation="MKRFEDLLKRLDECHCADSGCDCSEVMEHLFELVDEHMPSHQAQR
FT                   LLEHSAGCEHCADMIRAEVNVRVVLRKSCCGDVASEDLRARIIRVIER"
FT   gene            complement(395716..395931)
FT                   /locus_tag="Arch_0336"
FT   CDS_pept        complement(395716..395931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0336"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG4877 conserved hypothetical protein; KEGG:
FT                   ami:Amir_1210 hypothetical protein; SPTR: C6WRB0 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92093"
FT                   /db_xref="GOA:D7BME4"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D7BME4"
FT                   /protein_id="ADH92093.1"
FT                   /translation="MAERKAISLRLDPAVHDAIARWAADDLRSVNAQIEVILRDGLRRA
FT                   GRLSNNTGELPKRGRPRKDAAKSNDA"
FT   gene            complement(395936..396901)
FT                   /locus_tag="Arch_0337"
FT   CDS_pept        complement(395936..396901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0337"
FT                   /product="band 7 protein"
FT                   /note="COGs: COG0330 Membrane protease subunits
FT                   stomatin/prohibitin homologs; InterPro IPR001107; KEGG:
FT                   cgb:cg3138 membrane protease subunit
FT                   stomatin/prohibitin-like protein; PFAM: band 7 protein;
FT                   SMART: band 7 protein; SPTR: Q8NLV0 Membrane protease
FT                   subunits, stomatin/prohibitin homologs; PFAM: SPFH domain /
FT                   Band 7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92094"
FT                   /db_xref="GOA:D7BME5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D7BME5"
FT                   /protein_id="ADH92094.1"
FT                   /translation="MNTTATVTVSEDPVGHSGIRVDVKEKEAWTLGSGGAATLALLSLA
FT                   FIALSAWGIISGAIAQDNHTDTVASNIVLLVSCVALVVVTFASTGFTVISPGESRTVQF
FT                   FGTYKGTIRATGFNYTIPFSTRTKISVRVRNFETNETKVNDYSGNPINIAAIVVWQVAD
FT                   TAKAKFSVEDYENFIKSQSESALRHIATQHPYDFPVDGRSSLRGSTEDISVELANEVAD
FT                   RVSVAGLEIVETRISSLSYAPEIAQAMLQRQQAAAIVDARETIVDGAVSMVQMALDELE
FT                   RKEIVDLDPERRAAMVSNLLVVLCSDGQTQPVINAGGLYQ"
FT   gene            complement(396980..398221)
FT                   /locus_tag="Arch_0338"
FT   CDS_pept        complement(396980..398221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0338"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbb:CLD_3775 hypothetical protein; SPTR:
FT                   C0W061 Membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92095"
FT                   /db_xref="GOA:D7BME6"
FT                   /db_xref="UniProtKB/TrEMBL:D7BME6"
FT                   /protein_id="ADH92095.1"
FT                   /translation="MSSLFLWEIGTPAVYLFWVIVLIAQIAIAEINRRWNWTIFALWTI
FT                   GGIAVMPYVIAHGVPMVGWFPFGKFVIMIATATMTGYLLVLGKRHPDKARKYALWMGVA
FT                   LWLGLAINIMEANIRDITIFFEADTYYACGADPQCLQAINDARTIDVLNGLPESRGISA
FT                   PLHSAEWYQALAANFEANHIGIDPATGFRTIGGYWNLLSAAAGLLNIITITGLGKIFVT
FT                   SESKAVKANGKKQVRGLIWVDMVWPWVIAYDLWNHAFLYNALADYTWYCTLALLLACTI
FT                   PAFTWAKGQWIWFRCFTLMFWIAANNLLPELLVKPSEMTNFATMNPVANIVCAWAALIF
FT                   NLGLFVYWLYKIVAKKRHPLTGCLYFELSEFRTIVRQHADRETATWLTREIPETPEQLG
FT                   FIDRQSGKHSPRNQ"
FT   sig_peptide     complement(398135..398221)
FT                   /locus_tag="Arch_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            398383..399408
FT                   /locus_tag="Arch_0339"
FT   CDS_pept        398383..399408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0339"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pac:PPA1037 hypothetical protein; SPTR: C0W060
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92096"
FT                   /db_xref="UniProtKB/TrEMBL:D7BME7"
FT                   /protein_id="ADH92096.1"
FT                   /translation="MKKSTLLKLGGTAAVAGLSGLVAFSQFSGKATKEEQEWVYPADDL
FT                   IDANYKNGYSSTYAIDIDAPAYAVYRIFKQIGCDKSGSFSSEFLERTFARLPFFNSYEI
FT                   QEEFQQPDSMMPGDVAAFDYHGMSMEWADVVPGKYLVQWVDTKNPPAAPGAYAFRFPFM
FT                   KHFAAAWCFYFVPLKGERCRLINHWRIGFEPDNKVISTINWLNIELIGGVMTHLQNLYV
FT                   KRTVEFKKKQQHSGKIMRGLLGGRWFKTGTPAGRWDDTPLFEETFTQWMRFGRQNPAVK
FT                   EIREPVTDNPNWPPTGPGTPWADTVDEDYFTDWEEPEFSWDEQIRQKREKTYLKGWGKK
FT                   K"
FT   sig_peptide     398383..398457
FT                   /locus_tag="Arch_0339"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(399490..400569)
FT                   /locus_tag="Arch_0340"
FT   CDS_pept        complement(399490..400569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbt:CLH_1579 hypothetical protein; SPTR:
FT                   D0YSP8 Membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92097"
FT                   /db_xref="GOA:D7BME8"
FT                   /db_xref="UniProtKB/TrEMBL:D7BME8"
FT                   /protein_id="ADH92097.1"
FT                   /translation="MILMTLTSTPTVDYPVLFAFETGEWWDYVMLIVVTAALAITAWLA
FT                   QRNKWVVLAVFVIAPVLLTIFWWPYSTQGTGSAGWFPIVKQYSALAGSLCLVALQYSQK
FT                   LRRNQWYLLIPPAILAINILEAVIRDFQCASIHNLHPETGLATWGGPWNYMNGIAGILN
FT                   LLAISGWVGIFVANNKSKAIMWGDLTLGWIIAYDLWNFAYVYNCLSDRAWYSGVALLAS
FT                   CTIPALFPRLRGSWIQFRAYTLTLWSAVVLTFPHFMHDSMFAHRSAHNTTALFLFSFLA
FT                   LVVNIVVFGYHIYRISVLKRNPFKVEVYSDTPEYVRMVRKNASNEDKDLIAARLDTTPE
FT                   RLGYRKAVKRRRGMRPKKG"
FT   gene            complement(400661..401065)
FT                   /locus_tag="Arch_0341"
FT   CDS_pept        complement(400661..401065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0341"
FT                   /product="PilT protein domain protein"
FT                   /note="InterPro IPR002716; KEGG: afo:Afer_1620 PilT protein
FT                   domain protein; PFAM: PilT protein domain protein; SPTR:
FT                   C7M0N1 PilT protein domain protein; PFAM: PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92098"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D7BME9"
FT                   /protein_id="ADH92098.1"
FT                   /translation="MIYLDTSAAAKLFLPESGTERVKGYLRSGETIVSSTLLRTELIRT
FT                   LVRSLDSVVEHTLIPDYVDALLPAITLISVSDPILSQSEGILGHSKTLDALHIATALSV
FT                   NSSGDPVKILTFDKNFAACAKRCGFDVLET"
FT   gene            complement(401062..401373)
FT                   /locus_tag="Arch_0342"
FT   CDS_pept        complement(401062..401373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0342"
FT                   /product="prevent-host-death family protein"
FT                   /note="InterPro IPR006442; KEGG: mbt:JTY_1986 hypothetical
FT                   protein, antitoxin; SPTR: C0U553 Prevent-host-death family
FT                   protein; TIGRFAM: prevent-host-death family protein; PFAM:
FT                   Phd_YefM; TIGRFAM: prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92099"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMF0"
FT                   /protein_id="ADH92099.1"
FT                   /translation="MLITEQDTAHYVSLRELNQQSGRVMARVRDSQQEVIVTDRGKPIA
FT                   TIVPIQAEVSPLARLIAEGNALPASQSISSIDIDSLVITTQSNHSLDDVIQKDRDDRL"
FT   gene            complement(401443..402090)
FT                   /locus_tag="Arch_0343"
FT   CDS_pept        complement(401443..402090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0343"
FT                   /product="acyl-CoA thioesterase I precursor"
FT                   /note="InterPro IPR013831:IPR013830; KEGG: xce:Xcel_2490
FT                   acyl-CoA thioesterase I precursor; SPTR: D0WRR1 Putative
FT                   lipolytic enzyme, G-D-S-L"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92100"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMF1"
FT                   /protein_id="ADH92100.1"
FT                   /translation="MIDTLIVEELGMSNIETEHPTRIFFIGDELVAGFGDARAMGWTGR
FT                   VMARTACEPPLMHLTLATPGEGTEALASRWENDIVPRLDRDAENRLVIGLGSHDLESSL
FT                   SLARSRLYVANILDNAMSMGLAPFVVGPPPRNDQPLRNQNDLSQAYEQACTRRNIPYVD
FT                   CFTPLYNHEQWATDMSMNASYTPRQAGYGLMAWLVLHKGWHDWLGITQPDVM"
FT   gene            complement(402178..402273)
FT                   /pseudo
FT                   /locus_tag="Arch_0344"
FT   gene            complement(402260..402380)
FT                   /pseudo
FT                   /locus_tag="Arch_0345"
FT   gene            complement(402592..406308)
FT                   /locus_tag="Arch_0346"
FT   CDS_pept        complement(402592..406308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0346"
FT                   /product="2-oxoglutarate dehydrogenase, E1 subunit"
FT                   /note="COGs: COG0567 2-oxoglutarate dehydrogenase complex
FT                   dehydrogenase (E1); InterPro
FT                   IPR001078:IPR001017:IPR005475:IPR011603; KEGG:
FT                   bcv:Bcav_1274 2-oxoglutarate dehydrogenase, E1 subunit;
FT                   PFAM: Transketolase central region; dehydrogenase E1
FT                   component; catalytic domain of components of various
FT                   dehydrogenase complexes; SPTR: D0WRR3 Oxoglutarate
FT                   dehydrogenase (Succinyl-transferring), E1 component;
FT                   TIGRFAM: 2-oxoglutarate dehydrogenase, E1 subunit; PFAM:
FT                   2-oxoacid dehydrogenases acyltransferase (catalytic
FT                   domain); Dehydrogenase E1 component; Transketolase,
FT                   pyrimidine binding domain; TIGRFAM: 2-oxoglutarate
FT                   dehydrogenase, E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92101"
FT                   /db_xref="GOA:D7BMF2"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMF2"
FT                   /protein_id="ADH92101.1"
FT                   /translation="MASSQSEEFGANQGFIEDLYSSFLQNPQSVGPQWHEMFHAWQAEG
FT                   REAPSSSLSPSEETQEAQRTVHSSHSREATPATNVTRSDLPPQPRSAAQPAVTPYAKKF
FT                   DLKPKFDDIFTKSDTEYVQLKGAERGLAKNMDSSLELPTATSVRALPARVMFDNRTVIN
FT                   KYLATTRGGKISFTHLIAYAMVEALSEMPEMNYSYQVSDAGKPTLVKPSAVNLGIAIDV
FT                   AKPNGERTLVVPSIKNAEHMTFSEFLAAYENLVKRGREGALTIEDYQGTTASLTNPGGL
FT                   GTTHSIPRLMKGQGLIVGVGSMVYPPAFAGTAEAQLARMSVSKVVHVTSTYDHRVIQGA
FT                   TSGRFLRLMEHKLLGLDGFYERIYIALHVPYKPFVWETDVEYDAERELGKPARIAELIH
FT                   AYRSRGHLIADTDPLSFHIRRHPDLEIGSYGLTLWDLDRSFPTGGFAHSSHLTLREILD
FT                   QLRESYCRTVGIEYMHIQDPVQRRWFQERIEKPAEPATIDQRRRILTKLNEAEAFETFL
FT                   QTKYVGQKRFSLEGGESLIPALDSILEGAAESGLSDVAIGMAHRGRLNVLTNIAGKSYG
FT                   QVFNEFDGRIDPSSVQGSGDVKYHLGTEGVYTSPKGDKVGVYLAANPSHLEAADGVLEG
FT                   IVRGKHDLIGTDGTFYPVLPILIHGDAALSGQGVVWEVFNLSQLPAYKNGGTIHIVVNN
FT                   QIGFTTSPSSGRSSRYTTDIAKGLQIPIFHVNGDDPEAVARMARMAQEFREAFHKDVIV
FT                   DISCYRRRGHNEGDDPSMTQPVMYSLVDSKRTTRHIYAEALIGRGDMTAEDVAELESAY
FT                   HDTLNEALNSVRASEQTRTESEEQASRSLGKPQSQEDDAGAMIGWQTAVSPDVVARIGA
FT                   AHVQVPDGFTPHKKIMQLFNKRNTMCSEGKIDWGFGELLAFGSLLIEGVPVRMSGQDVR
FT                   RGTFVQRHATVHGEGTGTEWTPLQHLTEDQAPLAIYDSALSEYSVMAFEYGYSVERPDA
FT                   LVVWEAQFGDFANGAQTVVDEFISSAEQKWNQRSSVVLMLPHGYEGQGPDHSSARIERY
FT                   LQLCAENNMIVAQPSTPANHFHMLRRQAYQRPRKPLIAITPKQLLRRKGATSAVEEFTS
FT                   GTFQPVIGEHRTDLNVTRVIMCTGRLYYDLVERRDQNNDTSVAIIRLEQLYPNPVAELK
FT                   AELDKYPNAELLWVQDEPANQGAWPHLALEMFMPMGLQVRRVSRPAAASTATGLGKIHQ
FT                   AQAQTLLNEAFAR"
FT   gene            406501..407805
FT                   /locus_tag="Arch_0347"
FT   CDS_pept        406501..407805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0347"
FT                   /product="protein of unknown function DUF21"
FT                   /note="COGs: COG1253 Hemolysins and related protein
FT                   containing CBS domains; InterPro
FT                   IPR000644:IPR002550:IPR005170; KEGG: xce:Xcel_2484 protein
FT                   of unknown function DUF21; PFAM: protein of unknown
FT                   function DUF21; CBS domain containing protein;
FT                   transporter-associated region; SPTR: C0W8N2 HCC family
FT                   HlyC/CorC transporter; PFAM: CBS domain; Domain of unknown
FT                   function DUF21; Transporter associated domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92102"
FT                   /db_xref="GOA:D7BMF3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMF3"
FT                   /protein_id="ADH92102.1"
FT                   /translation="MMGLGVLLTLGTAIFVAAEFSLVALDPATVDSKAEAGDVRAKKVT
FT                   KALHHLSLQLSSCQVGITITTILLGYVAQAPLQDLFVKLLGRTDLAYTAVLATGVIGAF
FT                   IVVNLFSMVFGELVPKNMALAEPLRTASLVSLPLRAFTAVFKPVIVGLNNSANWILHRF
FT                   GVEVAEELSGARSATELSALVRRSAEQGTLDVSTARLLTRSIDIGALTAVDVMTDRGRV
FT                   RHLHADQTAADIIDLARSTGHSRFPVIGEDMDDIRGIVNLRRAIAVPFERRGEVIVTSS
FT                   SLMIPVPRVPETLELAPLLVRLRASGSQVAVVVDEYGGVSGIVTLEDVIEEIVGDVADE
FT                   HDRRRARSRVLATGETIVPGLMRPDEISREFHIEVPDDGPWETLGGWIMAGLGKIPDVG
FT                   DEYTEDGITARVEKMDGRRVETVRLTVNIEQEENE"
FT   sig_peptide     406501..406602
FT                   /locus_tag="Arch_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            407802..408833
FT                   /locus_tag="Arch_0348"
FT   CDS_pept        407802..408833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0348"
FT                   /product="protein of unknown function DUF21"
FT                   /note="COGs: COG1253 Hemolysins and related protein
FT                   containing CBS domains; InterPro IPR000644:IPR002550; KEGG:
FT                   xce:Xcel_2483 protein of unknown function DUF21; PFAM:
FT                   protein of unknown function DUF21; CBS domain containing
FT                   protein; SMART: CBS domain containing protein; SPTR: D1BCR2
FT                   CBS domain-containing protein; PFAM: CBS domain; Domain of
FT                   unknown function DUF21"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92103"
FT                   /db_xref="GOA:D7BMF4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMF4"
FT                   /protein_id="ADH92103.1"
FT                   /translation="MNLGPAIAVTIGLLAINAYFVGAEFAIMGSRRSRIEPLADNGKKS
FT                   ARTVLYALEHVTLMLATCQLGVTIASVALGAVAEPAIAHTLEGPLGKLGVPSSMLHPIA
FT                   ILIALAIVVYAHVVIGEMVPKNLAVTNPESAALVLGPPLVIISKIFYPVVASMNWVANH
FT                   VIRIFGLEPKNEVASAFTADEVASIVEVSKAAGVLDADVGLISSAIEFSEHTARDLMVG
FT                   EADLETVSDSLTPQELEDRVAHTGYSRFPVVASNGVLIGYVHVKDILDIAPEHREDPIP
FT                   GWKIRRLVTVEPGDEIETAMRVMQKAGAHMAEVNLKDGSQGVIFLEDVLEELIGEVRDA
FT                   MQR"
FT   gene            408925..409938
FT                   /locus_tag="Arch_0349"
FT   CDS_pept        408925..409938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0349"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG0739 Membrane protein related to
FT                   metalloendopeptidase; InterPro IPR016047:IPR011055; KEGG:
FT                   mlu:Mlut_00220 metalloendopeptidase-like membrane protein;
FT                   PFAM: Peptidase M23; SPTR: C0W8N4 Putative uncharacterized
FT                   protein; PFAM: Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92104"
FT                   /db_xref="GOA:D7BMF5"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMF5"
FT                   /protein_id="ADH92104.1"
FT                   /translation="MVSEEHTRPTRRELRLARLSHQANSSNSDTVVLDHAEDAAKPCDV
FT                   TRISTPLTACPEPEAVVSYAGSSHLVDKFKRFFGTQSPTKVILSTACAFAVAVGSGFAM
FT                   GPLVFESSAVAKSEETVLQGVQELDESTPSHLRALSGAADSARYRAYEEQFSGKPIVCQ
FT                   TTASANSLTSVLRDKVDHFIHPMAAGTFRESSPFGWRIHPILGSSKLHEGVDYAAPIGT
FT                   PIYAVADGKVVFSGSDSYTLGAPVLIIQHKVNGVEFTSWYLHSFSEGIHVKEGDEVKMG
FT                   DHVADVGNSGRSTGAHLHFEIHPGTFTGFTGAGPVDPIAFMKEHGAVDIHDVCGAK"
FT   gene            409942..410718
FT                   /locus_tag="Arch_0350"
FT   CDS_pept        409942..410718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0350"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="COGs: COG0584 Glycerophosphoryl diester
FT                   phosphodiesterase; InterPro IPR017946:IPR004129; KEGG:
FT                   bcv:Bcav_2653 glycerophosphoryl diester phosphodiesterase;
FT                   PFAM: glycerophosphoryl diester phosphodiesterase; SPTR:
FT                   D0WRR5 Putative glycerophosphoryl diester
FT                   phosphodiesterase; PFAM: Glycerophosphoryl diester
FT                   phosphodiesterase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92105"
FT                   /db_xref="GOA:D7BMF6"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMF6"
FT                   /protein_id="ADH92105.1"
FT                   /translation="MNHNRLWTIGEQPVVIAHRGGGLEAPENSFAAFERLHGLGIRHIE
FT                   TDVHATKDGIPVIIHDPLLDRVSDGHGLVRDYTWADLVSIHDHSGAGLMRLEDALEAFP
FT                   EAIFNIDAKENRVVAPLIAAITSTRSQHRVCLASFNERRLITLRKALPGVATSLGVSVV
FT                   VKLALALKLPRTLRNRIVATLPTANQGVQAIQVPKTFRGIHLVDEKFVHVAHACGWAVH
FT                   VWTINDLDTAADLLSIGVDGIVTDIPTQIKALIDKR"
FT   gene            complement(410816..410888)
FT                   /locus_tag="Arch_R0009"
FT   tRNA            complement(410816..410888)
FT                   /locus_tag="Arch_R0009"
FT                   /product="tRNA-Arg"
FT   gene            411029..412702
FT                   /locus_tag="Arch_0351"
FT   CDS_pept        411029..412702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0351"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COGs: COG0018 Arginyl-tRNA synthetase;
FT                   InterProIPR005148:IPR014729:IPR001412:IPR015945:IPR
FT                   008909:IPR001278:IPR009080; KEGG: kra:Krad_1250
FT                   arginyl-tRNA synthetase; PFAM: Arginyl-tRNA synthetase,
FT                   class Ic, core; arginyl tRNA synthetase domain protein;
FT                   DALR anticodon binding domain protein; PRIAM:
FT                   Arginine--tRNA ligase; SPTR: D0WRR6 Arginine--tRNA ligase;
FT                   TIGRFAM: arginyl-tRNA synthetase; PFAM: DALR anticodon
FT                   binding domain; Arginyl tRNA synthetase N terminal domain;
FT                   tRNA synthetases class I (R); TIGRFAM: arginyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92106"
FT                   /db_xref="GOA:D7BMF7"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMF7"
FT                   /protein_id="ADH92106.1"
FT                   /translation="MTPEELKVLIGNIIRDAAVAGTIALDPETLPEVRVERPRVREHGD
FT                   WATNVAMQLGKKAGMNPREFAQLVVDKLIEDPGVDHADIAGPGFINITVNAAVAGELAR
FT                   TILEKGEAFGLGESLKGDVINLEYVSANPTGPIHIGGARWAAVGDSLARILEASGARVI
FT                   REYYFNDHGSQIDRFAKSLLARARGLEAPEDGYGGQYIEDIARAVLEEKSNGSDPLALA
FT                   DEQAQEFFREHGVTRMFGEIKKELADFRVEFDVYFHEDSLHESGAVNQAIDDLRNKGVI
FT                   YEQDGATWLRSTDFGDDKDRVIIKSDGDAAYFAGDIAYYLNKRERGADHVIIMLGADHH
FT                   GYIGRMYAMARAFGDTAGKGENLELLIGQLVNLVQDGQPVRMSKRAGTIVVLSDLVDAA
FT                   GVDAARYSLVRAAMDTTLEIDLGLISSRTNENPVYYVQYAHARTKSVDANAASHGVTRE
FT                   VFTPALLDSAADSELIAKLAQFPEIVAQSAQLREPHRVARYLEELAGAYHAWYGASRVT
FT                   PRADEEVSDLHRTRLWLNDAAGQVLANGLSLLGVSAPEKM"
FT   gene            412717..413544
FT                   /locus_tag="Arch_0352"
FT   CDS_pept        412717..413544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0352"
FT                   /product="Homoserine kinase"
FT                   /note="COGs: COG0083 Homoserine kinase; InterPro
FT                   IPR014721:IPR020568; KEGG: cai:Caci_1201 homoserine kinase;
FT                   SPTR: D0WRS3 Homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92107"
FT                   /db_xref="GOA:D7BMF8"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMF8"
FT                   /protein_id="ADH92107.1"
FT                   /translation="MRMVKEYARIRVPATTVLCGSRERESVAIAVDVWDDVAATIGIGD
FT                   SRVTVTGPAKHVFSRDDQHPTLVAMRATLDTIQAPHAGVALISQTKIPPAVGLGSRTAA
FT                   MMAGILLVRELMGGSVFSDNDAVAIAASFNISPARALASINGGVCLGWDSRATKLPLSK
FT                   PCPVAVLVPKDARTVHGGGLPQGPVGVLSHALTQNRRLLSDVCSQVERAQATDPRVGES
FT                   AHLLRALHDAHWPVLIAGSGPALLVFSQLNEQMRRMFEDHGFECHSSEVQSTR"
FT   gene            413646..413900
FT                   /locus_tag="Arch_0353"
FT   CDS_pept        413646..413900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0353"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shi:Shel_02770 ATPase; SPTR: D0WFW9 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92108"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMF9"
FT                   /protein_id="ADH92108.1"
FT                   /translation="MMQLIGYHAWRAGADRDQEAASVGIKRARAEMISRIRDLTYRELS
FT                   EGDISFVNAMLVDGKQSSISAISKWDVAQIMSHSIAGGF"
FT   gene            414197..415930
FT                   /locus_tag="Arch_0354"
FT   CDS_pept        414197..415930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0354"
FT                   /product="transcription termination factor Rho"
FT                   /note="COGs: COG1158 Transcription termination factor;
FT                   InterPro IPR011113:IPR000194:IPR004665:IPR003593; KEGG:
FT                   xce:Xcel_2462 transcription termination factor Rho; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; Rho termination factor RNA-binding; SMART: AAA
FT                   ATPase; SPTR: D0WRS5 Transcription termination factor Rho;
FT                   TIGRFAM: transcription termination factor Rho; PFAM: Rho
FT                   termination factor, RNA-binding domain; ATP synthase
FT                   alpha/beta family, nucleotide-binding domain; TIGRFAM:
FT                   transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92109"
FT                   /db_xref="GOA:D7BMG0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMG0"
FT                   /protein_id="ADH92109.1"
FT                   /translation="MSETTTGRKPALSTMRLPELKALATSMGIDMPAKSKKADYVAAIK
FT                   GAISTKKTARVEKSASAQPAPQENQTTNGAPKQPTQSEETAPKSEKKIELDLPEEGHQR
FT                   NRRERNNDRRRNNKNKLSEEEKVAALDALGDAAERRAEEGRGNRDGEEDGRQRNRRDRN
FT                   NRRERNNRRDRNNRRERYQENTETDSAQEAPAEDVLIPVAGILDIDGNNAYLRTGGYLP
FT                   GKNDAYVSSQTIRRFGLRRGDAVQGSVRPHAENPRGRQHKYNPLVDVVAINGLSVEDAA
FT                   TRPEFNKLTPLYPQEMLRMETTQKALTTRMIDLVAPIGKGQRGLIVSPPKAGKTVVMQQ
FT                   IAMAIAHNTPNVHLMVVLVDERPEEVTDMQRLVKGEVIASTFDRPASDHTIVAELAVER
FT                   AKRLVELGQDVVILLDSLTRLSRAYNLAAPASGRILSGGVDAAALYPPKKFFGAARNIE
FT                   NGGSLTIIASALVETGSKMDEVIFEEFKGTGNMELRLSRQLADRRIFPAVDINASGTRR
FT                   EEQLLSPEELKIMWHLRRGLGQLDVQEASDQLLGRMRKTESNSALLMSIVRGVQGAGVE
FT                   E"
FT   sig_peptide     414197..414268
FT                   /locus_tag="Arch_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            416124..416336
FT                   /locus_tag="Arch_0355"
FT   CDS_pept        416124..416336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0355"
FT                   /product="ribosomal protein L31"
FT                   /note="COGs: COG0254 Ribosomal protein L31; InterPro
FT                   IPR002150; KEGG: xce:Xcel_2460 ribosomal protein L31; PFAM:
FT                   ribosomal protein L31; SPTR: C0W8Q2 50S ribosomal protein
FT                   L31; TIGRFAM: ribosomal protein L31; manually curated;
FT                   PFAM: Ribosomal protein L31; TIGRFAM: ribosomal protein
FT                   L31"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92110"
FT                   /db_xref="GOA:D7BMG1"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMG1"
FT                   /protein_id="ADH92110.1"
FT                   /translation="MKKTIHPEYAPVHVTCTCGNEFETRSTKAGGELRVDVCSACHPFY
FT                   TGKQKILDTGGRVARFEARYGKRTK"
FT   gene            416456..417568
FT                   /locus_tag="Arch_0356"
FT   CDS_pept        416456..417568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0356"
FT                   /product="peptide chain release factor 1"
FT                   /note="COGs: COG0216 Protein chain release factor A;
FT                   InterPro IPR000352:IPR005139:IPR004373; KEGG: xce:Xcel_2459
FT                   peptide chain release factor 1; PFAM: Class I peptide chain
FT                   release factor; PCRF domain protein; SPTR: D0WRS7 Peptide
FT                   chain release factor 1; TIGRFAM: peptide chain release
FT                   factor 1; PFAM: PCRF domain; RF-1 domain; TIGRFAM: peptide
FT                   chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92111"
FT                   /db_xref="GOA:D7BMG2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMG2"
FT                   /protein_id="ADH92111.1"
FT                   /translation="MSAFPAADAMVAEYQHIEEQMASPEVLARPEKLRSLGRRYAQLGR
FT                   VVSRYRTWEKAEADLADIREIIELGGDDAELFEEELPRLEEAASTAAASLRDALIPRDP
FT                   DDSRDAIVEVKAGEGGEESALFAADLVRMYQRYAESKGWSVQTLSATHTELGGYKDIQL
FT                   AVKSSSIPEDPADGVWAHLKFEAGVHRVQRVPATESQGRIHTSAAGVLVFAEVDEPEEV
FT                   QVADNELRIDVFRSSGPGGQSVNTTDSAVRITHLPTGITVSMQDEKSQIKNREAAMRVL
FT                   LARLRQLQLEEQAAKEADQRRSQVRTVDRSERVRTYNFPENRIADHRTGYKAHNLDAVL
FT                   NGELEPVITSLREMDEAERLEQAAKEATEV"
FT   gene            417565..418410
FT                   /locus_tag="Arch_0357"
FT   CDS_pept        417565..418410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0357"
FT                   /product="protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /note="COGs: COG2890 Methylase of polypeptide chain release
FT                   factors; InterPro IPR002052:IPR007848:IPR004556:IPR019874;
FT                   KEGG: bln:Blon_0576 modification methylase, HemK family;
FT                   PFAM: methyltransferase small; SPTR: D0WRS8
FT                   Protein-(Glutamine-N5) methyltransferase; TIGRFAM:
FT                   protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific; modification methylase, HemK family; PFAM:
FT                   Methyltransferase small domain; TIGRFAM: HemK family
FT                   putative methylases; protein-(glutamine-N5)
FT                   methyltransferase, release factor-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92112"
FT                   /db_xref="GOA:D7BMG3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMG3"
FT                   /protein_id="ADH92112.1"
FT                   /translation="MMTWGDAMRAGEEQLASSGLPSPHADVRLLAEHVWGSIPFPQDLI
FT                   TPEHAREFAATITRRASFEPVQHIMGKMWFRYLELASRPGVFIVRPETEMVAQAGLDAL
FT                   EKMTVENPVVVDLCTGSGAIAIAIATEKPRTRVWAVERDETAYALATANNERYGNRVTI
FT                   VHGDARTELAHLESAVDLLITNPPYVPRTQELPADVHRDPDLALYGGGDDGLDVPRTLV
FT                   HRAHTLLRPGGVFVMEHGDEQGPALVAEAIETGFTHAYTGRDLTGRDRWLYAEKPEKEG
FT                   "
FT   gene            418415..419062
FT                   /locus_tag="Arch_0358"
FT   CDS_pept        418415..419062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0358"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="COGs: COG0009 Putative translation factor (SUA5);
FT                   InterPro IPR017945:IPR006070:IPR004388; KEGG: art:Arth_2617
FT                   translation factor SUA5; PFAM: SUA5/yciO/yrdC domain; SPTR:
FT                   C1RKE7 Translation factor SUA5; TIGRFAM:
FT                   Sua5/YciO/YrdC/YwlC family protein; PFAM: yrdC domain;
FT                   TIGRFAM: Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92113"
FT                   /db_xref="GOA:D7BMG4"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMG4"
FT                   /protein_id="ADH92113.1"
FT                   /translation="MVVVSSTDTQARTAVQKAVRAGKVVCLPTDTVYGVGADPFSYDAV
FT                   TALLAAKSRTRAMPPPVLVASIEQAESLAETVPASARALMEEFWPGALTIILPARETLG
FT                   WDLGETFGTVALRMPDDSATRDFLAHIGPLAVTSANKTGQPPATTIADAETQLGESVAV
FT                   YVDGGTSPGGVPSSIVRWHPATDTYDVVRLGALSIADLSRIVRIEESAEDNA"
FT   gene            419059..420207
FT                   /locus_tag="Arch_0359"
FT   CDS_pept        419059..420207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0359"
FT                   /product="Glycosyl transferase, family 4, conserved region"
FT                   /note="COGs: COG0472 UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N- acetylglucosamine-1-phosphate
FT                   transferase; InterPro IPR018480:IPR018481; KEGG:
FT                   jde:Jden_1782 glycosyl transferase family 4; PFAM: Glycosyl
FT                   transferase, family 4, conserved region; SPTR: D0WRT0
FT                   Undecaprenyl-phosphate
FT                   alpha-N-acetylglucosaminyltransferase; PFAM: Glycosyl
FT                   transferase family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92114"
FT                   /db_xref="GOA:D7BMG5"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMG5"
FT                   /protein_id="ADH92114.1"
FT                   /translation="MRAYLLIMVLAGIVTYLLVPLVHRISLAMGAVTEIRARDVHKVPI
FT                   ARLGGVAMYVGFVVSLVVASQIPYFHIVLGSGSTAWAVVAGAGIICTIGVIDDIYELPW
FT                   YAKLAGQMLAAGVMVWFGVQLVSVPLLGLTVGSARLTLFVTIVSIVMVVNAVNFIDGLD
FT                   GLAAGVVGIAALAFFAYTYYLTRENSPGDYTSVATAVVAALVGICVGFLPHNFHPAKIF
FT                   MGDSGALMLGTIIAGASIIVTGQIDPASANTPQAIPAYMPLIVPLLVLVIPLIDLVWGV
FT                   VRRLAQGRSPFSADAGHLHHRLLRHGHSHTNAVLVLYMWTAVASFSAVSAVAFPLRWVA
FT                   LIGCVGIVVATVVTSRFCSARRLFEMRRTKAAVKRALERSAR"
FT   sig_peptide     419059..419148
FT                   /locus_tag="Arch_0359"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            420207..420659
FT                   /locus_tag="Arch_0360"
FT   CDS_pept        420207..420659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0360"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pct:PC1_2686 sulphate transporter; SPTR:
FT                   Q9I537 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92115"
FT                   /db_xref="GOA:D7BMG6"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMG6"
FT                   /protein_id="ADH92115.1"
FT                   /translation="MGNGVFGGRRRRVPGERYSAQEIIARASWGSMLVVFVSVLTGSGV
FT                   LYLGGKSHTIPSVLFAGGVAVLIHGLSWGASILGHIWANSTSAVMLVGYVGKLGIILLA
FT                   FILVYQINVLVPRTVALTLACCILIGLVVSSLVIMRNDGPEIGSWD"
FT   gene            420805..421635
FT                   /locus_tag="Arch_0361"
FT   CDS_pept        420805..421635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0361"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="COGs: COG0356 F0F1-type ATP synthase subunit a;
FT                   InterPro IPR000568; KEGG: xce:Xcel_2454 ATP synthase F0, A
FT                   subunit; PFAM: H+transporting two-sector ATPase A subunit;
FT                   SPTR: D0WRT2 ATP synthase F0, A subunit; TIGRFAM: ATP
FT                   synthase F0, A subunit; PFAM: ATP synthase A chain;
FT                   TIGRFAM: ATP synthase subunit 6 (eukaryotes),also subunit A
FT                   (prokaryotes)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92116"
FT                   /db_xref="GOA:D7BMG7"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMG7"
FT                   /protein_id="ADH92116.1"
FT                   /translation="MHSFLTATGTVPILLSSSTGDGFRAPTLDHEFSPDPILFAGSPFE
FT                   IHRLILVRLVAVLVLLAVMVWYSRTAKLVPSRGQAAVESLLDFSRVQVGEEILGKEHAG
FT                   KYQPMLATIFIGILFMNLTGVIPGLQIAGTSLIGMPLIYAAFVYVGFLYAGMKERGIGR
FT                   FFKEQLMPPGVPWPLYFLMVPLEFLSTFILRPITLTVRLLANMVAGHFILVLCFLGTHY
FT                   LYFTISGAFGTVLGSLTLLAGVIFVAFELFVGALQAYIFAMLAAAYISLSISEH"
FT   gene            421665..421874
FT                   /locus_tag="Arch_0362"
FT   CDS_pept        421665..421874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0362"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="InterPro IPR002379:IPR020537:IPR000454:IPR005953;
FT                   KEGG: cms:CMS_1929 ATP synthase C chain; PFAM:
FT                   H+transporting two-sector ATPase C subunit; SPTR: D0WRT3
FT                   ATP synthase F0, C subunit; TIGRFAM: ATP synthase F0, C
FT                   subunit; PFAM: ATP synthase subunit C; TIGRFAM: ATP
FT                   synthase, F0 subunit c"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92117"
FT                   /db_xref="GOA:D7BMG8"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMG8"
FT                   /protein_id="ADH92117.1"
FT                   /translation="MIGNIATIGYGIATIGPGLGVGLIGAKNQEATARQPELKGYLRVN
FT                   MFLSIAFAEALGLIGFAAGFVFAA"
FT   gene            421880..422440
FT                   /locus_tag="Arch_0363"
FT   CDS_pept        421880..422440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0363"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="COGs: COG0711 F0F1-type ATP synthase subunit b;
FT                   InterPro IPR002146:IPR005864; KEGG: bcv:Bcav_1303 ATP
FT                   synthase F0, B subunit; PFAM: H+transporting two-sector
FT                   ATPase B/B' subunit; SPTR: D0WRT4 ATP synthase F0, B
FT                   subunit; TIGRFAM: ATP synthase F0, B subunit; PFAM: ATP
FT                   synthase B/B' CF(0); TIGRFAM: ATP synthase, F0 subunit b"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92118"
FT                   /db_xref="GOA:D7BMG9"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMG9"
FT                   /protein_id="ADH92118.1"
FT                   /translation="MESTTILAQGEGLTFHLLWPAVPDLVWGTVAFLIVATAIYKFAWP
FT                   AFMSTLDERAEKIENGLKAADIARAEITEERADLDEQIRNAHRDAEQIREKATANAKSI
FT                   VSDAQAQARTEAGQIIDTAQLRIVADTDAARRTLRSDVGALATELASRIVGESLTDVEL
FT                   AKRVTDRFLDELEASTVPATQEA"
FT   gene            422440..423255
FT                   /locus_tag="Arch_0364"
FT   CDS_pept        422440..423255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0364"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="COGs: COG0712 F0F1-type ATP synthase delta subunit
FT                   (mitochondrial oligomycin sensitivity protein); InterPro
FT                   IPR020781:IPR000711; KEGG: bcv:Bcav_1304 ATP synthase F1,
FT                   delta subunit; PFAM: H+transporting two-sector ATPase delta
FT                   (OSCP) subunit; SPTR: D0WRT5 Putative H+-ATPase delta
FT                   subunit; TIGRFAM: ATP synthase F1, delta subunit; PFAM: ATP
FT                   synthase delta (OSCP) subunit; TIGRFAM: ATP synthase, F1
FT                   delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92119"
FT                   /db_xref="GOA:D7BMH0"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMH0"
FT                   /protein_id="ADH92119.1"
FT                   /translation="MRSGSQAALDRARDRWGAVLETVPETEIDAAESIFSVADLLVSHS
FT                   HLVAALEDNARDPEDRAQLAHDLFDGKVRGDVVELLMGLARERWSESGDLTLALEHLGV
FT                   HTLLAGARRSGQLSGVEEELYVAMRTLRNERGLRLTLSDSIYEPLARAGLARNVFDSYN
FT                   VFTKELLARAVVRTERGRTLAQSLTAYLDLAAELDNHIVASVTSAIPLTREQEERLSVI
FT                   LTRTYKTDVTIHVSIDPAVIGGIRIHVGDDVIDGTLASRITALRETFTN"
FT   gene            423296..424921
FT                   /locus_tag="Arch_0365"
FT   CDS_pept        423296..424921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0365"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /note="COGs: COG0056 F0F1-type ATP synthase alpha subunit;
FT                   InterProIPR020003:IPR004100:IPR000194:IPR000793:IPR
FT                   005294:IPR018118; KEGG: xce:Xcel_2450 ATP synthase F1,
FT                   alpha subunit; PFAM: H+transporting two-sector ATPase
FT                   alpha/beta subunit central region; H+transporting
FT                   two-sector ATPase alpha/beta subunit domain protein; SPTR:
FT                   D0WRT6 ATP synthase F1, alpha subunit; TIGRFAM: ATP
FT                   synthase F1, alpha subunit; PFAM: ATP synthase alpha/beta
FT                   family, beta-barrel domain; ATP synthase alpha/beta family,
FT                   nucleotide-binding domain; ATP synthase alpha/beta chain, C
FT                   terminal domain; TIGRFAM: proton translocating ATP
FT                   synthase, F1 alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92120"
FT                   /db_xref="GOA:D7BMH1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMH1"
FT                   /protein_id="ADH92120.1"
FT                   /translation="MAEVTIQPDDIRSALDNFVNSYEPAKASSEEVGHVTLSADGIARV
FT                   EGLPGAMANELLKFEDGTLGLAMNLEEREIGVVVLGDFSHIEEGMEVRRTGEVLSVPVG
FT                   EGYLGRVVDPLGNPIDGLGEIADIETRRALELQAPGVMARKSVHEPLQTGIKAIDAMIP
FT                   IGRGQRQLIIGDRKTGKTALAVDTILNQKANWESGDPQKQVRCIYVAIGQKGSTIAEVR
FT                   ATLERNGALEYTTIVASPASDPAGYKYLAPYTGSAIGQHWMYSGKHVLIIFDDLSKQAE
FT                   AYRAVSLLLRRPPGREAYPGDVFYLHSRLLERCAKLSDELGGGSMTGLPIIETKANDVS
FT                   AYIPTNVISITDGQIFLQSDLFNANQRPAVDVGISVSRVGGDAQIKAMKKVAGTLKITL
FT                   AQYRAQAAFAMFASDLDAATRQQLTRGERLMALLKQPQYTPYAVEDQVASVWAGANGYL
FT                   DDIEVSDVAKFEAGLIRHLRTNTSVLTDIATTGKLEADTEAALRAAVEEFRAGFTANNA
FT                   TLQANDDEPEAEQSQEQIVRPKRG"
FT   gene            424924..425829
FT                   /locus_tag="Arch_0366"
FT   CDS_pept        424924..425829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0366"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /note="COGs: COG0224 F0F1-type ATP synthase gamma subunit;
FT                   InterPro IPR000131; KEGG: jde:Jden_1775 ATP synthase F1,
FT                   gamma subunit; PFAM: H+transporting two-sector ATPase gamma
FT                   subunit; SPTR: D0WRT7 ATP synthase F1, gamma subunit;
FT                   TIGRFAM: ATP synthase F1, gamma subunit; PFAM: ATP
FT                   synthase; TIGRFAM: ATP synthase, F1 gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92121"
FT                   /db_xref="GOA:D7BMH2"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMH2"
FT                   /protein_id="ADH92121.1"
FT                   /translation="MAGAQRIYKQKIRATKTLEKVFRAMELIAASRIGKARDRALGQDP
FT                   YTQALTRSIATVAAHAHEDHPLVKERTDTNRVIVFVVTSDRGMAGAYSSSVLREAERLM
FT                   DELKEQGKEPVLYVSGRRGESYFRFRDVPVERSWTGESDKPSDDTSSDIADEFLNRFLA
FT                   DANAGGVSELYMIFTRFVSMVTQTVQVRRMLPIQIVDEEANAEATAPEHDEPLYEFEPS
FT                   AQKVFDELLPMYVGQRIHSVMLMSAASELAARQQAMHSATENAGNLIESYTRLANNARQ
FT                   AEITTEITEIISGADSLGKS"
FT   gene            425866..427326
FT                   /locus_tag="Arch_0367"
FT   CDS_pept        425866..427326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0367"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="COGs: COG0055 F0F1-type ATP synthase beta subunit;
FT                   InterProIPR020003:IPR004100:IPR000194:IPR000793:IPR
FT                   005722:IPR003593:IPR018118; KEGG: xce:Xcel_2448 ATP
FT                   synthase F1, beta subunit; PFAM: H+transporting two-sector
FT                   ATPase alpha/beta subunit central region; H+transporting
FT                   two-sector ATPase alpha/beta subunit domain protein; SMART:
FT                   AAA ATPase; SPTR: D0WRT8 ATP synthase F1, beta subunit;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM: ATP synthase
FT                   alpha/beta family, beta-barrel domain; ATP synthase
FT                   alpha/beta family, nucleotide-binding domain; ATP synthase
FT                   alpha/beta chain, C terminal domain; TIGRFAM: ATP synthase,
FT                   F1 beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92122"
FT                   /db_xref="GOA:D7BMH3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMH3"
FT                   /protein_id="ADH92122.1"
FT                   /translation="MTAVDNTQGVTTGRIVQVVGAVVDVEFPPDALPEINNALLTEVDL
FT                   SGQGEGESVLKMTLEVAQHLGDNIVRTIAMKPTDGLVRGATVIDTGAPITVPVGDATKG
FT                   HVFNVTGDVLNLGEGETLDVKERWPIHRKAPQFDELEPETKMFETGIKVIDLLTPYVQG
FT                   GKIGLFGGAGVGKTVLIQEMIQRVAQDHGGVSVFAGVGERTREGNDLIHEMEDAGVLDK
FT                   TALVFGQMDEPPGVRLRIALSGLTMAEYFRDVQNQDVLLFIDNIFRFTQAGSEVSTLLG
FT                   RMPSAVGYQPTLADEMGALQERITSTRGHSITSLQAIYVPADDYTDPAPATTFAHLDAT
FT                   TELSRDIASRGLYPAVDPLTSTSRILDAQYVGQAHYDTATKVKSILQKNKELQDIISIL
FT                   GVDELSEEDKITVARARRIEQYLSQNTYTAKKFTGVEGSTVPIAETVEAFRRITDGEYD
FT                   HIPEQAFFNIGGIEDIERAWHKIQQDMR"
FT   gene            427326..427577
FT                   /locus_tag="Arch_0368"
FT   CDS_pept        427326..427577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0368"
FT                   /product="ATPase, F1 complex, delta/epsilon subunit"
FT                   /note="COGs: COG0355 F0F1-type ATP synthase epsilon subunit
FT                   (mitochondrial delta subunit); InterPro IPR020546; KEGG:
FT                   bcv:Bcav_1308 H+transporting two-sector ATPase
FT                   delta/epsilon subunit; PFAM: ATPase, F1 complex,
FT                   delta/epsilon subunit-like; SPTR: C5C1U9 H+transporting
FT                   two-sector ATPase delta/epsilon subunit; PFAM: ATP
FT                   synthase, Delta/Epsilon chain, beta-sandwich domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92123"
FT                   /db_xref="GOA:D7BMH4"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMH4"
FT                   /protein_id="ADH92123.1"
FT                   /translation="MKLDIVARSGNLYAGDVTEIVVPAYDGELGILPGRAPVLSVVMPG
FT                   TVRFVTVAGERREIAVGKGFLTVDHDDVMIVVENHEEQ"
FT   gene            427581..427985
FT                   /locus_tag="Arch_0369"
FT   CDS_pept        427581..427985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0369"
FT                   /product="Protein of unknown function DUF2550"
FT                   /note="InterPro IPR019675; KEGG: kra:Krad_1272 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2550; SPTR:
FT                   A6W7H1 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF2550)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92124"
FT                   /db_xref="GOA:D7BMH5"
FT                   /db_xref="InterPro:IPR019675"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMH5"
FT                   /protein_id="ADH92124.1"
FT                   /translation="MPWLLWWAIVITALIVIVVGLYSLLRLRILFSRSGSFHVAVREGG
FT                   QERWQTGVAVFQPFQLNWFSTHSLSPYPNIQWKRGELDFQVMPPSGDGIQVVHITRGAE
FT                   EWSLATTPLAVSGIVSWIDSAPPVEEPELF"
FT   sig_peptide     427581..427685
FT                   /locus_tag="Arch_0369"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            428161..428856
FT                   /locus_tag="Arch_0370"
FT   CDS_pept        428161..428856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0370"
FT                   /product="protein of unknown function DUF91"
FT                   /note="COGs: COG1637 nuclease of the RecB family; InterPro
FT                   IPR002793; KEGG: ach:Achl_2332 protein of unknown function
FT                   DUF91; PFAM: protein of unknown function DUF91; SPTR:
FT                   D0WRU1 Nuclease of the RecB family protein; PFAM: Protein
FT                   of unknown function DUF91"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92125"
FT                   /db_xref="GOA:D7BMH6"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMH6"
FT                   /protein_id="ADH92125.1"
FT                   /translation="MRIVIARCSVDYSGRLDAHLEPATRVLMLKQDGSVLVHSDGGSYK
FT                   PLNWMSPPATFKEIPVADIDRKAGVVESWAVEHNKTNDVLLINIYEILHDVTQDLGIEP
FT                   GLVKDGVEAHLQKLLAEQVDVLGSDLELVRREYPTPIGPVDLMLLGKDGGHVAVEVKRR
FT                   GEIDGVEQLTRYLELLGRDSTLQPLRGIFAAQEIKPQARVLAEDRGIECIVLDYDAMRG
FT                   VDHPEDRLF"
FT   gene            428856..429143
FT                   /locus_tag="Arch_0371"
FT   CDS_pept        428856..429143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cai:Caci_1238 hypothetical protein; SPTR:
FT                   D0WRU2 Putative ATP/GTP-binding protein, doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92126"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMH7"
FT                   /protein_id="ADH92126.1"
FT                   /translation="MRRSKKYDRPVREINSYALMGYTRVEQGRDGRDFKVHHIVSGAKD
FT                   YVCPGCQGVIRRGESHEVAWTEDHILGKDFGQQDRRHWHTGCWNARGRRR"
FT   gene            429200..429979
FT                   /locus_tag="Arch_0372"
FT   CDS_pept        429200..429979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0372"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COGs: COG0596 hydrolase or acyltransferase
FT                   (alpha/beta hydrolase superfamily); InterPro
FT                   IPR000639:IPR000073; KEGG: bcv:Bcav_1326 alpha/beta
FT                   hydrolase fold protein; PFAM: alpha/beta hydrolase fold;
FT                   SPTR: D0WRU3 Putative SHCHC synthase; PFAM: alpha/beta
FT                   hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92127"
FT                   /db_xref="GOA:D7BMH8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMH8"
FT                   /protein_id="ADH92127.1"
FT                   /translation="MTMLSFRRTGNVSDCPLVLLHALPLDATMWDRVRELLAPIDVITV
FT                   DAPGFGESPAGSEIAEDPSVAAYVQALKETLDHHGVQQILLGGLSMGGSVAAEFVATYP
FT                   EMIRGLALMDTGIGADNQDRQAFRRDMAQRAEEGRAFEILEDWKDSMTGSEVTPEIQES
FT                   LVARFKAAPGEGLAWIQRALATREDRSDAVELVEGPVFFIRGTDDPTASLEYFMNLALK
FT                   AKEPRILEIEGAGHFTADEKPEELAQALSEFVQRCAR"
FT   gene            complement(429989..431296)
FT                   /locus_tag="Arch_0373"
FT   CDS_pept        complement(429989..431296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xce:Xcel_2425 hypothetical protein; SPTR:
FT                   D0WRU4 Putative cellulose-binding protein; PFAM: DivIVA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92128"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMH9"
FT                   /protein_id="ADH92128.1"
FT                   /translation="MAEEPLFPVVMRGYDRAQVDDRIDSLNTHLSQARAHVAHLDNEVL
FT                   QLSAQLAEANHALKENDRPSYSGLGSRVERLLRSTEEQALDLMTRARQEATSIVATAEQ
FT                   RADALRNAALEDSQKTLSRAHTEADSELERARAEVDSLTTIARRTSEEIVSSAEREADR
FT                   LRTQSEADAAALRSAAEHDAAQMRAEAETAATNLRSEAETDATNLRTEAENAVAQLRAE
FT                   TEAELARMRAETEQSIASAKAESERAIADATAACERSIAEAHEEATAKLTAENERLTAL
FT                   ATEMVSKAETDARTAEERVVEATQRASQLTASSESEAADLLNSARDEADAILTHARDEA
FT                   SRIMSEAETDAAKKLTSAREEIDALQEQRESLTSYIEDMRAILTGSDRSLALSQVVNSA
FT                   ANKREEDEPMPVEEKSEPAAEEEPQADDSEKLEAAE"
FT   gene            431441..432514
FT                   /locus_tag="Arch_0374"
FT   CDS_pept        431441..432514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0374"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_1331 hypothetical protein; SPTR:
FT                   D0WRU5 Putative uncharacterized protein (Fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92129"
FT                   /db_xref="GOA:D7BMI0"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMI0"
FT                   /protein_id="ADH92129.1"
FT                   /translation="MKRILGIVALFMGVVMLAGTFVVSFSQQKVSTVKLSSASKSAVFT
FT                   TTAPGVLTLVNDVVAVTLESKGHDVQWALGTPTDVKAFVGGAGSVDVAGLESWKALKVA
FT                   ENKGSAEANTAVKEAVGAKSFTLLGSDMWAKEGHAKNSANVELKASDLENKVLIATTDQ
FT                   GVAPKITLEWQRIHEVANLLVFYVMSVLLGLIGAFLLLNWHQEEAARTCVQRKASVKLR
FT                   SRGQSDEATSVLPSYDGDLADPDLERDIQRVHTDAAFGAAILPGTIRSSVFRNRELAEE
FT                   DRIIIPIADTDSVETPDRADDTAQEAVSEPVLKADVGSGDDEEEKMDERSEKDDWRSLW
FT                   NFSWGTPWKKEEGNTNA"
FT   sig_peptide     431441..431551
FT                   /locus_tag="Arch_0374"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            432507..433514
FT                   /locus_tag="Arch_0375"
FT   CDS_pept        432507..433514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0375"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_1332 hypothetical protein; SPTR:
FT                   D0WRU7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92130"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMI1"
FT                   /protein_id="ADH92130.1"
FT                   /translation="MRKTRLALAVMAAASLTLAGCAHDSSVPEPEVAKSASNIVPQKKY
FT                   AMIASDVAKALTQADQNRDAGALGPRIAGPFRVQREAEYALARATETTAPTSVVIDPKE
FT                   SALSSGSAFPRSFMAIDMTKTGRGIGTITVWQQPDARQNYQLWAAMDMFPAPPKIEIVN
FT                   TKNDKPGYPEAKPSEYSVDPATVLDSYVAYINARAMGDVKFNEGDPLYKQTEKQAHDLT
FT                   AALNELGEAKIAFTVPNKDIRAISTKDGGLVMVGELRYNMTVTRTKDRATLKLGSSIGA
FT                   LAEGKKDGIAVVDKPVVAQYSTSVAFYIPPKGSKDPIHVLGGSVPALLSVTKAE"
FT   sig_peptide     432507..432611
FT                   /locus_tag="Arch_0375"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            433519..434451
FT                   /locus_tag="Arch_0376"
FT   CDS_pept        433519..434451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0376"
FT                   /product="thioredoxin domain protein"
FT                   /note="COGs: COG3118 Thioredoxin domain-containing protein;
FT                   InterPro IPR012335:IPR012336; KEGG: bcv:Bcav_1333
FT                   thioredoxin domain protein; SPTR: D0WRU8
FT                   Thioredoxin-related protein; PFAM: Thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92131"
FT                   /db_xref="GOA:D7BMI2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMI2"
FT                   /protein_id="ADH92131.1"
FT                   /translation="MNMPGFGGVYDLSTLKKEPETPQAPVDTGNTIPGPWVTEAAEANL
FT                   QHVVQTSMSLPVLFVFMAPESEHSQTLVQNFTEVVNAHAGKIQLAVVDASVERGIAQAF
FT                   GVNAVPTAIALLQGQPVPLFQGLPDMDSLTTTVTKLLDAAAQYGLTGVLDGDPDGTPPE
FT                   PEIPPLHKEGLEALEAGNLEGAYAAYSAAIKENPGDSEAITALHQVELLQRVKAINPDG
FT                   SPLEAQSILHAAASAPFTDVDAHLKAADLELSFGRADAAFARLLEVVKATSADDRDKAR
FT                   TRLLSLFDVVGQHSDLVSQTRKALTNALF"
FT   gene            complement(434448..436124)
FT                   /locus_tag="Arch_0377"
FT   CDS_pept        complement(434448..436124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0377"
FT                   /product="alpha amylase catalytic region"
FT                   /note="COGs: COG0366 Glycosidase; InterPro
FT                   IPR013781:IPR006047:IPR006589:IPR017853; KEGG: cdi:DIP0532
FT                   putative amylase; PFAM: alpha amylase catalytic region;
FT                   SMART: alpha amylase catalytic sub domain; SPTR: Q6NJ80
FT                   Putative amylase; PFAM: Alpha amylase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92132"
FT                   /db_xref="GOA:D7BMI3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMI3"
FT                   /protein_id="ADH92132.1"
FT                   /translation="MKIHQQSTPVQWWEDAVIYQIYPRSFASSSGKIGDLRGITQRLGY
FT                   VAELGVDAVWLSPFYCSPQKDGGYDVSDYRRVDPLFGSNDDVATMIAQAHDYGLKVIVD
FT                   LVPNHTSDEHIWFRAALAGDHAARARYYFRDSDGCPPNDWISIFGGHAWTQVCQRADAP
FT                   GSPWEHDTSWYLHLFDSSQPDLNWDHSDVLNEFDDVLRFWLRLGVDGFRVDVAHGLAKD
FT                   PELPNWQYHWDMVAGGSEVPDNVPPPPMWNRPEVHDIYRRWRAVLDEFGPDRMLVAEAW
FT                   VDGEENLATYVRSDEMSQAFNFAFLMAPFTASDLRETVRSSLRAMDSVGAPTTWVLSNH
FT                   DIVRATSRLGLSSTGKGPNGIRSWEEQPDAKLGRKRALAAHLLQAALPGSSYIYQGEEL
FT                   SLPEHTSLPDDVREDPAFFRTEGREAGRDGQRVPMPWSSTEPAFGFSATGESWLPQPAE
FT                   WAEIAVDVQEQHADSSLNHFKRMLDLRKVLKMGSAALSDAEPTANHLHYVSSRDDRADV
FT                   HVMLAFDTPVLLPEDANLLIATCEITDGVLPANSAVWFERD"
FT   gene            complement(436146..437156)
FT                   /locus_tag="Arch_0378"
FT   CDS_pept        complement(436146..437156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0378"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000843:IPR001761:IPR010982; KEGG: sro:Sros_3351 LacI
FT                   family transcription regulator; PFAM: regulatory protein
FT                   LacI; periplasmic binding protein/LacI transcriptional
FT                   regulator; SMART: regulatory protein LacI; SPTR: D0WRV0
FT                   HTH-type transcriptional regulator MalR; PFAM: Bacterial
FT                   regulatory proteins, lacI family; family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92133"
FT                   /db_xref="GOA:D7BMI4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMI4"
FT                   /protein_id="ADH92133.1"
FT                   /translation="MAKRIRLADLAKQAGVSTATVSRVLNGKHSVAPETRQAVLAALDL
FT                   LGYERPDQLRERSGGLIGLVLPELTNPIFPQFAQSLEGAMSLHGYTPLLGTQVAGGATE
FT                   DSYVEAMLEHRVDGLIFVSGLHADSTASLERYHRISARGIPFITMNGYNPELGMPDFSA
FT                   DDSSAIRQAVRHLKGLGHQKIGLATGPLRFGPARVKTETYLDAMARVLPQEKPRHAHTL
FT                   FTVEGGVSACADLVSQGCTGIIFASDVMAYGAIRYCQSSGLRIPDDLSIVGFDDSPLNA
FT                   FTNPPLTTLHQPVKAMCDAAVSTLIGMINGTHSPMGPMRFEPELIVRESTALPRR"
FT   gene            437480..438712
FT                   /locus_tag="Arch_0379"
FT   CDS_pept        437480..438712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0379"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG2182 Maltose-binding periplasmic
FT                   protein/domains; InterPro IPR006060:IPR006059; KEGG:
FT                   bcv:Bcav_1781 extracellular solute-binding protein family
FT                   1; PFAM: extracellular solute-binding protein family 1;
FT                   SPTR: C0W247 Periplasmic maltose-binding protein; PFAM:
FT                   Bacterial extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92134"
FT                   /db_xref="GOA:D7BMI5"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMI5"
FT                   /protein_id="ADH92134.1"
FT                   /translation="MRRGIALAAVAGLAVAGLAACGSDDSAKKADKPATSDTKSDAALT
FT                   IWVDADRKPAFEIAAKEYEKATGHKVELVVKENDQIRSEFAAQVPTGKGPDITFGAHDW
FT                   LGEFVTNGIVAPVELGDKAKEFSDVALKGFTYENKTYGVPYAVENLAIIRNADLAKEPT
FT                   PAKFDDMIAAGKATGAKTPFMVQIGEKGDPFHMYPFESSFSGPVFKTDEAGNYTPELNL
FT                   GGEKGGAFAKWLADKAAAGELNTAWTYDIVVEAFKNGEVPFILGGPWMLGDFKGMNVAV
FT                   DPIPSAGDMPAAPFVGVQGGFISATSKNQLLATDFLVNYVGTEKVQDALFKAGQRTPAL
FT                   KASAEKIASDPVAAGFAKAGEAGLPMPALPQMGAVWSFWGTTEAQVMGGADPASTWEKM
FT                   ISDIQAEIAKK"
FT   sig_peptide     437480..437545
FT                   /locus_tag="Arch_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            438780..440396
FT                   /locus_tag="Arch_0380"
FT   CDS_pept        438780..440396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0380"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG:
FT                   bcv:Bcav_1782 fructose-bisphosphate aldolase; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: C0W248 Maltose ABC superfamily ATP binding
FT                   cassette transporter, membrane protein MalF; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92135"
FT                   /db_xref="GOA:D7BMI6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030156"
FT                   /db_xref="InterPro:IPR032550"
FT                   /db_xref="InterPro:IPR035277"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMI6"
FT                   /protein_id="ADH92135.1"
FT                   /translation="MSQMIKPTEASKKRAARRAERSKLDSPATTWGTGFIVKLVLMGIV
FT                   NALGIFIIFTAFGVGSNILGSLMAVLLVALDWVYFSRRTLALKYLAPGLVFLLVFQAFV
FT                   IFYTAYIAFTNYGHQHTLDKSTAIESILLQNSTKRVENSPQYPLVVVEKDGELGFAVVD
FT                   PDKNVLKAGTESHKLTEVDGTFSGTQISEVSGYTIVPLSELGNRQDEVTKLRVPISDNP
FT                   EDGAIGTQTGTVGYQFTSSITYDADADTMTDVETGTVYHADDDAGFFKADDGSTLNVGW
FT                   RVVVGFDNFLKGFGDSRYAQPFFQVLVWNVIFAFMSVLTTFLLGMLLAIVLNDERLKGR
FT                   KLYRTLLLLPYAFPSFMTAFLFAGLMNRSYGFFNQLLGTEIPWLTDPTMAKVSVILVNL
FT                   WMGFPYMFLIVTGALQAIPGELTEAAKIDGATSFQVWRNVTLPQLMISLTPLLIASFAF
FT                   NFNNFNLIYMLNGGGPRMGDASVPVGHTDILISMVYKIAGLTGEAAPNYGLAAAMSLVI
FT                   FLIVGAVSLYSFKKSKSMEAL"
FT   gene            440399..441313
FT                   /locus_tag="Arch_0381"
FT   CDS_pept        440399..441313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0381"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG3833 ABC-type maltose transport systems
FT                   permease component; InterPro IPR000515; KEGG: bcv:Bcav_1783
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: C0W249
FT                   Maltose/maltodextrin ABC superfamily ATP binding cassette
FT                   transporter, membrane protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92136"
FT                   /db_xref="GOA:D7BMI7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMI7"
FT                   /protein_id="ADH92136.1"
FT                   /translation="MEKTRETRSAVAATGTVANNKVPFGKWFRETGFRHVLAVLAVLYA
FT                   AFPILYIVSAALNPDIKTTLTGANKLFTSVSVDNFTELSDTMFWTWFSNTLIIGIATAI
FT                   GTVLMGAAAAYAFSRFRFSGRRMTLMSLMVIQMFPQLLTFVAIFLLLTTLGDVFPVLGI
FT                   DSKLALICVYLGGALGANTFLMYGFFNSIPMELDEAAKIDGATHSQVYWTIIMPLVIPI
FT                   LAVVGLLSFISSFNDFILARTILTSQENWTLAVGMNLWVGGNEKAWDWFAAGSIIAAVP
FT                   ILLLFLFLQKYIVSGLTGGAVKG"
FT   gene            complement(441407..441970)
FT                   /locus_tag="Arch_0382"
FT   CDS_pept        complement(441407..441970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0382"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="COGs: COG0431 flavoprotein; InterPro IPR005025;
FT                   KEGG: cur:cur_0127 putative oxidoreductase; PFAM:
FT                   NADPH-dependent FMN reductase; SPTR: C6MAM3 Flavin
FT                   reductase; PFAM: NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92137"
FT                   /db_xref="GOA:D7BMI8"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMI8"
FT                   /protein_id="ADH92137.1"
FT                   /translation="MTKKVSVLIGSLRAGSYARKIAHVAMEFFPADYDVQIVEIGNLPL
FT                   YNFDCDDPNVPEVSVPAEWTAFRETIKNSDGILFVTPENNRLVPACLKNAVDIGSKPNS
FT                   DVAWKNLPAGIISHSVGKMGGYSSQKTLRLALSYFDMPMPGQPEVFIGNSPELFDNNGM
FT                   MTAESTREFIADYITRFTALIEKQ"
FT   sig_peptide     complement(441899..441970)
FT                   /locus_tag="Arch_0382"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(442194..444380)
FT                   /locus_tag="Arch_0383"
FT   CDS_pept        complement(442194..444380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0383"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /note="COGs: COG0296 1 4-alpha-glucan branching enzyme;
FT                   InterProIPR013783:IPR013781:IPR013780:IPR004193:IPR
FT                   006047:IPR006048:IPR006407:IPR006589:IPR017853:IPR014756;
FT                   KEGG: bcv:Bcav_1334 1,4-alpha-glucan branching enzyme;
FT                   PFAM: alpha amylase all-beta; glycoside hydrolase family 13
FT                   domain protein; alpha amylase catalytic region; SMART:
FT                   alpha amylase catalytic sub domain; SPTR: D0WRV2
FT                   1,4-alpha-glucan branching enzyme; TIGRFAM:
FT                   1,4-alpha-glucan branching enzyme; PFAM: Alpha amylase,
FT                   C-terminal all-beta domain; Alpha amylase, catalytic
FT                   domain; Carbohydrate-binding module 48 (Isoamylase
FT                   N-terminal domain); TIGRFAM:
FT                   alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92138"
FT                   /db_xref="GOA:D7BMI9"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMI9"
FT                   /protein_id="ADH92138.1"
FT                   /translation="MNAKLEPLNVGTDILDAISHGYYHAPHDVLGPHSDGTNLTIRVIR
FT                   QLADAVTVVTLDGEYPAVHEHNGVWVAVLPGKEIRDYRIRARYGDFDSTGDDGYRFLPT
FT                   VGEMDTYLFGEGRHERLWEVMGAHLRTYETDMGVVTGTSFAVWAPNAKAVRVVGDFNAW
FT                   NGTVSSMRTMGTSGVWELFIPGAKEGSHYKFEIQYPDGSWHQKADPFARRTEVPPSTAS
FT                   IITSTHFTWSDEEWVEQRGASDPHAGPISIYEVHLGSWRMGLDFKELAEQLIGHIKYLG
FT                   FTHVEFMPLAEHPFGPSWGYQVTGYYSPTARFGTPDELRYLINELHKAGIGVIMDWVPA
FT                   HFPKDDWALARFDGTPLFEDPNPLRGEHPDWGTYIFNFGRNEVKNFLVANALYWLEEFH
FT                   IDGIRVDAVASMLYLDYSRQAGQWQPNQYGGRENLEAISFIQEANATAYRNHPGIMMIA
FT                   EESTSWEGVTRMTSEGGLGYGLKWNMGWMNDTLHYMAEEPINRRWHHGEITFSMVYAFS
FT                   EHFALPISHDEVVHGKGSLYEKMPGDAWQKLAGVRLLFGYQWAHPGKQLLFMGQEFAQI
FT                   SEWNEGKGLDWWLTDNPNHDGVMSCLARLNEVYKEHPALWSDDFTQRGFEWIDGSDGDN
FT                   NVLTFIRKSSIDDDVVVAAINFAGTPHLDYRIGLPEAGEWEEIVNTDALEYGGSGVGNM
FT                   GCVVTEDVAWNGRAQSALVQLPPLGVVYLTPKRA"
FT   gene            complement(444419..445798)
FT                   /locus_tag="Arch_0384"
FT   CDS_pept        complement(444419..445798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0384"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="COGs: COG3281 Uncharacterized protein probably
FT                   involved in trehalose biosynthesis; InterPro
FT                   IPR002160:IPR002575:IPR011009; KEGG: cmi:CMM_2112 putative
FT                   phosphotransferase; PFAM: aminoglycoside
FT                   phosphotransferase; SPTR: D0WRV4 Pep2 protein; PFAM:
FT                   Phosphotransferase enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92139"
FT                   /db_xref="GOA:D7BMJ0"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMJ0"
FT                   /protein_id="ADH92139.1"
FT                   /translation="MIRISSNDVGACVAPWMAEARWFRGATVESMRFVASCALPPSQPG
FT                   AVTVLHLVECGSLMFSVPLTYYVGGVAENAIGVVAGSVAVVDATDDPVGQHDLYHLFYG
FT                   VSEPDVEPAVWIDDAGAELDLTMVPARSIRDLPAPASSHKLTSEQSNTSIIYRYDHLPE
FT                   NQPAGIICKLLRVIDRGHNPDVELQQALDSAGSCSVPRQYGSVNGTWDDGSSADLIVAQ
FT                   EFLAGSVDAWQVITNELATFGPTMSSGQRERIVALGRLTRDIHDQLSTACGTSVMSNHT
FT                   VVEHLKERAERAIADAPQLAEYRTDITELYDSVRDLAWPRAQRIHGDFHLGQVLDVPER
FT                   GWVALDFEGEPLRPLSQRTQPDIALRDVAGMLRSFDYAAGTAEKAGADHDACRSWERAA
FT                   SAAYLEGYGHLTAAETHLLNAFVLDKALYEVSYETASRPTWVDIPLAGVKTALLRKTRT
FT                   T"
FT   gene            complement(445785..447470)
FT                   /locus_tag="Arch_0385"
FT   CDS_pept        complement(445785..447470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0385"
FT                   /product="trehalose synthase"
FT                   /EC_number="5.4.99.16"
FT                   /note="COGs: COG0366 Glycosidase;
FT                   InterProIPR013781:IPR006047:IPR012810:IPR006589:IPR 017853;
FT                   KEGG: xce:Xcel_2418 trehalose synthase; PFAM: alpha amylase
FT                   catalytic region; SMART: alpha amylase catalytic sub
FT                   domain; SPTR: D1BCY4 Trehalose synthase; TIGRFAM: trehalose
FT                   synthase; PFAM: Alpha amylase, catalytic domain; TIGRFAM:
FT                   trehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92140"
FT                   /db_xref="GOA:D7BMJ1"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMJ1"
FT                   /protein_id="ADH92140.1"
FT                   /translation="MSSLHFPTEKPGLASDPEWFRTAVFYEVLLRAFGDTEGSGTGDFR
FT                   GLIEHLDYLQWLGVDALWIPPFYPSPMRDGGYDISHYTAIKSEYGTMEDFAELVEQAHE
FT                   RGIRIVIDIVANHTSDQHPWFQSSRANPDGPYGDFYVWRDTDEEYADARIIFIDTESSN
FT                   WTFDPVRRQYFWHRFFSHQPDLNFENPAVQDAIIDVVKFWCEIGVDGFRLDAIPYLFEE
FT                   EGTNCENLPRTHEFIARLRREIDAAYPGRIFIAEANQWPQDVVEYYGSDDSPECHMCFH
FT                   FPVMPRIYYALRDQRATAIREILKATPDIPAGGQWGTFLRNHDELTLEMVSTEERAKMY
FT                   GWYAEDPRMRANVGIRRRLAPLLGNSRAEIELANALLLSLPGSPCLYYGDEIGMGDNIW
FT                   LEDRDSVRTPMQWTPDRNAGFSLADPGKLYLPLVQSLVYHYQGTNVESQLAQPASLLHW
FT                   MRGIIQVRSQYPVMGNGAFTLCDTDNESVLAFTRTNADQVMLCVMNVANTPRAATISVP
FT                   DFAGFAARDVFGGADFPSVSPGGTYQLTLGSRDFFWLELSDDKD"
FT   gene            complement(447467..449542)
FT                   /locus_tag="Arch_0386"
FT   CDS_pept        complement(447467..449542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0386"
FT                   /product="alpha amylase catalytic region"
FT                   /note="COGs: COG0366 Glycosidase; InterPro
FT                   IPR013781:IPR006047:IPR006589:IPR017853; KEGG:
FT                   bcv:Bcav_1337 alpha amylase catalytic region; PFAM: alpha
FT                   amylase catalytic region; SMART: alpha amylase catalytic
FT                   sub domain; SPTR: D0WRV5 Alpha-amylase family protein;
FT                   PFAM: Alpha amylase, catalytic domain; Domain of unknown
FT                   function (DUF3416)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92141"
FT                   /db_xref="GOA:D7BMJ2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/Swiss-Prot:D7BMJ2"
FT                   /protein_id="ADH92141.1"
FT                   /translation="MSTLQHKTSSARRSSRRSVAAPDFVAVSRIPIVEVSPQLLDGTAP
FT                   VKSTVDESFPVQATIFREGHDKFAARAVLVDGAGHTVDSVPMCDVSPGLFRFEGWLTPR
FT                   VPGPHRFFVEAWSDPYATWLHNAEIKVPAGIDVGLVFAEAEVLFKAALKGTPVRSGERA
FT                   AIRDALTVISKRRALPEVKLAAARSEEVRAAFAAYPVKELVSRSREYPVFVDRVRALVG
FT                   SWYELFPRSVGATRDSESGEWTSGTLRTAATDLDRVAGMGFDVVYIPPVHPIGLTNRKG
FT                   RNNSLTAVPGDPGSPYAIGSDAAGGHDAIEPSLGTFEDFDVFVGRAHELGMEVALDLAL
FT                   QCSPDHPWVKEHPEWFTARPDGTIAYAENPPKKYQDIYPLNFDNDPEGIYKEIKRVVEL
FT                   WVAHGVTIFRVDNPHTKPVGFWQRLLAEFRVEHPEVIFLAEAFTNPPMMQTLGTVGFHQ
FT                   SYTYFTWRNERQEIEEYLMEVSHESSHRMRPAFWPTTHDILTPYIQRGGISAAAIRAIL
FT                   AATGSPTWGIYNGYELIENIARPGAEEHIDNEKYEFKPRNYALAEQNGMATLLTMLNSI
FT                   RSKHKALQRLRNVTINPTSNDKIVSFTKVARPEETADGVMDAVIVVVNLDPYASRDATV
FT                   YLDLSPFGISPRWDGGPIIEVTDEMSGETYLWNEAPYVHLDPHGQVAHVLSVKVLS"
FT   gene            complement(449643..450314)
FT                   /locus_tag="Arch_0387"
FT   CDS_pept        complement(449643..450314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0387"
FT                   /product="methylated-DNA/protein-cysteinemethyltransferase"
FT                   /note="COGs: COG0350 Methylated DNA-protein cysteine
FT                   methyltransferase; InterPro IPR011991:IPR014048; KEGG:
FT                   cpc:Cpar_1288 methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; SPTR: B3QP38
FT                   Methylated-DNA/protein-cysteine methyltransferase; TIGRFAM:
FT                   methylated-DNA/protein-cysteine methyltransferase; PFAM:
FT                   6-O-methylguanine DNA methyltransferase, DNA binding
FT                   domain; TIGRFAM: O-6-methylguanine DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92142"
FT                   /db_xref="GOA:D7BMJ3"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMJ3"
FT                   /protein_id="ADH92142.1"
FT                   /translation="MHIRLALHTGNSVIDSYGLEATICEGFLVATTFVPHRDTGEWLDT
FT                   QLIQAGSISTADTANTTDHITTTGRANATGRTTDHANGTTAPAASEDLHTAALLETAFA
FT                   GWRNTGDPSLFRHLPLAPAHTAFAAQIRAALLALAPSQTISYHSLAACTHSPNAIRAAA
FT                   SACARNPLPLIVPCHAVLPTPAQHMLASTPQALNTPDFSPGKYAFGSDLKLAILRHESC
FT                   F"
FT   gene            complement(450671..453037)
FT                   /locus_tag="Arch_0388"
FT   CDS_pept        complement(450671..453037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0388"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="COGs: COG0058 Glucan phosphorylase; InterPro
FT                   IPR000811:IPR011833; KEGG: pac:PPA0081 carbohydrate
FT                   phosphorylase; PFAM: glycosyl transferase family 35; SPTR:
FT                   C0VYI8 Phosphorylase; TIGRFAM: glycogen/starch/alpha-glucan
FT                   phosphorylase; PFAM: Carbohydrate phosphorylase; TIGRFAM:
FT                   glycogen/starch/alpha-glucan phosphorylases"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92143"
FT                   /db_xref="GOA:D7BMJ4"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMJ4"
FT                   /protein_id="ADH92143.1"
FT                   /translation="MTKPDTTTALGMQVRAVSGRNEHSGTPMEYWTAMSNTVVDRIADN
FT                   WQRTEETYNATRMQHYFSAEFLMGRALLNNLTNLGMVEEATEALNAFGQNLSDVLEEEH
FT                   DAALGNGGLGRLAACFLDSCATMDLPVRGYGILYRYGLFRQLFNEGFQEEEPDAWMEEG
FT                   YPFVVRREEEQRLVKYADLDVRAVPYDMPITGYGTKNVNTLRMWKAEPTKEFDYDAFNS
FT                   QRFTDAIVERERVHDICRVLYPNDSTYEGKVLRVRQQYFFCSASLQAIVDNHLKQQGSL
FT                   DNFHEFNCIQLNDTHPVLAIPELMRILLDEHGYSWEAAWDIASHTFGYTNHTVLAEALE
FT                   TWEMTIFDRLFPRISEIVREIDRRFREELATEGYHPGKIEYMAPIQGNRVHMAWIACYA
FT                   SYSINGVAALHTEIIKKDTLHDWYDIWPERFNNKTNGVTPRRWLNQCNPRLASLLTELL
FT                   GSDAWVRNLDELKKLEKFGEDLTVLDRVNDIKAANKADFAAWIKNRQGVTVNPDAIFDV
FT                   QIKRLHEYKRQLMNAIYILDLYFRLKDDPTLDVTPRLFIFGAKAAPGYVRAKAIIKLIN
FT                   EIGRLINNDPDVAGKLQVLFVENYNVSPAEHIIPASDVSEQISTAGKEASGTSNMKFMM
FT                   NGALTLGTLDGANVEILDSVGEENAYIFGAKEEELPELRTNYNPRATAEHTPGLKRVLD
FT                   AFVDGTLNDGGTGMFHDLLNSLYEPSWEPADVYYVLGDFASYRETRDRMAADYTDRRHW
FT                   ARMVWKNIVESGRFSSDRTIGDYAREVWKIDPQTI"
FT   gene            complement(453223..454329)
FT                   /locus_tag="Arch_0389"
FT   CDS_pept        complement(453223..454329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0389"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /note="COGs: COG0180 Tryptophanyl-tRNA synthetase; InterPro
FT                   IPR014729:IPR001412:IPR002306:IPR002305; KEGG: pac:PPA1327
FT                   tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib; SPTR: C0W021 Tryptophan--tRNA ligase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: tRNA
FT                   synthetases class I (W and Y); TIGRFAM: tryptophanyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92144"
FT                   /db_xref="GOA:D7BMJ5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMJ5"
FT                   /protein_id="ADH92144.1"
FT                   /translation="MSENTPELAVENATSDASLEATRQMSDKINLAIDEDPSKFRVLTG
FT                   ARPTGHLHIGHYFGTLQNWVKLQKRGVDTWLLIADYQVITDRDEADSIQERTMSLLTDY
FT                   LAVGMDPEETVFFAHSQIPELNELVLPFLSVVTDAELRRNPTVKAEFEATHGRPMSGLL
FT                   LTYPVHQAADILFCKANLVPVGKDQLPHLEQARVIADRFEKRYNKGKKAKRIFPRPHAL
FT                   LSDATHVLGLDGEKMSKSRGNTIELRMSADETAKKLKRAVTDSDRHITYDPTNRPEVSN
FT                   LLLIASMCIGETPETIAERIGDGGGGTLKNVVTEALNEHLAPMRARRAELEKDQAYLRE
FT                   VLQRGIERAREQAQETLDDVHAALGMRY"
FT   gene            complement(454629..454931)
FT                   /pseudo
FT                   /locus_tag="Arch_0390"
FT   gene            complement(454950..457106)
FT                   /locus_tag="Arch_0391"
FT   CDS_pept        complement(454950..457106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0391"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /note="COGs: COG1523 Type II secretory pathway pullulanase
FT                   PulA and related glycosidase;
FT                   InterProIPR013783:IPR013781:IPR004193:IPR006047:IPR
FT                   011837:IPR006589:IPR017853:IPR014756; KEGG: bcv:Bcav_1345
FT                   glycogen debranching enzyme GlgX; PFAM: glycoside hydrolase
FT                   family 13 domain protein; alpha amylase catalytic region;
FT                   SMART: alpha amylase catalytic sub domain; SPTR: D0WRW1
FT                   Glycogen debranching enzyme GlgX; TIGRFAM: glycogen
FT                   debranching enzyme GlgX; PFAM: Alpha amylase, catalytic
FT                   domain; Carbohydrate-binding module 48 (Isoamylase
FT                   N-terminal domain); TIGRFAM: glycogen debranching enzyme
FT                   GlgX"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92145"
FT                   /db_xref="GOA:D7BMJ6"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMJ6"
FT                   /protein_id="ADH92145.1"
FT                   /translation="MPNTPYITAPLAEPSLTVPPRLGAHLVGDGVDIAIEAPHASAVWA
FT                   CFMDPADPTSEWQVALRPGMHGVWSGHVSSISAGQFYGVRADGRWDPAAGHVYNPAKLL
FT                   LDPYARAVGRAPRLDSALYGHAVDDAAAPLEQSTLDSGHVAPLGVIVADEPARGARPNI
FT                   PWDKTIVYEAHVVGLTKTLPRVPEELRGTYAGLGHPATIEHLTSLGVTAVELLPIHAKM
FT                   NEPFLENKGLENYWGYNTLGFFAPEPSYASAASQSAGAQAVIDEVKGMVGALHDAGIEV
FT                   LLDVVYNHSCEAGVDGPTVSWRGLDSSLYYRHDSSNPAALKDTTGCGNSFDFRRTSVMR
FT                   MTLDSLRYWVEIIGVDGFRFDLAATLGREGDNFNPNHPLYMAIATDPVLSGVKLINEPW
FT                   DVGYGGWRTGQFPVPTADWNDRFRDTLRAFWLTEPAAILNGGHGSDLRDLATRMAGSAD
FT                   LFGHGRLPGGRGVHASVNFVTAHDGFSLNDLTAYSMKHNDLNLEENRDGSDNNLSWNHG
FT                   VEGTASETIAAMRRKSARNLMGCLVMAAGTPMLTAGDEILKTQHGNNNAYCQNTPISWL
FT                   DWNIGEHEANMLATTSFLLRLRQEHSVFRPVQFFTGSPRDGDELRDMEWLDADGNRMND
FT                   YTWFNPQERLVQMLRSGRGVDRDALVIINGQDNSERVIIPWGRGKSFDLVWASQWERPR
FT                   DSFDSYEPGESLIMAPFSMAILLS"
FT   gene            457234..458022
FT                   /locus_tag="Arch_0392"
FT   CDS_pept        457234..458022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0392"
FT                   /product="NUDIX hydrolase"
FT                   /note="COGs: COG2816 NTP pyrophosphohydrolase containing a
FT                   Zn-finger probably nucleic-acid-binding; InterPro
FT                   IPR000086:IPR020084:IPR015376:IPR015797; KEGG:
FT                   nca:Noca_1514 NUDIX hydrolase; PFAM: NUDIX hydrolase; Zinc
FT                   ribbon NADH pyrophosphatase; SPTR: D1BAV9 Zn-finger
FT                   containing NTP pyrophosphohydrolase; PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92146"
FT                   /db_xref="GOA:D7BMJ7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMJ7"
FT                   /protein_id="ADH92146.1"
FT                   /translation="MDPEFRCGLGRVRVMRVCDGLIGVRAGAVAWERLRTEPVGLVYLG
FT                   SDGDHDFCVIDDDGAEMADLDFIDVRAGVADLDNADIQLVWSALALTAWHRRALFCERC
FT                   GSALESANYGRKRVCENGHEVFARMDPAVIMGIINGAGELLVARNRRWPVGRISVLAGF
FT                   VEAGETFEAAVRREVWEEAGVRVGAVEYAGSQPWPFPRSMMVAFYGYTADREVRPDGDE
FT                   IVEAFFIGKDELRARVDAGELSLPSAASVGRALVMHWLCG"
FT   sig_peptide     457234..457323
FT                   /locus_tag="Arch_0392"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            458134..460167
FT                   /locus_tag="Arch_0393"
FT   CDS_pept        458134..460167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0393"
FT                   /product="UvrD/REP helicase"
FT                   /note="COGs: COG0210 Superfamily I DNA and RNA helicase;
FT                   InterPro IPR002121:IPR014016:IPR014017:IPR000212; KEGG:
FT                   bcv:Bcav_2897 UvrD/REP helicase; PFAM: UvrD/REP helicase;
FT                   HRDC domain protein; SMART: HRDC domain protein; SPTR:
FT                   D0WRX3 ATP-dependent DNA helicase II; PFAM: HRDC domain;
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92147"
FT                   /db_xref="GOA:D7BMJ8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMJ8"
FT                   /protein_id="ADH92147.1"
FT                   /translation="MHPEAILESLDPDQREVARNVHGPMAVLAGAGTGKTRAITHRIAY
FT                   AVHSGAFDPRNILAVTFTTKAASEMRSRLRDLGVRPVNARTFHSAALAQLRHFWPQAIG
FT                   GYVPEIKESKIALVSGAAASLGLDNSKPAVRDLAAEIEWSKVSLCPPEEYVQRATELHR
FT                   DPVAGATYQDIAHLIRRYEEAKTERGVIDFEDVILLLIGIMRDEPEIARIIRHQYRHFV
FT                   VDEYQDVSPMQHRLLDLWLGDRRDLCVVGDVAQTIYSFAGAQSAYLSEFSRHYPQAKIV
FT                   TLNRDYRSTPQVVDLANTVISQARLDGAVHLTSMLPSGRPVAFDAYADDTDEATSIAQK
FT                   IVSLVNHGAKYSDIAILYRTNAQSAAFETALTDLGIPVSIKDAERFFQRKDVKEAMVML
FT                   RSVARLPQHKGLEDTVVDGLIQMGWRPEAPTGRGAIRERWDALNALREIAAEMEEKRGA
FT                   DVEEFLAEMRERAEMMNEPVSNSVTLASLHASKGLEWDSVFLVGMSEGLMPISLAKAGE
FT                   GIEEERRLFYVGITRAKHHLSISYARGNSGRTDRKRSRFLEDVWATTQSRATQARKKSA
FT                   ELAYEFETYHPQDMDLFNDLVRWRRGVADESGRKPYLILHDSVLRDIAVNKPRNLAELG
FT                   KIKGVGAMKLAYFGEAVLEIVNRTSIGSGRAASTGEMRWHLE"
FT   gene            complement(460111..461064)
FT                   /locus_tag="Arch_0394"
FT   CDS_pept        complement(460111..461064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_2892 hypothetical protein; SPTR:
FT                   D0WRX4 UBA/THIF-type NAD/FAD binding fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92148"
FT                   /db_xref="GOA:D7BMJ9"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMJ9"
FT                   /protein_id="ADH92148.1"
FT                   /translation="MQIIPGLPVLWREVDQIQIGYDPRTGVILSGLAPHELEFVDSLSR
FT                   PQSDLELAHRARQLHLSQPRVRDIVAMLDKAQVITTSQVGSPDVASSLRVRGHAPQYRS
FT                   TAHVRFARGDYVSVVAALILADAGVGIITCRDNASVQETDHPQMAENYTGIPRHLALTH
FT                   VLRARGMMNDEVIPPTVAVETGPYVINPVNGNHWLSAGIPVVHACIEEVDVVVGPTTIP
FT                   HESACASCMYLHYADADPFWNRLAMQAFGRTDVLADIASMELAGAHIAREVLALIDRLS
FT                   PSLTNRIVRIGPTPATPQLFEVPPHLSCGCSAAGSD"
FT   gene            complement(461157..462518)
FT                   /locus_tag="Arch_0395"
FT   CDS_pept        complement(461157..462518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG5282 conserved hypothetical protein;
FT                   InterPro IPR018766; KEGG: bcv:Bcav_2890 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2342; SPTR:
FT                   D0WRX5 Putative uncharacterized protein; TIGRFAM: conserved
FT                   hypothetical protein; PFAM: Uncharacterised conserved
FT                   protein (DUF2342); TIGRFAM: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92149"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMK0"
FT                   /protein_id="ADH92149.1"
FT                   /translation="MAEDNKDQWEEMLRAIMGDSADEVIRSMKDSGMDPSALGMAISPD
FT                   QMNAVTAQLRAMLGSSGEGPVNWKIAEEVARDTIIRSHMDSLSGTEGDKIRSALSVASL
FT                   WLDAVTDINPTSGPNLAWTRLDWIAHSLPTFRKLLDPLGSNINRAFSDVMKQQMGHLPS
FT                   DMAGMLGDPATLMAGLVSSFLGMQYGGALAQLAISSFGTADIGVPLMEGSSAALVGANV
FT                   SDFASDLEVSDDDVRMYIAVREAAAARLFASVPWLRSRIIDTVAEFARGIEIDMQSIED
FT                   QARSFDFSNPEALQGMDFTGVFSMEQSEAQKDALARLEHILSLIEGWVAAVSARAVLAY
FT                   IPSAVALREMFARRNATSHPAKAVWGVQLGVDLTPRHLRAATSFWERAARERGDAGRDQ
FT                   LWSHPDLLPTLENLENPDSFFSPEAAAIESELDSFLAELLDGGTDDSSSKATGE"
FT   gene            462645..463763
FT                   /locus_tag="Arch_0396"
FT   CDS_pept        462645..463763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3480 secreted protein containing a PDZ
FT                   domain; InterPro IPR020568; KEGG: cms:CMS_1888 hypothetical
FT                   protein; SPTR: D0WRX7 Pdz/dhr/glgf protein; PFAM: Lon
FT                   protease (S16) C-terminal proteolytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92150"
FT                   /db_xref="GOA:D7BMK1"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMK1"
FT                   /protein_id="ADH92150.1"
FT                   /translation="MKKVSWPAKSPFIPGILFGLFAVATLVMPTSFIVMAPGPANDVTA
FT                   LYDGKRIVSISGQKPYPSDTHLYMTTVSAYGNPDTGASGGTVASALFDSSARVVPVRAL
FT                   YASEETNDAVSSRDHEMMKSSQETAAAVAMERAGLDVKMTLEITGSTNKNAQVNKGDII
FT                   SAVQTPDMDKPQNIASFSQLSSALEKVKPGTGIKVTVIRDGKETVVPVTTVPRQPEFDG
FT                   SVRPGSVMGVFITVTKLELPVQVSYLIDGIGGPSAGNIFSLALYDQLTPGSLGGKNSIA
FT                   GTGAISWDGSIQPIGGINQKLAGANEAGVKNFLAPAANCSETRGHVPTGMNVWAVRTID
FT                   DSIQAAEAIANGDTSKLVPCSAVAAPKMRMGE"
FT   sig_peptide     462645..462764
FT                   /locus_tag="Arch_0396"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(463767..464315)
FT                   /locus_tag="Arch_0397"
FT   CDS_pept        complement(463767..464315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: jde:Jden_0724 hypothetical protein; SPTR:
FT                   C7R1S0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92151"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMK2"
FT                   /protein_id="ADH92151.1"
FT                   /translation="MTTEISPELKSLRDATLDIERHVATGGWDAPIRLFALVRAQAALA
FT                   ANPELANELPADVHAESIADPHLLFSVEQEDLPQTASLDELLGHIVWPEEVDGAAISVE
FT                   RIVLPPSAESDIPDDDEAALSYLQNHPERQDVRMVVAALRIGATWSVIRMRSHDSDADV
FT                   LSGENLVEGLTAAIKATFE"
FT   gene            464457..467516
FT                   /locus_tag="Arch_0398"
FT   CDS_pept        464457..467516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0398"
FT                   /product="protein of unknown function UPF0182"
FT                   /note="COGs: COG1615 conserved hypothetical protein;
FT                   InterPro IPR005372; KEGG: bcv:Bcav_2885 protein of unknown
FT                   function UPF0182; PFAM: protein of unknown function
FT                   UPF0182; SPTR: D0WRY1 Putative integral membrane protein;
FT                   PFAM: Uncharacterised protein family (UPF0182)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92152"
FT                   /db_xref="GOA:D7BMK3"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMK3"
FT                   /protein_id="ADH92152.1"
FT                   /translation="MSSSTANMPRPPAKQGLPGGAFTPTLVVLGVIVFALIIVAEFWTE
FT                   MAWFSQIGASRVFWTQYGAAISLGVVGALLAAIVFALNLRVALGKARSSDDVVVSTNPL
FT                   AKNVQWLRRHSVITYGLIPLVIGALFGAGLAGSWRTFLLWFNGTSFGTKDPEYGLDVSF
FT                   FVFSLPALQIVLSFLSTLLVISLGASIVGYWANGAFVFRGNKPHLKGKAQLHLGILLAA
FT                   GAFLFAGNYWLGRYNLLLGNKQRFSGATYTDINASQPGLTILAIASALVALMFLYAGIV
FT                   KRWKPAVVGIASVFAVALVVNAAYPALLQRFKVDPNAAELESEFIQRNINATLDAYGLA
FT                   NVEKQQYEARTTAEAGQLRQDSQTTAQIRLLDPNIVDPSFNQLQQNRQYYSFKEPLTVD
FT                   RYTINGELRDTVIAVRELNLDGLDNERRSWVNDHTVFTHGFGVAAAYGNTVTSKGDPAF
FT                   WEAGIPSTGELGKFEPRVYFGQQSPEYSIVGAPEKAKPWELDYPNDAAPNGQVNTTYKG
FT                   DGGPSIGNLWSKLMFAIKYRSTELFFSDRVTSHSQILFDRDPHKRVAKVAPYLTLDSKA
FT                   VPAVVDMDSNPDTPSELVWIIDGYTTTNNYPYSARETLNEATADSNNRAGARIAGGTNE
FT                   INYIRNSVKAVVNAYDGKVTLYQWDDKDPILKAWDGIFPGQITPLKKMPGDLIAHVRYP
FT                   EDLFKVQRTLLARYHVEDALSFYSGGDFWQIPREPTAKSETEVGAPAQPPYYLTMKMPG
FT                   QDEASFSLYSAYIPGGNTKRNVMTGFLAADSNAGNETGKIAPGYGKLRLLELPRDLTVP
FT                   GPGQAQNTMFANPKVSTDLNLLRQGGTKVLEGNLLSLPVGGGLLYVQPVYVQASKGTQY
FT                   PTLQYVLTLFGDSVGFAPTLQESLDMVFGGDAGVNAGDANIVGNKEAPVDGNQVKVPAK
FT                   PDGKKDAKPDPAEKPAPAGPSAPDAGKPATPSTPAADLAAALNDAKDAIKSADSAMKSG
FT                   DWAAYGDAQKKLNAAITRAAEAQQKVDAGK"
FT   sig_peptide     464457..464576
FT                   /locus_tag="Arch_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(468011..468727)
FT                   /locus_tag="Arch_0399"
FT   CDS_pept        complement(468011..468727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0399"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ttj:TTHA0096 NADH-quinone oxidoreductase chain
FT                   13; SPTR: Q72GE0 NADH-quinone oxidoreductase chain M"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92153"
FT                   /db_xref="GOA:D7BMK4"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMK4"
FT                   /protein_id="ADH92153.1"
FT                   /translation="MKLASKVFFNKQLIWMSLAILGTVIGALLANLGLTYYLSNAGFIV
FT                   SDFYMGVTEGANLTWYSKAIGANVLGLSSLFPFIAVAVISTYSAQHTRVFLGAGMERRS
FT                   IFYIMQLLIISLTAFFTVIVTLLFSGTSALGLASYDGYGVTTVVYTAMLLVTIQEVTLL
FT                   AIAIFLRFSAGMALAIVFAPPLLFGAFVGYTGFFEIPRVIEFLNNPYGLIGLYAAGFVA
FT                   VVALNWAIITRLPMRR"
FT   sig_peptide     complement(468647..468727)
FT                   /locus_tag="Arch_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(468724..469476)
FT                   /locus_tag="Arch_0400"
FT   CDS_pept        complement(468724..469476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0400"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439:IPR003593; KEGG:
FT                   xce:Xcel_3322 ABC transporter related protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: D0WP13
FT                   Putative ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92154"
FT                   /db_xref="GOA:D7BMK5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMK5"
FT                   /protein_id="ADH92154.1"
FT                   /translation="MTALPLQVHLDKAGYSYFRHNALTSVSTTIEAGKITGLLGRNGCG
FT                   KSTLSMMLAGQLKSKGHVRFTWDSETSSSPIWNNPKLMPHVTLVSDETSVLLEKKLSDT
FT                   IKIWEKTRPEFDTELCHTLLDQWGIKLKRKPGKLSRGQKSAFYASLGLASRAPLTIFDE
FT                   VHIGMDAVVRQEFYDALLADYVAHPRTIIISSHLVNEIEDIIENVVILDAGHVAASGTA
FT                   DELRERHSSPEKLASLTDVLIATTRRNS"
FT   gene            complement(469473..469862)
FT                   /locus_tag="Arch_0401"
FT   CDS_pept        complement(469473..469862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0401"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG1725 transcriptional regulator protein;
FT                   InterPro IPR011991:IPR000524; KEGG: kse:Ksed_02920
FT                   predicted transcriptional regulator; PFAM: regulatory
FT                   protein GntR HTH; SMART: regulatory protein GntR HTH; SPTR:
FT                   D0WP12 Transcriptional regulator, GntR family; PFAM:
FT                   Bacterial regulatory proteins, gntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92155"
FT                   /db_xref="GOA:D7BMK6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMK6"
FT                   /protein_id="ADH92155.1"
FT                   /translation="MASDSSALNFNSTTPIYLQIAQDIRDKILNQELQAGAQIMSTTQY
FT                   ATTYRINPATANKAFTILQNEGLIYKQRGIGMFVTDNAEEILRKTGQQTYVNSTLAPAI
FT                   NEGLALGFTSTDILSLIHTLLEETK"
FT   gene            470020..470096
FT                   /locus_tag="Arch_R0010"
FT   tRNA            470020..470096
FT                   /locus_tag="Arch_R0010"
FT                   /product="tRNA-Met"
FT   gene            470198..470641
FT                   /locus_tag="Arch_0402"
FT   CDS_pept        470198..470641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0402"
FT                   /product="pyrimidine dimer DNA glycosylase/DNA-(apurinic or
FT                   apyrimidinic site) lyase"
FT                   /note="KEGG: kse:Ksed_00360 pyrimidine dimer DNA
FT                   glycosylase/DNA-(apurinic or apyrimidinic site) lyase;
FT                   SPTR: C7NIG2 Pyrimidine dimer DNA glycosylase
FT                   /DNA-(Apurinic or apyrimidinic site) lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92156"
FT                   /db_xref="GOA:D7BMK7"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMK7"
FT                   /protein_id="ADH92156.1"
FT                   /translation="MRLWTIHPSQLDRAALIAGWREGLLAQKVLAGLTKGYKNHPQLDR
FT                   FKAQPEPMKAIGAWLSGLQEEATARGYSFDATKITFPAIPEHPINIPVTDGQLAYEAAW
FT                   LRSKIAVRAPHLLTSEPWISGEFRAHPIFVVVPGPIEPWEKIA"
FT   gene            470965..471513
FT                   /locus_tag="Arch_0403"
FT   CDS_pept        470965..471513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0403"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="InterPro IPR011991:IPR005149; KEGG: art:Arth_0527
FT                   PadR family transcriptional regulator; PFAM:
FT                   transcriptional regulator PadR family protein; SPTR: C2KN54
FT                   PadR family transcriptional regulator; PFAM:
FT                   Transcriptional regulator PadR-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92157"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMK8"
FT                   /protein_id="ADH92157.1"
FT                   /translation="MEPQYAFLGLLTREPNYGYELKKLYDQLFAGDKPILPGQVYATLA
FT                   RLLRDAKVIEIDDEGTPGGPARTRYALTETGRHAVAEWLQQPEVPSPTLQANMYAKTVI
FT                   ALIVDGDAAPYLRAQRAYHLQRMRTLTSRKADAPIAKKLLIDNAIFHIEADLRWIELAS
FT                   ARLAQLKEELCLKSSKPQI"
FT   gene            471483..472145
FT                   /locus_tag="Arch_0404"
FT   CDS_pept        471483..472145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0404"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1136 ABC-type antimicrobial peptide
FT                   transport system ATPase component; InterPro
FT                   IPR017871:IPR003439:IPR003593; KEGG: cai:Caci_7925 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: D0YQR1 Lipoprotein releasing system,
FT                   ATP-binding protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92158"
FT                   /db_xref="GOA:D7BMK9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMK9"
FT                   /protein_id="ADH92158.1"
FT                   /translation="MSEILKATNLTKTYGSTHAMRGISLDVSRGEALAIMGPSGSGKST
FT                   LLHALAGIELPDSGTVSFNGLELTTMSDAERTILRRRDFGFVFQFSQLVPELTALDNVA
FT                   VPLLLDGMAKSKAYYQAAEWLEKVGLYDHAQSLPGQLSGGEAQRVAIARALCPKPSVLF
FT                   ADEPTGALDSLNSESVMTMFMDIARNTGMTVVMVTHEPLIAAYADREVIVRDGLLEG"
FT   gene            472152..474344
FT                   /locus_tag="Arch_0405"
FT   CDS_pept        472152..474344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0405"
FT                   /product="protein of unknown function DUF214"
FT                   /note="InterPro IPR003838; KEGG: sro:Sros_4389 hypothetical
FT                   protein; PFAM: protein of unknown function DUF214; SPTR:
FT                   D0YQR0 Putative efflux ABC transporter, permease protein;
FT                   PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92159"
FT                   /db_xref="GOA:D7BML0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:D7BML0"
FT                   /protein_id="ADH92159.1"
FT                   /translation="MHLSWILFKNSLQRTKGRLALITGAVALGVMLLFTAASFHNALGN
FT                   DTYTAWGRAVANEARAQADGAPEPDVKESVKIHIAVDDPLRTVGTRQFFPVDVDTAGVV
FT                   NPPDLFGMTWPKDGEFLVSPGLRAIMNEHPEYRLEDRFGTKDRGDLPPQLTAGPDDLLV
FT                   FRGRALPDSGTRISDFTQGEPESLRVSQIIMYLGLIVVIFPVLMLIAISATLGSVQREQ
FT                   RYAALRLVGATSRQIANIMVVEALVGAVLGYLVGVFGWLAIRPIYPMIPIDGERLWADS
FT                   FGVSPLQAGVIALVAAGLVVAAHAWGMRGIRVSPLGVVRRQKTQGRPSPLRILPMLVSA
FT                   GVLAFLYITVDHNAGVTDDAFVLLGCVIVMMVGIVVASPWVTYLVAGFLAKRARRAPSV
FT                   IGLTYVRAHASRISRSVSGVLLALFAGTLFLTAVSEAESVFARESSQVHSLRTGSVVIT
FT                   NFDDDDAARTVALLKGEPEVDDIRQVPYIAGAWSVVDCAEIGGFMDIQCADGVAGVNLH
FT                   ASAIDRAGVVYADNLDDFKADVAQDFGAATSDPKSSLLVRLTNPDSVEQFRSTLARLDI
FT                   FTLDQWYSVAFGGEKATVSGAATIVLMTYLVYGGIAGTLVIAVISMLVSTYASLLERRR
FT                   SLLSLRLNGMRPKDMTAMMLIESVGPLVVMALIASMLGFATGWVMLQIFSPALDASFDV
FT                   MLFVALGLALTLAALAMLSLVPTMKRMTQPANNRHE"
FT   sig_peptide     472152..472265
FT                   /locus_tag="Arch_0405"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            474387..474971
FT                   /locus_tag="Arch_0406"
FT   CDS_pept        474387..474971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0406"
FT                   /product="putative molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A"
FT                   /note="COGs: COG0746 Molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A; InterPro IPR002052; KEGG:
FT                   pac:PPA0512 putative molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A; SPTR: C2BVS3 Molybdopterin-guanine
FT                   dinucleotide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92160"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7BML1"
FT                   /protein_id="ADH92160.1"
FT                   /translation="MVHTAIILAGGTARRLGGVSKPDYNVAGRRLLDIVLDELDMHNVP
FT                   AERVVVVGPPTLSVPTGVRRVLEDPPYGGPLAGIGAGVDCLDLADSDLVAFGTCDAPLA
FT                   SRMYSQLVEAVNNDPTSDGAAPVTADAEHWIQYMHGVYRFGVLKNLVTERDRPFRSAFR
FT                   HLNVATVSDCSNWCIDVDTPDDAYRLAEMLA"
FT   gene            complement(474975..475646)
FT                   /locus_tag="Arch_0407"
FT   CDS_pept        complement(474975..475646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0407"
FT                   /product="FMN-binding negative transcriptional regulator"
FT                   /note="COGs: COG2808 Transcriptional regulator; InterPro
FT                   IPR007396; KEGG: bvi:Bcep1808_3517 negative transcriptional
FT                   regulator; PFAM: Negative transcriptional regulator; SPTR:
FT                   C1WYZ0 Transcriptional regulator, COG2808; PFAM: Putative
FT                   FMN-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92161"
FT                   /db_xref="GOA:D7BML2"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D7BML2"
FT                   /protein_id="ADH92161.1"
FT                   /translation="MYIAHQHLMNPTDALAYAVSVGVGELVTSGLNGLNATRVPFVVVE
FT                   RDSQLIIQAHLSRVNPQVNDFGEALLIVTGADAHIPGHYLPPEKPESMVPSAPTWDYVT
FT                   VHLRGPMVTFDDPDWKRTHWEALVEQHEKVWTLADTKEERLERVFNAVVGVEITITEQL
FT                   GKAKLHQNLASDDISALADKLESDGDTKIACLMRDISVPWAQAREARVEKARRGHTAPE
FT                   F"
FT   gene            complement(475657..476196)
FT                   /locus_tag="Arch_0408"
FT   CDS_pept        complement(475657..476196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0408"
FT                   /product="Dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="COGs: COG0262 Dihydrofolate reductase; InterPro
FT                   IPR017925:IPR001796:IPR012259; KEGG: lxx:Lxx09920
FT                   dihydrofolate reductase; PFAM: dihydrofolate reductase
FT                   region; PRIAM: Dihydrofolate reductase; SPTR: D0WS26
FT                   Dihydrofolate reductase; PFAM: Dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92162"
FT                   /db_xref="GOA:D7BML3"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D7BML3"
FT                   /protein_id="ADH92162.1"
FT                   /translation="MRLGAIWAQARNGAIGKDGTIPWHIPEDLALFRKVTWGSPVIMGR
FT                   RTWESLPPRFRPLPGRKNLVVTRDRGFLAEGADVVHTVDSAITAASESGADFSWIIGGA
FT                   QLYSSTLPLCDLLVVSHIDIEIADADALAPLVPDNWRAHPACIQTNIENLGYHVSVLSN
FT                   PESTISEQEIRALLAS"
FT   gene            complement(476193..476993)
FT                   /locus_tag="Arch_0409"
FT   CDS_pept        complement(476193..476993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0409"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="COGs: COG0207 Thymidylate synthase; InterPro
FT                   IPR000398; KEGG: nfa:nfa50220 thymidylate synthase; PFAM:
FT                   thymidylate synthase; PRIAM: Thymidylate synthase; SPTR:
FT                   D0WS27 Thymidylate synthase; TIGRFAM: thymidylate synthase;
FT                   PFAM: Thymidylate synthase; TIGRFAM: thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92163"
FT                   /db_xref="GOA:D7BML4"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:D7BML4"
FT                   /protein_id="ADH92163.1"
FT                   /translation="MIDRQYEDLLADVLANGTVKGDRTGTGTLSVFGRQLRYDLSQGFP
FT                   RITTKFVAMKAVKGELLWFLRGDTNISWLRERGISIWDEWANDDGDLGPVYGYQWRSWP
FT                   APSGEHIDQIANVIDQIKNNPDSRRLIVSAWNVADLDAMALQPCHAFFQFYVADGKLSC
FT                   QLYQRSADLFLGVPFNIASYALLTHMVAQQTGLDVGDFVWSGGDCHIYLNHLEQVREQI
FT                   SREPYPFPTLALTKAPDIFSYTMDDISAADGYQHHPALHAPVAV"
FT   gene            complement(476990..477508)
FT                   /locus_tag="Arch_0410"
FT   CDS_pept        complement(476990..477508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0410"
FT                   /product="Protein of unknown function DUF2505"
FT                   /note="InterPro IPR019639; KEGG: bcv:Bcav_2830 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2505; SPTR:
FT                   D0WS28 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF2505)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92164"
FT                   /db_xref="InterPro:IPR019639"
FT                   /db_xref="UniProtKB/TrEMBL:D7BML5"
FT                   /protein_id="ADH92164.1"
FT                   /translation="MLNRNMNITEDLHYAAPLEDVLALFRSEELVFRRLQEVGHSDYEF
FT                   EADTVDGKHRTTVSLAINSAQLPDQAATFLGKHITAQIIGVENVGDVGAHIDYTINTKL
FT                   PMSFKARMLLVSSGATTAGKLEIHMDVNIPFAGSMIERSVASKIPRVIRQDTELVNTLL
FT                   VERRAKESE"
FT   gene            477531..478955
FT                   /locus_tag="Arch_0411"
FT   CDS_pept        477531..478955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0411"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterPro IPR003594:IPR005467:IPR013656:IPR011495; KEGG:
FT                   bcv:Bcav_2829 signal transduction histidine kinase; PFAM:
FT                   histidine kinase dimerisation/phosphoacceptor; PAS fold-4
FT                   domain protein; ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; SPTR:
FT                   D0WS29 Sensor histidine kinase; PFAM: Histidine kinase;
FT                   Signal transduction histidine kinase; Histidine kinase-,
FT                   DNA gyrase B-, and HSP90-like ATPase; PAS fold; TIGRFAM:
FT                   PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92165"
FT                   /db_xref="GOA:D7BML6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR022066"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038424"
FT                   /db_xref="UniProtKB/TrEMBL:D7BML6"
FT                   /protein_id="ADH92165.1"
FT                   /translation="MSTLTNILQQRTALAFDQREWLHMLTGDWQLLADIMFADLFLVTA
FT                   TVDGPVIAAQARPATAATLYEVDVVGEVAERWRLNRIQEALSTGEVVTWGDDVVESTYI
FT                   PVNYRGRNIAVVVAVNALYPDRILSHAQQNYDSLAEQLAYMITTGEFPFSEAPSGYRHG
FT                   TPRVSDGLIHVNEEGVVVFASPNAVSHLRRIGVDEPLHDRVLAELVTAKIDDYSTVDES
FT                   LPVVLMGRAAWMAEVESHSVTISLRGVPLRKDGERLGAIILCRDVSELRRQEKELITKD
FT                   ATIREIHHRVKNNLQTVSALLRLQSRRASSEETRTALATAQRRVATIALVHQQLSQTIN
FT                   EVVDFDELFIPVLRMAVDIAVNDVHVESSFTGSFGLIRAEQAAALSVVLNEIISNAVEH
FT                   GLPEGGHVSVDALRDGYELTVTVRDDGVGIGSEGPGSGLGTQIVRTMVSSELHGRITWE
FT                   KAEEGGTLVTITMMMK"
FT   gene            complement(479024..479272)
FT                   /locus_tag="Arch_0412"
FT   CDS_pept        complement(479024..479272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0412"
FT                   /product="transcription factor WhiB"
FT                   /note="InterPro IPR003482; KEGG: kra:Krad_3795
FT                   transcription factor WhiB; PFAM: transcription factor WhiB;
FT                   SPTR: A6WEL9 Transcription factor WhiB; PFAM: Transcription
FT                   factor WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92166"
FT                   /db_xref="GOA:D7BML7"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:D7BML7"
FT                   /protein_id="ADH92166.1"
FT                   /translation="MDWRHDAACLDEDPELFFPVGSSSAALAQVERAKNICRTCDVVDT
FT                   CLKWAMDTNQDAGVWGAMSEDERRTLKRRSARARRVS"
FT   gene            complement(479419..481932)
FT                   /locus_tag="Arch_0413"
FT   CDS_pept        complement(479419..481932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0413"
FT                   /product="protein of unknown function DUF214"
FT                   /note="InterPro IPR003838; KEGG: bcv:Bcav_2825 protein of
FT                   unknown function DUF214; PFAM: protein of unknown function
FT                   DUF214; SPTR: C5V906 ABC transporter integral membrane
FT                   protein; PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92167"
FT                   /db_xref="GOA:D7BML8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:D7BML8"
FT                   /protein_id="ADH92167.1"
FT                   /translation="MFPFIFEHVVAFWRAYILPSIVIILSTMLIYMGLATQEYIDQSEP
FT                   YAAHASVSDADIRIFNTQLPARDFLRQVENLHTVRLAYSPTSLWGMVMTAAGSAHLNIK
FT                   SVPPKSLRIEDFYQGTYPTTTDEIALPTAVAQRLKVSLGDSVLLTIPAVGKHGTLRQLT
FT                   VCGVYSYSPLNRNFQSLFNAIVGLDTKELWIDTAGKQPIDNHGILVSGRPSVGLDKLKE
FT                   SVLSIPGTIVQTREEAYEKYLTATRAYVANLQGSGRALLIVPLLATILTLYYTGRHILR
FT                   TREREYRLLVTMGATQTHIFILAFLQLPFIGIAAITIGMLLGHIGGKLLHALIQLLPGL
FT                   HFLLPYFQPSLMVSIQTIVVMIAAVSAATIAAVWNATYLPLFHFAKNTRTSPMLLRVTN
FT                   WFGTVFLTTALLVLAALATRRGQIPDTWATYHATIALLSIAFLTLIAMVAHVAVTHQFR
FT                   DALTRGKAPLSVSLRPREAGAFDVLNNSLFSSRLVVTSVAMLVVALTTNASSAHLVNTI
FT                   ADEISPYDIAVSTDEENGVMLNDDVIHSVLSYPGVKNTLLVYSANVHIKEKGADFEPFD
FT                   MNIRSVDRRAAEKYFADDDHADIPERGIIQIPSDVMRYLNIHSGDALALPAADGGAVSF
FT                   KVQRSASPWIVMELADFHLVKTPNVVNELWVKAQADQLKNFANFFVDFRTSIVTNHLTD
FT                   EFRVKAGITLDILTIAEKASWTLPILTGLIVYAIVAAVIALLSATSYCHGRRRREARLL
FT                   SSMGVPERHIRRGYMIESYGLVLIDMIIGTLLGLAAMPMIWFDLLGLRYHKNLAFPFMD
FT                   IVLILGGIMVFTGIFAFTRSLCRRP"
FT   gene            complement(481936..482664)
FT                   /locus_tag="Arch_0414"
FT   CDS_pept        complement(481936..482664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0414"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1136 ABC-type antimicrobial peptide
FT                   transport system ATPase component; InterPro IPR003439;
FT                   KEGG: blt:Balat_1147 putative ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SPTR: C6AJB3
FT                   Putative ABC transporter ATP-binding protein; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92168"
FT                   /db_xref="GOA:D7BML9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BML9"
FT                   /protein_id="ADH92168.1"
FT                   /translation="MSIAQLVNVSVASRKLPEGRALNNVSMSFGNGKFSAVLGPNGSSK
FT                   SLLIEVLGGLAPISTGQVITCGIDITHSGNDELAELRASSVSYVFNKHNVIDTLTIREN
FT                   LLLAHTFSSLHLDNVLYRDVIGSFNLRKYLDLRPSATTADVHQRVAIARAVLKRSRLIL
FT                   AHEPTQFLRQEPSENVLDSLRRCNREYGMSIIMSTHNNFAASYADHVHLFLDGEPTGMV
FT                   ANPSLQSLAFAQESSAYWAR"
FT   gene            complement(482661..483353)
FT                   /locus_tag="Arch_0415"
FT   CDS_pept        complement(482661..483353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0415"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="COGs: COG2197 Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain;
FT                   InterProIPR011991:IPR000792:IPR001789:IPR011006:IPR 016032;
FT                   KEGG: bcv:Bcav_2822 two component transcriptional
FT                   regulator, LuxR family; PFAM: response regulator receiver;
FT                   regulatory protein LuxR; SMART: regulatory protein LuxR;
FT                   response regulator receiver; SPTR: D0WS35 Two-component
FT                   system response regulator; PFAM: Response regulator
FT                   receiver domain; Bacterial regulatory proteins, luxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92169"
FT                   /db_xref="GOA:D7BMM0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMM0"
FT                   /protein_id="ADH92169.1"
FT                   /translation="MTQEKIRVGLVDDMDLMRSGLSMMINSLDDMEVVLEARDGLQAIN
FT                   RLQLVPVDVILMDVRMEGMDGLAATRAITSTTPPTGVDPKILILTTFDEDDYMLEGIRA
FT                   GASGFLLKDAPTAKMLEAIRTIYQGDAVIAPSTTRRLVDRLATDSIRLHASKPEVLDDL
FT                   TDREREVFYLIARGLTNTEIADRLYVAEATVKTHVTRIFAKLGVRDRVQAVVIAYEAGI
FT                   DTPGRGDV"
FT   gene            complement(483350..484540)
FT                   /locus_tag="Arch_0416"
FT   CDS_pept        complement(483350..484540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0416"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG4585 Signal transduction histidine kinase;
FT                   InterPro IPR003594:IPR011712; KEGG: bcv:Bcav_2821 histidine
FT                   kinase; PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; SPTR: D0WS36 Putative signal transduction
FT                   histidine kinase; PFAM: Histidine kinase; Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92170"
FT                   /db_xref="GOA:D7BMM1"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMM1"
FT                   /protein_id="ADH92170.1"
FT                   /translation="MKEETSDTSPNMADAVLACLFGLSGSAPLLIASGAFAFPHIFYLW
FT                   ILTLMASLIILMRRTVPNVASTLLIITLIFRCLLFPNLLFITDIIVLIMVYTASARARV
FT                   PVAVLVILSAIGSLTFIWVQRLPQYSWQDAWLFVTVLALIGTTSLAGFARRSQRDQAQK
FT                   FQAAERLLQQETSENQRGAIVRERTRIARDLHDIVAHTLGVVIAQADGGRYAGRKDPEQ
FT                   ALRALDTISDMSRAALSDIRSIVGVLREPSDFDSSLTPQPVTHDIASLIERVKESGIDI
FT                   AFVELGVNHPLPAGIGNALFRICQESVTNSMKHGGPHVAIVIKLEWQDRDVSLSIVDNG
FT                   RGASVISDGKGNGIIGMSERAALFGGTLEAGARPGGGFMVRATIPYDRDFHERRPQ"
FT   sig_peptide     complement(484430..484540)
FT                   /locus_tag="Arch_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            484570..487101
FT                   /locus_tag="Arch_0417"
FT   CDS_pept        484570..487101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0417"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /note="COGs: COG0272 NAD-dependent DNA ligase (contains
FT                   BRCT domain type II);
FT                   InterProIPR018239:IPR001357:IPR013839:IPR004150:IPR
FT                   004149:IPR000445:IPR001679:IPR013840:IPR010994:IPR016027;
FT                   KEGG: bfa:Bfae_18930 DNA ligase, NAD-dependent; PFAM:
FT                   NAD-dependent DNA ligase adenylation; NAD-dependent DNA
FT                   ligase OB-fold; zinc-finger NAD-dependent DNA ligase
FT                   C4-type; helix-hairpin-helix motif; BRCT domain protein;
FT                   SMART: NAD-dependent DNA ligase ; BRCT domain protein;
FT                   SPTR: D0WS37 DNA ligase, NAD-dependent; TIGRFAM: DNA
FT                   ligase, NAD-dependent; PFAM: NAD-dependent DNA ligase
FT                   OB-fold domain; NAD-dependent DNA ligase adenylation
FT                   domain; NAD-dependent DNA ligase C4 zinc finger domain;
FT                   BRCA1 C Terminus (BRCT) domain; TIGRFAM: DNA ligase,
FT                   NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92171"
FT                   /db_xref="GOA:D7BMM2"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMM2"
FT                   /protein_id="ADH92171.1"
FT                   /translation="MSHVAIDNFDDAQVRWQELAPQLLDAQETYYSTGDQVMVDATYDA
FT                   LMRELRALEEEFPQLWSPDSPSTKVGAKPVRGGLPSVTHISRMYSLQDVFSRDELAEWF
FT                   TGVSKELPDGVSFTTEVKIDGLALNLTYRNGWLERAATRGDGVTGEDVTRNVRMIASIP
FT                   DQLRGDRIPELVEIRGEVFFPVAAFTQYNASVDARNAQIDARNERISAANREIAAQNRA
FT                   IRAANASLPSDQQVAEIPSKRREAHVKPFVNPRNAASGTMRQEDTGSVALRSLDFLAHG
FT                   LGALDGADDVLRASLSSQEGVYSMFIEWGLPVSNVTETHSSLAEINDFLDRFQNARTSL
FT                   PFEFDGVAIKIDDRATQERLGYTTRVPRWAVAYKFPPTEVQTRLLDIRVQVGRTGRVTP
FT                   YAVMEPVFVDGSTVSQATLHNPTEVARKGVRIGDVVVIRKAGDIIPEVVGPIESERDGS
FT                   EVEFVMPTHCPDCGAPIAAISEGDIDLRCTNQKSCPAQLTQRVVHIGSRGALDVEALGD
FT                   ESAVWLCNPDKNRADALTAFATGSALIVEDNAGKTHKLHLSEQARIERGIVDKHGAILD
FT                   HHHIVAPELQRELGIPQPQHPILSTEAELFHLTADQARDVWIWQAEKKAGEPTGNWKYV
FT                   RAAWTKPTWKGTGDAREISKETHPSKTLLKILDELEGAKHKDLWRKLVALNIRHVGPVA
FT                   SQALADTFGSLDAMREASLEDISAVEGVGPIIASSFLAWFGEEWHRQIVERWQDAGVTF
FT                   KKEESDADVPQTLAGLTIVATGSLQHFTRDGIKETIAAHGGKATGSVSKKTNLVVVGEN
FT                   AGSKATKAEELGIRILNEAQFQQLLESGELA"
FT   gene            complement(487147..488406)
FT                   /locus_tag="Arch_0418"
FT   CDS_pept        complement(487147..488406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0418"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="COGs: COG1502
FT                   Phosphatidylserine/phosphatidylglycerophosphate/
FT                   cardiolipin synthase; InterPro IPR001736; KEGG:
FT                   xce:Xcel_1743 phospholipase D/transphosphatidylase; PFAM:
FT                   phospholipase D/Transphosphatidylase; SMART: phospholipase
FT                   D/Transphosphatidylase; SPTR: D0WS38 Cardiolipin
FT                   synthetase; PFAM: Phospholipase D Active site motif"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92172"
FT                   /db_xref="GOA:D7BMM3"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMM3"
FT                   /protein_id="ADH92172.1"
FT                   /translation="MSFWKNRSTSSAKRVLKYAVLAGIGAQIASIGAIIAVDAHRKRRN
FT                   PQSGEFPHLPPRSARVSDSEVTVYTFGNHLYDAMIEAIDNAKDRVYFESYIMKADDVGY
FT                   RFRNALIAAAMRGVQVFIILDTLGNLNQDPKSRRFPPLPSLHVIRFPLLRPWILTARSK
FT                   DSGFDHRKILVVDGEVGFVGGYNIGRLYADHWRDTHIRVVGPRSWELECAFIDMWNVYR
FT                   ASYHPVLPDNAVRSWVSTFTVSQNIPAYRSYPIRATYLDTINRASKNVWITMGYFIPDY
FT                   AIKASLINAAKRGVDVRILIPQYSNHIIADWVGRPHYSELLAAGCRIFLYKDAMVHAKT
FT                   MTVDGIWTTVGTANLDRLSMAGNYEVNAEIFDADLAAIMEETFELDMTNCVELTREEWD
FT                   SRTGLARLAERLMRPLAPFV"
FT   sig_peptide     complement(488290..488406)
FT                   /locus_tag="Arch_0418"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            488464..488760
FT                   /locus_tag="Arch_0419"
FT   CDS_pept        488464..488760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0419"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="COGs: COG0721 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase C subunit; InterPro IPR003837; KEGG:
FT                   bcv:Bcav_1383 glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; PFAM: Glu-tRNAGln amidotransferase C subunit;
FT                   SPTR: C5C2F6 Aspartyl/glutamyl-tRNA(Asn/Gln)
FT                   amidotransferase subunit C; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, C subunit; PFAM: Glu-tRNAGln
FT                   amidotransferase C subunit; TIGRFAM: glutamyl-tRNA(Gln)
FT                   and/or aspartyl-tRNA(Asn) amidotransferase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92173"
FT                   /db_xref="GOA:D7BMM4"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMM4"
FT                   /protein_id="ADH92173.1"
FT                   /translation="MSTFSKEEVARLADLARISLTDHELEQFAAELEVINESVSRLKEV
FT                   VSSDIPATSHPIPLTNVWREDEVVPGLDRDEVLAMAPHAEDGKFGVPAILGEE"
FT   gene            488764..490263
FT                   /locus_tag="Arch_0420"
FT   CDS_pept        488764..490263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0420"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /note="COGs: COG0154 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase A subunit and related amidase; InterPro
FT                   IPR000120:IPR020556:IPR004412; KEGG: jde:Jden_1714
FT                   glutamyl-tRNA(Gln) amidotransferase, A subunit; PFAM:
FT                   Amidase; SPTR: C2BRA5 Aspartyl/glutamyl-tRNA
FT                   amidotransferase subunit A; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; PFAM: Amidase; TIGRFAM:
FT                   glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)
FT                   amidotransferase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92174"
FT                   /db_xref="GOA:D7BMM5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMM5"
FT                   /protein_id="ADH92174.1"
FT                   /translation="MADLHKKTAWELAELLQAGNVTSVEITTMFLDRIDALNPKMNVYL
FT                   AVDRDGALAEAQAVDADRAAGKELPFFAGVPVALKDNMCQRGIPTTAASKMLDGWKPPY
FT                   DATVVRLLKEARLPILGHTNMDEFAMGSSTEHSAFGPTQNPWGHNLIPGGSGGGSAAAV
FT                   SGYLAPWALGSDTGGSIRQPGAMTGTVGTKPTYGAVSRYGIIAMASSLDQVGPVARDVR
FT                   DAAALQEIISKHDPFDSTSLTNDFSNLVAAAAEGAELGDLSGVTFGIVKELDGDGFAAG
FT                   VLDAFHAIVDKLKAAGAQFVEVSCPSFDYAMAAYYLIMPAEMSSNLARYDGVRFGNRVE
FT                   PTEGALTSETMMAATREAGFGTEVKRRIILGTYALSAGTYDAYYGSAQRVRTLVQRDLA
FT                   AAYEQVDVLLTPATPTVAFKFGEKLDDPMAMYKNDMTTIPANLAGAPAMTVPIGLSDGL
FT                   PVSAQIMAPTFEDARMYKAAAMVEKVADPAASRPDMAMWED"
FT   gene            490269..491762
FT                   /locus_tag="Arch_0421"
FT   CDS_pept        490269..491762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0421"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="COGs: COG0064 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase B subunit (PET112 homolog);
FT                   InterProIPR017958:IPR006075:IPR006107:IPR018027:IPR
FT                   004413:IPR003789; KEGG: bcv:Bcav_1385 glutamyl-tRNA(Gln)
FT                   amidotransferase, B subunit; PFAM: GatB region; GatB
FT                   central domain protein; Asn/Gln amidotransferase; SPTR:
FT                   A7B8Q7 Putative uncharacterized protein; TIGRFAM:
FT                   glutamyl-tRNA(Gln) amidotransferase, B subunit; PFAM:
FT                   GatB/GatE catalytic domain; GatB domain; TIGRFAM:
FT                   glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)
FT                   amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92175"
FT                   /db_xref="GOA:D7BMM6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMM6"
FT                   /protein_id="ADH92175.1"
FT                   /translation="MTELMDYSDVVANFDPVLGIEVHVELSTKTKMFDGAPNAFGGEPN
FT                   TFVTPVSLGLPGSLPVVNKKAIEYAIKLGLALNCQIAESCRFARKNYFYPDLAKNFQTS
FT                   QSDEPLAFDGYLDVELDDGAVFRVNIERAHVEEDAGKNTHIGGEGRIHGADHSLVDYNR
FT                   AGVPLVEIVTRPIEGCGDRAPEVAAKYVQTIRDIARAIGVSEARMERGNVRADINVSLR
FT                   KTPESPLGTRTETKNVNSFRSIASAVEFEMCRQAAILDAGGSILQETRHFQELDGTTLP
FT                   GRPKSDADDYRYFPEPDLVPLAPPRDWVEELRASLPELPADKRRRLLAEWGVSATEMRD
FT                   IVNAGALGLIEDSVKAGATSAGARKWWMGELARFAKDNEVELASVPVTSEQVAELDSLV
FT                   ESGKLTDKLARQALAGVLAGEGSPTEVVAARGLEVVNDDAALNAAVDDALAANPDVVEK
FT                   IRGGKVQAAGAIVGAVMKATHGKADAARVRELIMERVQA"
FT   gene            491842..493242
FT                   /locus_tag="Arch_0422"
FT   CDS_pept        491842..493242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0422"
FT                   /product="malic protein NAD-binding protein"
FT                   /note="COGs: COG0281 Malic enzyme; InterPro
FT                   IPR016040:IPR015884:IPR012301:IPR012302; KEGG:
FT                   nca:Noca_2034 malate dehydrogenase; PFAM: malic protein
FT                   NAD-binding; malic protein domain protein; SPTR: D0WL78
FT                   NADP-dependent malic enzyme; PFAM: Malic enzyme, NAD
FT                   binding domain; Malic enzyme, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92176"
FT                   /db_xref="GOA:D7BMM7"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMM7"
FT                   /protein_id="ADH92176.1"
FT                   /translation="MSKALPSYNVTLRIALPFDPRATATLVKEFADFGAIVTGVDMVES
FT                   DESNLLTDVTAKVDDIEHAEQIAAKLEMLDGVHVLGIHDSTVQAHLGGKIEIALKRPLN
FT                   TRQDLARIYTPGVARICTLIAKDPKLARKLTVKRNTVAVVSDGTAVLGLGDVGAKAAMP
FT                   VMEGKAALFKKFGDVDAWPICLDTTDTEEIVKIVKAISPGFGGINLEDISAPRCFEIER
FT                   RLRAELDIPVFHDDQHGTAVVVLAALINALKVVDKKIEDIRIVVSGVGAAGNAIIRLLQ
FT                   SQGARDIIGVGRNGALGPFREESGEDRNWIAQNTNPRGIEGNLTHVLKGADVFIGVSAG
FT                   NILTGADIATMADDAIVFALANPTPEVDPIEAATHAAIVATGRSDYPNQINNVLAFPGI
FT                   FRGMLDVRATHVTDRMLVVAAQAIAETVQPEQLNANFIIPGVFHPTAAKQVARAIREEF
FT                   QQSLAKDA"
FT   sig_peptide     491842..491913
FT                   /locus_tag="Arch_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            493741..495258
FT                   /locus_tag="Arch_R0011"
FT   rRNA            493741..495258
FT                   /locus_tag="Arch_R0011"
FT                   /product="16S ribosomal RNA"
FT   gene            495500..498585
FT                   /locus_tag="Arch_R0012"
FT   rRNA            495500..498585
FT                   /locus_tag="Arch_R0012"
FT                   /product="23S ribosomal RNA"
FT   gene            498669..498785
FT                   /locus_tag="Arch_R0013"
FT   rRNA            498669..498785
FT                   /locus_tag="Arch_R0013"
FT                   /product="5S ribosomal RNA"
FT   gene            499212..499652
FT                   /locus_tag="Arch_0423"
FT   CDS_pept        499212..499652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cdi:DIP0114 hypothetical protein; SPTR: Q6NKB9
FT                   Putative membrane protein; PFAM: Protein of unknown
FT                   function (DUF2871)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92177"
FT                   /db_xref="GOA:D7BMM8"
FT                   /db_xref="InterPro:IPR021299"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMM8"
FT                   /protein_id="ADH92177.1"
FT                   /translation="MRKLFIAAASYLAVGLISGVFYREFTRAYAYVGDTQLSRIHTHTL
FT                   VLGTLFFMILIGLNKLFDLSEDKRFNMWFILYNVGLAWTTAAMFTQGVVNIVYGPEEWI
FT                   PAFSGIAGFGHIILAFGLIRLFQILYTAIRGDSTNADSVLYR"
FT   gene            complement(499823..501205)
FT                   /locus_tag="Arch_0424"
FT   CDS_pept        complement(499823..501205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0424"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="COGs: COG3004 Na+/H+ antiporter; InterPro IPR004670;
FT                   KEGG: art:Arth_0107 Na+/H+ antiporter NhaA; PFAM: Na+/H+
FT                   antiporter NhaA; SPTR: A0JR38 Na(+)/H(+) antiporter nhaA;
FT                   TIGRFAM: Na+/H+ antiporter NhaA; PFAM: Na+/H+ antiporter 1;
FT                   TIGRFAM: Na+/H+ antiporter NhaA"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92178"
FT                   /db_xref="GOA:D7BMM9"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMM9"
FT                   /protein_id="ADH92178.1"
FT                   /translation="MTQRPTALRHVLSYGSYAEHLRIGKILRRETTGGIALMIAALVAI
FT                   IWANSPWAESYTALRDMKLGIDALHLQLSVGHWAADGLLAIFFFLVGLELKQEFVAGDL
FT                   RSPSRAVVPVVAAVGGVVVPALIYAFFNWNSPETLQGWAIPTATDIAFAVAVLAIIGSH
FT                   LPSPLRLFLLTLAVVDDLIAITIIAIFYTGEIHGTYFALFLIPAAIFGVLVQRFHVFWV
FT                   KHRWASWFILFPIAAVAWYFLHEAGIHATIAGVVLGFLVPVAFKHEGAQEALSEHRPDV
FT                   HGHGDHAPGLISMFEHGIRPISSGFAVPVFAFFSAGVTVGGWDGFVASLSSPVALGILA
FT                   GLIIGKPLGIVASTFVLTKLTRAKLDDSIAWADMIGVGFLAGIGFTVSLLVGELSFGLG
FT                   DANNDAAKVGILLASVLAALIAALILVPRNNRYRRIEEAEHADADANGIPDAFERANKE
FT                   LA"
FT   sig_peptide     complement(501047..501205)
FT                   /locus_tag="Arch_0424"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            501374..502129
FT                   /locus_tag="Arch_0425"
FT   CDS_pept        501374..502129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0425"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013216;
FT                   KEGG: art:Arth_2657 methyltransferase type 11; PFAM:
FT                   Methyltransferase type 11; SPTR: A7BAJ7 Putative
FT                   uncharacterized protein; PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92179"
FT                   /db_xref="GOA:D7BMN0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMN0"
FT                   /protein_id="ADH92179.1"
FT                   /translation="MTSLANPFHNAGTSAATYVDVRPGYSRTLLEPLFDDVDGAPCVAD
FT                   IGAGTGKLTTMLPEIVGLKGSVWAIEPSPDMREQLTNRILDIVRIIDATGEHTTLPDNS
FT                   CDVVFYAQSWHWVDPRAASAEAARILKPGGKLVILFNQMDVSIPWVKRLTRIMRSGDVH
FT                   RVTDTPVVVEKFSTPQLTVNVWQDHLTPRNVCKLGTTRSSWITSTPANQERMQANLRWY
FT                   LHEKLGYEEHHTVEIPYVTYMWVATLPKM"
FT   gene            502245..503570
FT                   /locus_tag="Arch_0426"
FT   CDS_pept        502245..503570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0426"
FT                   /product="protein of unknown function DUF1212"
FT                   /note="COGs: COG2966 conserved hypothetical protein;
FT                   InterPro IPR010619; KEGG: rmu:RMDY18_06380 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1212; SPTR:
FT                   C0W2A9 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF1212)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92180"
FT                   /db_xref="GOA:D7BMN1"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMN1"
FT                   /protein_id="ADH92180.1"
FT                   /translation="MDHQSTESATSSETIAEKLRSILMLGTMLLACGAGAYRVKAAMAR
FT                   AAKAIGLTRLDSAVSMTDITATAWNGKESYTSFAEQRRVGVNAEKLDRIMQGVSQLREG
FT                   MSAADLRLILKETTARDRHYGLWTTVLASAIACAGFCFLNGGRAVECTTVFFAAGIGQL
FT                   IRKLLLGRGIAHFLIWIVCAVASTLVYITLLAVGSFGGLLYLSQYESGLISSILYLIPG
FT                   FPLTTAMLDFVRNDVQSALARFSYCLMVIGSAGFSVWIVVHALDWHVEASVVVPLPFWT
FT                   MTLLRILTSFVAAYGFAVLFNAPWKVCAAAAMAGAFANTGRLLLQNHLHLPWQLGVGLA
FT                   ALVVGIAATLIAWKTSHSRVSLSVPAVVIMIPGVPFYRGLVALNEGDFQGAIATFAEVF
FT                   FVIMSIGFGLAIARVLMDNGWRHDMDTSHLPDTLGSDVRDAV"
FT   sig_peptide     502245..502367
FT                   /locus_tag="Arch_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(503696..505297)
FT                   /locus_tag="Arch_0427"
FT   CDS_pept        complement(503696..505297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0427"
FT                   /product="YidE/YbjL duplication"
FT                   /note="COGs: COG2985 permease; InterPro
FT                   IPR006037:IPR006512:IPR016040; KEGG: car:cauri_1117
FT                   putative transporter protein; PFAM: YidE/YbjL duplication
FT                   domain protein; TrkA-C domain protein; SPTR: C0W2B0
FT                   YidE/YbjL family protein; TIGRFAM: YidE/YbjL duplication;
FT                   PFAM: Predicted Permease Membrane Region; TrkA-C domain;
FT                   TIGRFAM: YidE/YbjL duplication"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92181"
FT                   /db_xref="GOA:D7BMN2"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMN2"
FT                   /protein_id="ADH92181.1"
FT                   /translation="MSYLFQLFADNQVLLLFFLVGSGTILSKFRVRGVSLGAAAVLFLS
FT                   IGITAWALYSGYKIEVEHDLGVLGLALFAFAIGISSGPNFFNTLKSSIVPVLLMLATFA
FT                   LAGGAAALVGRALGMDWALIAGTFAGATTNTPALSAAGAASGNPALATVGYAIAYLFGV
FT                   IGMLGFSALALSRRSADQDKPSPICNRTIRVEREDQPTVASLREIIGGTLHFSRIRRGE
FT                   TGPIWLPADTDVLEKDDLVTVIGTVAEVDQAIKLVGHGSSHSLIANRRYLDFRRITISN
FT                   SAIAGRKIGELDVEEKFGGTISRIRRGDTDMAASSTIRLQLGDRVRVVAPTHSMSKISK
FT                   YFGDSSHGLTDINPIALGLGMALGIIIGEWKILTPSGLTFSIGSAAGTLIVGLIMGRLG
FT                   RIGKFVTTLPFTTCQVLSELGLLIFLAYAGTKAGSQILVAFTGGAWLQILLLGMMVTVI
FT                   VGGGFYLSMRLFTSTGGTRLAGALGGIQTQPAVLAFANDRTSFDPRVALGYAMVYPVAM
FT                   VAKIFVGQVLGSFGAM"
FT   sig_peptide     complement(505184..505297)
FT                   /locus_tag="Arch_0427"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            505524..506969
FT                   /locus_tag="Arch_0428"
FT   CDS_pept        505524..506969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0428"
FT                   /product="aspartate ammonia-lyase"
FT                   /EC_number="4.3.1.1"
FT                   /note="COGs: COG1027 Aspartate ammonia-lyase;
FT                   InterProIPR020557:IPR000362:IPR003031:IPR018951:IPR
FT                   004708:IPR008948; KEGG: hsm:HSM_0765 aspartate
FT                   ammonia-lyase; PFAM: fumarate lyase; Fumarase C-like; SPTR:
FT                   B0USK4 Aspartate ammonia-lyase; TIGRFAM: aspartate
FT                   ammonia-lyase; PFAM: Lyase; Fumarase C C-terminus; TIGRFAM:
FT                   aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92182"
FT                   /db_xref="GOA:D7BMN3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMN3"
FT                   /protein_id="ADH92182.1"
FT                   /translation="MVQTRTEEDLLGTREIPDEAYYGVHTQRAIDNFHISGVTINDVPE
FT                   FIRGMVSVKKAEALANRDKHVLSARVSRAIVDACDLILNDGRCMDQFPVDVFQGGAGTS
FT                   VNMNTNEVVANLALETLGEPKGKYDVINPNDHVNKSQSTNDAYPTGFRIAVYRMIQQLA
FT                   EEVDRMRASFAAIGAKNAHVLKMGRTQLQDAVPMTVGQEFDAFGVLMSEEIRNLTRASE
FT                   LLLEVNLGATAIGTKLNTPDGFQEIVVGRLAEVTGLNVTASPNLIEATSDTGAYISVHG
FT                   ALKRLAVKLSMICNDLRLLSSGPRAGLNEINLPEMQAGSSIMPAKVNPVIPEVVNQICF
FT                   KVMGNDTTVMMASEAGQLQLNVMEPVIGQAIFESISLLTRAMVTLRERCVDGITVNEDI
FT                   CMSYVMNSIGIVTYLNDIIGHHNGDLIGKEAARTGKSVRDIVLERGLMSETELNRTLSV
FT                   ENLMTPVYMGETFPEESEKEIHD"
FT   gene            507034..508183
FT                   /pseudo
FT                   /locus_tag="Arch_0429"
FT   gene            508451..510538
FT                   /locus_tag="Arch_0430"
FT   CDS_pept        508451..510538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0430"
FT                   /product="formate acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /note="COGs: COG1882 Pyruvate-formate lyase; InterPro
FT                   IPR001150:IPR004184:IPR005949; KEGG: car:cauri_2089 formate
FT                   acetyltransferase; PFAM: pyruvate formate-lyase PFL;
FT                   formate C-acetyltransferase glycine radical; PRIAM: Formate
FT                   C-acetyltransferase; SPTR: C0VY68 Formate
FT                   C-acetyltransferase; TIGRFAM: formate acetyltransferase;
FT                   PFAM: Glycine radical; Pyruvate formate lyase; TIGRFAM:
FT                   formate acetyltransferase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92183"
FT                   /db_xref="GOA:D7BMN4"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMN4"
FT                   /protein_id="ADH92183.1"
FT                   /translation="MTQTAETATHPEWEGFKDGLWQNAIDVRDFIQKNYTPYEGDSSFL
FT                   AGETDKTRRVWETLEEKYLSVERQKRVYDVDVDTPADVDAFGPGYISEDDNVVVGLQTD
FT                   VPLKRAMMPNGGWRMVETAIKEAGKEANPEVKKIFTKYRKTHNDGVFDMYTPRIRAARS
FT                   SHIITGLPDAYGRGRIIGDYRRVALYGVDHLIAEKLKDKDLFADQPFTQDWARDREEIS
FT                   EQIKALKKLKNMAASYGFDISRPAQTAQEAVQWTYFGYLASVKSQDGAAMSFGRLSAFF
FT                   DIYFERDLAAGVITEQDAQEIIDQLVIKLRIVRFLRTTAYDEIFSGDPYWATWSDGGFG
FT                   EDGRPLVTKTSFRLLQTLVNLGPAPEPNITIFWSEKLPMGYKRFCAQVSIETSSIQYEA
FT                   DEQIRGYWGDDAAIACCVSPMAVGKQMQFFGARVNAAKALLYAMNGGRDEMSGKQIVDG
FT                   FEGIQGDGPLDFDEVWAKYEDMLDWVVGTYVEALNIIHYSHDKYAYEAMEMALHDSEIV
FT                   RTMGCGIAGLSIVADSLAAIKYATVTPVRDETGLIVDYKTEGDFPTYGNDDDRADDIAA
FT                   TIVHTVMEKIKRIPMYRNAIPTQSVLTITSNVVYGKATGNFPSGHRAGTPFAPGANPEN
FT                   GMDTHGMLASMLSVGKLHYKDALDGISLTNTIVPSSLGRDLAEQVDNLVGIMDAGFIKK
FT                   G"
FT   gene            510591..510839
FT                   /locus_tag="Arch_0431"
FT   CDS_pept        510591..510839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0431"
FT                   /product="formate C-acetyltransferase glycine radical"
FT                   /note="COGs: COG1882 Pyruvate-formate lyase; InterPro
FT                   IPR019777:IPR001150; KEGG: car:cauri_2088 formate
FT                   acetyltransferase; PFAM: formate C-acetyltransferase
FT                   glycine radical; SPTR: C0VY69 Putative uncharacterized
FT                   protein; PFAM: Glycine radical"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92184"
FT                   /db_xref="GOA:D7BMN5"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMN5"
FT                   /protein_id="ADH92184.1"
FT                   /translation="MATTYEERLESMKAQRAAKGGVQGLYHANINVLNRDTLEDAMEHP
FT                   EKYPQLTVRVSGYAVNFVRLTREQQLDVISRTFHQGM"
FT   gene            510863..511789
FT                   /locus_tag="Arch_0432"
FT   CDS_pept        510863..511789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0432"
FT                   /product="pyruvate formate-lyase activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /note="COGs: COG1180 Pyruvate-formate lyase-activating
FT                   enzyme; InterPro IPR001989:IPR007197:IPR012838; KEGG:
FT                   jde:Jden_1397 pyruvate formate-lyase activating enzyme;
FT                   PFAM: Radical SAM domain protein; PRIAM:
FT                   [Formate-C-acetyltransferase]-activating enzyme; SPTR:
FT                   C0VY70 [formate-C-acetyltransferase]-activating enzyme;
FT                   TIGRFAM: pyruvate formate-lyase activating enzyme; PFAM:
FT                   Radical SAM superfamily; TIGRFAM: pyruvate formate-lyase
FT                   1-activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92185"
FT                   /db_xref="GOA:D7BMN6"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMN6"
FT                   /protein_id="ADH92185.1"
FT                   /translation="MTTSIEHQSSDLFDATRYWGSEGSTGEYRPQPIEDEVPRLSGAGL
FT                   DGVSLAGPMSHHEHVSGVQAGDIGSVHSWELVTAVDGPGTRLTTFFAGCPLRCLYCHNP
FT                   DTLKMKEGTAVRATDMLEKIARYKAVFTVSKGGVTFSGGEPMMQPKFLARLLAGCKEIG
FT                   IHTAVDTSGFLGVNMTEEMLANVDLFLLDVKSGVPEQYKRTTGRDLAPTLAFGKRLVEN
FT                   GKKIWIRFVLVPGLTDAPENVNAVADIVQSWASSVERVEVLPFHQMARDKWASLGLEYQ
FT                   LNDVEPPSKEATEAVRDIFRSRGLTVF"
FT   gene            complement(511786..512478)
FT                   /locus_tag="Arch_0433"
FT   CDS_pept        complement(511786..512478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0433"
FT                   /product="alanine racemase domain protein"
FT                   /note="COGs: COG0325 enzyme with a TIM-barrel fold;
FT                   InterPro IPR001608:IPR011078; KEGG: eba:ebA1768
FT                   hypothetical protein; PFAM: alanine racemase domain
FT                   protein; SPTR: D0WRH4 Pyridoxal phosphate enzyme, YggS
FT                   family; PFAM: Alanine racemase, N-terminal domain; TIGRFAM:
FT                   pyridoxal phosphate enzyme, YggS family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92186"
FT                   /db_xref="GOA:D7BMN7"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMN7"
FT                   /protein_id="ADH92186.1"
FT                   /translation="MVAIAESLGRIRDIVDRYAGGRHVDIMLATKHQPIERLIEAYDAG
FT                   GVLMGHNLVDQLVSANAGLAEHGIHPYTSMIGHVQSNKLSSAMTVADRIDTVDSLKTAQ
FT                   RINRRQEERVARGEATGPYPVLIQINSAAADTQFGVAIGDVMQLAVAIADLPRVQIRGV
FT                   MTIGARGSETNIRASFATTRRLSEEMRTLPALADADVISMGMSNDMHLAISEGATVVRV
FT                   GTAVFGER"
FT   gene            complement(512478..515150)
FT                   /locus_tag="Arch_0434"
FT   CDS_pept        complement(512478..515150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0434"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="COGs: COG4581 Superfamily II RNA helicase; InterPro
FT                   IPR014021:IPR001650:IPR011545:IPR014001; KEGG: nfa:nfa37840
FT                   putative helicase; PFAM: DEAD/DEAH box helicase domain
FT                   protein; helicase domain protein; SMART: DEAD-like helicase
FT                   ; helicase domain protein; SPTR: D0WRH3 Putative
FT                   ATP-dependent helicase; PFAM: Domain of unknown function
FT                   (DUF3516); Helicase conserved C-terminal domain; DEAD/DEAH
FT                   box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92187"
FT                   /db_xref="GOA:D7BMN8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021904"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMN8"
FT                   /protein_id="ADH92187.1"
FT                   /translation="MSLSEPGLNVALDALEDAYGISPSDEAIYDAFASWVESTGKHMYP
FT                   HQDEALLNIVSGDHVIVATPTGSGKSLIAMQALFAALATGRTAYYTAPLKALVSEKFFE
FT                   LIRHFGAHNVGMVTGDSSINAGAPIVCATAEILANIALREGASADVGVVVMDEFHFYDD
FT                   PQRGWAWQVPLLALPQAQQILLSATLGDTRFLVADLERRTGRSVSIVDDAVRPVPLHFT
FT                   WSTEPIGEVIKELVATHMAPVYVVHFSQKEAVSQALALQSMPIASKEQKERIAAALGSF
FT                   TFSPGFGKVLSKLLRSGIGIHHAGLLPRYRRLVEKLAQAGLLNVICGTDTLGVGINVPI
FT                   RTVLMTSLTKFDGTKQRHITAREFHQIAGRAGRAGFDTVGYVVVQAPEHDIENARRLRK
FT                   AGDDPTKIKRVQRVKAPEGTISWSENTFTTLIEAQPETLTSRMRVDHSLILNLLQRLDP
FT                   IAGAKTILCDNHEPKKDRNTLVRKAITIYQSLRTAGVITHEDRDWRAQHGDTGAIHFTR
FT                   DVPSDFALNSPLAPFALAAFDLLEPESATYALDVVSIIEAVSEDPLPALYAQQRQARGE
FT                   LIGKLKADGVDYDERMALVDEVTWPKPLADLLEPALELYAKTNPWVRGQELKPKSVVRQ
FT                   LIEEALTFSEFISRYDLSRSEGVLLRYITDVYRAMRQSVPINVRTREVEDIIDWLGRLV
FT                   RSIDSSLLDEWEALADGRVTLDELTTLGSDDSVHGEEAAFGADADGNVAFTRNKHALRV
FT                   AVRNAMFERIELLDREDYDALHDLDSAAGWDADTWADAIAPYFDEYDFLGTDNEARSSR
FT                   FFSILEDPSYADLLQAGMAEDSASDLLESHQTGRVWLALQVLDSGTDDAAWGLWAIIDL
FT                   DASDAAGTLVVQPIRLGER"
FT   gene            complement(515147..516154)
FT                   /locus_tag="Arch_0435"
FT   CDS_pept        complement(515147..516154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0435"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000843:IPR001761:IPR010982; KEGG: pac:PPA2330 LacI
FT                   family transcription regulator; PFAM: regulatory protein
FT                   LacI; periplasmic binding protein/LacI transcriptional
FT                   regulator; SMART: regulatory protein LacI; SPTR: D0YQM2
FT                   LacI family transcription regulator; PFAM: Bacterial
FT                   regulatory proteins, lacI family; family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92188"
FT                   /db_xref="GOA:D7BMN9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMN9"
FT                   /protein_id="ADH92188.1"
FT                   /translation="MSKKKTATIYDVASAVGVSPSTVSRAFSNPARVSTDTAERIFAAA
FT                   RDLGFRTSGAAYASSDKATRVLCLVVADISNPTFAAMYKGFHKAAHEHGYAVVIANSDE
FT                   SGALEAHTLRRVLPDVDGVALAASRLTPAAILQVEKSKPLVLMNRYLDGHTCVVPDTNG
FT                   GITAVCRELAERGHKDVMYLSGPEMSWANAMRWRALQDQCAATSLQLTRTKFLSPDLVG
FT                   GADAARIWNRGRTSAVVAYNDLMAFGFVRQARRLGASIPDDVSVIGVDDSVICHMADPE
FT                   LSSLSTGSFDIGYKAAMSLIWQAANHTRRERSTIVVPMEFKIRGSIASRGSEKE"
FT   sig_peptide     complement(516077..516154)
FT                   /locus_tag="Arch_0435"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(516313..517722)
FT                   /locus_tag="Arch_0436"
FT   CDS_pept        complement(516313..517722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0436"
FT                   /product="Glucuronate isomerase"
FT                   /EC_number="5.3.1.12"
FT                   /note="COGs: COG1904 Glucuronate isomerase; InterPro
FT                   IPR003766; KEGG: art:Arth_0502 glucuronate isomerase; PFAM:
FT                   Glucuronate isomerase; PRIAM: Glucuronate isomerase; SPTR:
FT                   D0YQL1 Glucuronate isomerase; PFAM: Glucuronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92189"
FT                   /db_xref="GOA:D7BMP0"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMP0"
FT                   /protein_id="ADH92189.1"
FT                   /translation="MASPLFLDPDRLFPADEKTRDLARELYTTVKDLPIISPHGHVNPQ
FT                   MLLDNEPFSDATNLFLTYDHYVFRMLHSAGIDLTKIGVGKSDPVDPRTAWRIFCENWRL
FT                   LDGTASGYWLTHEFVTLFGIDEEPCAENADKLFDIIAEKLSTPEFRPRALFDSFPISVL
FT                   ATTDDPLDSLEYHAALAADETFTGQVIPTWRPDAYVNTRKPEWRSKVEALTASVGQPVD
FT                   SFEGYLEGFRASRARFIENGAVSADFGVAHPLAVDMDDAELGALYHKAVHEGLTAEESD
FT                   IFEGAMLFRFAGMSVEDGLVMTVHPGVYRNHNTESFTTFGPDTGHDIPVQTEYTKNIQP
FT                   LLDKYGNDPRLHLVLFTIDETVYSRELAPLAGFYPSVFIGAPWWFIDAPDAVLRFRAAT
FT                   TETAGFSRSSGFIDDTRAFLSIPARHDMSRRLDSVFLARYVIEGRISRTAAFHWIKALT
FT                   SDQPRKVFKLD"
FT   gene            complement(517801..518901)
FT                   /locus_tag="Arch_0437"
FT   CDS_pept        complement(517801..518901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0437"
FT                   /product="PfkB domain protein"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR011611; KEGG: xce:Xcel_0908 PfkB domain
FT                   protein; PFAM: PfkB domain protein; SPTR: D0YQL2
FT                   Carbohydrate kinase; PFAM: pfkB family carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92190"
FT                   /db_xref="GOA:D7BMP1"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMP1"
FT                   /protein_id="ADH92190.1"
FT                   /translation="MTIALRPANECRYDIVSLGEVMLRLDPGEGRIRTARHFAASEGGG
FT                   EYNVARGSRRAFGRRAAIVTALVRDEVGMLIEDLILQGGVDTSFITWVPSDGVGRSVRN
FT                   GLNFTERGFGVRGAVGNNDRGNTAVSQMVATDVDWDYLFGTLGVRWLHTGGIFTALSES
FT                   TAEVAKAAMQAAKKYGTVVSYDLNYRPSLWKSIGGQEKCQEVNRELAQYVDVMIGNEED
FT                   FTASLGFEVEGANENLDNLEVESFKKMIETVATQFPNFQAIGTTLRQVRSATVNDWGAV
FT                   AWSREQGFVQAIQRDGLEILDRVGGGDSFASGLIYGLMEFGDIEKAVNYGAAHGALAMT
FT                   TPGDTSMASLAEVERLVGGGSARVQR"
FT   gene            complement(518898..519542)
FT                   /locus_tag="Arch_0438"
FT   CDS_pept        complement(518898..519542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0438"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /EC_number="4.1.3.16"
FT                   /note="COGs: COG0800 2-keto-3-deoxy-6-phosphogluconate
FT                   aldolase; InterPro IPR013785:IPR000887; KEGG: tau:Tola_0229
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase; SPTR: D0YQL3 Khg/kdpg aldolase; TIGRFAM:
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase; TIGRFAM: Entner-Doudoroff aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92191"
FT                   /db_xref="GOA:D7BMP2"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMP2"
FT                   /protein_id="ADH92191.1"
FT                   /translation="MAIPSARPFLEKNPIVPVVVLNRVEDAVPTARALLAGGITSAEVT
FT                   FRTPVAAECIASIARNVPEIAVGAGTVINAEQANAAIDAGATFLVSPGFSATVADVAAE
FT                   RGVPLLPGVANPTDIMAAVEYGLDVMKFFPAVPLGGLSVIKAFAAPFPQLKFLPTGGIS
FT                   EKNAAEWLSQPFIAAIGGSWMVTTKLVDNGEFDTITELSAQAMSIAKEVTR"
FT   gene            complement(519572..520651)
FT                   /locus_tag="Arch_0439"
FT   CDS_pept        complement(519572..520651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0439"
FT                   /product="mannonate dehydratase"
FT                   /EC_number="4.2.1.8"
FT                   /note="COGs: COG1312 D-mannonate dehydratase; InterPro
FT                   IPR013022:IPR004628; KEGG: pac:PPA2327 mannonate
FT                   dehydratase; PFAM: Mannonate dehydratase; PRIAM: Mannonate
FT                   dehydratase; SPTR: D0YQL4 Mannonate dehydratase; TIGRFAM:
FT                   mannonate dehydratase; PFAM: D-mannonate dehydratase
FT                   (UxuA); TIGRFAM: mannonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92192"
FT                   /db_xref="GOA:D7BMP3"
FT                   /db_xref="InterPro:IPR004628"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMP3"
FT                   /protein_id="ADH92192.1"
FT                   /translation="MKMTFRWYGEGFDPIPLQYIKQIPEMTGIMGTLSGKQAGEVWEDQ
FT                   EIKDMIAPVHAAGLECEVIESVNVHEDIKMGLATRDEYIANYNTTLENLANNGVKVVVY
FT                   NFMPVFDWLRTELAHVTDDGSNCLYYDHAEVEGMSPRDIVERTAKDSGGLTLPGWEPER
FT                   LERLDEVMALYQDIDHEAMRANYRYFLEGIIPTAEKVGIKMACHPDDPAWDLFGLPRIH
FT                   RNRDDMDKIAKLYDSEYNGFCVCSGSLGSNPDNDVPAIFREFGERGLLNAAHVRNVKYL
FT                   GEKKFHEAPHPSSTGNLDMHAIMEAIYDTNPDVYIRPDHGRMIWGETGRPGYPLYDRAL
FT                   GAVYLSGLFESIAKMKSRG"
FT   gene            complement(520680..522281)
FT                   /locus_tag="Arch_0440"
FT   CDS_pept        complement(520680..522281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0440"
FT                   /product="Mannitol dehydrogenase domain protein"
FT                   /note="COGs: COG0246 Mannitol-1-phosphate/altronate
FT                   dehydrogenase;
FT                   InterProIPR016040:IPR013328:IPR013131:IPR013118:IPR 008927;
FT                   KEGG: pac:PPA2328 D-mannonate oxidoreductase; PFAM:
FT                   Mannitol dehydrogenase domain; Mannitol dehydrogenase
FT                   rossman domain; SPTR: D0YQL5 D-mannonate oxidoreductase;
FT                   PFAM: Mannitol dehydrogenase C-terminal domain; Mannitol
FT                   dehydrogenase Rossmann domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92193"
FT                   /db_xref="GOA:D7BMP4"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMP4"
FT                   /protein_id="ADH92193.1"
FT                   /translation="MELNFNGLSGIEGDIVLPSFDVAQMQKSGKETPRWVQIGPGNIFR
FT                   IFVARIAHDLVADGHMWPVTGVQTLAAEEMDRQLGKHDLMSLGVTLNPDGSRDLRVIAG
FT                   LSEALATQRDDDFARLVEIFRNDSLSLVSFTITEKGYAVHTSAGDLQPMLVEELATDPR
FT                   AYHAHTMALMAGLLFHRFEAGGAPITMLSTDNFSHNGDKLRESIMIVARGWEGNGAVSA
FT                   EFIAWLSDESKVAFPISVIDKITPRPNDSVSAQLAELGFSDMDIEFVGRTPVAGFVNAE
FT                   PTEYLIIEDKFAGDRPPLEDYGVQIVDRQVCDDFENMKVTTCLNPLHTALAVSGCLLRM
FT                   PTIDSEMRDSALAAMVHELGWNEGLPVVVDPGVVAPEDFLREVLEVRFPNTYLPDDPAR
FT                   IAMDTSQKLPIRFGETIKKYIERDLPLDSLHTIPLVFALWLRYLTGIADDGEAFTLASD
FT                   PLLEELQGMLAEVSVGMELSSDEAHRIVQPILSNKQIFGVDLYTTPLAAKVEGYFIELV
FT                   AGPGAVRSVLDREYTA"
FT   gene            complement(522412..522744)
FT                   /locus_tag="Arch_0441"
FT   CDS_pept        complement(522412..522744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0441"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ach:Achl_0779 oxidoreductase domain protein;
FT                   SPTR: B8HC64 Oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92194"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMP5"
FT                   /protein_id="ADH92194.1"
FT                   /translation="MWHSLPHDQRCNYVGYQWFCRRNFSRSYRADQPAYIASHFLEFRS
FT                   AWGTKLDLDSAQLEEAKEFLSAAERASGKIGICFQNRYNVPSQTLAALLDTGELGTPPE
FT                   HRGGKL"
FT   gene            522981..524165
FT                   /locus_tag="Arch_0442"
FT   CDS_pept        522981..524165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mno:Mnod_6520 chromosome segregation
FT                   ATPase-like protein; SPTR: B8IDC3 Chromosome segregation
FT                   ATPase-like protein; TIGRFAM: LPXTG-motif cell wall anchor
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92195"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMP6"
FT                   /protein_id="ADH92195.1"
FT                   /translation="MAANKIVSVPVILLAVVGTGLLPSSGNLQASGKNGSATQIEPEVD
FT                   RATIQNMGEDAQIAELQDAQELEQAQREMIDELETRVKRVATVLATISAERDNNRAVLE
FT                   VAQATKAQANEELANARTEQEQARALLAQMIHLRDNLERVRNQLEDNLAFTSRDLDRAN
FT                   NDVAQAQARHDAAMARIKASVDSCTQAAEEERIASEKTEVIEKRLTRAQARLASAKAAL
FT                   AKALNDLHATQEKIATLKEQLHIVEGGTAFTVRERPHNTIPDGDEPSTGVPQGMPVVGK
FT                   PPTIEIAGPVYVPKSANQEDSAPRIDVNPIKVLPANPAKPLHIPHPGRAIGRSKSLPRM
FT                   VDSAVLEPASNLTNYEPLEVLADTGMQISDVALGGAALLLGGVGAQALRRRRFR"
FT   sig_peptide     522981..523070
FT                   /locus_tag="Arch_0442"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            524340..525362
FT                   /locus_tag="Arch_0443"
FT   CDS_pept        524340..525362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xce:Xcel_2511 hypothetical protein; SPTR:
FT                   C0W204 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92196"
FT                   /db_xref="GOA:D7BMP7"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMP7"
FT                   /protein_id="ADH92196.1"
FT                   /translation="MDAHPTRKLIFTILRLIITTVIAVAMIKFAFFPSQKTHEPLVGGG
FT                   EFVMPTVTPTRGDIKNDTEFDATLIRNASKSVKSTAEGEIVHFFVEDGAKIEKGAPILQ
FT                   IKTTTEVTEPPATGSESDDESATPSAPQTRSVVSYNNIVAPATGTLTLDAILKQRVAIN
FT                   DSIGTIAPDSFYASVSVTPDQLYALQSIPKEAEVSIANGPAPFMCTNLHTTTTKSGGDK
FT                   HEGEAQTSSPQLVCDIPAGQTVFDGIKAKLRITGESATNALLLPLTAVEGRFREGKVYV
FT                   PAANGQQKPQELIVKLGINDGQMIVITEGLKEDTEVLEFTPQTKNDEQKDAPNDSGFRG
FT                   "
FT   sig_peptide     524340..524408
FT                   /locus_tag="Arch_0443"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            525365..526123
FT                   /locus_tag="Arch_0444"
FT   CDS_pept        525365..526123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0444"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1136 ABC-type antimicrobial peptide
FT                   transport system ATPase component; InterPro
FT                   IPR017871:IPR003439:IPR003593; KEGG: xce:Xcel_2510 ABC
FT                   transporter related protein; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase; SPTR: A7BA83 Putative uncharacterized
FT                   protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92197"
FT                   /db_xref="GOA:D7BMP8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMP8"
FT                   /protein_id="ADH92197.1"
FT                   /translation="MLSLRDITRDVQLPNGEDLHILRGTNLDVEAGEHISIVGHSGTGK
FT                   STLLNIVGLLDQPTSGTYTWDGKDVLELNDTQRSRLRGNSVGFVFQQFNLFPTRTVLNN
FT                   VEVPLLYNSGRALFSRRDRAAKILESVGLGDRLDAMPSQLSGGEQQRVAIARALVRQPR
FT                   LILADEPTGALDPETGRLVMDVLESAALRNNAALIVISHDMVIAQRANRVYQISDGVLH
FT                   DVEKANDAFIGVPGRRQHAMSDNKVEEDLT"
FT   gene            526120..527436
FT                   /locus_tag="Arch_0445"
FT   CDS_pept        526120..527436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0445"
FT                   /product="protein of unknown function DUF214"
FT                   /note="COGs: COG0577 ABC-type antimicrobial peptide
FT                   transport system permease component; InterPro IPR003838;
FT                   KEGG: cmi:CMM_2031 putative ABC transporter, permease
FT                   component; PFAM: protein of unknown function DUF214; SPTR:
FT                   C0W202 ABC superfamily ATP binding cassette transporter,
FT                   permease protein; PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92198"
FT                   /db_xref="GOA:D7BMP9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMP9"
FT                   /protein_id="ADH92198.1"
FT                   /translation="MIHNFIGALIEAWEEVKINKARVILSLIGVGAAVWAMSTVIALGS
FT                   IVSASNQQTMAHWGGQPGTVTLTVAKNSSEGEESAGNPLKSSPSNEQQQEFKKFRDAVK
FT                   ETARRLKLTVWTTRATPSLESIDAPYFNPCPAIYEKQCPGEHPEVEAVDPAYFALHAHD
FT                   LVAGRLLTEKDATLNMNPVVINESAWETIGRPALATHPRMWLSKDHRTAVTVVGVIKNV
FT                   VQGQMASIYIPADAQPFIFPKSGHGDYPTMLFLAPKGQEEIAKDVSQAVLGSILGDKYR
FT                   VDAFWDEGYAEQSANNAKVLETAVAVIGGMVIALGALGLLTMSIVTVKTRVREIGIRRA
FT                   VGASAKRVFFSVFLESVVATTVAGFVGVILSVFTIRVVPQLVSASFLPGELGMVAENVA
FT                   YPMQAALLGVIISAGVGALCGIIPATVAVRMRPIDAIRF"
FT   sig_peptide     526120..526245
FT                   /locus_tag="Arch_0445"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(527626..527701)
FT                   /locus_tag="Arch_R0014"
FT   tRNA            complement(527626..527701)
FT                   /locus_tag="Arch_R0014"
FT                   /product="tRNA-Lys"
FT   gene            complement(527765..527837)
FT                   /locus_tag="Arch_R0015"
FT   tRNA            complement(527765..527837)
FT                   /locus_tag="Arch_R0015"
FT                   /product="tRNA-Lys"
FT   gene            complement(527941..528558)
FT                   /locus_tag="Arch_0446"
FT   CDS_pept        complement(527941..528558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR020137; KEGG: jde:Jden_2460 hypothetical
FT                   protein; SPTR: C1RLQ9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92199"
FT                   /db_xref="GOA:D7BMQ0"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMQ0"
FT                   /protein_id="ADH92199.1"
FT                   /translation="MNWWEIFGWAGSVLVVVSLWVPSVWRFRILNLSGSLIATIYNIYF
FT                   GIWPYAAMNGVIVGIDAYWIARLSRKGTTTERGYAVVAASPSDALVQHFISRNAADIAT
FT                   SYPHFSASKLEGTYVQFIMHEDEIVGLFAMSQQGSVGSIVIDYVTPRFRDLGPGRYIYT
FT                   HITMFAKAGISEVRISPAETADPAYFSKLGFTEDSGYLIRTI"
FT   gene            528718..529707
FT                   /locus_tag="Arch_0447"
FT   CDS_pept        528718..529707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR011761; KEGG: jde:Jden_0904 hypothetical
FT                   protein; SPTR: D0WRH0 Putative uncharacterized protein;
FT                   PFAM: Prokaryotic glutathione synthetase, ATP-grasp domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92200"
FT                   /db_xref="GOA:D7BMQ1"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMQ1"
FT                   /protein_id="ADH92200.1"
FT                   /translation="MKTLQNSHKEPKPVKEKAVSVSAPIVTLATSEELPNLDTDERNLP
FT                   DALRERGLEPRIAVWNDPSVNWEEAGTVIIRSVRDYAKYRDEFLQWSASLPRVLNSAPT
FT                   IAWNSDKHYLKALEKYGLPTIPTMWLEPEQGLSKQQIHSRFPAAGDFVVKPAVASGGRG
FT                   TGRYSAIDAQQRGEAVEHAMYELSRGRTVMVQRYLEEIDRQGETSLVYLNGLPAYQVEK
FT                   EAMLHPRFRSAREAGVVEEVVRASHATEETWRWGERIRKALHSHIKDVNGKDELLLFNR
FT                   VDIVRGDESSKEEFYVVEISLIDGSLYLSQSEANLNMFADAIQMRVDM"
FT   gene            529904..529978
FT                   /locus_tag="Arch_R0016"
FT   tRNA            529904..529978
FT                   /locus_tag="Arch_R0016"
FT                   /product="tRNA-His"
FT   gene            complement(530249..530905)
FT                   /locus_tag="Arch_0448"
FT   CDS_pept        complement(530249..530905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0448"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="COGs: COG1949 Oligoribonuclease (3'->5'
FT                   exoribonuclease); InterPro IPR013520:IPR006055:IPR012337;
FT                   KEGG: krh:KRH_14510 oligoribonuclease; PFAM: Exonuclease
FT                   RNase T and DNA polymerase III; SMART: Exonuclease; SPTR:
FT                   D0WRE7 Oligoribonuclease; manually curated; PFAM:
FT                   Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92201"
FT                   /db_xref="GOA:D7BMQ2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMQ2"
FT                   /protein_id="ADH92201.1"
FT                   /translation="MVSNFSAQNTPIVWIDCEMTGLDLEKDALVEIAIVVTDAELNPLD
FT                   NGLDIVIKPPEEAAANMDSFVRNMHTTTGLIKRWETGTTIEDAEKQCIDYIKRFVPEIR
FT                   KAPLGGNSVGTDRTFLARDMPTLVDHLHYRIVDVSSIKELAKRWFPRAYFAAPEKTGNH
FT                   QALGDIYDSIDELRYYRSVLWPEDDGPSTDEAKEKAAQIKADLTVDRAQRAHDAL"
FT   gene            complement(530953..531025)
FT                   /locus_tag="Arch_R0017"
FT   tRNA            complement(530953..531025)
FT                   /locus_tag="Arch_R0017"
FT                   /product="tRNA-Arg"
FT   gene            531094..532704
FT                   /locus_tag="Arch_0449"
FT   CDS_pept        531094..532704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0449"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: bcv:Bcav_2645 putative transcriptional
FT                   regulator, TetR family; SPTR: D0WRE6 Putative
FT                   ATP/GTP-binding protein; PFAM: Dynamin family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92202"
FT                   /db_xref="GOA:D7BMQ3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMQ3"
FT                   /protein_id="ADH92202.1"
FT                   /translation="MTFLRVDTENIGEIRSNGRVTSDVFSRNTLADLVQRTIDALRDAS
FT                   LPLEMPGSFAMEESRRQLLTQLESRILPHVRARRLPTVIVFGGSSGAGKSTLVNSLVRA
FT                   NVSEASVLRPTTRVPMVLTHPDDASAMEDHALLQMGDQALVPSAIPGVVIVDAPDLDSI
FT                   DDSNRELSARLLDAADLWVFVTTAARYGDALAWNTLKDAHNRGITCAVVLDRVSDRVLQ
FT                   NVRADLARRMRDLGLQDAPLFVVPDQGAHEGLLPEECVVGLRSWLETIAETRMGESLIE
FT                   RTTRATLPGLRGSLLTLADALEVQEHARQDLKDKAIESAQVPLEKLRTNITHGRFGQGA
FT                   PTASWLSFASTGGVLAGMVTRSRPRFFDRHRVARDNATTATFDVLYTAVKVALTQALVT
FT                   ASHNAEDAWMKDIVNTEDLLARVRTVMDTDAIVEHAATAWKNDLSQVAVKVHDNPWLSE
FT                   SGVAALLGCAAGGISGAVSAARSAGLEARVQDVRVALLERVDQALTELTDIFVDAADSV
FT                   HMSDAATLRLRASEYLAHS"
FT   gene            532731..534197
FT                   /locus_tag="Arch_0450"
FT   CDS_pept        532731..534197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0450"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_2644 ATP-binding membrane protein;
FT                   SPTR: D0WRE5 Putative ATP-binding membrane protein; PFAM:
FT                   Elongation factor Tu GTP binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92203"
FT                   /db_xref="GOA:D7BMQ4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMQ4"
FT                   /protein_id="ADH92203.1"
FT                   /translation="MMNERQSQRLQGAEAVATRLKNLQEAVAAGGQFFDPFVSARAQDD
FT                   LSRTQERMNLGLDVTVVALVGGTGSGKSSLFNAITGLEFADSGDIRPTTERAAACVYGV
FT                   DATALLDYLAVDHDRRINHTSELNEGVSTFERLVLVDLPDHDSIAVKHSLEVARLLPMI
FT                   DVLIWVLDPQKYADQVLHASYLEQLSDRSDAMVVVINQIDTVRKSHRDLLINDVRALLA
FT                   KDGLPDVPIVTTSALLGDGIEVLRDTIRTAMDKPSIAATTAAAELDAIGRRLRVNVGNE
FT                   ESDLRGKERDDMISRIAGASGVGAATESIRNAGQSLLATAYVQPEKLGQSMSVAIRDSW
FT                   INTVRRGLPYIWQQAAESCVASAERIRNSTGVAVRSIEPPQIVRTKAWILSAIAVLVSA
FT                   TGITLGAIGLPYTSIVWRLGMILSGLLIGGALYAYATIDLRWQAEQLATQYEHDVHQAL
FT                   SAVVDEEMVEAPAEVLIKHKTTRIALETFT"
FT   gene            534332..534892
FT                   /locus_tag="Arch_0451"
FT   CDS_pept        534332..534892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0451"
FT                   /product="single-strand binding protein"
FT                   /note="InterPro IPR012340:IPR000424:IPR011344:IPR016027;
FT                   KEGG: ach:Achl_2173 single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; SPTR: D0WRE4 Single-stranded DNA-binding protein
FT                   1; TIGRFAM: single-strand binding protein; PFAM:
FT                   Single-strand binding protein family; TIGRFAM: single
FT                   stranded DNA-binding protein (ssb)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92204"
FT                   /db_xref="GOA:D7BMQ5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMQ5"
FT                   /protein_id="ADH92204.1"
FT                   /translation="MSNETTITIRGFAGGQPTVFTNSVDSESGEVTTHRTAVLRVGVTP
FT                   RYYVKSQGEFRDGPTSWYAVRTYGSLAANVASCVGKGTPVLVRGRLSVREYQDKQGISR
FT                   SENVIIADSLGIDLSTGTAAFTKVSNVPLPRVPGEPTIYQGPVDDDVERQFATGVDDEL
FT                   TAMDHEPGEESDDPAGVLDAVMA"
FT   gene            534986..536668
FT                   /locus_tag="Arch_0452"
FT   CDS_pept        534986..536668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0452"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG0488 ATPase components of ABC transporter
FT                   with duplicated ATPase domains; InterPro
FT                   IPR017871:IPR003439:IPR003593; KEGG: mlu:Mlut_09750 ATPase
FT                   component of ABC transporters with duplicated ATPase
FT                   domain; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: D0WRE3 ABC transporter, ATP-binding protein; PFAM:
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92205"
FT                   /db_xref="GOA:D7BMQ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMQ6"
FT                   /protein_id="ADH92205.1"
FT                   /translation="MAEFIYNMVRARKKVGDKLILDDVTMSFYPGAKIGMVGPNGAGKS
FT                   TILKIMAGLDEPSNGEARLSAGYSVGILMQEPPLNEEKTVLENVQEGVGDLISKVHRFN
FT                   EIGMEMAEPDADFDALMEEMGTLQTEIDAANGWDIDAQLEQAMEALQCPPADSPVNVLS
FT                   GGERRRVALCKLLLEAPDLLLLDEPTNHLDAESVLWLEQHLAKYPGAVIAVTHDRYFLD
FT                   HVAQWIAEVDRGHLYPYEGNYSTYLEKKQERLEVQGKKDAKLKKRLAEELDWVRSSAKG
FT                   RQAKSKARLARYEEMAAEADRTRKLDFEEIQIPPGPRLGNVVLEAKDIKKGFGERVLID
FT                   NLSFTLPRNGIVGIIGPNGVGKTTLFKTIVGLEPLDEGSLKIGETVKLSYVDQNRGGID
FT                   PEKTLWEVVSDGLDYIQVGNVEMPSRAYVSAFGFKGADQQKKAGVLSGGERNRLNLALT
FT                   LKQGGNLILLDEPTNDLDVETLSSLENALLDFAGCSVVITHDRWFLDRVATHILAYEGT
FT                   EENPSNWYWFEGNFEAYEKNKIARLGEDAARPGASTYRKLTRG"
FT   gene            536800..538446
FT                   /locus_tag="Arch_0453"
FT   CDS_pept        536800..538446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbt:CLH_0659 putative lipoprotein; SPTR:
FT                   C0VY11 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92206"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMQ7"
FT                   /protein_id="ADH92206.1"
FT                   /translation="MKSNRRILALVTASIANVALALAGCTDATPPPASNNKTGTETSEL
FT                   TGPHADPNRKLAPVSHEITHDGKVRVTQLDVGNVKMNGFVAPVRGVLVTPEGTPEAGKA
FT                   APLILFSHLRAPNCADAMFAFPCKGKKEGTRFDQGMAYFGEALAERGYAVLIPDLTPLW
FT                   VSGDESKPYSQKDMWTAIVKKLRDRIAAGASGSKDLGSDYKATLDFDQVGLVFHSRSAM
FT                   MVDAAQHLFGKDKLMSAMGYGGSYNAKDITDIDPAGPDMPTFLVNGDEDGDVERAANWW
FT                   LTEHVQQKRKTPIVSVQIPGYGHMFINRQLQTKEADDRKACSVIACPSSADHEKLLINS
FT                   AIDWFDATIRGAETSIPLKAHAPIPATYAGTDVRWLVATQGENVTRIPASSFTGIPGKE
FT                   ATLCGHVDPMVPTERKDICPEPENGVITPVSQLMHTTGAHADTHIDNAQEVALHILPAG
FT                   HDAQGAGPIVTLTLTLANGQQWSKELSAIDPAVGKALASMKTEASNGEYLISTIRVPLP
FT                   ADVFKGVAVTGVSIESRGVPVEMRGVDVVGE"
FT   sig_peptide     536800..536883
FT                   /locus_tag="Arch_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            538772..539464
FT                   /pseudo
FT                   /locus_tag="Arch_0454"
FT   gene            539457..540050
FT                   /locus_tag="Arch_0455"
FT   CDS_pept        539457..540050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0455"
FT                   /product="putative transcription regulator"
FT                   /note="InterPro IPR010982; KEGG: cef:CE1210 putative
FT                   transcription regulator; SPTR: Q8FQB1 Putative
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92207"
FT                   /db_xref="GOA:D7BMQ8"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMQ8"
FT                   /protein_id="ADH92207.1"
FT                   /translation="MTELLLAERITLARQLRTLSKTDFAKSIDVTLRTATNYERSGAPL
FT                   NKLTMIASTLNFPEKFFLGELLPELDRHSVEFRSYRGTPAKERKASLAHAKLGIGLMTW
FT                   IKSKFSLPSLGIPSFNGFATEFLFPRVAQYEYCVKNPDLKQIMTYKGAFGLSAFATVHA
FT                   LHRSGLLTDWAYRKMCVELSRQGLKSAEPESRMS"
FT   sig_peptide     539457..539531
FT                   /locus_tag="Arch_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            540465..540832
FT                   /pseudo
FT                   /locus_tag="Arch_0456"
FT   gene            541060..541437
FT                   /locus_tag="Arch_0457"
FT   CDS_pept        541060..541437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0457"
FT                   /product="HNH endonuclease"
FT                   /note="InterPro IPR002711:IPR003615; KEGG: cdi:DIP2153
FT                   putative bacteriophage holin protein; PFAM: HNH
FT                   endonuclease; SMART: HNH nuclease; SPTR: C2KNY6 Possible
FT                   bacteriophage endonuclease; PFAM: HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92208"
FT                   /db_xref="GOA:D7BMQ9"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMQ9"
FT                   /protein_id="ADH92208.1"
FT                   /translation="MPVKPVSPCSHPGCPELTHERYCEQHAKTEDARYRKYQRDPKINR
FT                   RYGSRWRKIRAAYVVAHPLCEDCLEAGRYTPVQEVHHVLPLEHGGTHNFENLRSLYKPC
FT                   HSRQSALDDDRWWQEPRVYTY"
FT   gene            541685..542193
FT                   /pseudo
FT                   /locus_tag="Arch_0458"
FT   gene            542495..545116
FT                   /locus_tag="Arch_0459"
FT   CDS_pept        542495..545116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0459"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="COGs: COG4932 outer membrane protein; InterPro
FT                   IPR008454:IPR019931; KEGG: sjj:SPJ_0350 collagen-binding
FT                   protein A; PFAM: Cna B domain protein; SPTR: C1CCC8
FT                   Collagen-binding protein A; TIGRFAM: LPXTG-motif cell wall
FT                   anchor domain protein; TIGRFAM: LPXTG-motif cell wall
FT                   anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92209"
FT                   /db_xref="GOA:D7BMR0"
FT                   /db_xref="InterPro:IPR013552"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR023849"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMR0"
FT                   /protein_id="ADH92209.1"
FT                   /translation="MDFHRTLPQGSVLKRLNSGSAFLALFVVLAMVLSTAVAAWAQDDK
FT                   QVFEGSMTEHGSNHFQVRPQQGGDWEPAYCMNVHRARPTALGQEGAGGLPQFKKSDDPS
FT                   NLGIFTEKKGAELTQKLLALMWVGYPNDATGAIKNGDLTKEQLRNATQNAIWRLTDGYD
FT                   GASHLDRDTLKAYKVMIGQSESETLSFGTKFELKSVPEGSRLNVYLPTNNVTPPAEYTQ
FT                   WQNLLSSQFVDKNDKPISPKPNNPNEPGDGEFKVNFGKLDKDTKTFVAGAKLQLRPQRN
FT                   SSTINGKAGDFAWDSKDVAEEIKMSPGEYLLRELQAPQNYKPIKKPNLPIARVDVADDG
FT                   SVTVHTEGDSVVLEGSTVKIFNESLTPAPKSFDVVISKTDVAGKEIAGAKIEVWSTGDD
FT                   AKKLESWTSVAGESKKIKLAAGKYVFKETVAPEGFKVVSDITFSVDANGNVTTTDVQQT
FT                   VNGKQVASAAGNKLTVINETKAPKSFDVVISKTDVAGKEIAGAKIEVWSTGDDAKKLES
FT                   WTSVAGESKKIKLAAGKYVFKETVAPEGFKVVSDITFSVDANGNVTTTDVQQTVNGKQV
FT                   ASAAGNKLTVINETKAPKSFDVVISKTDVAGKEIAGAKIEVWSTGDDAKKLESWTSVAG
FT                   ESKKIKLAAGKYVFKETVAPEGFKVVSDITFSVDANGNVTTTDVQQTVNGKQVASAAGN
FT                   KLTVINETKAPKSFDVVISKTDVAGKEIAGAKIEVWSTGDDAKKLESWTSVAGESKKIK
FT                   LAAGRYVFKETVAPEGFKVVSDITFSVDANGNVTTTDVQQTVNGKQVASAAGNKLTVIN
FT                   ETEKTDVNPDTSSTSGSSAPSKPQAGKKPLATTGAQVGTLTLLAGALMAGGVVLVSRRK
FT                   RS"
FT   sig_peptide     542495..542617
FT                   /locus_tag="Arch_0459"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(545487..545906)
FT                   /locus_tag="Arch_0460"
FT   CDS_pept        complement(545487..545906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0460"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: jde:Jden_1529 alpha amylase catalytic region;
FT                   SPTR: C0W0B5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92210"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMR1"
FT                   /protein_id="ADH92210.1"
FT                   /translation="MRIILASLPGAIYLPFGFCGGHVTFKGWVAVRALPPINSIEERRL
FT                   AHTQLALRLREKYDLGNANLAWVSGLEWQAPGVGVFTSDNIICVFNTSNEDVFVPVENE
FT                   LLLRSDSTRKWALPGAETALRTGPPQIFSTAEREE"
FT   gene            545930..546178
FT                   /pseudo
FT                   /locus_tag="Arch_0461"
FT   gene            546175..546835
FT                   /pseudo
FT                   /locus_tag="Arch_0462"
FT   gene            complement(546855..547244)
FT                   /locus_tag="Arch_0463"
FT   CDS_pept        complement(546855..547244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0463"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3959 GCN5-related
FT                   N-acetyltransferase; SPTR: D0YU50 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92211"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMR2"
FT                   /protein_id="ADH92211.1"
FT                   /translation="MFVRKCVADNKQVVAFFSFKMIVIEVQSFSKSLQKSANSNSAGQS
FT                   TGLLLAWMGRDETVDNCGKALMREVFLHAITAHKIAAYSLLVVDALLDNLVSFYEHFGF
FT                   RRVPSDTRRLVMKASALLKIAERLN"
FT   gene            complement(547520..547942)
FT                   /locus_tag="Arch_0464"
FT   CDS_pept        complement(547520..547942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0464"
FT                   /product="Uncharacterized phage-associated protein"
FT                   /note="COGs: COG3600 Uncharacterized phage-associated
FT                   protein; KEGG: vei:Veis_1323 hypothetical protein; SPTR:
FT                   D0YU49 Putative phage-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92212"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMR3"
FT                   /protein_id="ADH92212.1"
FT                   /translation="MILSPDVSHNVDPASVANYILHLDTQREDSDVTQMKLHKLLYLAQ
FT                   AHYLAVTGYRLMDSDVEAFEHGPVIKAVFPMFREYGREVIVNHRPLCLVTCPKMSKISS
FT                   SNSGIFIRITLQVTFASLLTIKIRGRIITSRTLGTS"
FT   gene            complement(548014..548529)
FT                   /locus_tag="Arch_0465"
FT   CDS_pept        complement(548014..548529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0465"
FT                   /product="NUDIX hydrolase"
FT                   /note="InterPro IPR000086:IPR020084:IPR015797; KEGG:
FT                   lhe:lhv_1697 hypothetical protein; PFAM: NUDIX hydrolase;
FT                   SPTR: C7XIN6 NUDIX family hydrolase; PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92213"
FT                   /db_xref="GOA:D7BMR4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMR4"
FT                   /protein_id="ADH92213.1"
FT                   /translation="MNSELFLELTDNEWTCEFIDHDRDIARAIVIDDDGYFHFVRVERD
FT                   DDFGKATIIETAGGGVEPEENLDTAIKRELKEELGAEVDVLCKIGVVSDFYNLIHRHNI
FT                   NNYFLCKITGTGAKHLTKAEIDDFHLSTLKLKFDDAVAEYERCATTQLGRLIANRELPV
FT                   LQRAKEML"
FT   gene            548696..548956
FT                   /locus_tag="Arch_0466"
FT   CDS_pept        548696..548956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0466"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /note="InterPro IPR007337; KEGG: lba:Lebu_0151 addiction
FT                   module antitoxin, RelB/DinJ family; PFAM: RelB antitoxin;
FT                   SPTR: C7ND10 Addiction module antitoxin, RelB/DinJ family;
FT                   TIGRFAM: addiction module antitoxin, RelB/DinJ family;
FT                   PFAM: RelB antitoxin; TIGRFAM: addiction module antitoxin,
FT                   RelB/DinJ family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92214"
FT                   /db_xref="GOA:D7BMR5"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMR5"
FT                   /protein_id="ADH92214.1"
FT                   /translation="MVTTTINLRIDQEVKSDMEAVCKELGMNMTTAFTIFAKKMGREGR
FT                   IPFEVSIDPFYSKENLAHLRRSIASLESGRGVAHELVDDGE"
FT   gene            548946..549215
FT                   /locus_tag="Arch_0467"
FT   CDS_pept        548946..549215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0467"
FT                   /product="addiction module toxin, Txe/YoeB family"
FT                   /note="COGs: COG4115 conserved hypothetical protein;
FT                   InterPro IPR009614; KEGG: dhd:Dhaf_2026 addiction module
FT                   toxin, Txe/YoeB family; PFAM: Addiction module toxin
FT                   Txe/YoeB; SPTR: C4G508 Putative uncharacterized protein;
FT                   TIGRFAM: addiction module toxin, Txe/YoeB family; PFAM:
FT                   Plasmid encoded toxin Txe; TIGRFAM: toxin-antitoxin system,
FT                   toxin component, Txe/YoeB family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92215"
FT                   /db_xref="GOA:D7BMR6"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMR6"
FT                   /protein_id="ADH92215.1"
FT                   /translation="MVNKIWAPEAWDDYVWWQTQDRKTLKRINSLIKDIERGSMYEGIG
FT                   KPEPLRGELSGFWSRRIDDKNRLVYRVRDGHIEIASCRSHYGAR"
FT   gene            complement(549333..550232)
FT                   /locus_tag="Arch_0468"
FT   CDS_pept        complement(549333..550232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0468"
FT                   /product="acyl-CoA thioesterase"
FT                   /note="COGs: COG1946 Acyl-CoA thioesterase; InterPro
FT                   IPR003703; KEGG: bcv:Bcav_2638 palmitoyl-CoA hydrolase;
FT                   PFAM: acyl-CoA thioesterase; SPTR: D0WRE2 Acyl-CoA
FT                   thioesterase II; PFAM: Acyl-CoA thioesterase; TIGRFAM:
FT                   acyl-CoA thioesterase II"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92216"
FT                   /db_xref="GOA:D7BMR7"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMR7"
FT                   /protein_id="ADH92216.1"
FT                   /translation="MPIYLPVPASSEEPLASILRTLRLEVREPGSYVGTNLSQFNGRVY
FT                   GGQVFGQAVMAAWASVMDSYPDRDIHSITAAFMRPGDQKEPISFDVEEVNDSRSFSTRR
FT                   VHASQFGKTILSCRASFQERQPGVEHASEVPCAPDPETLESSVEFFANFDHPASKHMHT
FT                   TSAIDMRHVDGPIWVRPAAKRDGHTLIWFKIRGEMPAGSSQLLHRAMLAYATDQFMLEP
FT                   VMRMHGMFWLSPDISLATLDHAIWWHRDVDMSDWVLAELDSPSAQGGRGLAVAKFFQHG
FT                   THIATMAQEGMTRSRLVG"
FT   gene            550472..552613
FT                   /locus_tag="Arch_0469"
FT   CDS_pept        550472..552613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0469"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="COGs: COG1640 4-alpha-glucanotransferase; InterPro
FT                   IPR013781:IPR003385:IPR017853; KEGG: bcv:Bcav_2633
FT                   4-alpha-glucanotransferase; PFAM: glycoside hydrolase
FT                   family 77; PRIAM: 4-alpha-glucanotransferase; SPTR: D0WRE1
FT                   4-alpha-glucanotransferase; TIGRFAM:
FT                   4-alpha-glucanotransferase; PFAM:
FT                   4-alpha-glucanotransferase; TIGRFAM: glutamate--cysteine
FT                   ligase/gamma-glutamylcysteine synthetase, Streptococcus
FT                   agalactiae type; 4-alpha-glucanotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92217"
FT                   /db_xref="GOA:D7BMR8"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMR8"
FT                   /protein_id="ADH92217.1"
FT                   /translation="MPDHSLDLEKLHRLADAYNVATEFWGFNGEHVSVDQDTLIAVLAA
FT                   MGVDATSNDMIEAALVAKEEAPWRQILPSCVVTRNDRELTVPVHVPHGWDVVLTILCED
FT                   GTERSVRQCEDFTPPRMVEGHQIGQASFVLDEGLPLGYHTLRARVSHNETDKFAEDTTT
FT                   LIVTPARLDRGSLDDKRSWGMMAQLYSTRSAQSWGIGDTDDLLEMASLFGSMGADYLLV
FT                   NPLHAAEPIEPISPSPYLPVTRRFFNPMYIRPENIREVAYLSGPERSLVTWAAENVKKD
FT                   SVKNTHIDRDSSWKAKREALEVIFKAGRSQSRDREFAQYRHNEGQGLEDFALWCALVEH
FT                   YEGRPFPEDLKDIHGRAVAKARTALKERVDFWAWLQWVMDEQLADAQRAAKAAGMAFGV
FT                   AHDLAVGVHPAGSDTWTIPEAFARGIGVGAPPDMYNQQGQNWSQPPWRPDALERMDYAP
FT                   LRDMARTVLRHAGVLRVDHVMGLFRLWWIPDGSPASRGTYVRFNHDAMVGILLLEAYRA
FT                   GAVVVGEDLGNVEPWVRDYLSDRGMWGTSIFWFEKDEQGNPLRAEDYRYGALVSVDTHD
FT                   LPPAAGYLAEEHVDLRARLGLLVEAEEEVRAQARHERETVYARLREYGLIGDDPSEREV
FT                   IEAIHVYLAKTPSPLLCISLVDAVGERRAQNQPGTDQEYANWKIPLADGTEKVVLVEEL
FT                   ATNPRLISLVETFTKALNS"
FT   gene            552676..552915
FT                   /locus_tag="Arch_0470"
FT   CDS_pept        552676..552915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0470"
FT                   /product="phosphotransferase system PTS EIIB protein"
FT                   /note="InterPro IPR001996; KEGG: cai:Caci_8113
FT                   phosphotransferase system PTS EIIB protein; SPTR: C7QIN6
FT                   Phosphotransferase system PTS EIIB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92218"
FT                   /db_xref="GOA:D7BMR9"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMR9"
FT                   /protein_id="ADH92218.1"
FT                   /translation="MNELAEDFVLGLGGAENIIEAVPAYTRIRIEVGSIGAVNEDLLRA
FT                   AGAHGVVRQKHYIQLIVGPSADELARAICDLIVA"
FT   gene            complement(552902..554107)
FT                   /locus_tag="Arch_0471"
FT   CDS_pept        complement(552902..554107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0471"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="COGs: COG1301 Na+/H+-dicarboxylate symporter;
FT                   InterPro IPR001991; KEGG: bfa:Bfae_09780 Na+/H+
FT                   dicarboxylate symporter; PFAM: sodium:dicarboxylate
FT                   symporter; SPTR: C0VZC5 DAACS family dicarboxylate/amino
FT                   acid:cation Na+ or H+ symporter; PFAM: Sodium:dicarboxylate
FT                   symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92219"
FT                   /db_xref="GOA:D7BMS0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMS0"
FT                   /protein_id="ADH92219.1"
FT                   /translation="MEPAIIAKLKKNLLAWIVLAIVAGALLGKILPTTAIVPFATFNDV
FT                   FGKFLGFSVPLIIVGLVTPAIADLGKSGGRWVILTVGLGYISTILAGLGTWGLASLLYP
FT                   SFLAGQEVPDLAEPENAVASLMDASFSLPPVFGVLTALILAFLVGFGAVAAQAESIISL
FT                   LQEFRDIIFIVIKKSIVPLLPLHVFGIFLNMSKSGQFETVIVAMAKVIAFAFALTLIML
FT                   LGQFTIAGTVAKKNPLTSLWNMRDAYATALGTASSAATIPVTLRSTMKNGVSEDVAGFV
FT                   VPLCATIHLAGSTIKITAFALALQHMLGLDIEPGKIIGFILMLGIIMIAAPGVPGGAIT
FT                   AAQSVVQGMLGFTDPMYGIMVALYVAVDSFGTATNVTGDGAIAMIVNRFVTPEKSAATT
FT                   QQ"
FT   sig_peptide     complement(554003..554107)
FT                   /locus_tag="Arch_0471"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(554393..555169)
FT                   /locus_tag="Arch_0472"
FT   CDS_pept        complement(554393..555169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0472"
FT                   /product="formate/nitrite transporter"
FT                   /note="COGs: COG2116 Formate/nitrite family of transporter;
FT                   InterPro IPR000292; KEGG: jde:Jden_2227 formate/nitrite
FT                   transporter; PFAM: formate/nitrite transporter; SPTR:
FT                   C0VY37 FNT family formate-nitrite transporter; PFAM:
FT                   Formate/nitrite transporter; TIGRFAM: formate/nitrite
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92220"
FT                   /db_xref="GOA:D7BMS1"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR024002"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMS1"
FT                   /protein_id="ADH92220.1"
FT                   /translation="MDSLTQTIENQADVGVAKAKKAQHVGAYLVGGALAGAFVGIGCLF
FT                   MYTGPAGMYVHHSDLAGTMMGLVFGIGLILVVYAGGELATSGMMIMPLAAIRHKVSVLR
FT                   AAWMIMFMLIGNLVGSIVLSALITGAHVFKPGSLPHQMLDGVVSGKLAKDYSEVFFRAI
FT                   LCNVMVCLAIWTISRMKTEIGQIIVIVWAITVFVAAGFEHVVANMTSFSLAMMNGIDGI
FT                   TVGNAAMSLLVAGAGNLVGGMVVVGGTYVLAAKMEA"
FT   gene            complement(555237..557783)
FT                   /locus_tag="Arch_0473"
FT   CDS_pept        complement(555237..557783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0473"
FT                   /product="aminopeptidase N"
FT                   /note="COGs: COG0308 Aminopeptidase N; InterPro
FT                   IPR014782:IPR012778; KEGG: bcv:Bcav_2630 aminopeptidase N;
FT                   PFAM: Peptidase M1 membrane alanine aminopeptidase; SPTR:
FT                   D0WRD5 Aminopeptidase; TIGRFAM: aminopeptidase N; PFAM:
FT                   Domain of unknown function (DUF3358); Peptidase family M1;
FT                   TIGRFAM: aminopeptidase N, Streptomyces lividans type"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92221"
FT                   /db_xref="GOA:D7BMS2"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012778"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMS2"
FT                   /protein_id="ADH92221.1"
FT                   /translation="MPGQNLTRVEAAARADIITSHSYRVELDLRGDTTFRSQTTAKFGA
FT                   TAGASTFIDLIAQSVEKIVLNGVELPTAAYADSRITLENLKEENELYVDATCVFSHTGE
FT                   GLHRATDPADGEVYLYSQFEVPDSRRMYTVFEQPDLKAEFTFVVTAPEAWKVFSVSPTP
FT                   EATPAGDGFATWEFSPTERISSYLTCIVAGPYEGVTDSHPSKDGRVIPMGVYARKSLAE
FT                   YLDGEEIITITKQAMDFFEDAWDVPYPFRKYDQIFVPEYNAGAMEHPGCVTILDDYVFR
FT                   SRPTQALVERRAITVVHELAHMWFGDLVTMKWWDDLWLNESFAEFTSHVATAEATAWKD
FT                   AWVTFNSSEKSWAQMQDQLPSTHPIAADIRDLEDVQVNFDGITYGKGASVFQQLVAYVG
FT                   RDAFFTGVSKYLKKKAWGNATLDDLLVELSAASGRDLTEWVKLWLQESGINILRPRMEL
FT                   DGSTIREFVIEQASDGRASLRPHRIGVGGYSRDDSGKLVRVVHTELDIDAEATVVPAFS
FT                   GIERPELILINDGDLAYAKVRLDDKSLAFAVENINSFTDRLPRTLVLFSAWDMTRDGEM
FT                   AASDYAALVLKALETEDHGTVLRSLINQLTTAVTLYSAPAKRDALQAEVGAHLAQLAKD
FT                   AQPDTDRQFQLAMASVSLAHTDEQVDTVAGWLDGVDVPEGLSVDANFRWVILTRLAAAG
FT                   RVDAAMIEAERVERDNTASGAANAARARAAISTPEAKEASWEEITGGEVPNSIQRAASY
FT                   GFTNGNPALLVPFVERYFANIESQWENRTVEIASNFIGGAFPTKLTGRTDLGVDIVALG
FT                   EAWLEENTEVAPAARRLFSEALAHAQRAARAQQADA"
FT   gene            complement(558199..560199)
FT                   /locus_tag="Arch_0474"
FT   CDS_pept        complement(558199..560199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0474"
FT                   /product="Endothelin-converting enzyme 1"
FT                   /EC_number="3.4.24.71"
FT                   /note="COGs: COG3590 metalloendopeptidase; InterPro
FT                   IPR018497:IPR008753; KEGG: xce:Xcel_1104 neprilysin; PFAM:
FT                   peptidase M13; Peptidase M13, neprilysin-like; PRIAM:
FT                   Endothelin-converting enzyme 1; SPTR: D1BJV6
FT                   Endothelin-converting enzyme; PFAM: Peptidase family M13"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92222"
FT                   /db_xref="GOA:D7BMS3"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMS3"
FT                   /protein_id="ADH92222.1"
FT                   /translation="MSIDNTAQQVAEQLNFAVRPQDDLFRHVNGAWIDSTEIPADQSSA
FT                   GSFIDLHNQAEEDVRTIITDLAATGSEDPDAAKIGALYNSFMNEGVINGLGATPLAPEF
FT                   NVLDSAASKEDLEIAIAQFYTTGIGAPFGIGTDADRNNPDQYIPWAYQSGIGLPDEAFY
FT                   RAEEYAEILDAYRTFIPTLYSLATGSTDVDAKDAAEQILAVETAIASHHFSVVESRNAE
FT                   LTNNVMSYDEFTQLAGSFNLKAILAAIGITADNAPEILCMTPRSFTGLGEVWEKFDIDA
FT                   LRTYLRWHVVLARAPYLSDDISAANFAFYGTTLSGQEVQRDRWKRAVMLVNDGLGEAVG
FT                   KVYVAKHFPPAHKEKMEQLVADLLDAYRESISTLDWMTEETRERALAKLAAFTPKIGYP
FT                   VRWKDYSDLAISSDDLMGNIRAIAAFEHAEDIAKLGTTVDRDEWHMTPQTVNAYYNPVM
FT                   NEIVFPAAILQPPFFDADADAAWNYGGIGAVIGHEIGHGFDDQGSKYDGTGRLNNWWTD
FT                   KDREEFEKRTKALVDQYSAYVPAQFPDDSPHHVNGELTLGENIGDLGGLTIALKAYNIA
FT                   CKRDGLASSADAPEIAGFTGIQRVLLSYARIWQEKRRDELMLQRVATDPHSPAEFRANG
FT                   VVKNVDAFAEAFDVQPGDALYLAPEDRVRIW"
FT   gene            560236..560679
FT                   /locus_tag="Arch_0475"
FT   CDS_pept        560236..560679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0475"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /note="COGs: COG0698 Ribose 5-phosphate isomerase RpiB;
FT                   InterPro IPR003500:IPR011860; KEGG: bcv:Bcav_2620 ribose
FT                   5-phosphate isomerase; PFAM: Ribose/galactose isomerase;
FT                   SPTR: D1BJV4 Ribose 5-phosphate isomerase; TIGRFAM: ribose
FT                   5-phosphate isomerase; sugar-phosphate isomerase,
FT                   RpiB/LacA/LacB family; manually curated; PFAM:
FT                   Ribose/Galactose Isomerase; TIGRFAM: ribose 5-phosphate
FT                   isomerase; sugar-phosphate isomerases, RpiB/LacA/LacB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92223"
FT                   /db_xref="GOA:D7BMS4"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR011860"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMS4"
FT                   /protein_id="ADH92223.1"
FT                   /translation="MRVHIAADHAGFELKAHLIEHLREQGHEVTDHGYETYDKLDAYPP
FT                   VCFAAGEAVVADPGSLGIVIGGSGNGEQIAANKVAGVRAALVWNEEIASLAREHNNANV
FT                   ISLGARQHSLEEATRFVDVFLSTGYDPESRHQSRIDMMSDYEK"
FT   gene            complement(560692..561273)
FT                   /locus_tag="Arch_0476"
FT   CDS_pept        complement(560692..561273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0476"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="COGs: COG1045 Serine acetyltransferase; InterPro
FT                   IPR018357:IPR001451:IPR005881:IPR011004; KEGG:
FT                   mlu:Mlut_09440 serine O-acetyltransferase; SPTR: D0WRD0
FT                   Serine O-acetyltransferase; TIGRFAM: serine
FT                   O-acetyltransferase; PFAM: Serine acetyltransferase,
FT                   N-terminal; TIGRFAM: serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92224"
FT                   /db_xref="GOA:D7BMS5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMS5"
FT                   /protein_id="ADH92224.1"
FT                   /translation="MHNHPPLFTQMKEDMQAVLKHDPAARNLVEVFLAYPGVHAVWGYR
FT                   IAHRMWGHERLKTPARILAQAVRTFTGIEIHPGAELGRRLFIDHGMGVVIGETAEVGDD
FT                   VVIFHGTTLGGVSMSEEKRHPTVGDRVVIGSGAKVLGPITVGHDVAIGANAVVVKDVPD
FT                   GNTAVGIPAKNRPARNRAETGEQLDPAMWI"
FT   gene            complement(561295..562221)
FT                   /locus_tag="Arch_0477"
FT   CDS_pept        complement(561295..562221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0477"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="COGs: COG0031 Cysteine synthase; InterPro
FT                   IPR001216:IPR001926:IPR005856:IPR005859; KEGG:
FT                   xce:Xcel_1111 cysteine synthase A; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   SPTR: D0WRC9 Cysteine synthase A; TIGRFAM: cysteine
FT                   synthase; cysteine synthase A; PFAM: Pyridoxal-phosphate
FT                   dependent enzyme; TIGRFAM: cysteine synthase A; cysteine
FT                   synthases"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92225"
FT                   /db_xref="GOA:D7BMS6"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMS6"
FT                   /protein_id="ADH92225.1"
FT                   /translation="MLYNNATELIGNTPLVRINRIAGTAATVAAKLEFYNPANSVKDRI
FT                   GVAIIDAAEASGELAPGGTIIEATSGNTGIALAWVGAARGYKVILTMPESMSKERRALL
FT                   RGFGAELVLTPKADGMRGAVEAAEKLVAETPGAIKASQFANAANPEKHYTTTGPEIWND
FT                   LDGNVDIFIAGIGTGGTITGTGKYLKEKNPELHIVAVEPAESPLLSEGKAGPHGIQGIG
FT                   ANFVPEVLDTEVYDEVLPVPSDAAIDFARRAAHEEGLMVGISAGAALYAAAQVAARPEN
FT                   AGKTIVAIIPDFGERYVSTPLFAGLTD"
FT   gene            complement(562323..562976)
FT                   /locus_tag="Arch_0478"
FT   CDS_pept        complement(562323..562976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0478"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="COGs: COG1739 conserved hypothetical protein;
FT                   InterPro IPR020569:IPR001498:IPR015269:IPR020568; KEGG:
FT                   cur:cur_1185 hypothetical protein; PFAM: protein of unknown
FT                   function UPF0029; Domain of unknown function DUF1949; SPTR:
FT                   D0WRC8 IMPACT family member YigZ; PFAM: Uncharacterized
FT                   protein family UPF0029; TIGRFAM: conserved hypothetical
FT                   protein TIGR00257"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92226"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMS7"
FT                   /protein_id="ADH92226.1"
FT                   /translation="MITLLRLPAGTELRSELEIKRSRFITLIRRVESADSARQLVADAR
FT                   AEFPDARHHCSAYVVSVPGAQPLSHSSDDGEPSGTAGRPMLDVLTGGGLTDIAAVVVRY
FT                   FGGTLLGTGGLVRAYSDAVRLTLSDTPLVQPVTRSIQRLVLPHASAGKFEAEARGRGYA
FT                   VVETLYESDGVVFRVAVDNVDQFGIFVSENSRGEIEPIPDGSLILDQPAGTCSL"
FT   gene            563136..563300
FT                   /locus_tag="Arch_0479"
FT   CDS_pept        563136..563300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0479"
FT                   /product="ribosomal protein L32"
FT                   /note="InterPro IPR002677; KEGG: cur:cur_0544 50S ribosomal
FT                   protein L32; PFAM: ribosomal L32p protein; SPTR: D0WRC7
FT                   Ribosomal protein L32; TIGRFAM: ribosomal protein L32;
FT                   PFAM: Ribosomal L32p protein family; TIGRFAM: ribosomal
FT                   protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92227"
FT                   /db_xref="GOA:D7BMS8"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMS8"
FT                   /protein_id="ADH92227.1"
FT                   /translation="MAVPKRKMSRSNTRSRRSQWKAELTELQTVKSLGGREVRIPRRLA
FT                   KAAQKGLLD"
FT   gene            563505..564137
FT                   /locus_tag="Arch_0480"
FT   CDS_pept        563505..564137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0480"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kko:Kkor_1729 hypothetical protein; SPTR:
FT                   C7RCZ9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92228"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMS9"
FT                   /protein_id="ADH92228.1"
FT                   /translation="MSRKFFGILAAATIVLTGCSDTQSATDKVTDKPAASETKKEEPKP
FT                   TLSETTLKRALKETDLKETPQEDRNVYDAPVLHLEVPKELIRQHDKKDGRIGFWKDADE
FT                   SRSIVLAVVGIAGVAQNAENYAAMLREASQAQGKNVDVQEDVEFGDVSAHHISVSGGAY
FT                   HSEIFAFTVDGVAYELTLNAKSPELLDTLRPFALTTVATPKEHRSAN"
FT   sig_peptide     563505..563576
FT                   /locus_tag="Arch_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            564166..565161
FT                   /locus_tag="Arch_0481"
FT   CDS_pept        564166..565161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0481"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR011040; KEGG: cti:RALTA_A0551 conserved
FT                   hypothetical protein, 4Fe-4S cluster binding motif; SPTR:
FT                   A7BBY7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92229"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMT0"
FT                   /protein_id="ADH92229.1"
FT                   /translation="MIEAIGEPRRLCAPSDKGEVRIPALANVAGETVCLFDVRPAPASG
FT                   AGRAFTGEVMASDLPNPNYLAYVSVDHPSDPIRFTDEPAISSDACVASEGASITVAYGS
FT                   VDGPVSYMSSRFTGPRLVPWLAYGADLDSLAHHRLDVLYEETRADALFATSGSTITIDD
FT                   MAFVPYTMRCGDEAHVRIAHFRRGELVDLSGPITAPHAQIDETSLAYDPAGTVILNARI
FT                   QGFEGRGAGGRLVAYSSDGLTFTCPDRVEIPHPGSNAKALGHMLIHPHSLTARERGAIV
FT                   DMRTGRILFDFGPGEFGYSDAIWAPDGTLCVVAERNNELWEWRLAGVPGA"
FT   gene            complement(565138..566001)
FT                   /locus_tag="Arch_0482"
FT   CDS_pept        complement(565138..566001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0482"
FT                   /product="ABC-3 protein"
FT                   /note="COGs: COG1108 ABC-type Mn2+/Zn2+ transport systems
FT                   permease components; InterPro IPR001626; KEGG: cdi:DIP0441
FT                   hypothetical protein; PFAM: ABC-3 protein; SPTR: C0W5N9 ABC
FT                   superfamily ATP binding cassette transporter, permease
FT                   protein; PFAM: ABC 3 transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92230"
FT                   /db_xref="GOA:D7BMT1"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR022392"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMT1"
FT                   /protein_id="ADH92230.1"
FT                   /translation="MNIIDFFTDLTNPALSFLPRALIVAILASIVCGVVGTHVVLRGMS
FT                   FVGDALSHAVFPGIAAAFALQGSILLGGAVAGVIVTLLITLFSQHRRLKEDSIIGVFFA
FT                   AAFALGLVIMSRIPGYTGSLESFLFGSLNGSTDSDMLAVAGLGFVIISVLALFHRKLVA
FT                   VSVDRDYASSLGMSTLAADLIIYLAVAAAVVVSVQTIGNILVLALLITPAAAARMLTDR
FT                   VATMMVISPALGSLGAFLGIWASWTWDVPTGATIVLILTVIFVVAWLFAPRRGVITGRL
FT                   RARHAG"
FT   sig_peptide     complement(565903..566001)
FT                   /locus_tag="Arch_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(565998..566720)
FT                   /locus_tag="Arch_0483"
FT   CDS_pept        complement(565998..566720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0483"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1121 ABC-type Mn/Zn transport systems
FT                   ATPase component; InterPro IPR017871:IPR003439:IPR003593;
FT                   KEGG: stp:Strop_2035 ABC transporter related; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: C0W5P0 ABC
FT                   superfamily ATP binding cassette transporter, ABC protein;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92231"
FT                   /db_xref="GOA:D7BMT2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMT2"
FT                   /protein_id="ADH92231.1"
FT                   /translation="MTRLLHVDNVGVKLGGRNVLHDISFSIESGQLVGLIGPNGAGKTT
FT                   LMRAINGLIPTAAGTITRNAKIGYVPQSRLIEWDYPMSLEQLVATSFIPTQRWYSRLGK
FT                   KEWQAVYQALDTVGLAHYSDRTLAELSGGQKQRLLVARALVTQPSLLLLDEPFTGLDHP
FT                   NQDSLTELFTSLANTGVGILMSTHDLPGAVDMCSQLLMVNRTVRAYGTPADLRDPHLWM
FT                   ETYGVREHSPLLKSLGLA"
FT   gene            complement(566717..567652)
FT                   /locus_tag="Arch_0484"
FT   CDS_pept        complement(566717..567652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cdi:DIP0439 hypothetical protein; SPTR: C0W5P1
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92232"
FT                   /db_xref="GOA:D7BMT3"
FT                   /db_xref="InterPro:IPR022435"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMT3"
FT                   /protein_id="ADH92232.1"
FT                   /translation="MKHRILTALTLTTLTLSASSAYATTDSSEADPALTQRVDADEVIA
FT                   PAGKQVELDAGHIDLGPKMIDGKWHFMARDDSQATPVWRQIDDMLYRVSDNGILTVPND
FT                   ATYSFIKSDDQKVWVVPQQEIPGVVWLGWNTQDPAVTENVNGTVTLTYGGHDGPGQFTT
FT                   FVQAGNFGAPQLLWTSDKKEQQPIDVELHSHTHANWVFTKPGIHRVTLTAAATLNDGTT
FT                   VSETKTLTFAVGSDTDAATALDETAKLTSDTTEPSNAPHAEKPRPAQHGPSTLPIVAGL
FT                   AGIGIVSALLAIYFFKRRESATKKSAKDEL"
FT   sig_peptide     complement(567584..567652)
FT                   /locus_tag="Arch_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(567649..569205)
FT                   /locus_tag="Arch_0485"
FT   CDS_pept        complement(567649..569205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0485"
FT                   /product="periplasmic solute binding protein"
FT                   /note="COGs: COG0803 ABC-type metal ion transport system
FT                   periplasmic component/surface adhesin; InterPro
FT                   IPR006129:IPR006128:IPR006127; KEGG: pac:PPA1501
FT                   periplasmic solute binding protein; PFAM: periplasmic
FT                   solute binding protein; SPTR: C0W5P2 ABC superfamily ATP
FT                   binding cassette transporter, solute binding protein; PFAM:
FT                   Periplasmic solute binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92233"
FT                   /db_xref="GOA:D7BMT4"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="InterPro:IPR022434"
FT                   /db_xref="InterPro:IPR022435"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMT4"
FT                   /protein_id="ADH92233.1"
FT                   /translation="MKRFLAMACTAAMLSGCSPATTTHSHQIVASTPFLADITRNIAGS
FT                   NFTVTSLTPPGRDPHTYEPTMSTIRSIAYADMAITNQLLLEDAALMDTIAANLPRTSRV
FT                   VALGDEAVPFGAYHIPLVEDVSLSTTWLGLRVDGAGGSQDSVSFHATDVSGPAPMAAFT
FT                   TGTFGQANAWLTSSDGISDADSLALPTNAHTHMSWAFMKPGVYKIALAAELSSAATHDL
FT                   GSSTVTFAVGVDPAKVASTMIDDDGRPARVISSGHVDITASLADGISLRGEDGNGTSYV
FT                   VDPHKTVIAVPHSTATTIPNQGNWRFLGKPGQDVWILAQAVIGKHVHGEIDPHMWLDVR
FT                   NTAAYVDTIAQALASYDPAHKNDYLTNARTYKEKLAKLDRWIKLTMAAIPPENRRLVTS
FT                   HDGYGYFAKGYGLDVAGYVSPNPSVEPSTRDLTNLSATLGSLNIPAVFAELGAAGQSPA
FT                   LINVARAHNINVCTITGDVLHGNQTYIDLMTNLTTTISTCLNPGALPPWPADQDIPKVT
FT                   P"
FT   sig_peptide     complement(569131..569205)
FT                   /locus_tag="Arch_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            569550..571907
FT                   /locus_tag="Arch_0486"
FT   CDS_pept        569550..571907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0486"
FT                   /product="carbon starvation protein CstA"
FT                   /note="COGs: COG1966 Carbon starvation protein predicted
FT                   membrane protein; InterPro IPR003706; KEGG: krh:KRH_18870
FT                   carbon starvation protein; PFAM: carbon starvation protein
FT                   CstA; SPTR: D0WP83 Carbon starvation protein A; PFAM:
FT                   Carbon starvation protein CstA"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92234"
FT                   /db_xref="GOA:D7BMT5"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMT5"
FT                   /protein_id="ADH92234.1"
FT                   /translation="MSAPTTPVYTAEEEKYILRNKDGVPVGVKPHQKWTPFKIALWVGI
FT                   SLLGALGWTMLAIIRGEEVNSIWFVITAICTYAIGYRFYALYIQRKIMIPDDTNATPAE
FT                   RINNGRDFDPTNRVVLYGHHFAAIAGAGPLVGPVLAAQMGYLPGTLWIIFGVLIAGAVQ
FT                   DMLVLFFSMRRGGRSLGKMAQDEIGKIGGAVATVIVLVMLMIVLAVLAMVCVNALAESP
FT                   WGVFSVGMTIPLAIAMGLWLRFVQPGKITQVSIAGCFGLVLCIIGGRYVAESPIGEWLH
FT                   LSPTTLVIAMVIYGFFAAVLPVWMLLTPRDYLSTFMKVGTIAILAVGIIVVRPILEMPA
FT                   VTEFASNTDGPVFAGELFPFLFITIACGALSGMHATVSSGTTPKMVQKESQVRMIGYGG
FT                   MLMESFVAIMALAAAASLNQGIYFGMNTSAGTVDKLAGTAIVQQYDGNREEITADAISK
FT                   LGVTDVKGGKIEARWETEDANGNEVVVTGADAFKAVAKDVGEPSIVSRTGGAPTLAVSM
FT                   AHILHQVGGGKGMMGFWYHFAIMFEALFILSAVDAVTRVARFQVSEALGSIMPKFKDPN
FT                   WNVGAWFATALVVASWGSLLLMGVTDPRGGIQTLFPLFGIANQLIAAIALLLCTVVVAR
FT                   KGFVKYIWIPLIPFAFDVAVTFTASYQKIFSTDAKIGYFQQWRDALAKAETLTDPAAIE
FT                   DNAAVIRNTFIQGTLSIVFVVAVAFVIVAGFIRIFQTIKSGKYSNSEDPYQESNFYAPT
FT                   NLVASSLEKKLVVEYEQVGDPNLIPGAKPRTH"
FT   gene            572054..572254
FT                   /locus_tag="Arch_0487"
FT   CDS_pept        572054..572254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0487"
FT                   /product="protein of unknown function DUF466"
FT                   /note="InterPro IPR007423; KEGG: mlu:Mlut_08620
FT                   uncharacterized small protein; PFAM: protein of unknown
FT                   function DUF466; SPTR: D0WP82 Putative uncharacterized
FT                   protein; PFAM: Protein of unknown function (DUF466)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92235"
FT                   /db_xref="InterPro:IPR007423"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMT6"
FT                   /protein_id="ADH92235.1"
FT                   /translation="MSFREEMKDRYLRARYMWRAITGEGAYDKYVERHRREHPDHEPMT
FT                   EREFWRERSDEAERNVQARCC"
FT   gene            complement(572372..573196)
FT                   /locus_tag="Arch_0488"
FT   CDS_pept        complement(572372..573196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0488"
FT                   /product="2,5-didehydrogluconate reductase"
FT                   /EC_number="1.1.1.274"
FT                   /note="COGs: COG0656 Aldo/keto reductase related to
FT                   diketogulonate reductase; InterPro
FT                   IPR001395:IPR018170:IPR020471; KEGG: krh:KRH_00260
FT                   2,5-diketo-D-gluconic acid reductase; PFAM: aldo/keto
FT                   reductase; PRIAM: 2,5-didehydrogluconate reductase; SPTR:
FT                   P06632 2,5-diketo-D-gluconic acid reductase A; PFAM:
FT                   Aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92236"
FT                   /db_xref="GOA:D7BMT7"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMT7"
FT                   /protein_id="ADH92236.1"
FT                   /translation="MTSTVLLNDARQIPQIGYGTFLVPPEDAEARVSEALEAGYRHIDT
FT                   AAIYRNEEGVGRAIAASGIARDELWITTKLWNDHRGPEQTRAGMEESLSKLGLDYVDLY
FT                   LIHWPAPANGPIASTWETFGELRSEGLTRSIGVSNFDYRYMPDLFATGLVPAVNQIELH
FT                   PQFQQRQTTAMADFHDVRIEAWGPLGQAKVDYNSGVIADIAARYSVSWAQVVLAWHVAK
FT                   GHIVFPKSSTPQRMAENLAAGMLMLMPSEVAAIDALDKGVAGRVSADPADVS"
FT   gene            complement(573506..573799)
FT                   /locus_tag="Arch_0489"
FT   CDS_pept        complement(573506..573799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0489"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_0448 hypothetical protein; SPTR:
FT                   A4F6X2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92237"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMT8"
FT                   /protein_id="ADH92237.1"
FT                   /translation="MSHDLHAEHTVEEHMHGEGCGHEAIQHGDHVDYVHGTHHHALHGD
FT                   HYDEHEAVAEHTVEEHMHGEGCGHEAVAHEDHVDYIHDGHRHALHGEHYDEH"
FT   gene            complement(573842..574141)
FT                   /locus_tag="Arch_0490"
FT   CDS_pept        complement(573842..574141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0490"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="InterPro IPR011991:IPR001845; KEGG: cms:CMS_0559
FT                   ArsR family transcriptional regulator; PFAM: regulatory
FT                   protein ArsR; SMART: regulatory protein ArsR; SPTR: B0RD80
FT                   Putative ArsR-family transcriptional regulator; PFAM:
FT                   Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92238"
FT                   /db_xref="GOA:D7BMT9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMT9"
FT                   /protein_id="ADH92238.1"
FT                   /translation="MDIQKGLPQAAELFKALGNESRLELLVLLDKEPLGVSALAELANM
FT                   SQPLVSQHLRTLRAVGLVTATRHGKEMIYSVADAHVAHVVTDALIHVQETLDPQ"
FT   gene            complement(574342..575010)
FT                   /locus_tag="Arch_0491"
FT   CDS_pept        complement(574342..575010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0491"
FT                   /product="deoxynucleoside kinase"
FT                   /note="COGs: COG1428 Deoxynucleoside kinase; InterPro
FT                   IPR002624; KEGG: cbt:CLH_1831 deoxyguanosIne kinase; PFAM:
FT                   deoxynucleoside kinase; SPTR: A8U7A9 Deoxynucleoside kinase
FT                   family protein; PFAM: Deoxynucleoside kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92239"
FT                   /db_xref="GOA:D7BMU0"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMU0"
FT                   /protein_id="ADH92239.1"
FT                   /translation="MLVVGGMIGVGKTTLASVIAADLDIDLYTENVDGNDILPLFYTAS
FT                   EEEQMLKRYPFLLQLEFLTSRYRDIKHALFGGPSIMDRSIYEDWYFAKVNTDLGRISSE
FT                   EFKLYAKILDEMMKEIAQFPKKAPELMIYLHASFDTILNRIGARGRDFEQDEKLVSYYR
FT                   SLWEGYDDWVYNHYSASPVLLVNADEFDFFRGEDRTLLVDQVAKLKDNPTAQYMTLARP
FT                   "
FT   gene            complement(575164..576282)
FT                   /locus_tag="Arch_0492"
FT   CDS_pept        complement(575164..576282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0492"
FT                   /product="C4-dicarboxylate transporter/malic acid transport
FT                   protein"
FT                   /note="COGs: COG1275 Tellurite resistance protein and
FT                   related permease; InterPro IPR004695; KEGG: krh:KRH_19610
FT                   TDT family transporter; PFAM: C4-dicarboxylate
FT                   transporter/malic acid transport protein; SPTR: B2GGJ2
FT                   Putative TDT family transporter; manually curated; PFAM:
FT                   C4-dicarboxylate transporter/malic acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92240"
FT                   /db_xref="GOA:D7BMU1"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMU1"
FT                   /protein_id="ADH92240.1"
FT                   /translation="MRTEEKRIINYVKQQRAIILPPMGPAWFSSVMGTGILSNLLGRHI
FT                   HAQPWLIVPSAFLLGVGALLLTLYTYSYCARWIKNTNNIRSKRHLLPAVDPNWGTVSMG
FT                   YLSIGAALLTVGPHIGLSSIAVPGDTILWWIGTLIGIITNFSFMAHAIFRHLGQPVPAW
FT                   GLAVVGPMVSATTGAILLTHYACLGMQFFILTLSFLCFIIALVNGAIIFALAYGSHMRF
FT                   NKLPTAVALSAWIPLGVVGQSTAAAVAIASSSGLFLTQLAHPYATHMAIGYGCIMLLTA
FT                   IPVIAFAARQTISGFARNLPFSPGWWALTFPIGTLALGGAFLSEVPMIAGTLLATIASI
FT                   IGWASLTTLCFTWTFCAIASLWAVKNGPRTTN"
FT   sig_peptide     complement(576199..576282)
FT                   /locus_tag="Arch_0492"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(576308..576817)
FT                   /locus_tag="Arch_0493"
FT   CDS_pept        complement(576308..576817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0493"
FT                   /product="molybdopterin binding domain protein"
FT                   /note="COGs: COG0521 Molybdopterin biosynthesis protein;
FT                   InterPro IPR001453:IPR008284; KEGG: tfu:Tfu_0376
FT                   molybdopterin adenylyltransferase; PFAM: molybdopterin
FT                   binding domain; SPTR: Q47T03 Molybdopterin
FT                   adenylyltransferase; PFAM: Probable molybdopterin binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92241"
FT                   /db_xref="GOA:D7BMU2"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMU2"
FT                   /protein_id="ADH92241.1"
FT                   /translation="MDGMVTAAIVRISDSVTSTEQIDPLIARVVQAFSTIDVSVIPTLY
FT                   SRDDVRDIAQAVEVAGLNQVDVVITIGGTGISPLDYTARAMDPLLRFDIPGIPEAIRAY
FT                   AYSHGDTSALLWRCRAGVLVAGPKRILVVNTADTDLGVEAALNTLIPLLPIALTTIHKN
FT                   NNTRQL"
FT   gene            577023..578423
FT                   /locus_tag="Arch_0494"
FT   CDS_pept        577023..578423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0494"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   pac:PPA0604 putative sugar binding protein; PFAM:
FT                   extracellular solute-binding protein family 1; SPTR: A7B9K4
FT                   Putative uncharacterized protein; PFAM: Bacterial
FT                   extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92242"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMU3"
FT                   /protein_id="ADH92242.1"
FT                   /translation="MERKLTNTAAIATAALLALSGCMGGSGKATNADSSSDIPTPKVNC
FT                   EIPEANINNKPVKSDKIEGEITFQTQGLKGTFDDFVNKKIADFEKLHPGTKIKWTDIPG
FT                   GPDFDTTMITQASNCSMADVVNIASSTVLALSKANLLLNFDVKTPDVGKEFIPGVWNSV
FT                   KFGAGESHTAYPWYFGPFLTTYNKQIFEKAGLDPEKAPATMDEYFDNAHKIAAAKTGAY
FT                   SLYGNTSWYMVPQWRAIGVEMMNSDHSEFTFAKDKAALAWVTHMADLYKEGAIPPDSMT
FT                   GDMDMSLAYGEGNLAYGTPNASFLRNVKTNAQATYDVTGVGKEALNKGMKPIFDGQYLA
FT                   VSVTTKNAPLATEWAKFFTSPEAGLEWARFGIDTGLAVVFPATTEALKDPSLSAVEGNG
FT                   VFEQARRLAAEEALDAEAYIPLFYVTGAVADSLQKNVNLAVVGEMSPQEALDTAQAEMN
FT                   KLLKKLNK"
FT   sig_peptide     577023..577118
FT                   /locus_tag="Arch_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            578495..579442
FT                   /locus_tag="Arch_0495"
FT   CDS_pept        578495..579442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0495"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG: lxx:Lxx23450
FT                   ABC transporter, permease protein; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: A7B9K3 Putative uncharacterized protein;
FT                   PFAM: Binding-protein-dependent transport system inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92243"
FT                   /db_xref="GOA:D7BMU4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMU4"
FT                   /protein_id="ADH92243.1"
FT                   /translation="MSTTVHNDVKKSKQRQRTETINGAARYRTWWMPWLWVGIPIILVF
FT                   AFYIFPFINTFVLSFTDADPLSGQGQNVGFQNYIDMFRDPMFWNATFNSVVYALIVVPL
FT                   MTLIPLFLAVLVKEWIPGIGLFRSLYYIPAVSSLVVISLAWRAMLKDDGVVNNLLHYIG
FT                   VIEQPVPFLTGRWMLLISAMLITLWQGIPYYMLMYMAALANVDRTLYEAAEVDGAGPIR
FT                   RFFTVTIPGVRMMMALVATLVSIGCLKIFTEVQLLSNGTGGIGGRSETLTMYIRNEGLD
FT                   PMYGSLGAGSAAAVFLFFMTVGFIVLSQRLSNDR"
FT   gene            579448..580377
FT                   /locus_tag="Arch_0496"
FT   CDS_pept        579448..580377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0496"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0395 ABC-type sugar transport system
FT                   permease component; InterPro IPR000515; KEGG: pac:PPA0606
FT                   putative transport system permease protein; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Q6AA54 Putative transport system permease
FT                   protein; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92244"
FT                   /db_xref="GOA:D7BMU5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMU5"
FT                   /protein_id="ADH92244.1"
FT                   /translation="MSIATTTSQPTDQLPARGANTAVKKNRQSSAHAVQRIHGWKLVRR
FT                   YITLVVVLIVLVGPIVGPLLSAFKGPNEPLFGPGASMIPHEWSLAAFTKLFTDTNILIF
FT                   IGNSLVVCGLNVVSALVFSTTGGYMISRKGWRGRKVVMAFLMSALIFPFESIMLSLYAQ
FT                   VRAMGFYDTLIGVWLPGMMGPFHLFLMMAAFRGIPDEIEDAALIDGAGEWKRFWRVMLP
FT                   QTKGSLVIVGLTAFIFAWQDYLWPLLNIQSDEKNTMMLGIARLQSDFGTDYRVVLAGAI
FT                   VALIPVLAVYFSTQKYFFRGIEEGGLKF"
FT   gene            580390..581757
FT                   /locus_tag="Arch_0497"
FT   CDS_pept        580390..581757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0497"
FT                   /product="glycoside hydrolase family 29
FT                   (alpha-L-fucosidase)"
FT                   /note="COGs: COG3669 Alpha-L-fucosidase; InterPro
FT                   IPR013781:IPR000933:IPR017853:IPR016286; KEGG: pac:PPA0607
FT                   glycosyl hydrolase, putative alpha-L-fucosidase; PFAM:
FT                   glycoside hydrolase family 29 (alpha-L-fucosidase); SMART:
FT                   glycoside hydrolase family 29 (alpha-L-fucosidase); SPTR:
FT                   Q6AA53 Glycosyl hydrolase, putative alpha-L-fucosidase;
FT                   PFAM: Alpha-L-fucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92245"
FT                   /db_xref="GOA:D7BMU6"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016286"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMU6"
FT                   /protein_id="ADH92245.1"
FT                   /translation="MADFDFTPDNLEAAGALSPTFDPGYEYPDDPQIGASLEHWRDLKF
FT                   GVIIHWGIYTAIGQAGSWSLHRDRLGEFTDPPDDFVGSDADYHRWYYEQRHSFVGDDFD
FT                   ADRWATLCADAGMKYVVFTTKHHDGFAMYDTALSNMKSTAEDCPLSRDIFGEVTSAFRA
FT                   HGMETGVYFSKADWARPDYWDLARPLHDRFANYDTKEESGRWDRFVDFSHAQIAELLSN
FT                   YGPMNVLWLDAGWVRAPREDFKIDQLAALARSIQPGILIVDREVHGPHENYRTPEQELP
FT                   DRYVDYPWESCMTWTRTWCSTMKDEPARPTWEIVANLLRIVARGGNYLVGFGPDSSGAL
FT                   SVHVERGLRELGGWMCNHGEGIYGTRALAAPPRVVQKSGADHDWFVVEKSDTLYLYGVP
FT                   SDGACSAASVMIDVDVAEASILGGGVAQIDIDRGVSVLHLVPEENEMGYVVKLTRR"
FT   gene            581779..581961
FT                   /locus_tag="Arch_0498"
FT   CDS_pept        581779..581961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0498"
FT                   /product="AAA ATPase"
FT                   /note="KEGG: mjl:Mjls_0867 AAA ATPase; SPTR: Q1BDQ7 ATPas"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92246"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMU7"
FT                   /protein_id="ADH92246.1"
FT                   /translation="MGELVVTDEFREALDVLDAGSHLFLTGRGTGKSALIRPIDIAVAY
FT                   PDGTTIESLVKSYAR"
FT   gene            582008..582247
FT                   /locus_tag="Arch_0499"
FT   CDS_pept        582008..582247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0499"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rlt:Rleg2_1061 hypothetical protein; SPTR:
FT                   D0YT67 AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92247"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMU8"
FT                   /protein_id="ADH92247.1"
FT                   /translation="MRETRKDTIDSLNGSGVDTDAAIYQPLDEITVGYLLTRNFEIVPI
FT                   GSPEDVARLLEAKLAGKRAMLLDGANLSILLKNS"
FT   gene            complement(582339..582605)
FT                   /locus_tag="Arch_0500"
FT   CDS_pept        complement(582339..582605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0500"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcu:Tcur_4129 phosphoenolpyruvate carboxylase;
FT                   SPTR: D1A204 Phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92248"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMU9"
FT                   /protein_id="ADH92248.1"
FT                   /translation="MALLTNTVNLLHLEGLYAEHDDLLPIAKVNNASPRWPIFEVIAMS
FT                   MPLAFGKAENAIAENSTAAAPRAPDLDLAKNHADTNFVCGTAK"
FT   gene            582737..585199
FT                   /locus_tag="Arch_0501"
FT   CDS_pept        582737..585199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0501"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: C1FFK9 Predicted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92249"
FT                   /db_xref="GOA:D7BMV0"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMV0"
FT                   /protein_id="ADH92249.1"
FT                   /translation="MNTKNSLAMRAALAATLSGVVIAGGAPAFAAPATDADAAKVIVCP
FT                   TEQVKKEQLERARQAVEAARAKVVEARAAVEAAKSHVDEAQAVYDAAQRQADKTADSLA
FT                   KAKGELVKAKSAVKAAQSAYDAAVAAEKAAKDAYDAYQAAKPDEVAARLEAAKKASARV
FT                   VELEKAMLDANKASVEAGDAEALRREMVKANKEAIAAADKTSKAKTARDEANKAAVAAA
FT                   EKTSKAKADRDKANKAAIAAGEAVKTAVEERDKADKAVTEAHKAFESAKAAWKAYDEAE
FT                   AAYTRINPVAVVENLKKAKAAAEDAEKRREALVEAQQALMKAGSDFDPKKLADAKAAQE
FT                   KAENKTKEASNKLTDAEKAVEKAKTTAETAKNVKNFAESNLTRAEQSNDATEIEEAKRK
FT                   VKDATQRLEKATQELTKATQEKQAANDAFEQAKQELLAANKVYWEAQEAEKAAKDHAAL
FT                   KAKAEAAEAEYSKIDHIQVRRALEAAEAKAAEADKLRKVMEDALEVSQKAGDPDQLEEA
FT                   RNEAARTWAAADRKVEALQGKEATADKLAKEKQDALVAAEQAEKEADARVASAQADFEA
FT                   KEKAEAAADAVLKKAVEDHKRAEAAEAKAQQAYDAYHAAKPKAVEAELVAAQKAAEHVA
FT                   KLNKAMADANKASLEAGDANVLKDKLAQAKDGEKAASAAVSEANIANEAARDAVQNAKD
FT                   ALASVEAVFNKAVQVASDADGALKVANSKLNEIEALPTCEPQKPADAEKPVPPSKPADP
FT                   QKPAGAEKPGVKDKVVAGSAAPKEKAGSQLARTGAETGNAVAFSLMALLGGAGLFGASR
FT                   YTARHRRG"
FT   sig_peptide     582737..582826
FT                   /locus_tag="Arch_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            585380..585659
FT                   /pseudo
FT                   /locus_tag="Arch_0502"
FT   gene            585896..586537
FT                   /locus_tag="Arch_0503"
FT   CDS_pept        585896..586537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0503"
FT                   /product="type III restriction system methylase"
FT                   /note="InterPro IPR002296; KEGG: ajs:Ajs_0195 type III
FT                   restriction system methylase; SPTR: C0W730 Type III
FT                   restriction system methylase; PFAM: N-6 DNA Methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92250"
FT                   /db_xref="GOA:D7BMV1"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMV1"
FT                   /protein_id="ADH92250.1"
FT                   /translation="MSQDDNLVKSKQRVADHGEVFTPSWMVNDMLDLVKDESERIDARI
FT                   LEPACGEGAFLQEVLRRKLTTCQARYGRNEFERDHYALLGLMCIYGIELLEDNAQICRD
FT                   NLHAIFVDFLGPDAKPEWTQAARVVLKTNIVQADALTMKLSNGEAIAFAEWGYLGKGRF
FT                   QRRDFLYGDLAKRSAFGEDTLFGNMEIADIFTPTTSFPTMSVADIAALES"
FT   gene            586540..588159
FT                   /locus_tag="Arch_0504"
FT   CDS_pept        586540..588159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0504"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /EC_number="2.1.1.72"
FT                   /note="InterPro IPR002052:IPR002296:IPR011639; KEGG:
FT                   dol:Dole_0904 site-specific DNA-methyltransferase
FT                   (adenine-specific); PFAM: Eco57I restriction endonuclease;
FT                   PRIAM: Site-specific DNA-methyltransferase
FT                   (adenine-specific); SPTR: C0W729 Type III restriction
FT                   system endonuclease; PFAM: Eco57I restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92251"
FT                   /db_xref="GOA:D7BMV2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR011639"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMV2"
FT                   /protein_id="ADH92251.1"
FT                   /translation="MEGLLGRAHNPDVLTCIANLSNDEVFTPPEMASAMLDMVAEAWAA
FT                   DHDGKNLWANPNVTFLDPFTKTGVFLREITRRLVEGLEAQIPDLQERVNHVLTKQVYGI
FT                   AITELTALMARRSVYCSKRASGGHSICTGFDAPDGNIWFERTEHTWTGGTRESRVDPLT
FT                   GDEIFIYTGRKCSYCGAGENDYGRGDELETHAYAFIHTDNIKQRINEIFGAAMHFDIVI
FT                   GNPPYQLSDGGHNASASPIYQLFVQKAFDLDPSYVTMVTPSRWFAGGKGLDDYRDQMLH
FT                   DHRLRRLVDYPKLYEAFPGVKIRGGVSYFLWDRNHDGPCSVQTMWDGKPLGPEAERYLD
FT                   EFDVLVRQNEAVSILRKVQSLSEPTMDQMVSANKPFGLRTFVHGAESPTGQTDPIQLFG
FT                   SQKVSWIERDDLPLNIELVDTWKVLMTRVQGTSAAVETKFLSKPIIAGPGTACTETYVI
FT                   AGAFSSESEAQSVASYIRTRFARFLVSLRKSTQDAPRRVYAFIPQQSWDRTWTDAELYA
FT                   KYGLTDEDIAFIESIVRPMEDE"
FT   gene            588159..590732
FT                   /locus_tag="Arch_0505"
FT   CDS_pept        588159..590732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpb:Cphamn1_0745 hypothetical protein; SPTR:
FT                   C0W728 Type III restriction system endonuclease; PFAM: Type
FT                   III restriction enzyme, res subunit; TIGRFAM:
FT                   glutamate--cysteine ligase/gamma-glutamylcysteine
FT                   synthetase, Streptococcus agalactiae type"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92252"
FT                   /db_xref="InterPro:IPR018306"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMV3"
FT                   /protein_id="ADH92252.1"
FT                   /translation="MARSAEVLLPPRPSARLRIYAWSPKNPAPEYEGLIKVGQTTREDV
FT                   RERIRESQGQVQQEFTLYADEIAQRDDGSLFRDKDVIERLKAKGFENPHFGSATEWVRC
FT                   KPRDVLSAIAELRKGVVFTGHHYQTFGMRPEQARAVEQTIGYYKSIWEEDINAVPRFLW
FT                   NAKMRFGKTFTSYQLAKRMGAKRVLVVTFKPAVQDAWHEDLASHVDFDSWQYRNTDLMA
FT                   ERGPGDPDEPLVYFGSFQDLLGRDRKTGLIKSKNEWVHTINWDLVIFDEYHFGAWRESA
FT                   KALFEGEDQKVADKELAVEFADGALDAFDTELDELGSDEAEFLPITTRAYLYLSGTPFK
FT                   ALATGEFIEEQIFNWTYTDEQEAKARWELERQGERNPYGALPEMRLLTYQMPDDILSVA
FT                   AQGEFDEFDLNTFFEATGEGDAARFVHESDVQKWLDLIRGEHAPTQLDSLKAGSRPPFP
FT                   YADARLLPYMQHSFWFLPSVASCFAMANLLRARHNTYWHSYDVIVAAGVKAGIGVAALP
FT                   PVREAIDDGYDTKTITLSCGKLTTGVTVKQWSAILMLRNLTSPETYFQAAFRVQSPWAI
FT                   TNPNGDNPHEEEVLKPVAFVFDFAPTRALRQMADYASGLNPTAESPERAVADLVKFLPV
FT                   LAYDGANMKEINAGEILDIAMSGTSATLLAKKWESAILVNVDNMTLRKIMDNQAAMEAI
FT                   MNIEGFRALGSDIFETVVNKSEKVSATKKEKGGDLTKKEKKELTEEEKEYKSKRKQIQE
FT                   KLIKFATRIPAFMYLTDFRENTLHDVITKIEPDLFKKVTGLSVADFNLLVNLGVFNSIH
FT                   MNQAVFAFRRYEDASLHYTGIRSHPEQQRILGLYDTVITLEAQQP"
FT   sig_peptide     588159..588221
FT                   /locus_tag="Arch_0505"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            590981..591276
FT                   /pseudo
FT                   /locus_tag="Arch_0506"
FT   gene            591348..592202
FT                   /locus_tag="Arch_0507"
FT   CDS_pept        591348..592202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0507"
FT                   /product="Integrase catalytic region"
FT                   /note="COGs: COG2801 Transposase and inactivated
FT                   derivatives; InterPro IPR001584:IPR012337; KEGG:
FT                   cur:cur_1459 transposase for insertion sequence; PFAM:
FT                   Integrase catalytic region; SPTR: B1VGV7 Transposase for
FT                   insertion sequence; PFAM: Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92253"
FT                   /db_xref="GOA:D7BMV4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMV4"
FT                   /protein_id="ADH92253.1"
FT                   /translation="MSNVRESVITSRGYRNAYGTPSARSVWDRELVAKVLQIHGENYGV
FT                   YGVRKMWHALSRRGVRVGREQTARLMRLAGVSGKGKGRSPITTHKARREDTRPGLVHRE
FT                   FHAAGPNRLWVADITYVRTAQGFVYAAFVTDVFSRKIVGWALSDSMRTEALPLQALNQA
FT                   ITSAKETAGVIHHSDHGSQYVSIVYNDRLTDAGITPSTGTVGDSYDNALAENVNSSYKN
FT                   ELINNHRWKDVLEVEIATFEWVTWWNQTRLHQALNYRTPVEVENYYWRIASTSEKMKTR
FT                   ANA"
FT   gene            complement(592310..593605)
FT                   /locus_tag="Arch_0508"
FT   CDS_pept        complement(592310..593605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0508"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR016196; KEGG: tte:TTE2456 major
FT                   facilitator superfamily permease; SPTR: Q8R7F6 Permeases of
FT                   the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92254"
FT                   /db_xref="GOA:D7BMV5"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMV5"
FT                   /protein_id="ADH92254.1"
FT                   /translation="MNSFVQSQGKLLKARRLIIIGLIASVFGNYVVEAGFSAFTASGTI
FT                   AVSSLVLLKTIEQIIVFAFPLYARIVGKFSPDKALITVDLTEAGMSALALCLTVIKPEF
FT                   AIGCLFLYMLLDALVAPVSDLADEFYGAALAEIDEKAALAFNATLYSALAFLGFVVGGP
FT                   LGSFFASVSVEILLLTNIILSLCGAGLRGFARTKFAATPILEIDDEEYLATGSRLPVKD
FT                   FVRDLFVSGPASPLLSLLIRIASAMTGELFLLWVAGVSAERNSTLNAFSGMAIVLAVFG
FT                   FGAMLGPLVGRWLRKMSSARMVLFASAIFAGLLILLFACYEAIVGSKLVWALSLVFLIT
FT                   VLNRARLVVLETYRQTEFKGTRFVRIMSWSYSFGALGTILGLQIGYWLKLASNPVPCLL
FT                   VGGVLWIFIGIIVNLRIGISKKTSQGVLCESQ"
FT   sig_peptide     complement(593504..593605)
FT                   /locus_tag="Arch_0508"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(594179..595259)
FT                   /pseudo
FT                   /locus_tag="Arch_0509"
FT   gene            595509..596531
FT                   /pseudo
FT                   /locus_tag="Arch_0510"
FT   gene            596522..596976
FT                   /pseudo
FT                   /locus_tag="Arch_0511"
FT   gene            597116..597469
FT                   /locus_tag="Arch_0512"
FT   CDS_pept        597116..597469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0512"
FT                   /product="HNH endonuclease"
FT                   /note="InterPro IPR002711:IPR003615; KEGG: cdi:DIP2153
FT                   putative bacteriophage holin protein; PFAM: HNH
FT                   endonuclease; SMART: HNH nuclease; SPTR: C2KNY6 Possible
FT                   bacteriophage endonuclease; PFAM: HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92255"
FT                   /db_xref="GOA:D7BMV6"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMV6"
FT                   /protein_id="ADH92255.1"
FT                   /translation="MPIKPASPCSHPACPELTHERYCEAHTKAEDARYRKYQRDPKINR
FT                   RYGSRWRKIRSAYVAQHPLCEDCLEAGRYTPVQEVHHVLPLEHGGTHDFDNLRSLCKPC
FT                   HSRQTSLDDDRWR"
FT   gene            597850..598170
FT                   /locus_tag="Arch_0513"
FT   CDS_pept        597850..598170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pac:PPA1591 hypothetical protein; SPTR: Q6A7D5
FT                   Conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92256"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMV7"
FT                   /protein_id="ADH92256.1"
FT                   /translation="MDQMVLKTQQWLNTTYKTKTGFGSREWSNRMGHAHASRIVGRTES
FT                   AKPIRAVTCMALSKEPCGYLHSHFDTNLVWGQLCSVGGVFSSLVGTKVWALSHCEITPK
FT                   LG"
FT   gene            complement(598328..599239)
FT                   /locus_tag="Arch_0514"
FT   CDS_pept        complement(598328..599239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0514"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cms:CMS_0575 hypothetical protein; SPTR:
FT                   B0RD96 Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92257"
FT                   /db_xref="GOA:D7BMV8"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMV8"
FT                   /protein_id="ADH92257.1"
FT                   /translation="MSGSSNSVSAEHGNSKRLIVALLFVSIGFQALAFAVPGDTFSLTF
FT                   RLVGVLSLVVAISLGMKSKTENKPLLTVGIGVVTCLTAIALVATQTYAAQAAGSDNYSS
FT                   IRSETITYKEPDLNAIANTNKSLVELKGVDLEEQVLSAKELKYSPKSGATPMWSAAQAY
FT                   TLDSKKIVAVPLESELSLANKILFIWENGKLVTQEVYGEMLSDNKVQVRLWNDGKLSAN
FT                   KTVVNLDTGSKGGIEPLGMNWGKLNQCLNSIGINWAVLAVISVACGWACALTAGAGCIY
FT                   CLSAATGWTGGSISSCVYRAWE"
FT   sig_peptide     complement(599135..599239)
FT                   /locus_tag="Arch_0514"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(599580..600203)
FT                   /locus_tag="Arch_0515"
FT   CDS_pept        complement(599580..600203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0515"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_1204 nucleoside recognition
FT                   domain-containing protein; SPTR: Q1ZIG2 Membrane protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92258"
FT                   /db_xref="GOA:D7BMV9"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMV9"
FT                   /protein_id="ADH92258.1"
FT                   /translation="MRTNRTYSNRNAVRLCFLLASLLGLLMFVAQVYYSKGGVVRGAPI
FT                   LLIGKPVNILLLPAAIYLVVSVLALILLITTLKQTNSDIKKRRVKAILMVAFLTGTAAF
FT                   AGTVINMDSYGIVPSKQDDTNCRVIYSWGNSSMHHRFGRFYTMSNNFHLGVKTPYSWSA
FT                   KGSGKIHDTAWEVRWESGYGTLHTYSSIGIDPDTDIPARFTCDE"
FT   sig_peptide     complement(600078..600203)
FT                   /locus_tag="Arch_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            600264..600836
FT                   /locus_tag="Arch_0516"
FT   CDS_pept        600264..600836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pac:PPA1589 hypothetical protein; SPTR: C2KNY1
FT                   Putative uncharacterized protein; PFAM: Phage terminase,
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMW0"
FT                   /protein_id="ADH92259.1"
FT                   /translation="MAKDGTNRGGRRVRAGAKPEPLNEKLAAGRPTTRLDDPLNEPFDF
FT                   IGADVGDGAVLAGETMPEPSDYLSDIQRDGKPLGADLVYRETWQWLDARGCSQFVTPRL
FT                   IESYAQAFARYVQCEQAISKFGLLGKHPTTGAAIAYPFVAMSQSFEKQANVYWYEIFEI
FT                   VRANCTSDYSGAAPGDEVMERLLQARS"
FT   gene            600916..601776
FT                   /locus_tag="Arch_0517"
FT   CDS_pept        600916..601776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0517"
FT                   /product="Methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COGs: COG0192 S-adenosylmethionine synthetase;
FT                   InterPro IPR001412:IPR002133; KEGG: pac:PPA1587
FT                   S-adenosylmethionine synthetase; PFAM: S-adenosylmethionine
FT                   synthetase; PRIAM: Methionine adenosyltransferase; SPTR:
FT                   C2KNY0 S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase, C-terminal domain;
FT                   S-adenosylmethionine synthetase, central domain;
FT                   S-adenosylmethionine synthetase, N-terminal domain;
FT                   TIGRFAM: S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92260"
FT                   /db_xref="GOA:D7BMW1"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMW1"
FT                   /protein_id="ADH92260.1"
FT                   /translation="MSVTKTAEAVCIGHPDKLCDLIADTILDDILYEDPAARVAVEVMA
FT                   SGHRVIVTGEITSKVRPRIRESVRYDAAGSPVAVETVVVSIQHDAAKDLDELAAEVKTL
FT                   IVAPARKPYLPISANTEILINPSDMFTVGGPKADTGLTGRKLMVDTYGGLGPRGGGAFS
FT                   GKDPSKVDRTGAYLARLIARTIVDARLATECQMAISYAIGKADPVAFQIDTLGTGEYSD
FT                   QILTKAAAEVFPLRPGGIIDALNLRKPGFTRYSTYGHFGHTGLHWENSFAHVDALKKAI
FT                   TRHEG"
FT   gene            601766..602257
FT                   /locus_tag="Arch_0518"
FT   CDS_pept        601766..602257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcm:Bcenmc03_2420 excinuclease ABC subunit C;
FT                   SPTR: B1JWQ1 Excinuclease ABC C subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92261"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMW2"
FT                   /protein_id="ADH92261.1"
FT                   /translation="MKVEYECATCGVRGTRRYARNRVPSQFFCSVPCQNEWQKSRKDLI
FT                   EKNKDPEFRKKVSAGLRRCARMVPMTITGSNSLKSFANAGSADGVEAGAISLCTTSSQP
FT                   NVEASAGAIISQFFAARATRRLKQKRNVSTNLLAIGASANFLFKKGSTYVHDNQAATDS
FT                   "
FT   gene            602229..603479
FT                   /locus_tag="Arch_0519"
FT   CDS_pept        602229..603479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0519"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="COGs: COG0863 DNA modification methylase;
FT                   InterProIPR002052:IPR002295:IPR003115:IPR002941:IPR 015840;
FT                   KEGG: pac:PPA1586 ParB family DNA methylase; PFAM: DNA
FT                   methylase N-4/N-6 domain protein; ParB domain protein
FT                   nuclease; SMART: ParB domain protein nuclease; SPTR: C2KNX9
FT                   ParB family DNA methylase; manually curated; PFAM:
FT                   ParB-like nuclease domain; DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92262"
FT                   /db_xref="GOA:D7BMW3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR015840"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMW3"
FT                   /protein_id="ADH92262.1"
FT                   /translation="MIIKQLPIADLRPAAYNPRKELKPGDAEFEKLKRSLSEFGYVELV
FT                   VVNAANDNTVISGHQRLSVLKHVGQETVDCVVVELDEMREKALNVAMNKISGEWDESKL
FT                   ALLIADLDASDFDAELTGFDDAEIQQLIGSLDEGEVANDDFDLTVALEAAAFVERGDIW
FT                   AVGRHRLVCGDATSQTDVEALMDGKRANLVLTDPPYNVAFESGSGLSIKNDKMDREKFY
FT                   NFLLSAFTNMAAVCEKGASAYVFHADTEGLNFRRAFQDAGFYLSGCCIWVKDSLVLGRS
FT                   PYQWQHEPVLYGWVKTGKHRWYADRKQTTIWNFAKPRRNADHPTSKPLDLLAYPLQNST
FT                   QANAIVLDTFAGSGSTLMACETTDRICHAMELDEKYASVILRRYAEHTGDAAGITCLRD
FT                   GKQLAYLDVVKDVERQG"
FT   gene            603583..603870
FT                   /locus_tag="Arch_0520"
FT   CDS_pept        603583..603870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pac:PPA1583 hypothetical protein; SPTR: C2KNX5
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92263"
FT                   /db_xref="InterPro:IPR040613"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMW4"
FT                   /protein_id="ADH92263.1"
FT                   /translation="MNNDKVTMELLQMATDSYGTVIAYGDFVLASVYRHLGKGRIGNDA
FT                   RVYKLAEQPIGGWGPDARSFIECELTLVAEADELFEDAGHAIAWALAHTN"
FT   gene            603897..605504
FT                   /locus_tag="Arch_0521"
FT   CDS_pept        603897..605504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0521"
FT                   /product="Terminase"
FT                   /note="COGs: COG4626 Phage terminase-like protein large
FT                   subunit; InterPro IPR005021; KEGG: cce:Ccel_2837 terminase;
FT                   PFAM: Terminase; SPTR: C2KNX4 Phage terminase; PFAM: Phage
FT                   Terminase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92264"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMW5"
FT                   /protein_id="ADH92264.1"
FT                   /translation="MMRTLDTYTPTRFMADGSRYDKRKADFAVAFIQALKHTKGRWSGQ
FT                   PFQLIDWQEQIIRDLFGTVKEDGYRQFTTAYVEIPKKMGKSELAAAVALLLTCGDGEER
FT                   AEVYGCAADRQQASIVFEVAADMVRMSPALSKRVKILASQKRIIYKPTNSFYQVLSVEA
FT                   YSKHGFNISGVVFDELHTQPNRALFDVMTKGSGDARTQPLYFLITTAGTDTHSICYEQH
FT                   EKAEDILAGKKIDPTFYPVIYGAGREDDWTDEAVWHKANPSLGVTIPVEKVQVACNSAK
FT                   QNPAEENTFRQLRLNQWVKQSVRWMPMHVWNANNAPVDLSDLEGRVCYGGLDLASTTDI
FT                   TAFVLVFPPQTGDEPYVIAPWFWIPEDNLKLRVNRDHVPYDLWEQQGFLQTTEGNVVHY
FT                   GAIEAFIEQLGERFDIREISFDRWGAVQMSQNLEALGFTVVPFGQGFKDMSPPSKELMK
FT                   LALEGHLAHGGHPVLSWMVDNIHVRTDPAGNIKPDKQKSTEKIDGVVATIMALDRAIRN
FT                   GSDHHAGSVYDERGLLLI"
FT   gene            complement(605564..606295)
FT                   /locus_tag="Arch_0522"
FT   CDS_pept        complement(605564..606295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0522"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Os01g0932600; hypothetical protein; SPTR:
FT                   Q5JMG9 Os01g0932600 protein; PFAM: Protein of unknown
FT                   function (DUF1643)"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92265"
FT                   /db_xref="InterPro:IPR012441"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMW6"
FT                   /protein_id="ADH92265.1"
FT                   /translation="MTRNSWKTALKEALEREDPDQKLKGHSIFARVNNESSPSLEIVPD
FT                   PAKPNELRLLLTHYRPEKPKGDHVVVIGMNPSNARAFSGRVQTESGWVPATDQTTLIVG
FT                   GWLHNTELDNTQRLTMMNLVPIIDKNSDAVQQRINDWTGPNLEQIFKETLETILESSKT
FT                   SSQNVRIICAWGSSAKHAWVKQGEKWFTDFIKCSRNHHITDGILVCRLKFKKKTDTEPA
FT                   YPPHPIGSWGLNDGNDLIPFP"
FT   gene            606330..607079
FT                   /locus_tag="Arch_0523"
FT   CDS_pept        606330..607079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0523"
FT                   /product="portal protein"
FT                   /note="COGs: COG4695 Phage-related protein; InterPro
FT                   IPR006944; KEGG: tex:Teth514_1252 HK97 family phage portal
FT                   protein; PFAM: portal protein; SPTR: C2KNX2 HK97 family
FT                   portal protein; PFAM: Phage portal protein; TIGRFAM: phage
FT                   portal protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92266"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMW7"
FT                   /protein_id="ADH92266.1"
FT                   /translation="MGFLSWLRGDSARKADHHALTGGGYSFFFGATSSGRPVTERSAMQ
FT                   MTAVYSCVRILAEAIAGLPLQVYQQSADGAKVKALDHPLYRLLHDEPNPEMTSFVFRET
FT                   LMTHLLLWGNAFAQVLRNGKDEVIGLYPLMPNRMTVGRDEAGRLYYEYQRTWDEPTGRF
FT                   ENVTLAARDVLHIPGLGFDGLVGYSPIAMANAAKHAAITTTLNDLAGEPVRDFQPAQWS
FT                   ALIDHAIVTEDTIRFVFRVGEEVTIWL"
FT   gene            607269..608066
FT                   /locus_tag="Arch_0524"
FT   CDS_pept        607269..608066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0524"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cgb:cg1911 putative secreted protein; SPTR:
FT                   B6XSG0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92267"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMW8"
FT                   /protein_id="ADH92267.1"
FT                   /translation="METRRIFAYVGTGLATAGMLAATTAGPALAVEGSTNLNAYRVSHT
FT                   LGDNKPAVAADKGIILTDFERQSIIDEFVDYGVNDSIARALVEKYESGQLLDSMKSGMQ
FT                   PISTTSKDLGDVVEVIRTYSDGSIAVETTSNLEAAKKESITNSANETPQFRSVYGCKYS
FT                   SGGNYASYWKNCTADVNLVVVRMGFLFDYQSIRDIGSKITGYRSYFHHIFGGSLSNFRF
FT                   DRISNTQVRLSADFDVAFKGFPAGWTAWMQANVNGSTAYTTNN"
FT   sig_peptide     607269..607358
FT                   /locus_tag="Arch_0524"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            608096..608215
FT                   /locus_tag="Arch_0525"
FT   CDS_pept        608096..608215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92268"
FT                   /db_xref="GOA:D7BMW9"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMW9"
FT                   /protein_id="ADH92268.1"
FT                   /translation="MNAAVFSGSLAIIVSIMVAIALIVLCVGVWRYIHSKKKD"
FT   sig_peptide     608096..608158
FT                   /locus_tag="Arch_0525"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(608306..608965)
FT                   /locus_tag="Arch_0526"
FT   CDS_pept        complement(608306..608965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0526"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="COGs: COG2197 Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain;
FT                   InterProIPR011991:IPR001789:IPR013249:IPR000792:IPR 011006;
FT                   KEGG: kra:Krad_4263 two component transcriptional
FT                   regulator, LuxR family; PFAM: response regulator receiver;
FT                   Sigma-70 region 4 type 2; SMART: response regulator
FT                   receiver; regulatory protein LuxR; SPTR: D0YQC0 Two
FT                   component LuxR family transcriptional regulator; PFAM:
FT                   Response regulator receiver domain; Bacterial regulatory
FT                   proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92269"
FT                   /db_xref="GOA:D7BMX0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMX0"
FT                   /protein_id="ADH92269.1"
FT                   /translation="MTESLRIVIADDDAIVRSGLANLLNHQDGISVVATAANGSEALTA
FT                   ISRAQPDVALIDVDMPILDGISTAKILSQEYPRIAIVMLTAFEHEESLAKSLAANARGF
FT                   LTKDIPAAQLAELIKQAHAGMNVISPRPTQILAEAYIKAQANQEKYQDFIDTIEHLPRY
FT                   LRAVFNLVIKAKPNKTIAKELNITEATTRAYISELFTATGFTNRGELTITALKAGY"
FT   gene            complement(608973..610103)
FT                   /locus_tag="Arch_0527"
FT   CDS_pept        complement(608973..610103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0527"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="COGs: COG4585 Signal transduction histidine kinase;
FT                   InterPro IPR003594; KEGG: cai:Caci_0638 histidine kinase;
FT                   PFAM: ATP-binding region ATPase domain protein; SPTR:
FT                   C2KNP1 Histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92270"
FT                   /db_xref="GOA:D7BMX1"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMX1"
FT                   /protein_id="ADH92270.1"
FT                   /translation="MPISKTNWRVRQTVQALPSDAFPLHLLGNFTYPLIAVIFVFAEGL
FT                   INPSVTAFDRPQLWIILTFGTLLATSAWTPVAQILYMICFAATSYWPATADLTFPVLGV
FT                   YIICIAWIIRGWMIPAFATLAAVGILLVNSSSRMSSQIISTLVMFTLISSTGLVLRSLV
FT                   RKIHTSAQQLRAAQEASTAIRADLATQLHDTIAKDLARISITTQNIALNHPDLANELVP
FT                   LADIVQNMARRIRPIILDLDVLANRHSLDRSIAMSAQMLTTRSITLSTDSEANLDAKLD
FT                   RETTTLASLFVRESATNALKYAPSASNVDLIIELAPEILSLTMRNDVAALPQAGSITGG
FT                   FGLSNLRQRIEASGGSLTFVHNDNEWVIIASIPYSR"
FT   gene            complement(610090..610299)
FT                   /locus_tag="Arch_0528"
FT   CDS_pept        complement(610090..610299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0528"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oan:Oant_1198 BioY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92271"
FT                   /db_xref="GOA:D7BMX2"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMX2"
FT                   /protein_id="ADH92271.1"
FT                   /translation="MNFSPYSWRLGMTSLVLSMGLTMFPLPVTTDSANGFTPHELAITA
FT                   LLPTWKPVKCFLFPNLSECKSAHK"
FT   sig_peptide     complement(610195..610299)
FT                   /locus_tag="Arch_0528"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(610847..610920)
FT                   /locus_tag="Arch_R0018"
FT   tRNA            complement(610847..610920)
FT                   /locus_tag="Arch_R0018"
FT                   /product="tRNA-Gly"
FT   gene            complement(611003..611680)
FT                   /locus_tag="Arch_0529"
FT   CDS_pept        complement(611003..611680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0529"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="COGs: COG2197 Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain;
FT                   InterProIPR011991:IPR000792:IPR001789:IPR011006:IPR 016032;
FT                   KEGG: ckp:ckrop_0504 two-component system, response
FT                   regulator; PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR; response
FT                   regulator receiver; SPTR: D0WNH1 Two-component system
FT                   response regulator; PFAM: Response regulator receiver
FT                   domain; Bacterial regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92272"
FT                   /db_xref="GOA:D7BMX3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMX3"
FT                   /protein_id="ADH92272.1"
FT                   /translation="MKIFIADDAALMREGLSGILQRVGFEIVGHAENAPDLVAGVRRIF
FT                   NDGGVIDVVLTDVRMPPTLTDDGLRAAAELRHDFPDLAVLLLSQYVAPAYATALFSSDD
FT                   GLARGGIGYLLKERVSKITDFVASLTMVAGGGVVVDPDVAAGLVRGRSTALAGLTPRER
FT                   EVLELMARGLSNSQIQEVLFLSAAAVSKHVANVFTKLDLPPGEDNRRVRAVLTYLTEVG
FT                   ERP"
FT   gene            complement(611685..612413)
FT                   /locus_tag="Arch_0530"
FT   CDS_pept        complement(611685..612413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0530"
FT                   /product="histidine kinase"
FT                   /note="COGs: COG4585 Signal transduction histidine kinase;
FT                   InterPro IPR011712:IPR003594; KEGG: kse:Ksed_07210
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase dimerisation and phosphoacceptor
FT                   region; SPTR: D0WNH3 Sensor histidine kinase; manually
FT                   curated; PFAM: Histidine kinase; Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92273"
FT                   /db_xref="GOA:D7BMX4"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMX4"
FT                   /protein_id="ADH92273.1"
FT                   /translation="MWLSKKHRQRPVAEEIAKLTESRREIVAAFEIERRRIERDLHDGA
FT                   QQYIVATGMALGEMELVVAMADLPAELADLPAIISRAQSANERGLASLRETVNNVHPKI
FT                   LSDMGLESAVRDAAERSEVNVRVNVPHPLPQLPEGVVAAAYFLVAEALTNTAKYAPHAS
FT                   ASVMLAADTDLLVSIVDTGPGGAVVKPGHGLGGMRERLAAFGGSLDVRSPAGGPTVVQG
FT                   KIPLLLRTGESSVVLDDVKE"
FT   gene            612720..613424
FT                   /locus_tag="Arch_0531"
FT   CDS_pept        612720..613424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0531"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1136 ABC-type antimicrobial peptide
FT                   transport system ATPase component; InterPro
FT                   IPR017871:IPR003439:IPR003593; KEGG: kse:Ksed_07200
FT                   ABC-type antimicrobial peptide transport system, ATPase
FT                   component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: D0WNH4 Lipoprotein releasing system,
FT                   ATP-binding protein LolD; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92274"
FT                   /db_xref="GOA:D7BMX5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMX5"
FT                   /protein_id="ADH92274.1"
FT                   /translation="MAGRINTMNEMNLRGRGLHKTYGDVNALAGVDIDIAHGEHVAIMG
FT                   PSGSGKSTLLHVLSGILTPDEGQVTIGSIAVSGLNDAKRSELRRRVLGFVFQDGQLVPE
FT                   LTARENVAFPLLLTGISRRKAMKTADSWLERLGVRSQANKRPGEMSGGQAQRVAIARAL
FT                   VHDPAVLFADEPTGALDQATGHEVMQLLTATAKMNGTTLVVITHDTKVASWCERLIEIR
FT                   DGLIHYDGAVTR"
FT   gene            613421..614815
FT                   /locus_tag="Arch_0532"
FT   CDS_pept        613421..614815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0532"
FT                   /product="protein of unknown function DUF214"
FT                   /note="InterPro IPR003838; KEGG: kse:Ksed_07190 predicted
FT                   permease; PFAM: protein of unknown function DUF214; SPTR:
FT                   D0WNH5 Putative permease domain protein; PFAM: Predicted
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92275"
FT                   /db_xref="GOA:D7BMX6"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMX6"
FT                   /protein_id="ADH92275.1"
FT                   /translation="MNTFGLAGMLTRARLRARSGTGVLDVLAVVAFSFSSWLTLTTLGG
FT                   VYMFWHNTDAVNAAVASRFGEGILNDGLGQSYFALAVVALALLTVPLLSLGGAAARLGA
FT                   GGRERRLASLRLIGMSSRQVLGMSVLESVLQASLGFVIGLVAYFGSLPAWKMLTFGTLP
FT                   INPSQMLLPWWALCATFFLMAVIAALSTVIGLQRVSISPLGVAHRIIPPSVKMWRMAVL
FT                   AATLVGVLYMTSLFSPSQVAVGQIISIGVTFLLFIGGISFAGPLLIQLTMRPLVLTSSP
FT                   ALLVGIRRVVSDSRGAWRNISAIALMGVVATLASTLSFVTLSQDVDSTGASIQEMIAHD
FT                   IRQGVMIAFAFALIIGAVSTLIHQSSDVFDRAGEARTLVHVGTPVTTLIRARFIQVLLP
FT                   LVAVSAILVALSLLPALANPVLNNWSNLNVMGVMILSGLVLTALSVAVTIPIQYQVVYE
FT                   RVRRND"
FT   sig_peptide     613421..613513
FT                   /locus_tag="Arch_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(614830..615177)
FT                   /locus_tag="Arch_0533"
FT   CDS_pept        complement(614830..615177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0533"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cjk:jk1223 hypothetical protein; SPTR: C0XR15
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92276"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMX7"
FT                   /protein_id="ADH92276.1"
FT                   /translation="MKPIRYKLDYDWVWSHNSLGTRTLRLIIKDDDPAKLRTAVTSYIR
FT                   SLPTDANGIAGRGGWAIYPNVNESTPNAIVIDIVSGGEDVADGIEDGADYAYNHLRKTA
FT                   GITLEWRQLED"
FT   gene            615699..616386
FT                   /pseudo
FT                   /locus_tag="Arch_0534"
FT   gene            complement(616383..617438)
FT                   /locus_tag="Arch_0535"
FT   CDS_pept        complement(616383..617438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0535"
FT                   /product="cobalamin synthesis CobW domain protein"
FT                   /note="KEGG: nml:Namu_3858 cobalamin synthesis CobW domain
FT                   protein; SPTR: D1BFN4 Predicted GTPase, G3E family; PFAM:
FT                   Cobalamin synthesis protein cobW C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92277"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMX8"
FT                   /protein_id="ADH92277.1"
FT                   /translation="MNTHTLHVISCTDPLLTDVLGLALNTDPSATWHARIEINDDEADH
FT                   IGILSITSATGDRFTTNLNGSCITCAVRAGMIEFLEGATSNDHYFFLPAGIELAHLCPG
FT                   LANELHAINMQLGTVMHAIDSTNATTELLTHIPVAEHEAGLTPDDERCLAEIHALNLGY
FT                   ADLILLTGGHDTQGGELVEHLRAHDTLMADPFEDNILAITQGITHDPHAALERIHPATV
FT                   QAWGGPDGHGTWTLDLTSERAFHPERLFDFAESLGSHGVCARGCFWLASRPSTICSWDA
FT                   LGGQVAISSAGEWDASEAHTHIIIVGIGDSSVTDAIEAGFMSALATQEEMLFSEVEDGL
FT                   DQWLGSQTPNY"
FT   gene            617534..617839
FT                   /locus_tag="Arch_0536"
FT   CDS_pept        617534..617839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0536"
FT                   /product="ribosomal protein S14"
FT                   /note="COGs: COG0199 Ribosomal protein S14; InterPro
FT                   IPR001209; KEGG: gbr:Gbro_1466 ribosomal protein S14; PFAM:
FT                   ribosomal protein S14; SPTR: D0L6I7 Ribosomal protein S14;
FT                   PFAM: Ribosomal protein S14p/S29e"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92278"
FT                   /db_xref="GOA:D7BMX9"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMX9"
FT                   /protein_id="ADH92278.1"
FT                   /translation="MAKRSKIVADQRRRETVAKYAERRAELKKASVDVNLSAEEREAAM
FT                   AKLHALPRNASPTRLRNRDVVDGRPRGFVGKFGLSRVRFRKMAHEGLLPGITKSSW"
FT   gene            617855..617977
FT                   /locus_tag="Arch_0537"
FT   CDS_pept        617855..617977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0537"
FT                   /product="ribosomal protein L36"
FT                   /note="InterPro IPR000473; KEGG: rop:ROP_04730 putative 50S
FT                   ribosomal protein L36; PFAM: ribosomal protein L36; SPTR:
FT                   C1ARP3 50S ribosomal protein L36; TIGRFAM: ribosomal
FT                   protein L36; manually curated; PFAM: Ribosomal protein L36;
FT                   TIGRFAM: ribosomal protein L36, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92279"
FT                   /db_xref="GOA:D7BMY0"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMY0"
FT                   /protein_id="ADH92279.1"
FT                   /translation="MKVRASLKSLKNQPGSKVVRRHGRVYVINKLNPKFKGRQG"
FT   gene            617977..618210
FT                   /locus_tag="Arch_0538"
FT   CDS_pept        617977..618210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arch_0538"
FT                   /product="ribosomal protein L28"
FT                   /note="COGs: COG0227 Ribosomal protein L28; InterPro
FT                   IPR001383; KEGG: kra:Krad_0287 ribosomal protein L28; PFAM:
FT                   ribosomal protein L28; SPTR: C2AMB1 LSU ribosomal protein
FT                   L28P; TIGRFAM: ribosomal protein L28; PFAM: Ribosomal L28
FT                   family; TIGRFAM: ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Arch_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADH92280"
FT                   /db_xref="GOA:D7BMY1"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:D7BMY1"
FT                   /protein_id="ADH92280.1"
FT                   /translation="MATYCQVTGRKPQFGKTVSHSHKRTSRRFNPNLQTKKYYVPSLKR
FT                   TISLTVSAKGIKTIDSKGIESVVADLKRRGEL"
FT   gene            618218..618385
FT                   /locus_tag="Arch_0539"
FT