(data stored in ACNUC8465 zone)

EMBL: CP002046

ID   CP002046; SV 1; circular; genomic DNA; STD; PRO; 2952962 BP.
XX
AC   CP002046; AAMP01000001-AAMP01000006; CH672373;
XX
PR   Project:PRJNA13570;
XX
DT   10-JUN-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Croceibacter atlanticus HTCC2559, complete genome.
XX
KW   .
XX
OS   Croceibacter atlanticus HTCC2559
OC   Bacteria; Bacteroidetes; Flavobacteriia; Flavobacteriales;
OC   Flavobacteriaceae; Croceibacter.
XX
RN   [1]
RP   1-2952962
RX   DOI; 10.1128/JB.00733-10.
RX   PUBMED; 20639333.
RA   Oh H.M., Kang I., Ferriera S., Giovannoni S.J., Cho J.C.;
RT   "Complete genome sequence of Croceibacter atlanticus HTCC2559T";
RL   J. Bacteriol. 192(18):4796-4797(2010).
XX
RN   [2]
RP   1-2952962
RA   Giovanni S.J., Cho J.-C., Ferriera S., Johnson J., Kravits S., Halpern A.,
RA   Remington K., Beeson K., Tran B., Rogers Y.-H., Friedman R., Venter J.C.;
RT   ;
RL   Submitted (23-FEB-2006) to the INSDC.
RL   J Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850,
RL   USA
XX
RN   [3]
RP   1-2952962
RA   Oh H.-M., Lee K., Cho J.-C.;
RT   ;
RL   Submitted (11-MAY-2010) to the INSDC.
RL   Division of Biology and Ocean Sciences, Inha University, College of Natural
RL   Sciences Inha University, Incheon 402-751, Republic of Korea
XX
DR   MD5; 0cf2a67f043e55ab369c1c7f42f303c0.
DR   BioSample; SAMN02603922.
DR   EnsemblGenomes-Gn; CA2559_r07731.
DR   EnsemblGenomes-Gn; CA2559_r07732.
DR   EnsemblGenomes-Gn; CA2559_r13674.
DR   EnsemblGenomes-Gn; CA2559_r13675.
DR   EnsemblGenomes-Gn; CA2559_t07677.
DR   EnsemblGenomes-Gn; CA2559_t07679.
DR   EnsemblGenomes-Gn; CA2559_t07681.
DR   EnsemblGenomes-Gn; CA2559_t07683.
DR   EnsemblGenomes-Gn; CA2559_t07685.
DR   EnsemblGenomes-Gn; CA2559_t07687.
DR   EnsemblGenomes-Gn; CA2559_t07689.
DR   EnsemblGenomes-Gn; CA2559_t07691.
DR   EnsemblGenomes-Gn; CA2559_t07693.
DR   EnsemblGenomes-Gn; CA2559_t07695.
DR   EnsemblGenomes-Gn; CA2559_t07697.
DR   EnsemblGenomes-Gn; CA2559_t07699.
DR   EnsemblGenomes-Gn; CA2559_t07701.
DR   EnsemblGenomes-Gn; CA2559_t07703.
DR   EnsemblGenomes-Gn; CA2559_t07705.
DR   EnsemblGenomes-Gn; CA2559_t07707.
DR   EnsemblGenomes-Gn; CA2559_t07709.
DR   EnsemblGenomes-Gn; CA2559_t07711.
DR   EnsemblGenomes-Gn; CA2559_t07713.
DR   EnsemblGenomes-Gn; CA2559_t07715.
DR   EnsemblGenomes-Gn; CA2559_t07717.
DR   EnsemblGenomes-Gn; CA2559_t07719.
DR   EnsemblGenomes-Gn; CA2559_t07721.
DR   EnsemblGenomes-Gn; CA2559_t07723.
DR   EnsemblGenomes-Gn; CA2559_t07725.
DR   EnsemblGenomes-Gn; CA2559_t07727.
DR   EnsemblGenomes-Gn; CA2559_t07729.
DR   EnsemblGenomes-Gn; CA2559_t09173.
DR   EnsemblGenomes-Gn; CA2559_t13660.
DR   EnsemblGenomes-Gn; CA2559_t13662.
DR   EnsemblGenomes-Gn; CA2559_t13664.
DR   EnsemblGenomes-Gn; CA2559_t13666.
DR   EnsemblGenomes-Gn; CA2559_t13668.
DR   EnsemblGenomes-Gn; CA2559_t13670.
DR   EnsemblGenomes-Gn; CA2559_t13672.
DR   EnsemblGenomes-Gn; CA2559_t13674.
DR   EnsemblGenomes-Gn; EBG00001065783.
DR   EnsemblGenomes-Gn; EBG00001065784.
DR   EnsemblGenomes-Gn; EBG00001065785.
DR   EnsemblGenomes-Gn; EBG00001065786.
DR   EnsemblGenomes-Gn; EBG00001065787.
DR   EnsemblGenomes-Gn; EBG00001065788.
DR   EnsemblGenomes-Gn; EBG00001065789.
DR   EnsemblGenomes-Gn; EBG00001065790.
DR   EnsemblGenomes-Gn; EBG00001065791.
DR   EnsemblGenomes-Gn; EBG00001065792.
DR   EnsemblGenomes-Gn; EBG00001065793.
DR   EnsemblGenomes-Gn; EBG00001065794.
DR   EnsemblGenomes-Gn; EBG00001065795.
DR   EnsemblGenomes-Gn; EBG00001065796.
DR   EnsemblGenomes-Gn; EBG00001065797.
DR   EnsemblGenomes-Gn; EBG00001065798.
DR   EnsemblGenomes-Gn; EBG00001065799.
DR   EnsemblGenomes-Gn; EBG00001065800.
DR   EnsemblGenomes-Gn; EBG00001065801.
DR   EnsemblGenomes-Gn; EBG00001065802.
DR   EnsemblGenomes-Gn; EBG00001065803.
DR   EnsemblGenomes-Gn; EBG00001065804.
DR   EnsemblGenomes-Gn; EBG00001065805.
DR   EnsemblGenomes-Gn; EBG00001065806.
DR   EnsemblGenomes-Gn; EBG00001065807.
DR   EnsemblGenomes-Gn; EBG00001065808.
DR   EnsemblGenomes-Gn; EBG00001065809.
DR   EnsemblGenomes-Gn; EBG00001065810.
DR   EnsemblGenomes-Gn; EBG00001065811.
DR   EnsemblGenomes-Gn; EBG00001065812.
DR   EnsemblGenomes-Gn; EBG00001065813.
DR   EnsemblGenomes-Gn; EBG00001065814.
DR   EnsemblGenomes-Gn; EBG00001065815.
DR   EnsemblGenomes-Gn; EBG00001065816.
DR   EnsemblGenomes-Gn; EBG00001065817.
DR   EnsemblGenomes-Gn; EBG00001065818.
DR   EnsemblGenomes-Gn; EBG00001065819.
DR   EnsemblGenomes-Gn; EBG00001065820.
DR   EnsemblGenomes-Gn; EBG00001065821.
DR   EnsemblGenomes-Gn; EBG00001065822.
DR   EnsemblGenomes-Gn; EBG00001065823.
DR   EnsemblGenomes-Gn; EBG00001065824.
DR   EnsemblGenomes-Gn; EBG00001065825.
DR   EnsemblGenomes-Gn; EBG00001065826.
DR   EnsemblGenomes-Gn; EBG00001065827.
DR   EnsemblGenomes-Gn; EBG00001065828.
DR   EnsemblGenomes-Gn; EBG00001065829.
DR   EnsemblGenomes-Gn; EBG00001065830.
DR   EnsemblGenomes-Gn; EBG00001065831.
DR   EnsemblGenomes-Gn; EBG00001065832.
DR   EnsemblGenomes-Gn; EBG00001065833.
DR   EnsemblGenomes-Tr; CA2559_r07731-1.
DR   EnsemblGenomes-Tr; CA2559_r07732-1.
DR   EnsemblGenomes-Tr; CA2559_r13674-1.
DR   EnsemblGenomes-Tr; CA2559_r13675-1.
DR   EnsemblGenomes-Tr; CA2559_t07677-1.
DR   EnsemblGenomes-Tr; CA2559_t07679-1.
DR   EnsemblGenomes-Tr; CA2559_t07681-1.
DR   EnsemblGenomes-Tr; CA2559_t07683-1.
DR   EnsemblGenomes-Tr; CA2559_t07685-1.
DR   EnsemblGenomes-Tr; CA2559_t07687-1.
DR   EnsemblGenomes-Tr; CA2559_t07689-1.
DR   EnsemblGenomes-Tr; CA2559_t07691-1.
DR   EnsemblGenomes-Tr; CA2559_t07693-1.
DR   EnsemblGenomes-Tr; CA2559_t07695-1.
DR   EnsemblGenomes-Tr; CA2559_t07697-1.
DR   EnsemblGenomes-Tr; CA2559_t07699-1.
DR   EnsemblGenomes-Tr; CA2559_t07701-1.
DR   EnsemblGenomes-Tr; CA2559_t07703-1.
DR   EnsemblGenomes-Tr; CA2559_t07705-1.
DR   EnsemblGenomes-Tr; CA2559_t07707-1.
DR   EnsemblGenomes-Tr; CA2559_t07709-1.
DR   EnsemblGenomes-Tr; CA2559_t07711-1.
DR   EnsemblGenomes-Tr; CA2559_t07713-1.
DR   EnsemblGenomes-Tr; CA2559_t07715-1.
DR   EnsemblGenomes-Tr; CA2559_t07717-1.
DR   EnsemblGenomes-Tr; CA2559_t07719-1.
DR   EnsemblGenomes-Tr; CA2559_t07721-1.
DR   EnsemblGenomes-Tr; CA2559_t07723-1.
DR   EnsemblGenomes-Tr; CA2559_t07725-1.
DR   EnsemblGenomes-Tr; CA2559_t07727-1.
DR   EnsemblGenomes-Tr; CA2559_t07729-1.
DR   EnsemblGenomes-Tr; CA2559_t09173-1.
DR   EnsemblGenomes-Tr; CA2559_t13660-1.
DR   EnsemblGenomes-Tr; CA2559_t13662-1.
DR   EnsemblGenomes-Tr; CA2559_t13664-1.
DR   EnsemblGenomes-Tr; CA2559_t13666-1.
DR   EnsemblGenomes-Tr; CA2559_t13668-1.
DR   EnsemblGenomes-Tr; CA2559_t13670-1.
DR   EnsemblGenomes-Tr; CA2559_t13672-1.
DR   EnsemblGenomes-Tr; CA2559_t13674-1.
DR   EnsemblGenomes-Tr; EBT00001668473.
DR   EnsemblGenomes-Tr; EBT00001668474.
DR   EnsemblGenomes-Tr; EBT00001668475.
DR   EnsemblGenomes-Tr; EBT00001668476.
DR   EnsemblGenomes-Tr; EBT00001668477.
DR   EnsemblGenomes-Tr; EBT00001668478.
DR   EnsemblGenomes-Tr; EBT00001668479.
DR   EnsemblGenomes-Tr; EBT00001668480.
DR   EnsemblGenomes-Tr; EBT00001668481.
DR   EnsemblGenomes-Tr; EBT00001668482.
DR   EnsemblGenomes-Tr; EBT00001668483.
DR   EnsemblGenomes-Tr; EBT00001668484.
DR   EnsemblGenomes-Tr; EBT00001668485.
DR   EnsemblGenomes-Tr; EBT00001668486.
DR   EnsemblGenomes-Tr; EBT00001668487.
DR   EnsemblGenomes-Tr; EBT00001668488.
DR   EnsemblGenomes-Tr; EBT00001668489.
DR   EnsemblGenomes-Tr; EBT00001668490.
DR   EnsemblGenomes-Tr; EBT00001668491.
DR   EnsemblGenomes-Tr; EBT00001668492.
DR   EnsemblGenomes-Tr; EBT00001668493.
DR   EnsemblGenomes-Tr; EBT00001668494.
DR   EnsemblGenomes-Tr; EBT00001668495.
DR   EnsemblGenomes-Tr; EBT00001668496.
DR   EnsemblGenomes-Tr; EBT00001668497.
DR   EnsemblGenomes-Tr; EBT00001668498.
DR   EnsemblGenomes-Tr; EBT00001668499.
DR   EnsemblGenomes-Tr; EBT00001668500.
DR   EnsemblGenomes-Tr; EBT00001668501.
DR   EnsemblGenomes-Tr; EBT00001668502.
DR   EnsemblGenomes-Tr; EBT00001668503.
DR   EnsemblGenomes-Tr; EBT00001668504.
DR   EnsemblGenomes-Tr; EBT00001668505.
DR   EnsemblGenomes-Tr; EBT00001668506.
DR   EnsemblGenomes-Tr; EBT00001668507.
DR   EnsemblGenomes-Tr; EBT00001668508.
DR   EnsemblGenomes-Tr; EBT00001668509.
DR   EnsemblGenomes-Tr; EBT00001668510.
DR   EnsemblGenomes-Tr; EBT00001668511.
DR   EnsemblGenomes-Tr; EBT00001668512.
DR   EnsemblGenomes-Tr; EBT00001668513.
DR   EnsemblGenomes-Tr; EBT00001668514.
DR   EnsemblGenomes-Tr; EBT00001668515.
DR   EnsemblGenomes-Tr; EBT00001668516.
DR   EnsemblGenomes-Tr; EBT00001668517.
DR   EnsemblGenomes-Tr; EBT00001668518.
DR   EnsemblGenomes-Tr; EBT00001668519.
DR   EnsemblGenomes-Tr; EBT00001668520.
DR   EnsemblGenomes-Tr; EBT00001668521.
DR   EnsemblGenomes-Tr; EBT00001668522.
DR   EnsemblGenomes-Tr; EBT00001668523.
DR   EuropePMC; PMC2937408; 20639333.
DR   EuropePMC; PMC5315476; 27623332.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01685; 6S-Flavo.
DR   RFAM; RF01692; Bacteroid-trp.
DR   RFAM; RF01725; SAM-I-IV-variant.
DR   RFAM; RF01726; SAM-II_long_loops.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002046.
DR   SILVA-SSU; CP002046.
DR   StrainInfo; 295635; 1.
XX
CC   On or before Jun 9, 2010 this sequence version replaced
CC   gi:83849221, gi:83848323, gi:83848034, gi:83848033, gi:83848032,
CC   gi:83848031.
CC   Genome was manually curated based on annotation generated by the
CC   NCBI Prokaryotic Genomes Automatic Annotation Pipeline Group.
CC   Information about the Pipeline can be found here:
CC   http://www.ncbi.nlm.nih.gov/genomes/static/Pipeline.html.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2952962
FT                   /organism="Croceibacter atlanticus HTCC2559"
FT                   /strain="HTCC2559"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:216432"
FT                   /culture_collection="ATCC:BAA-628"
FT                   /culture_collection="KCTC:12090"
FT   gene            complement(join(2951798..2952962,1..25592))
FT                   /locus_tag="CA2559_00005"
FT   CDS_pept        complement(join(2951798..2952962,1..25592))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00005"
FT                   /product="transcriptional regulator, AraC family with
FT                   Parallel beta-helix repeat"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00005"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87090"
FT                   /db_xref="GOA:A3U4C3"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4C3"
FT                   /protein_id="EAP87090.2"
FT                   /translation="MQSFAQDNRASNIGKNIDLQVNYQFDEVTGEIIWPMPSDFTNRLA
FT                   LSGANSSSYRSAVSYFGQDQDGVADGLDQDDDNDGILDINECNANGPEEVVNGNFTNNF
FT                   DNWVEGGLDNWATGDVGAGNNSAFIVTGDNAGDQSSFEQAVTVTANQPHEFDFIVAAQN
FT                   TDATPSTLEVLFDGVVVYSATTADIIADFGNLTFGQVSIIAPFNNANPVITFNAVTGTT
FT                   GGNDAFIVDNVSLNGDCVDTDNDGFPDVVDQDSDGDGIPDNVEVQETLGFQISTGNDTD
FT                   GDGLDNAYDTDNGGVQIFLLDSDADGTPDFLDLDSDDDGVPDSNESGLPSSLADSDGDG
FT                   LNDAVDASNGFDVPNGIISDPTTLQDSDDDVNLPGGDVDFRDDIDRADLDNDGVYDDVD
FT                   LDDDNDGILDTVEGQCTPPQSQTWTLNGTSASYNFGNGITAVITQTGTNNAEAENFNAA
FT                   GAGFWSEPLEGDESVELTMAENQSFTISYQDNGGNPVFVTNPIFNIDRIGGQVNGLQNA
FT                   LRYTLQGGLTWDLLASTDDLMYTSNSVTDSGAANGVPPGPDYSAQSSQDDINGTAAGTL
FT                   RINGTISEFTINTTQVGPAGNDAFEIILAACLSTDTDGDNIPDFADVDSDGDGCFDALE
FT                   GADNISFTQVDSDGMLEGAVNPSTGVPNDVNTTNGQAIGTSQNAAAEDSFGQCEFATSG
FT                   EDTDGDGIFNIDDLDDDNDGILDVDECPAMATPPAAAEPEALNWVVGNYNVFAVGGNTN
FT                   AQGPIESGFVRNAFENGYNVEILEGPDDYTVVGTVASFDGGTIALDDAGIPGTVDFADT
FT                   VDGNFISGDAGDGIRIEGPGNAPAGSEYSVTYTFDDPLDYFSFDWVDIFDAAGGQLVRY
FT                   EYYADGNLVGYLENNLLGGSQVGQVNAYDANGNLRGQLVAGQNTETTIGFQSEIEFSTI
FT                   TLRYTYPNGYTAVDFHGIDALTYRKTPVCDNDGDGVPNSIDLDNDNDGIYDVVENGNGD
FT                   LDTNNDGRIDTNDNPSQGVGVNGVPDVVEDTPDSGTTDAPLNADGDALPNFLDIDADGD
FT                   GIIDNIEGQTTDGYVAPNDTFTDIDGNGVDDIYDTNGTPIQPANTDTFDQPDYLDINSD
FT                   NDGDSDLIEAYDTNGDGVADITPTGTDSDNDGLDDAFDDVDLTVDDFQDNPDNNDQLPT
FT                   DFPDDEMPGGDRDWRDVLNIDSDGDGIFDDVDLDDDNDGILDTDENGPNGGNNQPDCGN
FT                   HTVLSFDEPFTEESGDGDNNTFLQGEVFRFPNVANFNGQNVDALVTIVDLVNVTSIPTI
FT                   DDNGSDSGSFKPRTAFTLANAGDRAYTEYRFDFVNSANGNPVVLEEFFVNFNDIDGNNN
FT                   CSEQNWSQYPYTYTIDDPTQISTSTEGDFLIGTGGTEEFTGAGNTNPSVNYTTKHISSS
FT                   SYTIRIGVQANQPNVSAGGRQHNVEFDCIDNYNNPQTLGLDSDGDGIPNQFDLDADNDG
FT                   IYDIVENGNGALDTNNDGAADAADGQNVGANGVPDDAEDSPESGTTPQPLDQDTDGLPN
FT                   FIDIDADNDGIIDNIEGQTTAGYQTPGLFDDVDNNGVDDNYDTNGTPIVPTDTDGDGLP
FT                   DYLDTDSDNDTIPDNTEGYDVNMNGVADTLPTGLDSDNDGLDDAYDNVNLGEDDFQDNP
FT                   DNNNQFPTDFPDDDMPGGDRDWREGNDLDMDGVPDVVDIDDDNDGIIDVRESPGFDADV
FT                   DGDGVPAYLDDNDNDAAVGNDDGLVQPEFDFDGDGIANFQDLDSDGDGIPDNVEAQTTQ
FT                   GYTLPSGDGPAITDANGDGLDDAYDPDLEGLGLLPINTDGAADGPDYLDTNADNEGAND
FT                   TIEAGLTLANADDDGDGLDNSVDTTVGYNDVNGTINDPALLPDTDNDLGEGGNVDFRDR
FT                   STPNDFDGDGIDNAEDRDDDNDGIDDVTEGFGFYTNGNDVCTGSRYDFQGGTYISGTGS
FT                   GIGTVGARYRFPNAAPGLNAIVTVVSKPASVTINNIDFTDPADNVDNNQRSLQPLLTYA
FT                   QNATGNLSVQFSIRFENSADNSPASVPRLGGFIQDIDSNANNGTVREFYRVQNATGYAI
FT                   GNPTNVLAQNLGGSPQITQFIANNTGAAPVQPIDIDNRYRVFFQKRNVTQAAPLVFNIG
FT                   AVKNTNTSQQRYYSIRFDECRIDLYNDPSYVFFDAPNTDGLAGPDYQDLDSDNDGCFDT
FT                   TEAGFTDNTDPAFNDGILGSQSPESVDGNGLVTSGDNGDFYQQPVDMDNNGIFDFQEFG
FT                   PDVNGNGIADACDDQDMDGIPDFVDIDDDNDGILDVVESPGFDADVDGDGVPAYLDDND
FT                   NNSAIGNDDGLVQPAFDFDGDGNANHLDQDADNDGIPDNVESQTTAGYTQPTGLDDDND
FT                   GLDNAYEAGGITPINFDGQDNPDYLDLDSDNDGVVDAIEGNDVNNDGIADIALTGLDDD
FT                   NDGLDNAFDSTVGYGDPNGNQVTTNPQAELNNTDNDPEPDYRDLDDENDGVPTATELGD
FT                   PNNPVDSDNDGTPDYLEVNDPELTLTKTSNATGNEVAGQTIIYTFSVENTGNVSVSSIT
FT                   VDDVLTGSTDLAISPGSLAPGETGTATANYIVSQADVDNGSIVNSASVEGTAIGNVTVT
FT                   DISDNGDELVDDDNDGDSTNDPTVITLTQTPELTLLKTSDASGNEVAGDVITYTFEVTN
FT                   TGNVTVTGLNIDDTLTGTTDLTLTPSTLAPGAVGTATATYTVLQSDVDNGSITNQATVD
FT                   GLDPDNAPVTDTSDDDGINDEDPTIVTLTQTPELTLLKTSDATGNEVAGDVITYTFEVT
FT                   NTGNVTVTGLNIDDTLTGTTDLALTPSTLAPGAVGTATATYTVLQSDVDNGSITNQATV
FT                   DGLDPDNAPVTDTSDDDGINDEDPTIVILTQTPELTLLKTSDATGNEVAGDVITYTFEV
FT                   TNTGNVTVTGLNIDDTLTGTTDLALTPSTLAPGAVGTATATYTVLQSDVDNGSITNQAT
FT                   VDGLDPDNAPVTDTSDDDGINDEDPTIVTLTQTPELTLLKTSDATGNEVAGDVITYTFE
FT                   VTNTGNVTVTGLNIDDTLTGTTDLALTPSTLAPGAVGTATATYTVLQSDVDNGSITNQA
FT                   TVDGLDPDNVPVRDTSDDDGINDEDPTIVTLTQTPELTLLKTSGATGNEVAGDVITYTF
FT                   EVTNTGNVTVTGLNIDDTLTGTTDLALTPSTLAPGAVGTATATYTVLQSDVDNGSITNQ
FT                   ATVDGLDPDNVPVRDTSDDDGINDEDPTIVTLTQTPELTLLKTSGATGNEVAGDVITYT
FT                   FEVTNTGNVTVTGLNIGDTLTGTTDLALTPSTLAPGAVGTATATYTVLQSDVDNGSITN
FT                   QATVDGLDPDNAPVTDTSDDDGINDEDPTIVTLTQTPELTLLKTSDATGNEVAGDVITY
FT                   TFEVTNTGNVTVTGLNIDDTLTGTTDLALTPSTLAPGAVGTATATYTVLQSDVDNGSIT
FT                   NQATVDGLDPDNAPVTDTSDDDGINDEDPTIVTLTQTPELTLLKTSDATGNEVAGDVIT
FT                   YTFEVTNTGNVTVTGLNIDDTLTGTTDLALTPSTLAPGAVGTATATYTVLQSDVDNGSI
FT                   TNQATVDGLDPDNAPVTDTSDDDGINDEDPTIVILTQTPELTLLKTSDATGNEVAGDVI
FT                   TYTFEVTNTGNVTVTGLNIDDTLTGTTDLALTPSTLAPGAVGTATATYTVLQSDVDNGS
FT                   ITNQATVDGLDPDNAPVTDTSDDDGINDEDPTVITLTQTPELTLLKTSDATGNEVAGDV
FT                   ITYTFEVTNTGNVTVTGLNIDDTLTGTTDLALTPSTLAPGAVGTATATYTVLQSDVDNG
FT                   SITNQARVDGLDPDNAPVTDTSDDDGINDEDPTIVTLTQTPELTLLKTSDATGNEVAGD
FT                   VITYTFEVTNTGNVTVTGLNIDDTLTGTTDLALTPSTLAPGAVGTATATYTVLQSDVDN
FT                   GSITNQATVDGLDPDNAPVTDTSDDDGINDEDPTIVTLTQTPELTLLKTSDATGNEVAG
FT                   DVITYTFEVTNTGNVTVTGLNIDDTLTGTTDLALTPSTLAPGAVGTATATYTVLQSDVD
FT                   NGSITNQATVDGLDPDNAPVTDTSDDDGINDEDPTIVTLTQTPELTLLKTSDATGNEVA
FT                   GDVITYTFEVTNTGNVTVTGLNIDDTLTGTTDLALTPSTLAPGAVGTATATYTVLQSDV
FT                   DNGSITNQATVDGLDPDNAPVTDTSDDDGINDEDPTIVTLTQTPELTLLKTSDATGNEV
FT                   AGDVITYTFEVTNTGNVTVTGLNIDDTLTGTTDLALTPSTLAPGAVGTATATYTVLQSD
FT                   VDNGSITNQATVDGLDPDNAPVTDTSDDDGINDEDPTIVTLTQTPELTLLKTSDATGNE
FT                   VAGDVITYTFEVTNTGNVTVTGLNIDDTLTGTTDLALTPSTLAPGAVGTATATYTVLQS
FT                   DVDNGSITNQATVDGLDPDNAPVTDTSDDDGINDEDPTIVTLTQTPELTLLKTSDATGN
FT                   EVAGDVITYTFEVTNTGNVTVTGLNIDDTLTGTTDLALTPSTLAPGAVGTATATYTVLQ
FT                   SDVDNGSITNQATVDGLDPDNAPVTDTSDDDGINDEDPTVITLTQTPELTLLKTSDATG
FT                   NEVAGDVITYTFEVTNTGNVTVTGLNIDDTLTGTTDLALTPSTLAPGAVGTATATYTVL
FT                   QSDVDNGSITNQATVDGLDPDNAPVTDTSDDDGINDEDPTVITLTQTPELTLLKTSDAT
FT                   GNEVAGDVITYTFEVTNTGNVTVTGLNIDDTLTGTTDLALTPSTLAPGAVGTATATYTV
FT                   LQSDVDNGSITNQATVDGLDPDNAPVTDTSDDDGINDEDPTVITLTQTPELTLLKTSDA
FT                   TGNEVAGDVITYTFEVTNTGNVTVTGLNIDDTLTGTTDLALTPSTLAPGAVGTATATYT
FT                   VLQSDVDNGSITNQATVDGLDPDNAPVTDTSDDDGINDEDPTIVTLTQTPELTLLKTSD
FT                   ATGNEVAGDVITYTFEVTNTGNVTVTGLNIDDTLTGTTDLALTPSTLAPGAVGTATATY
FT                   TVLQSDVDNGSITNQATVDGLDPDNAPVTDTSDDDGINDEDPTVITLTQTPELTLTKTS
FT                   TSTVTSAGDIIVYTFSVENTGNVTITGITIDDVLTASNNLAISPNNLEPGEVGTITAMY
FT                   TVTQNDVDNGFVENSALVTGTDTNNNPITDISDNGDELNDGPDADLDPTNDPTIITIDP
FT                   NGSLSVEKLSAYRDANNNSITDFGDVIDYTISVENTGNVSLSNVVVNDPLLGGVLTLTS
FT                   GDIDLDGELDVDEVFVYEFTYDISQTDINNGSVDNTVTADANDTNGDPVLQDSDMVNTP
FT                   LDQTPELTLIKSNNATGNEIAGDVITYTFTVTNTGNVTVSVLNIDDTLTNSTDLELVPN
FT                   TLAPGEVGTVTANYTVLQSDVNTGSITNQATVEGLDTNNISVSDLSDDDGINDEDPTIT
FT                   TLNQIPELTLTKTAVLGGSNVGDEITYTFNVENTGNVSISNISITDALTGTTGIAITPP
FT                   NLDPGQTGEYSTTYTLTQSDIDMGMVENTATANGDANGDPVTDVSDNGDENVDDDNDGD
FT                   ATNDPTIVTINQTPELILTKTFVIGGTGSVGDVVTYTFNVLNSGNVSVSDITIDDAFLN
FT                   VTDLDLVPSTLESGESASIDVMYTITQDDVDNGMITNTAIVEGQDPNNILVDDVSDNGD
FT                   ENVDDDNDGDATNDPTIAPLVQNPLIGLVKEGTFNDANNTISYVYTVTNTGNTTLFDVS
FT                   VSEDMLEFTGTGTLPSPTNPMGGTDEDGDGDLLDLLPGASLTYTAIYTLTQEDINTGNV
FT                   DNQANVSAEAPNGDPLNNADDIIDASDDNSNAAGENDITTTTITQDPEITLIKDGVYQD
FT                   TNGNSIVDVDDTILYTYTVRNTGNVTAFDVDVTEDATDFTGQGVLPTPAYVSGGTNEGG
FT                   DPTIVDLLPGATLTFTASYVLIQADIDATQVTNRADATAFDPTLVNVITDESDSANGAD
FT                   NTGANNDPTTTQLAVTPEITLVKTANHLDDNVNGSVEIGETIAYTMTVTNTGNTSVTVL
FT                   TVSDPTIGANMVPLSPTELAPGEQGTAVINYTILESDILTGSITNSATADGLDPDGNPV
FT                   TDVSDDDGNGDDDPTITPTVAEPSIEVTKTSNDVGAFNVGDTVEFTIAVENTGNTTLNN
FT                   VALIDTFTDNDGNTLVLTSEPTFNSPSSQGSLEGTLLPVSATNTGEVATYTATYIITQN
FT                   AFDSGAVINQVNVTAQDGNNTAVDDISDDGDDLDGNVINDPTIVPFVQDPIIAVVKTGV
FT                   YEDTNANGITDEGDTINYTLTVTNEGDVSLNSVVVSDPLLGGTIAGPVSGDDGDNILQI
FT                   NETWIYEGSYIIMNSDIVNGNVSNQADVLAESPNGDPANPADDVTDLSDDNSNAPGEND
FT                   PTITPLDQDAVLSGVVFDDINGNGTQDAGELGIENVEVILTDDLGNTIATLSTDSDGNW
FT                   TSIVPAGDITSTITTATLPNGNEVQTAGDNPTTTLVDPGQMVNEAPDGFFTPNANLALE
FT                   KEASPIVDENNNGITDAGDTILYTFTVTNNGNVVVNNIVVNDAMIPVTNLPLAVTDLAP
FT                   GETSSTTTTYTIQQSDIDNGSFTNTATAVGEAIDPNGDSLGNVTDVSDDPNNPLNTDDD
FT                   LDGDFEDPTTVNFDATGNITGTVFNDTNGNGVQDAGELGIPNVDVLIVDANNISQTVTT
FT                   DSDGNWIATVAEGNASVNVDENTLPNNGTDTILTTIGSDPETVTAVTGETIATINDGYF
FT                   VNNPNLDLEKSSGGAVDFNSNGITDAGDTITYTFTLTNNGNVAMSNITIDDAAINVMGI
FT                   VIPDLLPGESETVSVTYTITQTDLDNGNVTNTATASGTPTDPNGNVLPIETDDSDDPND
FT                   PNNVDDDLDGDFEDPTITQLDGQGILSGSVFSDDNGNGIQDLGEIGIANVDVVITDDLG
FT                   NPIQTVTTDNNGVWSITLPEGEYTSNIDETTLPNGNEVQTAGVDPTTTILGPGATIAQA
FT                   PDGFFTPDSNLNLEKESSPIVDTNNNGIVDEGDTITYTFTVTNNGNVLVNGITIDDNMI
FT                   PVVGLPLLDQDLSPGETSTATVDYSITQLDIDNGSFTNTATATGEAFDPNGDTLGNVTD
FT                   VSDDPNNATNVDNDNDGDFEDPTVTVIPQESIITGTVYNDENNNGIQDAGELGLPGVDV
FT                   VITDVNNVEQTVTTDANGDWTATVPAGDTVIDVDETTLEDGSVLTTVGSDPETVTAIAG
FT                   DTTATTDDGYISDGVITGTVYNDENNNGIQDAGELGLPGVDVVITDVNNVEQTVTTDAN
FT                   GDWTATVPAGDTVIDVDETTLEDGSVLTTAGSDPETVTAIAGDTTATTDDGYISDGVIT
FT                   GTVYNDENNNGIQDAGELGLPGVDVVITDVNNVEQTVTTDANGAWTATVPAGDTVIDVD
FT                   ETTLEDGSVLTTAGSDPETVTAIAGDTTATTDDGYISDGVITGTVYNDENNNGIQDAGE
FT                   LGLPGVDVVITDVNNVEQTVTTDANGAWTATVPAGDTVIDVDETTLEDGSVLTTAGSDP
FT                   ETVTAIAGDTTATTDDGYISDGVITGTVYNDENNNGIQDAGELGLPGVDVVITDVNNVE
FT                   QTVTTDANGAWTATVPAGDTVIDVDETTLEDGSVLTTAGSDPETVTAIAGDTTATTDDG
FT                   YISDGVITGTVYNDENNNGIQDAGELGLPGVDVVITDVNNVEQTVTTDANGAWTATVPA
FT                   GDTVIDVDETTLEDGSVLTTAGSDPETVTAIAGDTTATTDDGYISDGVITGTVYNDENN
FT                   NGIQDAGELGIPGVDVVITDVNNVEQTVTTDANGDWTATVPAGDTVIDVDETTLEDGSV
FT                   LTTAGSDPETVTAIAGDTTATTDDGYISDGVITGTVYNDENNNGIQDAGELGIPGVDVV
FT                   ITDVNNVEQTVTTDANGDWTATVPAGDTVIDVDETTLEDGSVLTTAGSDPETVTAIAGD
FT                   TTATTDDGYISDGVITGTVYNDENNNGIQDAGELGLPGVDVVITDVNNVEQTVTTDANG
FT                   AWTATVPAGDTVIDVDETTLEDGSVLTTAGSDPETVTAIAGDTTATTDDGYISDGVITG
FT                   TVYNDENGNGIQDAGELGLPGVDVVITDVNNVEQTVTTDANGDWTATVPAGDTVIDVDE
FT                   TTLEDGSVLTTAGSDPETVTAIAGDTTATTDDGYFENDPELTLEKISNGVLDFNSNGIV
FT                   DAGDTITYDFTVTNTGNVVINNITIDDATINVMNITLTPSSLNPGESGTASVVYELTES
FT                   DISNGSISNQAIASGIPQDPIGNNLPVVTDESDDPTTVTPEDPTITILDQNAILTGVVF
FT                   DDVNNNGIQDIDEDGISGIDILVTDVDGIMQTVTTDANGNWNITVPAGQTIIDVDETTL
FT                   EDGSVLTTAGSDPETVLAEAGQSIATTPDGYISDGVITGTVYNDENGNGIQDAGELGLP
FT                   GVDVVITDVNNVEQTVTTDANGDWTATVPAGDTVIDVDETTLEDGSVLTTAGSDPETVL
FT                   VTAGDTTATTDDGYISDGVITGTVYNDENNNGIQDAGELGLPGVDVVITDVNNVEQTVT
FT                   TDANGDWTATVPAGDTVIDVDETTLEDGSVLTTAGSDPETVTAIAGDTTATTDDGYISD
FT                   GVITGTVYNDENGNGIQDAGELGLPGVDVVITDVNNVEQTVTTDANGDWTATVPAGDTV
FT                   IDVDETTLEDGSVLTTAGSDPETVLVTAGDTTATTDDGYISDGVITGTVYNDENNNGIQ
FT                   DAGELGLPGVDVVITDVNNVEQTVTTDANGDWTATVPAGDTVIDVDETTLEDGSVLTTA
FT                   GSDPETVTAIAGDTTATTDDGYISDGVITGTVYNDENGNGIQDAGELGLPGVDVVITDV
FT                   NNVEQTVTTDANGDWTATVPAGDTVIDVDETTLEDGSVLTTAGSDPETVLVTAGDTTAT
FT                   TDDGYISDGVITGTVYNDENNNGIQDAGELGLPGVDVVITDVNNVEQTVTTDANGDWTA
FT                   TVPAGDTVIDVDETTLEDGSVLTTAGSDPETVLVTAGDTTATTDDGYNVPVNTGTLSGV
FT                   VFNDENNNGIQDAGELGCQELMS"
FT   gene            26013..27614
FT                   /locus_tag="CA2559_00010"
FT   CDS_pept        26013..27614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00010"
FT                   /product="peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00010"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87091"
FT                   /db_xref="GOA:A3U4C4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4C4"
FT                   /protein_id="EAP87091.1"
FT                   /translation="MKFNEEIARRRTFGIISHPDAGKTTLTEKLLLFGGAIQEAGAVKS
FT                   NKIKKGATSDFMEIERQRGISVATSVLAFEYDGIKINILDTPGHKDFAEDTFRTLTAVD
FT                   SVIVVIDVAKGVEEQTEKLVEVCRMRNIPIIVFINKLDREGKDAFELLDEIEQKLSLKV
FT                   TPLSFPIGMGYDFKGIYNIWEKNVNLFSGDSRKNIEETIENEDLQSSELEELIGTDAAE
FT                   TLREEIELVEGIYPSFDKQAYNDANLQPVFFGSALNNFGVRELLDCFVSIAPTPRAKQS
FT                   DTRLVKPDEKEFTGFVFKIHANMDPKHRDRLAFIKIVSGKFERNVPYLHVRQGKKLRFS
FT                   SPNAFFAEKKEIVDTSYPGDIVGLHDTGNFKIGDTLTEGEELNYKGIPSFSPEHFRYIN
FT                   NADPMKSKQLYKGIDQLMDEGVAQLFTLELNGRKVIGTVGALQFEVIQYRLEHEYNAKC
FT                   SYENLNVYKACWVEAKDPKSEEFKDFKRVKSKFLAKDKRNQLVFLSDSQFSLQMTQQKY
FT                   PNVKFHFVSEFDKESK"
FT   gene            complement(27786..28115)
FT                   /locus_tag="CA2559_00015"
FT   CDS_pept        complement(27786..28115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00015"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87092"
FT                   /db_xref="InterPro:IPR021857"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4C5"
FT                   /protein_id="EAP87092.1"
FT                   /translation="MSDEKKPQNPKGKKGQINIELDETVAQGTYSNLAIINHSVSEFVV
FT                   DFVNIMPGTPKSKVKSRIILTPQHAKRLAKALNDNIKRFEKAHGEIRDYEQPPMPLNFG
FT                   PTGQA"
FT   gene            complement(28286..32593)
FT                   /locus_tag="CA2559_00020"
FT   CDS_pept        complement(28286..32593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00020"
FT                   /product="DNA-directed RNA polymerase beta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00020"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87093"
FT                   /db_xref="GOA:A3U4C6"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4C6"
FT                   /protein_id="EAP87093.1"
FT                   /translation="MARNNEQNTVKRFNKISIGLASPEAILAESRGEVLKPETINYRTH
FT                   KPERDGLFCERIFGPVKDYECACGKYKRIRYKGIVCDRCGVEVTEKKVRRDRVGHINLV
FT                   VPVAHIWYFRSLPNKIGYLLGLPSKKLDMIIYYERYVVIQPGIAKNEDGEALQKLDFLT
FT                   EEEYLNILETLPQENLYLEDSDPNKFIAKMGAECLIDLLQRIDLDALSFELRHKANNET
FT                   SKQRKTEALKRLQVVKALRDSNEYRENKPEWMIMKVIPVIPPELRPLVPLDGGRFATSD
FT                   LNDLYRRVIIRNNRLKRLVEIKAPEVILRNEKRMLQESVDSLFDNTRKSSAVKTDSNRP
FT                   LKSLSDSLKGKQGRFRQNLLGKRVDYSARSVIVVGPELKLFECGLPKNMAAELYKPFVI
FT                   RKLIERGIVKTVKSAKKIIDKKEPVVWDILENVLKGHPVLLNRAPTLHRLGIQAFQPKL
FT                   IEGKAIQLHPLVCTAFNADFDGDQMAVHLPLGPEAILEAQLLMLASHNILNPANGSPVT
FT                   VPSQDMVLGLYYMTKGRKHTPEVPIVGEGLTFYSAEEVVIAYNEKRLNINANIKVRTKD
FT                   FNEEGELVNQIIETTTGRVIFNMEVPEKAGYINQVLTKKALRDIIGDILKVTSVPETAQ
FT                   FLDRIKSLGYDFAFRGGLSFSLGDIIIPPEKQQMIDEANEQVEGIRGNYNMGLITFNER
FT                   YNQVIDIWTATNANLTDLAMSRISTDQQGFNSVFMMLDSGARGSKEQIRQLTGMRGLMA
FT                   KPKKSNSGGGEIIENPILSNFKEGLSILEYFISTHGARKGLADTALKTADAGYLTRRLV
FT                   DVSQDVIINETDCGTLRGVEVSPLKKNEEVVEKLSERIIGRTALNDVINPLTKEVLVEA
FT                   GVEITDAMAKLIEAAPIESVEVRSALSCEAKKGICVKCYGRNLATGKTVQMGEAVGVVA
FT                   AQSIGEPGTQLTLRTFHVGGVAGNISEENKHIAKFNGVAEIEDLKTVKGENNQGEEADI
FT                   VISRTTEIKIVDKKTGIVLSTSNVPYGAQIFVKPGDKVSKDDVLVQWDPFNGVIISEFA
FT                   GKIKYENLVQGMTYQVETDEQTGFQEKVITESRDKKKIPTLLIMGKKDEVIRSYNLPVG
FT                   AHIMVDDGDKIKIGKILVKIPRKSAKAGDITGGLPRVTELFEARNPSNPAVVSEIDGVV
FT                   SFGKIKRGNREIIVESKLGEVKKYLVKLSNQILVQENDYVRAGMPLSDGSITPEDILNI
FT                   KGPSAVQQYLVNEVQEVYRLQGVKINDKHFEVVVRQMMRKVKINDPGDTIFLENQLIHK
FT                   SDFIEENDAIFGMKVVDDAGDSNNLKPGQIVSPRELRDENSLLRREDKNLVVAKDAQPA
FT                   TATPILQGITRASLQTKSFISAASFQETTKVLNEAAVSGKVDSLEGLKENVIVGHRIPA
FT                   GTGMRRYDNIIVGSKEEMNEMVEAKQETEVNYN"
FT   gene            complement(32692..36504)
FT                   /locus_tag="CA2559_00025"
FT   CDS_pept        complement(32692..36504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00025"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00025"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87094"
FT                   /db_xref="GOA:A3U4C7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4C7"
FT                   /protein_id="EAP87094.1"
FT                   /translation="MLATQTERLNFSNVKNRPDYPDFLDIQIQSFQDFFQLETKSDERE
FT                   AEGLYKTFMENFPITDTRNQFVLEFLDYFVDPPRYSIQECIERGLTYSVPLKARLKLYC
FT                   TDPEHEDFETIVQDVYLGTIPYMTPSGTFCINGAERVVVSQLHRSPGVFFGQSFHANGT
FT                   KLYSARVIPFKGSWIEFATDINSVMYAYIDRKKKLPVTTLFRAIGFERDKDILEIFDLA
FT                   EEVKVTKSGLKKVLGRKLAARVLNTWYEDFVDEDTGEVVSIERNEIVLDRDTELEKEHI
FT                   EEILETGTKTILLHKEDNSTGDYAIIHNTLQKDPTNSEKEAVEHIYRQLRNAEPPDEET
FT                   ARGIIDKLFFSDQRYNLGEVGRYRMNKKLGLDIAMDKQVLTKEDIITIIKYLIELINSK
FT                   AEIDDIDHLSNRRVRTVGEQLSQQFGVGLARMARTIRERMNVRDNEVFTPIDLINAKTL
FT                   SSVINSFFGTNQLSQFMDQTNPLAEITHKRRLSALGPGGLSRERAGFEVRDVHYTHYGR
FT                   LCPIETPEGPNIGLISSLSVYAKVNALGFIETPYRKVDDGKINLDESPIYLSAEEEEGM
FT                   KIAQANIPLDDKGNIEAERVIARLEGDFPVEDPKNVNYIDVAPNQISSISASLIPFLEH
FT                   DDANRALMGSNMMRQAVPLLRVDSPIVGTGLERQVASDSRVLINAEGAGTVEYVDANMV
FT                   TIKYDRSEEERQVSFDSDSKSYNLIKFRKTNQGTSINLKPIVKVGDRVERGQVLCQGYA
FT                   TEAGELALGRNMKVAFMPWKGYNFEDAIVISEKVVREDIFTSIHVDEYSLDVRDTKLGN
FT                   EELTNDIPNVSEEATKDLDEYGMIRIGAEVKPGDILIGKITPKGESDPTPEEKLLRAIF
FT                   GDKAGDVKDASLKASPSLNGVVIDKKLFERAIKDKRKRAQDKEDIARLEVEYDAKFDDL
FT                   KAVLVEKLFNLIGGKTAQGVKNDLGEDILPKGKKYTLKMLNSVEDYTHLTQGTWTTDDE
FT                   LNSMVADLIHNYKIKENDLQGNLRREKFTISVGDELPAGIIKLAKIYIAKKRKLKVGDK
FT                   MAGRHGNKGIVARIVREEDMPFLEDGTPVDIVLNPLGVPSRMNIGQIYETVLGWAGQKL
FT                   GRKFATPIFDGATLDQINELTDEAGIPRFGHTHLYDGGTGDRFDQPATVGVIYMLKLGH
FT                   MVDDKMHARSIGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGASSTLREILTVKSD
FT                   DVIGRAKTYESIVKGEPMPEPGLRESFNVLMHELKGLGLDIRLEE"
FT   gene            complement(36697..37071)
FT                   /locus_tag="CA2559_00030"
FT   CDS_pept        complement(36697..37071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00030"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00030"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87095"
FT                   /db_xref="GOA:A3U4C8"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4C8"
FT                   /protein_id="EAP87095.1"
FT                   /translation="MADLKDFAEQLVNLTVKEVNELADILKEEYGIEPAAAAVAVAAGG
FT                   GADAGGADEQTEFDVILKGAGASKLAVVKLVKELTGAGLKDAKELVDNAPSPIKEGIAK
FT                   DEAEALKAQLEEAGAEVELK"
FT   gene            complement(37128..37661)
FT                   /locus_tag="CA2559_00035"
FT   CDS_pept        complement(37128..37661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00035"
FT                   /product="putative 50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00035"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87096"
FT                   /db_xref="GOA:A3U4C9"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4C9"
FT                   /protein_id="EAP87096.1"
FT                   /translation="MAMTREQKGQVIKDLTAQLNDNSIIYLADISTLNAGSTSDLRRAC
FT                   FKANVKLNVVKNTLLAKAMENTEKDFGGLSEVLKGNTSIMISETGNAPAKVIQEFRKKT
FT                   KGEKPLLKGAFIEEAVFVGDDKLETLVNIKSKEEVIGDIIGLLQSPAKNVISALKSSGG
FT                   KLAGILKTLSEKEG"
FT   gene            complement(37665..38363)
FT                   /locus_tag="CA2559_00040"
FT   CDS_pept        complement(37665..38363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00040"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00040"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87097"
FT                   /db_xref="GOA:A3U4D0"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4D0"
FT                   /protein_id="EAP87097.1"
FT                   /translation="MARLTKKQKEAQSKIEAGNTYTVAEASALVKEVANANFDASVDLA
FT                   VRLNVDPRKANQMVRGVVTLPHGTGKDVKVLALVTPDKEAEAKEAGADFVGLDEYLDKI
FT                   KGGWTDVDVIITMPSVMGKLGPLGRVLGPRGLMPNPKTGTVTMDVAKAVSDVKAGKIDF
FT                   KVDKYGIVHAGIGKASFDADKLAGNARELLTTLVKLKPTAAKGVYIKSIYMSSTMSPSV
FT                   QIDTKRFTED"
FT   gene            complement(38384..38824)
FT                   /locus_tag="CA2559_00045"
FT   CDS_pept        complement(38384..38824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00045"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00045"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87098"
FT                   /db_xref="GOA:A3U4D1"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4D1"
FT                   /protein_id="EAP87098.1"
FT                   /translation="MAKEVSKVVKLQVRGGAANPSPPVGPALGAAGVNIMEFCKQFNGR
FT                   TQDKAGKVLPVVITVYKDKSFDFVIKTPPAAVQILEAAKTKSGSGEPNRKKVATISWDQ
FT                   VRAIAEDKMPDLNAFTVESAMQMVAGTARSMGVNVKGGNAPV"
FT   gene            complement(38894..39445)
FT                   /locus_tag="CA2559_00050"
FT   CDS_pept        complement(38894..39445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00050"
FT                   /product="putative transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00050"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87099"
FT                   /db_xref="GOA:A3U4D2"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4D2"
FT                   /protein_id="EAP87099.1"
FT                   /translation="MSEVKEKKWYVVRSVSGQENKIKDYIEREISHHGLEDFVDQILVP
FT                   TEKVIQIRNGKKVNKERVYFPGYIMVQANLSGEIPHIIKGINGVIGFLGEVKGGDPVPL
FT                   RKSEVNRMLGKVDELSVAADNVAIPYTVGETIKVIDGPFNGFNGTVEKVNEEKRKLEVM
FT                   VKIFGRKTPLELSYMQVEKV"
FT   gene            complement(39458..39655)
FT                   /locus_tag="CA2559_00055"
FT   CDS_pept        complement(39458..39655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00055"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00055"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87100"
FT                   /db_xref="GOA:A3U4D3"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4D3"
FT                   /protein_id="EAP87100.1"
FT                   /translation="MAGFINYVSESFNELKNHVTWPTFAEAQKLTVTVAVFSIIFSLAI
FT                   WGVDTVFSNLIDKYFEWVKS"
FT   gene            complement(39698..39770)
FT                   /locus_tag="CA2559_t07729"
FT   tRNA            complement(39698..39770)
FT                   /locus_tag="CA2559_t07729"
FT                   /product="tRNA-Trp"
FT   gene            complement(39832..41019)
FT                   /locus_tag="CA2559_00060"
FT   CDS_pept        complement(39832..41019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00060"
FT                   /product="translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00060"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87101"
FT                   /db_xref="GOA:A3U4D4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4D4"
FT                   /protein_id="EAP87101.1"
FT                   /translation="MAKETYDRSKPHLNVGTIGHVDHGKTTLTAAITKVLADAGFSEAS
FT                   AFDQIDNAPEEKERGITINSSHVEYATANRHYAHVDCPGHADYVKNMVTGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGIPRIVVFMNKVDMVDDEELLELVEMEIRDLLSFYEY
FT                   DGDNGPVIQGSALGALNGEQKWVDTVLSLMEAVDSWIEEPQREVDKPFLMPIEDVFSIT
FT                   GRGTVATGRIETGIANTGDPVEIIGMGAEKLTSTITGIEMFRQILDRGEAGDNAGILLR
FT                   GIEKSQISRGMVIVKPGSVTPHKKFKAEVYILKKEEGGRHTPFHNNYRPQFYVRTTDVT
FT                   GTISLPDGVEMVMPGDNLTITVELLQTIAMNVGLRFAVREGGRTVGAGQVTEILD"
FT   gene            complement(41095..41166)
FT                   /locus_tag="CA2559_t07727"
FT   tRNA            complement(41095..41166)
FT                   /locus_tag="CA2559_t07727"
FT                   /product="tRNA-Thr"
FT   gene            complement(41282..41354)
FT                   /locus_tag="CA2559_t07725"
FT   tRNA            complement(41282..41354)
FT                   /locus_tag="CA2559_t07725"
FT                   /product="tRNA-Gly"
FT   gene            complement(41442..41523)
FT                   /locus_tag="CA2559_t07723"
FT   tRNA            complement(41442..41523)
FT                   /locus_tag="CA2559_t07723"
FT                   /product="tRNA-Tyr"
FT   gene            complement(41576..41649)
FT                   /locus_tag="CA2559_t07721"
FT   tRNA            complement(41576..41649)
FT                   /locus_tag="CA2559_t07721"
FT                   /product="tRNA-Thr"
FT   gene            complement(41747..42064)
FT                   /locus_tag="CA2559_00065"
FT   CDS_pept        complement(41747..42064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00065"
FT                   /product="putative sigma(54) modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00065"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87102"
FT                   /db_xref="GOA:A3U4D5"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4D5"
FT                   /protein_id="EAP87102.1"
FT                   /translation="MKVNVQSVNFNVDQKLVVFIQEKLDKLEQFYDKIIFADVFLKVQH
FT                   TSEKENKITEVLLSIPGDELMVKKNTKTFEEGIDECERALQRQLIKKKEKINAHSNKKI
FT                   A"
FT   gene            complement(42089..42976)
FT                   /locus_tag="CA2559_00070"
FT   CDS_pept        complement(42089..42976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00070"
FT                   /product="putative site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00070"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87103"
FT                   /db_xref="GOA:A3U4D6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4D6"
FT                   /protein_id="EAP87103.1"
FT                   /translation="MATIKAFLDYLRLEKKYSIHTINAYNNDLVALSDFVSREFSETSI
FT                   NNIPYALIRSWIISLVDSGISNRTINRKVSSLKSYYSFLQKIEELEVSPLIKHKSLKVE
FT                   KRLQVPFSKKEVSDVLSGFTLNSFEDYRDKAIVELFYSTGMRRSELINLKLSDINIANH
FT                   YVKVLGKRNKERIIPLIESVSLTLRQYFEIKDAEFKESSKWIFVTSKNDKVYETLVYRI
FT                   INNYFSKVSSKIKKSPHLLRHSFATHLLGEGANLNAVKDLLGHSSLAATQVYTNNDIAV
FT                   IKRAYSASHPRNKN"
FT   gene            complement(43041..43286)
FT                   /locus_tag="CA2559_00075"
FT   CDS_pept        complement(43041..43286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00075"
FT                   /product="ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00075"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87104"
FT                   /db_xref="GOA:A3U4D7"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4D7"
FT                   /protein_id="EAP87104.1"
FT                   /translation="MHPINQNESVLKKGGTSMLIIPVKDGENIDRALKRFKRKFDKTGT
FT                   MRELRRRQQFNKPSVVRRAEIQKAEYIQHLRDQENK"
FT   gene            complement(43327..44697)
FT                   /locus_tag="CA2559_00080"
FT   CDS_pept        complement(43327..44697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00080"
FT                   /product="alpha-amylase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00080"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87105"
FT                   /db_xref="GOA:A3U4D8"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013776"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR015237"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4D8"
FT                   /protein_id="EAP87105.1"
FT                   /translation="MKNYYKYSALLLIALFLFSCNKDESFTETETTSEESELTVNAMAT
FT                   IGSGVMMQAFYWDVPAGGTWWNTVNGKLQNWSNAGIDAIWLPPVSKAQNGPFSMGYDPF
FT                   DYYDFGEYDQMGSVETRFGSRTELESLISTAHNNGISVIADIVINHNSGGASESNVFTG
FT                   SDTYTDYNPASGIFYRTQYDFHPNDYHNNDSGAFGGFPDLCHHKSYVQDHLWNNPNSVA
FT                   KYYKNVLGFDGWRFDYVKGFEPWVVNSWTNAVGGFSVGEYWDANVNTLEWWVNNSGSSA
FT                   FDFACYYRMRDAFQNNDLNNLSGDMLWKRNANKAVTFVANHDTDEIFNNKLLAYAYILT
FT                   HEGYPTLFYKDYEEWLDKNKLNNLIWIHNNLAGGSTINLYTDVDEYIAKRNGYNNNGLV
FT                   VYLNISNNWQERWVQTNWNSTRIKDYTGNSSWEPVTQADGWVKIQVPPNGYSVWSVK"
FT   gene            complement(44813..45973)
FT                   /locus_tag="CA2559_00085"
FT   CDS_pept        complement(44813..45973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00085"
FT                   /product="probable acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00085"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87106"
FT                   /db_xref="GOA:A3U4D9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4D9"
FT                   /protein_id="EAP87106.1"
FT                   /translation="MYFTEEHNLFRESFREFLQKEVVPHIDKWEETGHIERFIWEKFGE
FT                   MGYFGLTYPEQYGGLGLDFFYTVIFLEELQRVNSGGFAAAMWAHNYLAMTHLNAEGDER
FT                   IKEKYLSASISGEMIGCLCVTEPFCGSDVAAMRTTAVKKGDKYIINGSKTFITNGVYSD
FT                   YLVVAAKTAPELGNKGMSMFVIDRDTKGVSATKLNKLGWRASDTGEIAFDNVEIPAENL
FT                   MGEEGKGFPYIMQHFASERLIMGINAHARAEFALEYAMDYMKEREAFGRSIDKFQALRH
FT                   IIAQRVSEVEMAKTFNYTVSKRLSENEYVVKEASMSKLLSTKIADETIYDCLQMLGGYG
FT                   YIEEYPMARLLRDSRLGPIGGGTSQILKEIIAKMVIDKKEYKAAAR"
FT   gene            complement(45988..46788)
FT                   /locus_tag="CA2559_00090"
FT   CDS_pept        complement(45988..46788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00090"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87107"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4E0"
FT                   /protein_id="EAP87107.1"
FT                   /translation="MTIILVLQLAYWLIPFPKGVAPKDTPELVRFQQKVDSLKQLKIKE
FT                   NTPKQYPFNPNFLTDYKGYTLGMSTQEIDRLLAYRKQNKWVNSKKDFQDVTKVSDSLLN
FT                   TFSHLFKFPDFITNPKKKKVFAKDRKLSYKDKIDLNKATALQLQEVYGIGPYYSEKIIA
FT                   YRTKLNGFSDNVQLNDVYGLEPNVINNILKKFTVKTPVNIKKININTAKITDLSELPNL
FT                   NYEIARQIIKYRELNGEFNDINQLKSIAEFPIEKFDRIQLYLTL"
FT   gene            complement(46857..48485)
FT                   /locus_tag="CA2559_00095"
FT   CDS_pept        complement(46857..48485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00095"
FT                   /product="putative Na(+)-linked D-alanine glycine permease"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00095"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87108"
FT                   /db_xref="GOA:A3U4E1"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4E1"
FT                   /protein_id="EAP87108.1"
FT                   /translation="MRKQLLSIFTLLIPIITFAQEQTTSEKIDAVFSEYTGWFVEGIFY
FT                   EIPFSETFQIPWVLIVLIGGALFFTIYFKFINITGFSKAIQVVRGKYEDIEKHGAEELY
FT                   GADGIAMSDEGDIVDTIRDESADGEVSHFQALTAALSATVGLGNIAGVAVALSIGGPGA
FT                   TFWMIVAGLLGMASKFAECTLGVKYRDVGPDGTVYGGPMYYLKKGLKEKGLGGLGKVLA
FT                   VVFAIFVIGGSFGGGNMFQANQAAAQFVQLFDIESANAGMFFGIGMAVLVAVVIIGGIK
FT                   RIASVTEKIVPFMAGIYVLAALIILGANFTLIDDAFGLIFEGAFSGLGIAGGLIGVMIQ
FT                   GIRRGAFSNEAGVGSAAIAHSAVRTKYPASEGIVALLEPFVDTVVICTMTALVIIITNF
FT                   ESSFMEYGTPITEGVELTATAFDTVIPHFSIVLTIAVILFAFSTMISWSYYGMQGWKFL
FT                   FGKGRITDLVYKFLFLMFVIVGASISLGSVIDFSDAMIFAMVVPNIIGVILLSPKIKKE
FT                   LKKYNKAISKKHNALEDGATDVNNL"
FT   gene            complement(48583..49590)
FT                   /locus_tag="CA2559_00100"
FT   CDS_pept        complement(48583..49590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00100"
FT                   /product="potassium channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00100"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87109"
FT                   /db_xref="GOA:A3U4E2"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4E2"
FT                   /protein_id="EAP87109.1"
FT                   /translation="MIKIFKSRIYVAFLLLSVSLGFGILGYRFISNYDWIDALYMTVIT
FT                   ITTVGFGEVNPLTNADKVFTIFLILFSVVILGYVISVFTEYMFTRRSYEEFKHKTLEKK
FT                   IQKLKDHVIVCGFGRNGREAVEKLKSYKKEFVIVEMDEDLVSKHEDDDTMFCIGNANED
FT                   ETLIRAGIDQASALICAMPEDADNLFTVLSARQLNKNLKIISRASVDTSFRKLKLAGAD
FT                   NVILPDKIGGDHMASLVVMPDLVEFLDNLSVSGQDNVNVREILYEHVCPDNIDKTIREV
FT                   DLRNLTGCTIIGYKNPAGDYVVNPEASTLITKGSKLIVIGKPNQINTLRNEFNI"
FT   gene            complement(49587..49817)
FT                   /locus_tag="CA2559_00105"
FT   CDS_pept        complement(49587..49817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00105"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87110"
FT                   /db_xref="GOA:A3U4E3"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4E3"
FT                   /protein_id="EAP87110.1"
FT                   /translation="MLTVVYKIRHFFERHGFYVSSRLADRLGMRAKSVRLFFIYVSFAT
FT                   LGVGFAIYLTLAFWLKLKDLVYTKRTSVFDL"
FT   gene            complement(49909..51135)
FT                   /locus_tag="CA2559_00110"
FT   CDS_pept        complement(49909..51135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00110"
FT                   /product="extracellular alkaline serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00110"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87111"
FT                   /db_xref="GOA:A3U4E4"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4E4"
FT                   /protein_id="EAP87111.1"
FT                   /translation="MKIFKPNTTFIAIAGMAVSSLFLSCEAEEQITETQNLKNDSSVLQ
FT                   ESQSQAISGQYIVTLNEAASRSIKNDDSYKGRLANVNAFVNEMIAAPHMKSTSVKQVYG
FT                   FAMTGFTATLSPEQLKSLQSDSRVASVEPDVMVKLSVAKEETTAMTFVAQNTPYGITRV
FT                   NGGVDGTGKTAWIIDSGIDLDHPDLNVDVDRSRSFVPGEPSPDDQNGHGSHVAGTVAAI
FT                   DNGIGVIGVAPNAKVVALKVLGADGSGATSGIIAALDYVAAVGEPGDAANMSLGPAVPI
FT                   LGINSALDNATTRVGAKGIGVAIAAGNSTSIANLYSPARASGENVYTVSAMDSNDQFAY
FT                   FSNFGSVVDYCAPGVSVYSTSMQGGYATLSGTSMAAPHVCGLLLLGDLRTDGNVFLDPD
FT                   FNPDPIAVH"
FT   gene            complement(51274..52548)
FT                   /locus_tag="CA2559_00115"
FT   CDS_pept        complement(51274..52548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00115"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87112"
FT                   /db_xref="InterPro:IPR021272"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4E5"
FT                   /protein_id="EAP87112.1"
FT                   /translation="MQETLLHHIWNFKKFDFLNATTQQGQQLIISSVGIHNTTQSGPDF
FT                   FNAKLKIDDQLWAGNVELHLKSSDWYAHRHEKDPAYDNVILHVVWEHDVEIYRKDGQPI
FT                   PTLTLKELVSESLLRKAQKLLSNKTKWIACEDEFPLIEEFTLSHWLERMYLERLEEKSN
FT                   EIERLVEQTQSNWEEVLFLMLAKNFGLNVNGSFFYNALQSLPFNVVLITRHNRFQLEAL
FT                   VFGQCNLLQANEEVFYANSLLKEYNYLVKKFKLENHSTETPKFFRLRPDNFPTIRLAQF
FT                   VELYASNSNLFSKIIKCTTLQEIETVFKIEVSEFWQTHYSFTSSHKQKKKQLSKAFVRL
FT                   LIINTIIPLTFFYNKKNGLENTTIINWMRLLPLELNNITKGYTAIYPSLNANALYSQGL
FT                   IHMKRNYCDKLKCLNCEIGLKIIKK"
FT   gene            complement(52570..53262)
FT                   /locus_tag="CA2559_00120"
FT   CDS_pept        complement(52570..53262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00120"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87113"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4E6"
FT                   /protein_id="EAP87113.1"
FT                   /translation="MKIQYTFQVLLVVLVCIFFQCKSVPVPDTKKGVSFLALGDSYTIG
FT                   QNVSEDNRWPNQLKEALNRDGLKVRDIKIIAKTGWRTDDLISAINYRLDETETYDVVSV
FT                   LIGVNNQYQKKSITTYEEDLKVVFEKAIKHSKKGAKGVFALNIPDYGSAPMLHHKAEQV
FT                   AVEIDEFNTVFKKVASTYKIPVYDINTISKQAYSNESLIASDGLHPSGAQYKLWVEYML
FT                   PFVKQYFK"
FT   gene            complement(53259..53609)
FT                   /locus_tag="CA2559_00125"
FT   CDS_pept        complement(53259..53609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00125"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00125"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87114"
FT                   /db_xref="GOA:A3U4E7"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4E7"
FT                   /protein_id="EAP87114.1"
FT                   /translation="MKLKNPFRTSPVPANTREILALERTRLANERTLLAYIRSSLYLLI
FT                   GGIAVLQLKDFSTLHSVGYLALVSCVIFLTIGISRFLLLKRKLFKWKKILGEELLEESL
FT                   NEKEHPKEISEE"
FT   gene            complement(53643..54623)
FT                   /locus_tag="CA2559_00130"
FT   CDS_pept        complement(53643..54623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00130"
FT                   /product="cystathionine beta-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00130"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87115"
FT                   /db_xref="GOA:A3U4E8"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4E8"
FT                   /protein_id="EAP87115.1"
FT                   /translation="MQYAENILGTIGNTPMVKLNKLTAELPCLVLAKYETFNPGNSVKD
FT                   RMAVQMIEDAEADGRLKPGGTIIEGTSGNTGMGLALAAIVKGYKMICVLSDKQSKEKMD
FT                   ILRAVGSEVHVCPTDVAPDDPRSYYSTSARLAKEIPNSWYVNQYDNLSNTKAHYESTGP
FT                   EIWEQTDGKVTHFVVGVGTGGTISGVGKYLKEQNPNVKIWGVDTYGSVFKKYHETGEFD
FT                   EKEIYPYVTEGIGEDILPKNVNFDIIDGFTKVTDKDAAVYTQRLSKEEGMFLGNSAGAA
FT                   IKGLLQLKEHFSKDDVVVVLFHDHGSRYVGKMYNDDWMRKMGYIE"
FT   gene            complement(54694..55836)
FT                   /locus_tag="CA2559_00135"
FT   CDS_pept        complement(54694..55836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00135"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00135"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87116"
FT                   /db_xref="GOA:A3U4E9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4E9"
FT                   /protein_id="EAP87116.1"
FT                   /translation="MAIAVGVIMMLIAFATGLGLQNKIRDKISAFNGHITISNFDNNNT
FT                   KVSLKPISKNQDFYPEFKSVNGITHVQGVAFKAGVIRTEDDFEGVVIKGLDTDYNWDVF
FT                   KDYVVQGRLPNYKESLNDEVLISEYTSNRLNIKLGDKAVTYFLRDNTLERPLLRAFKVV
FT                   GIYNSGFQEFDETYVIGDIRHIRRLNKWNDNDVGHFEVFIDDFSELEEKGVEVYEHIDS
FT                   TLDSKTIKQQYYSIFEWLGLFDFNIALIIGIMILIAGINMITALLVLILERTQMIGILK
FT                   ALGSNDNSIRKIFLYNAGYLIVVGLFWGNLIGLGLLFIQKYLKVLPLNPETYYVTEAPV
FT                   YIGWYILFVNLGTLTLCLLMLLIPSYVISKINPIKAIKFD"
FT   gene            55941..57206
FT                   /locus_tag="CA2559_00140"
FT   CDS_pept        55941..57206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00140"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87117"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4F0"
FT                   /protein_id="EAP87117.1"
FT                   /translation="MNMWFKNTAFVMVFTFLSCGNGKTQVNNTSKASENEKIKTTQSTT
FT                   TRSPQRGLSVTVGANQFEEYLPLLKDKKVAIVGNQTSIVFKNSGYVHLVDTLLSKGVTI
FT                   TKVFAPEHGFRGQADAGEKVNDSKDTKTGLPIISLYGNNKKPSVEQLNNVDVIVFDIQD
FT                   VGARFYTYISTLHYIMEACAEQGKQLIVLDRPNPNGHYADGPLLDQKHSSFVGMHPVPV
FT                   VHGMTIGEYAQMISGEGWLDTPKKTDLTVIPVKNYNKSMPYNLPIKPSPNLPNSTAVNL
FT                   YPTLCFFEGTNVNAGRGTNKQFQVFGSPYLNPEIYNFKYTPKANEGSKYPKHLGELCYG
FT                   FDLSENNKRFTELHLEILISAYNNTANKAEFFNSFFTKLAGTTILQEQIESGLTAEEIS
FT                   ETWQEGLKIYNQVRTAYELYKR"
FT   gene            57299..58054
FT                   /locus_tag="CA2559_00145"
FT   CDS_pept        57299..58054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00145"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00145"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87118"
FT                   /db_xref="GOA:A3U4F1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4F1"
FT                   /protein_id="EAP87118.1"
FT                   /translation="MFVNIPIENYHILIINQTTGNNKLESDFENVRVINTTELGLSKSR
FT                   NMALKQARKKIVLIADDDVVYLKDFGQHVIQSFNRQTDADFISFKTIVNENGKPFRNYV
FT                   KVPRALKKKELRRILSIEMCFKKGSIKQARFNEWFGLGAKFPNMSNQFFLKDLWQQGLK
FT                   FYEDPTPIVLHEPISSSDEVSTDRILYTRGAVFYKKYGSFAYLYVAKYGFFMLRKGYVS
FT                   ISKLPKKLWKMQEGISDYKQLLKQGLDRR"
FT   gene            58041..58457
FT                   /locus_tag="CA2559_00150"
FT   CDS_pept        58041..58457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00150"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87119"
FT                   /db_xref="InterPro:IPR008894"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4F2"
FT                   /protein_id="EAP87119.1"
FT                   /translation="MTEDKTTVKDVTFLDIPKIIDPRGNLAVIEQQTIPFSHKRVYYLF
FT                   DVPEGAKRGGHSHIEQSEVLIALNGSFTVIVDDGEDKKRVTLDNPLKGLLIPNGIWREL
FT                   EDFTKGSVCLVLASDIFEEADYIREYTDFKSSKS"
FT   gene            complement(58443..59378)
FT                   /locus_tag="CA2559_00155"
FT   CDS_pept        complement(58443..59378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00155"
FT                   /product="putative fucosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00155"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87120"
FT                   /db_xref="GOA:A3U4F3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4F3"
FT                   /protein_id="EAP87120.1"
FT                   /translation="MPFFSVIIPLFNKAEYVERTLNSVLLQSFDDFEVIIVNDGSTDNS
FT                   LKIAESFTDDRIVIYSKDNKGVSTARNYGVTKATSNYIAFLDADDIWKPNHLNALHNLI
FT                   VDMPSCALYCMGYIKQKSEKSKIRAQFGTIADGYKGVVSGYFKNSLPFTIAGMGAVAVN
FT                   KAKFIEVGGFTEGVTHGEDIELWTTLALQGKVALYNIVTVTHLINIKGRVSNLKIDDKV
FT                   FPDFNQFNEAERKSKDLKVYLDNNRYAIALAYRLAKDSKNYKFWKNQIELENLNKKQKL
FT                   LLKLPVGLVVTLKEIHQFLLEKGFYISTFR"
FT   gene            complement(59378..60223)
FT                   /locus_tag="CA2559_00160"
FT   CDS_pept        complement(59378..60223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00160"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00160"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87121"
FT                   /db_xref="GOA:A3U4F4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4F4"
FT                   /protein_id="EAP87121.1"
FT                   /translation="MVNSLDVQAKAIKEPLEIIILDDGSTNSNITLELEILEKRPLVTI
FT                   IRHAKNKGRLKSRLALANAAKFDWLLFLDADVLPCASNFLKQYFLETELSHPFVFGGVS
FT                   YKDDVSPAKEFRLHWLYGKTREQRDVAVRQNNPYSTIVSANMCVQKSSFIQITSTNATS
FT                   NYGTDIIFLEAIKQSGKNVKHIHNPVYHLGLEPIHRYLPKQIEALTTLKQQVEAGNLAA
FT                   KERPLHKAYLSLNQFYMTAIFQNLYSLFSKYIMANLNSASPSIRCFDLFKLYHYSKLYN
FT                   "
FT   gene            60403..61578
FT                   /locus_tag="CA2559_00165"
FT   CDS_pept        60403..61578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00165"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87122"
FT                   /db_xref="GOA:A3U4F5"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4F5"
FT                   /protein_id="EAP87122.1"
FT                   /translation="MWSQNSIYVDCSTYLKAAQLLIYDFQPHQWRPLGMAIYATIPGAL
FT                   GQDYQSVFTYVKPINLLLWLGCITFLYLIILKLSNRKFAFYGALLFMSCIGLTVLNNLL
FT                   LSEIPWLFCILIGIYGLTKHKIDNSILWLSVGIAFIIISIEFRPISKFIIFLLLVIYGF
FT                   TFLKSLASKSRFFVAAAALIILGQCSLMKQEYGDFTISYIDSFTVHHYLTEPAAFATSN
FT                   YTDRKAFEDDWMSPYFNKPYTERREYATSKFISEISENPFGVINVYLKNQLHNLTTPSL
FT                   YVLDAKNLKNTPYFTLSKTILLLLSKFQNIAFSCLGIVGLLLTLFLALKKQLQFKEDKL
FT                   LLFISLSLGYTITVIGISAEQYDRLNVPNYALIIILSVLLYPKLKSLSKAK"
FT   gene            complement(61571..62260)
FT                   /locus_tag="CA2559_00170"
FT   CDS_pept        complement(61571..62260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00170"
FT                   /product="putative ATP-binding protein involved in cell
FT                   division"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00170"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87123"
FT                   /db_xref="GOA:A3U4F6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4F6"
FT                   /protein_id="EAP87123.1"
FT                   /translation="MSETVLELKNAAIYQRESLILSEVDVHINKGDFVYLIGKTGTGKS
FT                   SFMKTLYGDLPLQEGEGSIVDYNLRTLKEKDIPFLRRKLGVVFQDFKLLNDRTIRGNLE
FT                   FVLKATGWKDKKGMDSKIDEVLDKVGMKTKAFKFPYQLSGGEQQRVAIARALLNDPELI
FT                   LADEPTGNLDPQTSVEVMEVLQDINKNGNTILMATHDYALLLKYPSKTLKCDGQKVFEV
FT                   VQKKQTT"
FT   gene            62527..65547
FT                   /locus_tag="CA2559_00175"
FT   CDS_pept        62527..65547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00175"
FT                   /product="TPR-domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00175"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87124"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4F7"
FT                   /protein_id="EAP87124.1"
FT                   /translation="MKLPKILVILSFGLLLHTASAQQTAVFTNQYVAYEQALSLYDNNQ
FT                   FAAAQQQFEKVKLTTEDGTVEANCSYYIANCAVRLNQQGADDLMQDFVDRYPTSTKRNS
FT                   AFSDVANYYFENGQYSRARKWYDQVNQSNLSNSEKEKFNFNYGYTLFQNKRFDDAKSYM
FT                   NKVRDSKEYGAQAKYYLGFMAYEGDDYQEADELFEEVKGNDRYEKNLSYFQADMNFKLG
FT                   KFEKAVAEGKAQLAKSNPKEKSQLNKIIGESYFNLGNYAEAVPYLKEYRGTRGKWNNTD
FT                   YYQLGYAYYKQGEFDNAISEFNKIVDGKNAVAQNAYYHLAESYLKLDQKQQALNAFKNA
FT                   SEMEFDNAIKKDALLNYAKLSYEIGNSYESTPKVLTRYLETYPDTAEKTELQNLLIDSY
FT                   ITSKNYAEAMELLESSRDFDNKVAYQKVAFYRGIELYNEDNYTEAKTYFEKSLSEPRDA
FT                   SFTARATYWNAETDYNLNNFQDALIGYKEFQGMSAASQTEAYKNLDYNLGYAYFKQKDY
FT                   EQAISYFKKYSETSSDTSRKKDAFLRLGDTYFVTSKYWPAMESYNDAIALGGKSADYAA
FT                   FQKAISYGFVNKNDRKIEDLTSFLNQFSRSTYRDDALYELGNTYVAIGNTQEGIKAYNR
FT                   LIRDVPKSSYVSKALLKQGLIYYNSDRGNEALEKFKKVAADFPGTAQADQAVKTARLIY
FT                   VDLGRTSEYANWVKTLDFVNVTDADLDNTTYEAAEQQYRQENANAALRGFENYLEEFPN
FT                   GLHALQSHFYLAQLQFKDNKKEESISHYKFVLTKERNEFTEQSLAQLSQIYLEKSNYKD
FT                   AIPVLKRLETEADFPQNIVFAQSNLMKSYYQQDNYEQAVSYAENVLANSSIDTKVKNDA
FT                   HIIIARSAMKTGDEAKAKTAYATVQKTATGKLAAEALYYDAYFKNKAGNYKASNESVQT
FT                   LAKEYSGYKEYSVKSLLVMAKNFYALEDAYQATYILENIINNFTDYPTVVDEAKAELIK
FT                   IKTEEAKTNADVNTNGN"
FT   gene            65525..67354
FT                   /locus_tag="CA2559_00180"
FT   CDS_pept        65525..67354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00180"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87125"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4F8"
FT                   /protein_id="EAP87125.1"
FT                   /translation="MLTLTATKFFKMLNTQINLHLTKNLSLDMSKLNIKYLILTIAILA
FT                   SSGLIAQEDDKETIGSETVVVVKPYTPSVSDAFKVKQTPQLLDSITLQKKSITYKIFSI
FT                   PVASTFTPTKGTAARVEKARPIQAFDSYATLGVGNYTSAFAEFYTNFEINRGENFGINF
FT                   KHNSAQGGIDDVLLDDNYYDTNLGLDYSFRDRDLSYTIGLDALHKQYNWYGFSNNIIVT
FT                   NDNLNRTDVVQNYFGAGLRANLSLNDSFLDQTRFGLSVFGDSYGSSEINATLKPEMEFE
FT                   IAGEKIQTNVSVDYLNTSFDQNYEGTTDLASSYLNLGLSPSILILRDDLELNLGASVFY
FT                   SLDSESSESNIFVYPNINASYRLAGEYFIAYAGLNGELKQNSYKAFVDNNPFVSPTLAI
FT                   TPTDQQYVGSLGAKGKLSDVISYNIKGSYANVEAQPLFKSNTNTFPLGGLLEDYEYGNS
FT                   FGVVYDNIKTVSFFGELNFDITKVLRLGLNAEYFSYNTDTQEEAWNLPELKASLLADYK
FT                   ITDKFTAGANLFFVGERQAQASDFDMSGNLTTENITLDSYIDANVQLNYLINDQLSFFV
FT                   KGNNLFADSYEKWLNFPVYGIQGMAGATYKFDW"
FT   gene            complement(67485..69281)
FT                   /locus_tag="CA2559_00185"
FT   CDS_pept        complement(67485..69281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00185"
FT                   /product="GTP-binding elongation factor family protein
FT                   TypA/BipA"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00185"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87126"
FT                   /db_xref="GOA:A3U4F9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4F9"
FT                   /protein_id="EAP87126.1"
FT                   /translation="MEIKNIAIIAHVDHGKTTLVDKIMYHCQLFRENENTGDLILDNND
FT                   LERERGITITSKNVSVNYKDIKINIIDTPGHADFGGEVERVLNMADGVLLLVDAFEGPM
FT                   PQTRFVLQKAIDLGLKPCVVINKVDKENCTPDLVHEKVFDLMFELGAEEWQLDFPTVYG
FT                   SAKQGWMSDDYQKPTENIEPLLEMVYDHIPAPKIEEGTTQMLITSLDFSSYTGRIAIGR
FT                   LQRGHLKENMQISLVKRDGSIQKARIKELHTFEGLGRKKVEEVKAGDICAIVGLESFDI
FT                   GDTVADFENPEGLKTIAIDEPTMSMLFTINDSPFFGKDGKFVTSRHVKDRLTKELEKNL
FT                   ALRVEETDSADKFMVFGRGVLHLSVLIETMRREGYELQIGQPQVIIKEIDGVKCEPFEE
FT                   LTIDLPEEVSGRAVEFVSLRKGEMTSMEAKGDRMVCEFIIPSRGIIGLRNQLLTATAGE
FT                   AIMAHRFKEYAPLKGDIPQRQNGSLVSMENGSAIPYSIDKLQDRGRFFVDPGEDIYEGQ
FT                   VIGENSRGDDMVVNVTKTKKLSNVRSSGADDKAKITPAIKFSLEEALEYIQKDEYVEVT
FT                   PNHLRLRKIYLKEVDRKRYKIV"
FT   gene            69399..70217
FT                   /locus_tag="CA2559_00190"
FT   CDS_pept        69399..70217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00190"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00190"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87127"
FT                   /db_xref="GOA:A3U4G0"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4G0"
FT                   /protein_id="EAP87127.1"
FT                   /translation="MKLDLIPRLKHTDSNNFFLLAGPCAIESEDMALRIAERVVEITNT
FT                   LKIPYIFKGSFKKANRSRIDSFTGIGDEKALKILKKVSDTFDVPTVTDIHENSDAALAA
FT                   EYVDILQIPAFLVRQTDLVVAAAKTGKVVNLKKGQFMSPESMQHAVKKVTDSGNNQVMV
FT                   TDRGTMFGYQDMVVDFRGIPTMKQYAPTVLDVTHSLQQPNQTSGVTGGRPDMINTIARA
FT                   GIAAGVDGLFIETHFDPANAKSDGANMLDLQYLESLLTNLTKLRQVVNTF"
FT   gene            complement(70214..70567)
FT                   /locus_tag="CA2559_00195"
FT   CDS_pept        complement(70214..70567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00195"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87128"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4G1"
FT                   /protein_id="EAP87128.1"
FT                   /translation="MNPAEDYILKKPQPWQSILLELRFIILSISEDVEESYKWSLPFYG
FT                   AYKQMFCFLNFRKTYIDLGIPYGIHIKQHSQYLVDGENRKMLRSLRFHTLEDIDHAIVK
FT                   AILTEAFQNLKQR"
FT   gene            complement(70573..72540)
FT                   /locus_tag="CA2559_00200"
FT   CDS_pept        complement(70573..72540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00200"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87129"
FT                   /db_xref="InterPro:IPR011519"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4G2"
FT                   /protein_id="EAP87129.1"
FT                   /translation="MGFSQDDCASAIAITEGIYTVDAIDGTEVPSPICAANGGGATAGE
FT                   WYTYTAQENLGLTITTDLSQNQNQDPQADTRFHVYTGTCGDLVCRSGDDDAGTGFLSIA
FT                   QFNVEAGTTYYIAFDNKWNSSGFDFQIIEGAVIAEPETIITFTSTGSETDGTQRALVDM
FT                   NGDYLDDIVSISTTNVNIRYQQTSGDFTTANIETTSAENSPSWSLSAGDIDGNGYNDLL
FT                   YGGASGVTFMIANDTGTGFSQISGSEYVFSQRSNFVDINNDGHLDAFVCHDVEPNVYYI
FT                   NDGNGNLTFNQGGLGDTVNGGNYGSIWIDYDNDRDMDLFIAKCRGGNSGANINQLHEND
FT                   GSGNFTEVSTAMNLADPVQTWSSAWGDFDNDGDMDAFIGASSFTNGGHKFMRNDESTFT
FT                   DVITGTGLENFEDTDIEYVTHDFDNNGYLDIYSGSGNFFFNNGDMTFTQQIVNFGAGPI
FT                   GDLNNDGFLDILSGNIYMNDGNDNNWLKITTEGVQSNWNGIGARIEIQSAMGSQMRDIR
FT                   SGDGFRYMSSLNAHFGIGTDTEIESVTIYWPSGIVDTILNPTINETLFVQEGQTLSIKD
FT                   NSALQLNLYPNPTHQYLYVEGLQNDTKNTSLQIVDVQGKQVNNVRLNSNRVDVSQLSNG
FT                   IYFATITINNQSQTLKFVKD"
FT   gene            complement(72617..73768)
FT                   /locus_tag="CA2559_00205"
FT   CDS_pept        complement(72617..73768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00205"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87130"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4G3"
FT                   /protein_id="EAP87130.1"
FT                   /translation="MLRQLPFAILRCIFLCVILVITACSEDDGYEEPPTTVNPTDDDPV
FT                   DDGNTGGENETLVVFNPAEVPYQNLSDYNFFQGDISNLIPQDDVLPYDLQSPLFSDYAK
FT                   KKRFIWMPSGVSASYTSDASLLDFPNGTVLIKNFYYINVQPSNTTKIIETRVMYKLNNT
FT                   WEFAEYIWNEDQTNAVLDMDGSFTDITWVNDGNETQTINYRIPSEGECFTCHKKNDQPI
FT                   PIGLKPQNINKIFAYTDGEMNQLEKFQFQGYLDSYPSTIQTVVKWDDTSADITERVRAY
FT                   IDINCAHCHAEGSHCDYRPMRFAYNETAIAENLGICVTPDENIGDQFTHIIASGNAARS
FT                   VLYERISSTDEAVRMPLLGRTVNHEEGAALIQEWINSLEPSCN"
FT   gene            complement(73857..75071)
FT                   /locus_tag="CA2559_00210"
FT   CDS_pept        complement(73857..75071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00210"
FT                   /product="hypothetical saccharopine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00210"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87131"
FT                   /db_xref="GOA:A3U4G4"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR027281"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4G4"
FT                   /protein_id="EAP87131.1"
FT                   /translation="MSNITFALIKERKNPPDRRVVFSPSKLKDASKAFNDANFIVEASN
FT                   IRIFKDQAYVDEGFTVTENVSEANVFLGVKEVPVSALIPNKKYFFFSHTIKEQPYNRAL
FT                   LRAILDKKIELYDHETIVKENGGRLIGFGRYAGLVGAYNGFRALGLRDTLFSLPKAEGL
FT                   TDLNAMKTELDKITLPNIKIVLSGTGKVALGAKEILDHLKIKQVNVKDYLTTNYDEPVY
FT                   TMIDVLDYNTRIDGKEGNRYEFYNDPTPYKSNFMRFAKVSNMFIAGHFYGNDAPFLFTR
FT                   KDAKHPEFNIDLVSDISCDVDGPVASTLRASTIADPFYGYNPETEQEVPFNEKDAITVM
FT                   AVDNLPCELPKDASEGFGEMFLKHVIPAFFNGDKDGVLQRARMTTSKGTLTDRFKYLQD
FT                   FVNGN"
FT   gene            complement(75941..76072)
FT                   /locus_tag="CA2559_00215"
FT   CDS_pept        complement(75941..76072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00215"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87132"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4G5"
FT                   /protein_id="EAP87132.1"
FT                   /translation="MSNGNDRNVKNEKGHSTPRDSKNMHSEEDNSTSDGLKISNEEE"
FT   gene            complement(76077..76328)
FT                   /locus_tag="CA2559_00220"
FT   CDS_pept        complement(76077..76328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00220"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87133"
FT                   /db_xref="GOA:A3U4G6"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4G6"
FT                   /protein_id="EAP87133.1"
FT                   /translation="MEAALGIVAGILTMCGIVPQIVKAYKSKQVDDVSRGMLMIIMSGV
FT                   GLWTVYGILKDDIPIIITNALAFLLNGYMLLLTYKLKK"
FT   gene            complement(76337..76789)
FT                   /locus_tag="CA2559_00225"
FT   CDS_pept        complement(76337..76789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00225"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87134"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011971"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR019052"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4G7"
FT                   /protein_id="EAP87134.1"
FT                   /translation="MDKKEISNSIQEIIENNNDSYKGYKQVADKANDSQLRSFFIQQAA
FT                   ERKEFAGKLLNQLKIYNPDHNDNASGSAVGSLHRTWINVKTALSQDNDEALLEECLRGD
FT                   KASIEDYEEFLNNNKEIPDNLRSTITQQVQDIKNTLESVSRLEDVH"
FT   gene            77330..78127
FT                   /locus_tag="CA2559_00230"
FT   CDS_pept        77330..78127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00230"
FT                   /product="putative tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00230"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87135"
FT                   /db_xref="GOA:A3U4G8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4G8"
FT                   /protein_id="EAP87135.1"
FT                   /translation="MSEKRLAQNTIDIYTEVTRIFLRYLSLKQADEITNIWVQRFNYDY
FT                   IIGNGFGVAYQNQCINGIKKFVSFLGKPLVLDTLVRPKKPQKLPVVLSKEEISQLFNVI
FT                   NNLKHKALLALLYSAGLRIGEALQLTPEAIDSKRMLIRIEQAKGNKDRYTLLSESFLTL
FT                   LRMYYKKYKPKTYLFEGQNGGAYTSSSAQKVLKRALRDAGITRIGVTLHTLRHSFATHL
FT                   LESGTDLRYIQELLGHNSPKTTMIYTHVSSKSLQNIRNPFDEL"
FT   gene            78247..78528
FT                   /locus_tag="CA2559_00235"
FT   CDS_pept        78247..78528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00235"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87136"
FT                   /db_xref="GOA:A3U4G9"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4G9"
FT                   /protein_id="EAP87136.1"
FT                   /translation="MRNKLSKIISKEDNGPTLVGKILMIVGVIISTILYGIFFGWIFFL
FT                   IGIIFIWFSELSKTEKWLWTLVPSLIWIPMMILFSILLPMIYYSIVNA"
FT   gene            78521..78880
FT                   /locus_tag="CA2559_00240"
FT   CDS_pept        78521..78880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00240"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87137"
FT                   /db_xref="GOA:A3U4H0"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4H0"
FT                   /protein_id="EAP87137.1"
FT                   /translation="MLKKIFFFILILVSIISVGYFLTKDKDALEFSSEKWKNWTESETE
FT                   LSTRWNMIESLRENHKLNGKTKQELIILLGEPQIKTDKEFYYHLGMSGFGINTGTLYFE
FT                   FDNQNKVIKFDIWDG"
FT   gene            79258..81465
FT                   /locus_tag="CA2559_00245"
FT   CDS_pept        79258..81465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00245"
FT                   /product="site-specific DNA-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00245"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87138"
FT                   /db_xref="GOA:A3U4H1"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="InterPro:IPR035386"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4H1"
FT                   /protein_id="EAP87138.1"
FT                   /translation="MATINFYLDKPDKKGFAPIHLRINCNGNQVKVSTGQKIEPKKFDK
FT                   SKQKAIGLTTESHEINHYLDFLRERADELLHHSNKKTFIQDEVKSLLNEHIENYKENSN
FT                   VNIVKEQVSLYGKPFTFVDLFAGAGGFSEGFLQAEHNNKFFDFVVANDINENCELTHVV
FT                   RYNHQLGLDAEFLKQDITEPDFLDNLLEKINGRKIDVVCGGPPCQSFSLAGKRKKFDKK
FT                   DDLFSHYLEVIKVLQPKYFVMENVKGILTKEKGKIKELIIKEINSIVDTKEIPLLISFI
FT                   KKIRKESNSFLFDSIIKRVELEKLLEKDKESGKADFINFVENRFRKLTPKIADYKTSKT
FT                   DENINTIRHGFNLLARAKEWEKLKRDIIKEKDFCNIDSDNFANAFTDFLTEISSENVIS
FT                   KIENAFKILKVPNTYKKDCDDIITALKIYTTSFDESIEILKSHCNKSQTKELETILESI
FT                   RLYKIEKPFVANASNYGVPQNRERVLFIGCRKDQKFISEIPATVSEEEKVTIFEALYDL
FT                   DFIGNNQEAHRYELVDISSQYNGTAKKMAKLLKKRKIDGKPISKGGKSFAEWSRKGRLI
FT                   ERFKPQTKPFYVRNTEALENGEKYFDILNNHKTSNQNETVIERLGVILKNGDYKKAQPE
FT                   LEKLGLSTNKRNYNVLKPDEQSSTIMTIADDYIHYNSPRSLTVREMARLQSFDDSFVFQ
FT                   GKRSTGGNNRKTEVPQYTLVGNAVPPLLARAVASEILKNIK"
FT   gene            81462..82643
FT                   /locus_tag="CA2559_00250"
FT   CDS_pept        81462..82643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00250"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87139"
FT                   /db_xref="InterPro:IPR029127"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4H2"
FT                   /protein_id="EAP87139.1"
FT                   /translation="MRKLTDEEQEKIKLLTKNQVSLTLIEPTETGLKKSIMDATGSVRS
FT                   YLKSENIHDYELQNQGTESKVMIPTIIHTGFKIIKSKASLYRPSTKKGDPRIWFYGLTK
FT                   VAEPNDIIGITFYNDNFQVFNLTKLDIKELIYSSILNPFQELINAISTTENEVAFELLA
FT                   MLRKIANAGPIPSMVDADTSVGRTLETALGIDINSSKQPDYKGIELKSFRNSRTNRKNL
FT                   FAQVPDWKLSKFKSSAEILDNFGYERDDAFKLYCTVSAITRNSQGLNLRIDNDIKQLIE
FT                   NSDKPEVGDFVVWTLDKLHNRLKSKHKETFWVEAESTRINDREHFQYKLVEHTKKPITS
FT                   QFDLLIEQGIITLDHLIKRNSKGKVVEKGPLFKIKPKGIELLFPPSESYDLMV"
FT   gene            83008..83571
FT                   /locus_tag="CA2559_00255"
FT   CDS_pept        83008..83571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00255"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00255"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87140"
FT                   /db_xref="GOA:A3U4H3"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4H3"
FT                   /protein_id="EAP87140.1"
FT                   /translation="MTTLFIKNMVCNRCVMAVRNELNNSGIEPIDVQLGEVTLEKDLTA
FT                   QEKEKFSKALVSLGFEMIDDKKSRLIEQIKTIIIDLVHHQDNGTKTNLSDVLSSKLFHD
FT                   YNYLSNLFSEVEGTTIEKYFIAQKIEKVKELLVYDELSLSEIAFRLNYSSVAYLSNQFK
FT                   KVTGLSPSHFKNIREDRRKPLDEV"
FT   gene            83661..85886
FT                   /locus_tag="CA2559_00260"
FT   CDS_pept        83661..85886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00260"
FT                   /product="putative copper transport-related membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00260"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87141"
FT                   /db_xref="GOA:A3U4H4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4H4"
FT                   /protein_id="EAP87141.1"
FT                   /translation="MATTNQNTVTQTFPVLGMTCASCASSAESIVTHQEGVVSASVNYA
FT                   TGNLIVEFLSNVTNAEKIRKAVQGVGYDLLIEDESKQQESLEVIHEKKFKQLKNKTLWA
FT                   VILSLPVVIIGMFFMDMPYGNEIMWAFSTPVVLWLGRDFFINAWKQAKHRKANMDTLVA
FT                   LSTGIAYIFSVFNMLFAGFWHQRGLHAHVYFEAAAVIIAFILLGKLLEEKAKGNTSSAI
FT                   KKLMGLQPKTVIVIQADNTEKQTAIENVKVDDVILVKPGEKIAVDGMVISGSSYVDESM
FT                   LSGEPVPILKKENEKVFAGTINQKGGFQFKAVKVGKETMLAQIIKMVQDAQGSKAPVQK
FT                   LVDKVAGIFVPVVMGIALLSFIVWMIFGGDNAIVQGLLAAVTVLVIACPCALGLATPTA
FT                   IMVGVGKGAEQGTLIKDAESLELAKKVNAIILDKTGTITEGRPQVTGIQWLNNDDSKKY
FT                   ILFSIEKQSEHPLAEAVVKYLDKVNSTSLTNFDSITGKGAKADQNNETYFVGNKKLLFE
FT                   NNISIPEELQQQANEWSKLSKTVIWFSDSKQALSVIAISDKIKKTSAQAIKEMQDMGID
FT                   LYMLTGDNEATARAIAEQTGIKHYKAEVLPQHKADFVKELQEEGKTVAMVGDGINDSTA
FT                   LATADVSIAMGKGSDIAMDVAKMTIISSDLTKIPQAVKLSKQTVATIKQNLFWAFIYNL
FT                   IGIPIAAGILYPINGFLLNPMIAGAAMAMSSVSVVSNSLRLKWKKVI"
FT   gene            85983..86201
FT                   /locus_tag="CA2559_00265"
FT   CDS_pept        85983..86201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00265"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87142"
FT                   /db_xref="GOA:A3U4H5"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4H5"
FT                   /protein_id="EAP87142.1"
FT                   /translation="MENKELKFKTNLNCGGCVSKVQSDFDNAAGVCHWDVDTDNSDKIL
FT                   TVSSKGISEDEVIKIVQSKGFKAEVIS"
FT   gene            86383..87120
FT                   /locus_tag="CA2559_00270"
FT   CDS_pept        86383..87120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00270"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87143"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4H6"
FT                   /protein_id="EAP87143.1"
FT                   /translation="MNRILSLIICAFLITSCGKKREGEEKTGILSHLVSISDNENNGIQ
FT                   EILDFYGGRAEYSIGASASTSDGTKKYFEIEMSQSDAIDKRLDKAYLPSSNIAYRFYKN
FT                   LKAEKKNYDEIKVVLISKENKKQEFDFPISLLEKAEKRIKVAEKTVNLLKEKQFDELKN
FT                   MLNNELVPFDKDELISRLKEVEPQFGNILEFRLFGFKITEIKDKELMHISAAIIRDKQN
FT                   NEFSVDIDFNSEKYELYQLQYKL"
FT   gene            complement(87178..87294)
FT                   /locus_tag="CA2559_00275"
FT   CDS_pept        complement(87178..87294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00275"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87144"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4H7"
FT                   /protein_id="EAP87144.1"
FT                   /translation="MSSIFFIVVANGIVYGLLRGLARNLANKNLIENPRGFS"
FT   gene            87275..87706
FT                   /locus_tag="CA2559_00280"
FT   CDS_pept        87275..87706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00280"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87145"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4H8"
FT                   /protein_id="EAP87145.1"
FT                   /translation="MKKILLIILIGISNLTFAQTGTNLNGKIVDEKLNCLFGVKITNLN
FT                   SGTESISDQNGRYEINVTENDTLEFQMIGLTTDKIKIEKPIQTLNLIMIDKDVNCLGAI
FT                   WTDKQYRKAYREIEKQLKKLYKTAEKQNVWKNSSCQHRI"
FT   gene            87854..88873
FT                   /locus_tag="CA2559_00285"
FT   CDS_pept        87854..88873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00285"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87146"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4H9"
FT                   /protein_id="EAP87146.1"
FT                   /translation="MISNEEITLILEKPESSTLDFKQELYDFSNDKDLKNTAKFVKDVI
FT                   SFTNTIRSEKGFIFFGVKEKEDKSLDVIGLSNSLDESILQEKVKDKVFPRPFFEYYEVN
FT                   YNLKKIGILEFPINKYELPITPVVKMKGLEVGKVYYRNGTSNTEANGIDVIRINDWFKS
FT                   LPGHLDLSLTDKISGILKRLTLNEEKLSVILTDLLSISKIHSLKQLELFCSAQIRGIKH
FT                   DETENHKYRIQKVIISPNSFETNPYSFIDITASMIKKEIEKEDGFYEYRMLFNQSIVRL
FT                   EDLLSQFINNKSYATVKMSSKHLFGKKDYDLNVFIFEDNIRGVYSNIRQKTIDELMRI"
FT   gene            89129..90043
FT                   /locus_tag="CA2559_00290"
FT   CDS_pept        89129..90043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00290"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87147"
FT                   /db_xref="GOA:A3U4I0"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4I0"
FT                   /protein_id="EAP87147.1"
FT                   /translation="MTSYTFAQKLSINETLDYIEEIENKYTNRIGYVSGDKGITVRNDY
FT                   TFDKDSGILSMTAYWVHNGETIEKIESVHISDLSSEVEYSDKWMKLKCINENCFEVTRF
FT                   KYNNRTSTYTKDYRIGYSDEISLYVVQEYNAKKALTAFDYLFSLFNDLKIERDKDDPFA
FT                   QIAKAKEVSFKNSNSGTIQLKEQNGTFEIPVKIGGISKGFVLDSGASDTTISSELEAQL
FT                   IRNGTVTKENYLSNALYRIADGSIISQRRFVLKSLKVGNFTVKDIIISVGDEDSPLLLG
FT                   KNFLDRFESWVINNSNKTIELKA"
FT   gene            90043..90309
FT                   /locus_tag="CA2559_00295"
FT   CDS_pept        90043..90309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00295"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87148"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4I1"
FT                   /protein_id="EAP87148.1"
FT                   /translation="MNCNKTIETNISEEIFLLEIEKAKKCVAKVLNIDLNDIEEIANED
FT                   VLVKLDKREKKLCNRRIFNFQSGSLDCYMSKDLEFIEIFHHPN"
FT   gene            90476..90931
FT                   /locus_tag="CA2559_00300"
FT   CDS_pept        90476..90931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00300"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87149"
FT                   /db_xref="InterPro:IPR032025"
FT                   /db_xref="InterPro:IPR038312"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4I2"
FT                   /protein_id="EAP87149.1"
FT                   /translation="MSKLRKLIDEITEFGINPKVELTDKTDVLKNLLVGIYSEFLNVEF
FT                   EFDETDYDEEPDFNYNEIKENVKSNFPNFDWYSMVLDSNKMEPNIEIGIGDELDDLADI
FT                   IKDLLAVKWRMDNTSKNDALWHFEFSMRTHSEQHLVDLLKRLKDRNE"
FT   gene            90924..91247
FT                   /locus_tag="CA2559_00305"
FT   CDS_pept        90924..91247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00305"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87150"
FT                   /db_xref="GOA:A3U4I3"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4I3"
FT                   /protein_id="EAP87150.1"
FT                   /translation="MNKKLKWTLRMALTSFSLLVFALLINYFREPLLGIKEGYAPHNFS
FT                   FNFLFFLPAILTSLGLGIAVIGRTIKHWKNWNSLNRKLIFIGLSSPVILLFIFQTIRIL
FT                   TIE"
FT   gene            91420..92352
FT                   /locus_tag="CA2559_00310"
FT   CDS_pept        91420..92352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00310"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87151"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4I4"
FT                   /protein_id="EAP87151.1"
FT                   /translation="MSAIEFIMQGGMASTGGDLSEAEQKESNELVKKFGNKVREIGRQL
FT                   MVPANQLSIFRMNFLFVGKDQQNYHFAFVDKPGGNSITYRDLSKYGIIPTQSLIHQLKI
FT                   EIGEVHWIFTIPVLTAKTITDEQIEEYSKQYVESVLQASKKTEQKVSDQAISVPELGKY
FT                   IEAFRDDYPTTQKTAFIVMQFGNTKVHDSLVKVIKETLKKYNIVGLRADDKEYADDLFA
FT                   NIRTYMHCSDFGISIFERVTEDNFNPNVSLEVGYMMGLGKPICLLKDKTLTNLHTDLVG
FT                   KLYKPFDPLDIEETLPNQLEKWLKDKGII"
FT   gene            92681..93172
FT                   /locus_tag="CA2559_00315"
FT   CDS_pept        92681..93172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00315"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87152"
FT                   /db_xref="GOA:A3U4I5"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4I5"
FT                   /protein_id="EAP87152.1"
FT                   /translation="MSEIHNIIFEKGIDRLSFDVSILYNELENIEFEDYDLALAELQEL
FT                   KLIKRIGIGNSFKITNSGYKAYEMGIEKFIQEQKKIDYRKERKVFYDYQVSRFRAKTGY
FT                   IPYVISFISLIISIFAFLNNKNKELQQPIKSNALEQIKDSTLFSIQTKRADSLNKLNRK
FT                   "
FT   gene            93387..95141
FT                   /locus_tag="CA2559_00320"
FT   CDS_pept        93387..95141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00320"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87153"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4I6"
FT                   /protein_id="EAP87153.1"
FT                   /translation="MTKSAHFKVDPKLAELLGETYRSVEEATKELIDNAYDADSENVKI
FT                   QLPDELTPDQKIVIEDDGSGMKENEVRNEYLNIANSRTSRKGNVTFSKKRKVKGRKGIG
FT                   KFSGLMVASQMTIETYASGKMTSLTINKDDLAKAGYDLEKVPLPINVTDCDKTKHGTRI
FT                   TLEGINQNFSFPNPDRLKEILIRDYGREMDFDITINGENIGVLDLQGKSYSERIELPDG
FT                   KMATLNYTVTEKPIKQAGIAIRVNNKIIGRPQNFLSDDEIIPKKLQNRVYGEIICDDLE
FT                   DDLTADFGAVIDNSKLYQKLTTSTTEKLRKSVDEVFVTDMKMAKARYQRKINKELEKLP
FT                   DFKQPFAKKALYKVLEKFYGETEERINTVISVMVSAMEKDHYWDIVQNIEDTRTGDVEK
FT                   FAEALSEFGFLEMSIISSQAINRLRFLDELNILIENPKTLESTVHKAFEKNTWLFGDDY
FT                   SVIFSDQGLKTSIEKVINKTYKGEKPDDRPDILFGRNITRSLVLIEFKRPSFTLNRDTE
FT                   SQALKYRDELNVYFHNQKIEIILLGGKVKGIISSHNERGDVLYRTYVDLISVARQKLIW
FT                   LIDELKKE"
FT   gene            95288..96349
FT                   /locus_tag="CA2559_00325"
FT   CDS_pept        95288..96349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00325"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87154"
FT                   /db_xref="InterPro:IPR025139"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4I7"
FT                   /protein_id="EAP87154.1"
FT                   /translation="MKKKYQIFVSSTYEDLKEERDLVIKAILEMGHIPVGMEMFSAGDE
FT                   QQWQLIQSQINDCDYYIIISAFRYGSMDGDISYTEKEYDYAFSKGIPVLGFVINEDVKW
FT                   PATKVDKNATKVEKLTSFKSKIQSKLVSFWNDKNDLYGKVSISLMKQFNTNPRTGWVKS
FT                   SESMGPEVLKEISRLSTENSDLRKEIEEYENKLNNEEKAEFEKTLNTLKHNKRSPSFFY
FT                   YGGEDWEYENEEFTLLEIFNLLAPELMIENSSKYCSMYLGTMLNPDKERELRAEWPIPS
FT                   NTVRKILADLNVLEIIKPSTKKHSVKDENDYWTLTEQGKKLFKEVRRELLDKNLENGKI
FT                   ASVKNEKTTKTKK"
FT   gene            complement(96330..96464)
FT                   /locus_tag="CA2559_00330"
FT   CDS_pept        complement(96330..96464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00330"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87155"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4I8"
FT                   /protein_id="EAP87155.1"
FT                   /translation="MRGLALNFASTHQTENPLGFSEVDENKQLLIAIVSSSYFTFLFS"
FT   gene            96504..97523
FT                   /locus_tag="CA2559_00335"
FT   CDS_pept        96504..97523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00335"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87156"
FT                   /db_xref="GOA:A3U4I9"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4I9"
FT                   /protein_id="EAP87156.1"
FT                   /translation="MKRIINKIFEIPLIIPIRIALFLLVTLLSYKFLTFFSSEYKFDAK
FT                   ELLNLLISTISIIIAIIITYLFSKLFSEKAERIQRKAEIDTLSHKITAFRKMAFQIRGF
FT                   SEFWKFGNNNIKSKMDHKYNDLAYEDLRNDRFTYEELTPIIRDVGETAIQSYLGLKGLE
FT                   NEENTFGFFQSFNPKNYTLDEIARFKDYANSFWYLLNRSDSNIVNLNRENRYSLNFIDE
FT                   LYFEITAKKIDQSNYNKEIEELFGHFDTDIFHKHFYLSKLNSTALPQVYITSLLNMLIF
FT                   IALVIASLVVFIADFNSLTRYISTILVVSIFIANTIDLTIITVSALKSELNVKAFYRI"
FT   gene            97754..99370
FT                   /locus_tag="CA2559_00340"
FT   CDS_pept        97754..99370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00340"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87157"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4J0"
FT                   /protein_id="EAP87157.1"
FT                   /translation="MKNKEKITDFERTNPLSLFYEFGMSPDELKSEIIDCFSNYFQNQE
FT                   RLKKYATTDLVNNWLSYILVERDSPESIKSIDTILEIFNGAKNINQNKTIEAYNSWLPE
FT                   ISQGISRFWSLYNNQIDIKNLCVEDYLEESLRMIGHSIEGISKPFIKLLFHLNRIKRNK
FT                   QSDFSEIKSKDLGVVIDELINTTDLDDLLIISNHSIRLNQWRNIAYHHNSKIIDGKIIC
FT                   WYKKNGINEEFELSRDELFSSLLKILLTFKLIRVSETIFCFDNINEIQELRDSIEKEPL
FT                   NIRDEAKLLDFKSSLSLQGFKIKKLKTENNSSVLTLIDMQEYGNFQKRAIHSSQFLYNL
FT                   WLHTNSNKLIVEYYVFNGDKFLVSEIDSTIFANHTGGDMKLSELLTDVNFSFISKSYSQ
FT                   NKNPFEKLILSKNIKEHKQKFYSQQGEELSIEEFSKKFILSVFTNYLVFISEGFNTNDI
FT                   QINIGSDGAMAIADKKIILRVPATIRNKAYQLKLIELLEQVINLYSNGELKREIVEDAK
FT                   MNNKYYFKKSLVKDQLKNEDK"
FT   gene            99578..100249
FT                   /locus_tag="CA2559_00345"
FT   CDS_pept        99578..100249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00345"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87158"
FT                   /db_xref="GOA:A3U4J1"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4J1"
FT                   /protein_id="EAP87158.1"
FT                   /translation="MKEVPKKDKKKLKKAKSDTFKIVLTALLTSMFTGFVSYFLMFSQL
FT                   KEEQNYWKTRTKAEKVSQLLEKQIEIFDNVNSGILLTEVLAKDFKLYSAKFMSTIELSL
FT                   AGGKNSTNEESEILNNKAIEYHKQINQLATDIQMSEMYFGAKVDSLINPLSESLNSNYQ
FT                   NNLILGDTTRLKGYKNVTEYFKRDFNTTKELSENRLKILKAMRSEIDSTAEILYGDYLK
FT                   N"
FT   gene            complement(100313..100588)
FT                   /locus_tag="CA2559_00350"
FT   CDS_pept        complement(100313..100588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00350"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87159"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4J2"
FT                   /protein_id="EAP87159.1"
FT                   /translation="MYFTHFKYLDNLVFQRLQVLLFFNRPRTLSTIRGIGEIEQSDVSF
FT                   PVSESVDFNANVVTWESQLMRLLWTTVSYKNSCGFTCEDFPQENQT"
FT   gene            101264..103174
FT                   /locus_tag="CA2559_00360"
FT   CDS_pept        101264..103174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00360"
FT                   /product="ABC transporter, ATP-binding protein-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00360"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87161"
FT                   /db_xref="GOA:A3U4J4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4J4"
FT                   /protein_id="EAP87161.1"
FT                   /translation="MSKELTDFVQYIQKAQNEFNSHRQGAFDLGCNSETLESFDKLISL
FT                   TSSLENKAKQGELKINYLNQFQSNIESILSILPFRGQPNSSFLAHQNEHYKSQIKNSLE
FT                   QNNTSISSLYNQIEFNIDFFNKIGYFDSNVVAIGANGSGKTTLSNKFKTYLQNNGVVIS
FT                   AQRILLVPSFDSIANPAKTASELKQYQLRDKTNKSNSEFNYLKQEFGIVLKNLLADNIS
FT                   VGNSYRKNAIDAVKSGKAISNPDTTNLDITFQIWNSLIEHRTISCDDGINITAKSNDGR
FT                   SYPAIQMSDGEKVMLYLIAQVLQSPKNGFIVVDEPEMYLHKTILKKLWDLLENERNDCI
FT                   FIYLTHDLDFATSRTTAKKIWIKSFTHPDKWDIEDIPTDEIPETLLFELLGSRKNILFC
FT                   EGVKGSIDERVYSILFPELTIMPVGSCFDVINHTKAFNKLQNVNTKSYGLIDSDHHDTD
FT                   RLDKLKESDIFSFKVAEVENLFLDSDFLKILAQQILIDEENVKLIETDIISELDKLKEI
FT                   QASNYVSTKVNYYFTDSDVSKGNALAQLETNYQNFLDKISINDWYNQRLAELNEMIGNS
FT                   DYNNVLIAYNNKGIRNIASKHLKISDFTDRSIKLLQGNIEAKTALNKYFPEEIKTAGNN
FT                   V"
FT   gene            103354..103677
FT                   /locus_tag="CA2559_00365"
FT   CDS_pept        103354..103677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00365"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87162"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4J5"
FT                   /protein_id="EAP87162.1"
FT                   /translation="MKLDLYTKSILTVIAICLTINVLKDFDIIPKTYAKESLKNEPNLL
FT                   PNKNYGLIPVNADGTIDVNIKSSSEMDVNITGVSTSDELDVNIDEIGGGYVSHGGPISV
FT                   EID"
FT   gene            103756..104169
FT                   /locus_tag="CA2559_00370"
FT   CDS_pept        103756..104169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00370"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87163"
FT                   /db_xref="GOA:A3U4J6"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4J6"
FT                   /protein_id="EAP87163.1"
FT                   /translation="MDINPSEIMISAIVGVVVAELWNFIKRKYEETRPIKKLKKIKAIK
FT                   VLWFILSYILPLGTIVFLIIDKNTEPTFKNISLFIIICISLVYNLLMSHIINLYKMNTK
FT                   LTNISSEKLTKIDQTFDKVYHHIEKTKSDNNLK"
FT   gene            104524..104727
FT                   /locus_tag="CA2559_00375"
FT   CDS_pept        104524..104727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00375"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87164"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4J7"
FT                   /protein_id="EAP87164.1"
FT                   /translation="MNTRIMVETKDEITRIKALQKEIEQLKKLVVKKDLDELVNDSYLQ
FT                   VAAQKLGYKNVLELKKKLNIKL"
FT   gene            104790..104981
FT                   /locus_tag="CA2559_00380"
FT   CDS_pept        104790..104981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00380"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87165"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4J8"
FT                   /protein_id="EAP87165.1"
FT                   /translation="MKRDAIYKYKCRADKRLQLEKQIIHIVQKRRKSLPREGVRKLMIS
FT                   LQKDFENQKSKNWKRHFV"
FT   gene            105178..105579
FT                   /locus_tag="CA2559_00385"
FT   CDS_pept        105178..105579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00385"
FT                   /product="ISPsy11, transposase OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00385"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87166"
FT                   /db_xref="GOA:A3U4J9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4J9"
FT                   /protein_id="EAP87166.1"
FT                   /translation="MYSRKVVGYDLSDSLELKGCVRALNKAIYNTKTIKGLVHHSDRGI
FT                   QYCSNVYTQILKRKKIGISMTEENHCYENAMAERVNGILKDEFYLDQTFTNVAHAKRAA
FT                   KNAINLYNQIRLHLSLDYKTPNMVYKLSA"
FT   gene            105632..105931
FT                   /locus_tag="CA2559_00390"
FT   CDS_pept        105632..105931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00390"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87167"
FT                   /db_xref="GOA:A3U4K0"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4K0"
FT                   /protein_id="EAP87167.1"
FT                   /translation="MKIFNIVTSVILTILILCIAYLIPEFESIQVDPMGDGQSGIGKGV
FT                   IGLMIFGLGVLSLIFALIFILLMVIRNTNRNKWSYINLLASSLISAFTFIYFFG"
FT   gene            105945..106400
FT                   /locus_tag="CA2559_00395"
FT   CDS_pept        105945..106400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00395"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87168"
FT                   /db_xref="InterPro:IPR021284"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4K1"
FT                   /protein_id="EAP87168.1"
FT                   /translation="MFQDFITLKTRHLRFVKTVSDSEIVYGLKSKNGYATSSSTQYEDD
FT                   VGKPIGMICFWAEKVRAKSCAKDDWKKYKVSEIPLAEFMENWCIGMANDGLLIGTQFDQ
FT                   NLLGHEVEPLDLILELTSELKSIEKDLNFKKFNGIADLEKQVKEINE"
FT   gene            complement(106601..107242)
FT                   /locus_tag="CA2559_00400"
FT   CDS_pept        complement(106601..107242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00400"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87169"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4K2"
FT                   /protein_id="EAP87169.1"
FT                   /translation="MGKISQGILGGLSGKVGNVIGGNWKGIDYIRIKPSSVANPRTEGQ
FT                   VNQRTKFSSVLEFLQPNKAFLKVGYKNFANKRTEFNSAMSYLLNNAITGTAPNFTVDYT
FT                   NALLSRGSLSGVLNGVTDLSNAGQVDFSWGDNSAEGNASSTDKAMVLVYNPSKKESIYI
FT                   LDGAVRTAGTQTVTIPNTYAGDTVELFMAFVSADGSQVSNSIYLGSGTAN"
FT   gene            107660..107995
FT                   /locus_tag="CA2559_00405"
FT   CDS_pept        107660..107995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00405"
FT                   /product="putative excisionase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00405"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87170"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4K3"
FT                   /protein_id="EAP87170.1"
FT                   /translation="MENPFEIINQRLERIETLLENIYRASNINETGIATTPIMNIKQVS
FT                   AYLDLSVSALYKMTSTKEIPHAKRGKRLYFDKKDIDSWVLENKVTTTSDIERMATEYIL
FT                   KNPIKFP"
FT   gene            108851..110089
FT                   /locus_tag="CA2559_00410"
FT   CDS_pept        108851..110089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00410"
FT                   /product="adenine-specific DNA modification
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00410"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87171"
FT                   /db_xref="GOA:A3U4K4"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4K4"
FT                   /protein_id="EAP87171.1"
FT                   /translation="MLDLTKITTSLTLSKEVTHTDAKKEPLHNWFPYLEGFSETFIENI
FT                   LNSMSESPKFLYEPFSGSGTVPVFSKRNGIHCLYSEVNPFLLELTDLKISTFDLTDIDK
FT                   ASFKKELYTISQNIETILNNTTENKNLKEYYDKVFGRSIYFEKENFSAVLKLSNYIKSI
FT                   DNKNTKQFLRIAVCNCLLPASLLKRAGDIRYKRGKEKNNIPSIITLLKAKLLVIADDLN
FT                   EVNSSENKITLERNTNAKVYMNGYEEKIDAIITSPPYLNGTNYIRNTKLELWFLGYLKE
FT                   KKDLSRFRKEVVTAGINDVSKEEKKIIIPFIQDILDNKDLWYDKRIPKMITDYFFDMKI
FT                   VIENFYKYLKKGGKVFLDIGDSVYANQHIPTDLILIELFKNEGFTIIDNLKLRDRRSKS
FT                   GRIVKQCLIVAEK"
FT   gene            110086..111210
FT                   /locus_tag="CA2559_00415"
FT   CDS_pept        110086..111210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00415"
FT                   /product="adenine-specific DNA modification
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00415"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87172"
FT                   /db_xref="GOA:A3U4K5"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4K5"
FT                   /protein_id="EAP87172.1"
FT                   /translation="MIDLKKWDDFKIRPPFKEAPFNKRNWGNKQHSLCSFYGKLKPAIS
FT                   HHLVDTFSSEGDNVFDCFTGSGTIPFEASLNNRKSYALDINPISITLTTAKIQNQSKEG
FT                   CTKIFDELVDYLAQTNVLDDQLALAQDFGFNKSLIEYYHEETLKEICIARKFFMTYANK
FT                   DANYHYVLSALLHILHGNRPYALSRRSHSITPYSPTGIYEYKSLTEKLYEKMSRSFLEV
FT                   KSDNFIEGNVYEQDILEPWNDEINNIDAIITSPPFFDSTRFYLVHWLRSWFLGWEKNDF
FT                   DIKKQNFVGEKQKKNFQLYDSIFQQSKERLSKNGVVVFHLGKSKKKNMGQELEALAKSY
FT                   FKNIELFDEDVTLLEKHGIKDKGTVSAHQYLVMY"
FT   gene            complement(111207..112661)
FT                   /locus_tag="CA2559_00420"
FT   CDS_pept        complement(111207..112661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00420"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87173"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4K6"
FT                   /protein_id="EAP87173.1"
FT                   /translation="MAKQKKYGFRTPIRRTTKNITGNKVGGVLTGSEAEIKYSKKIIID
FT                   KTLTIHYKIPKELAVSLFNSNIGIAALGGYFLSSKDIKILFSLNVSGNESKIEYNLSAN
FT                   RYESIGHDLEVDLDEDFSVINASIVFECSERVSVNYTHFGIGFVNKDAYIESEEAYRHY
FT                   SNSKKRICFPEQFYFDNYVEFDNSSEGSIILTKSCNRCQRFLPINPFNQRQQLAFSNHC
FT                   TTKAPCTHKGFSIYNIVSNNISEDSLISFQKKLLDKGYSFEDGNLISYFGHQLECKACK
FT                   KFFVNAALNHLRSSSQHREDSLRRRAFELLSCRLLDRKWIYHEFRKNTGKEFDKYIFDK
FT                   FEKSCFKCGVAIKSSKKMHLDHTMPLSHLYPLDESATCLCASCNLAKSDMFPIDFYTEN
FT                   ELERLSVLTSLPLELLKSRSPNELVITELKNKILWFIDDFLNHPEYIKLRDGKKAADSI
FT                   LHSVNKAVSKSSNPFNIINIYNEAKG"
FT   gene            complement(112661..112864)
FT                   /locus_tag="CA2559_00425"
FT   CDS_pept        complement(112661..112864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00425"
FT                   /product="transcriptional regulator, XRE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00425"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87174"
FT                   /db_xref="GOA:A3U4K7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4K7"
FT                   /protein_id="EAP87174.1"
FT                   /translation="MEDLLQHFGNNIRRLRKEQGFSQEELAHKADLHRTYIGMIERAEK
FT                   NITLLNIGKISKALDVEIKELF"
FT   gene            complement(113071..113967)
FT                   /locus_tag="CA2559_00430"
FT   CDS_pept        complement(113071..113967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00430"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87175"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4K8"
FT                   /protein_id="EAP87175.1"
FT                   /translation="MYDTIKSKTIIDNLPKVFFANKLQNVDWAGFLWRPIQNKKANVIG
FT                   FQSELQNIHLKLYGSELQIENSLQKFFMGNNYQDFTFTQVLTALDTLNNHLPVNIYKTS
FT                   LSRADVGVVINHDTIKETDRWIDYKSTLPIPMIKGNVIYGKEIRKTNYKFKAYNKTFEA
FT                   KKTADVKLEEQLMRVELKGNYRYFNNRANPLGIYSVQDLIDPIKYNLLANELLNFYANI
FT                   NKKTNLDFSNWSAKETRLYGYMNYADSAQAMKLHHKETHKKERGQYLKLLSKYKDAEQE
FT                   RSVLNKLKAKVDFSIRN"
FT   gene            complement(114026..114310)
FT                   /locus_tag="CA2559_00435"
FT   CDS_pept        complement(114026..114310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00435"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87176"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4K9"
FT                   /protein_id="EAP87176.1"
FT                   /translation="MEAIILSKDQYQELIGRIDEINSKIADASKKPEDTFLDNADFLQL
FT                   MHISKRTAQTWRDEGKISFSQIGNKIYYRMSDVQTLLNKNYNKAFKKAR"
FT   gene            complement(114417..116462)
FT                   /locus_tag="CA2559_00440"
FT   CDS_pept        complement(114417..116462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00440"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87177"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4L0"
FT                   /protein_id="EAP87177.1"
FT                   /translation="MFNKPINNIVKAHFETMRKTAKEKAEKDFNDKILNEIDGLDDFEK
FT                   LKVCVVENEKNKALKKQDPHPYYINNSDDWLLTQFANRHFLLNVDETDEFIQSVYLGDY
FT                   GKLIFDKIDELLKHIPKLTYKDFLAGVQCQYLETFEHYYNIEEEDYYKISKWQMNALLD
FT                   IVEYDVNNCIKAYQEHCATIRNPINFISNELSILEEVLTETINDTSVLKQILSKLYIFK
FT                   NNEISKYDNDLLLENYPLFFNDENNYRKLNPDNLKEPLNKISNNAKSIVSNELTIFYVL
FT                   DTVLKWMKSIIKGKSIYEPFEYIDLKEKIKEVRIETEKEYQKEIDALNEFCFNDESITS
FT                   EQKKEYLRAKFGDEIDAYNKIKDKRIFFFLRDENEALLIENLRFSYVVNNLLDEVLEEL
FT                   KTAYRILNVSWEITAIFYELFDSRTMYYKNDSGSHLIIHSLMNDMVLDKDDYNELHSSM
FT                   DVFFRRFQNDSVPLDIHFINHRNVHLRLFEKCISRLQKILDNAEPNNKVLYIQSRLKEL
FT                   KQRELTFRTIAERNKRLEGKEDKFPNLFKEFLSIEADFIRETSVIAPLSYLPENPKILI
FT                   DKPRLETFEDLLSTEKQTYVLQMLEDLSITVGGNYALSPKKLGAIRGVIEALREKKIIP
FT                   HLGLHKVYVMFADKINASKKSELDASNTSEDYKKDAIEYIKNNPLH"
FT   gene            complement(116466..117683)
FT                   /locus_tag="CA2559_00445"
FT   CDS_pept        complement(116466..117683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00445"
FT                   /product="tyrosine type site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00445"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87178"
FT                   /db_xref="GOA:A3U4L1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="InterPro:IPR035386"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4L1"
FT                   /protein_id="EAP87178.1"
FT                   /translation="MASVKIILRKDKIDKTGDAPLYLRVIKDRRTKFISLSLKLHPNEW
FT                   DDDKQKVKKNHQNSTRLNAYISKKVADAEGEIADLERRNQSTSARRIKEAIKGKPLINF
FT                   FDFAFDRCEKLKDTVTLSTYRSYKNNIEKFERFVGHRELMFDDITATTLKNYASYCSSK
FT                   LGNNNTTINYAFRILNLMFREAKREDLISNELAPFTKFKVKKNKTTKRYLNAEQFDAFM
FT                   NLEVPDKHKAQVIKDMFIFSVFSGGLRFGDVIELQWKNYDKKNHRITKTIRKTKRQHSI
FT                   RIGQKAIDILEKYASYDNSQNDIIFPFAKIDEQYFKDREHRSLITNRAISLSNMYLSRM
FT                   GKQLELPFNLSFHISRHTFATRALNNGMRIEHVSKLMDHTDIGITQVYAKIISSELDNA
FT                   VDKYIN"
FT   gene            118001..118597
FT                   /locus_tag="CA2559_00450"
FT   CDS_pept        118001..118597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00450"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87179"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4L2"
FT                   /protein_id="EAP87179.1"
FT                   /translation="MKKTLTTIIFLISITCFSQDLNKETHYYFQGNQITKTQFESFDNR
FT                   KIYTRTIENDSLIIEKIYLHKSIGKLDSIQLKQVTMFLTKIIGSEFNQEKKTMIHLYRE
FT                   NDKNIYSDSKYKKYWKWIKNNSKRYQSFLIGTKDSQIEPNKKKHIYLDQYDLIEKLFFQ
FT                   SSDFKINHILIKPNGEIYIYFGLNDILHALDWSVD"
FT   gene            119024..119980
FT                   /locus_tag="CA2559_00455"
FT   CDS_pept        119024..119980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00455"
FT                   /product="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00455"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87180"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4L3"
FT                   /protein_id="EAP87180.1"
FT                   /translation="MKTNQFGKKGWTPDNIHNLNGKTYVITGTTSGTGFEAAKILLSKG
FT                   AKVVMLNRNPEKAENTIITLKQELGNAIKVSNITMDLAKQVSVKNAAAEVLKTVSQIDA
FT                   LICNAAIAQVPKQTLTVDGWESQMGTNHFGNWTLQALLFPRIEKSNGRIVTVGSMGYNM
FT                   GIKTIKFDDLNWDKNYSPNGVYSQSKLAQIMCVYELQDRLKEAGITNVKAYACHPGASK
FT                   TSLIKTSGSLMTRFVWQLMKFSPLVQSAEKGAYPQLMCATEPNLDQSEFYGPTGKNNWT
FT                   GPVGAHKLEPHAKDKTVAKKLWEVSEKETGVKWNINS"
FT   gene            120006..120617
FT                   /locus_tag="CA2559_00460"
FT   CDS_pept        120006..120617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00460"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87181"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4L4"
FT                   /protein_id="EAP87181.1"
FT                   /translation="MNTIKYITIIALLTSLGLFSQERNWTTEKSKDGKTVVNYELVKEY
FT                   NGTHFYYIAQTTANVSLEELDAYFSNTDNHKYFIERTTTTEEFKKISDNQWLAYYFFDA
FT                   PWPLPNSDLVIELSRTKIDDDKLIFTAVSVKNDYKKSDVDRMKTYKVIYEFEKISDSTT
FT                   KITYNADYIPIGSIPNFLIRSWFPEGPANIVTNLGTLKKN"
FT   gene            120627..121538
FT                   /locus_tag="CA2559_00465"
FT   CDS_pept        120627..121538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00465"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00465"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87182"
FT                   /db_xref="GOA:A3U4L5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4L5"
FT                   /protein_id="EAP87182.1"
FT                   /translation="MQHFKTLSSYLDYLGLPRPEHPMLSVFNSKGSGYLPCPRESSPPI
FT                   TNDCYSISFKKYVEGDLNYGRTKYDFTNGALICIAPRQVLQWDDSVVFEQKGFSINVHE
FT                   DFLKGTELAQQLKKYGFFSYSVNEALHLSPKEEKQIESIVENIDIEYQNNQDEFSKDII
FT                   ISQLSTLLKYANRFYERQFLNRKELSNNLLEQFNKQLDVYFNSGQLPEKGIPSIENIAD
FT                   KLSVSQRYLSDTLKKETGKTSTEHLQLYLIDEAKNILLNPNKTISEVAYDLGFEYPPYF
FT                   SRLFKKKEGISPTEYREKYKLN"
FT   gene            121542..122078
FT                   /locus_tag="CA2559_00470"
FT   CDS_pept        121542..122078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00470"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87183"
FT                   /db_xref="GOA:A3U4L6"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4L6"
FT                   /protein_id="EAP87183.1"
FT                   /translation="MDLLKLATDWAKAEVFSTKFFILFAFAFLIASIGFWQLGKTEIAR
FT                   AYIMPTLVAGILLLIIGSGLLYTNIQRVSQFEKEYHANAETFLDSEISRSEATLKEYRT
FT                   IVFKVIPIIIIVAALLIIFLSTPTWRAISITTIAMLIVILLVDGTAHSRIEAYYKKLKL
FT                   VEVNTANINSPAVKN"
FT   gene            122277..122606
FT                   /locus_tag="CA2559_00475"
FT   CDS_pept        122277..122606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00475"
FT                   /product="transcriptional regulator, ArsR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00475"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87184"
FT                   /db_xref="GOA:A3U4L7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4L7"
FT                   /protein_id="EAP87184.1"
FT                   /translation="MGLAKTEIFTDLQNEIARYAKVFGHPARVAILEHLYKIDTCVCGD
FT                   LVQEIGLAQPTISQHLKELKHLGLIKGQVEGTSVCYCIDAENWAKMKSIMFTFLNQDVS
FT                   KSNCC"
FT   gene            122661..123131
FT                   /locus_tag="CA2559_00480"
FT   CDS_pept        122661..123131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00480"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87185"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4L8"
FT                   /protein_id="EAP87185.1"
FT                   /translation="MTLSEIKSALQTLETISFKLPDGSLVPSHFHVTEVGKVTKHFIDC
FT                   GGTVRHEEVVNFQLWNADDYNHRLHPEKLVHIIELSETKLGIDENLPIEVEYQGDTIGK
FT                   FGLEFVNNSFQLTTTQTDCLAKDQCGIPEEKPKLKMSELQAENSCAPGSGCC"
FT   gene            123150..123770
FT                   /locus_tag="CA2559_00485"
FT   CDS_pept        123150..123770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00485"
FT                   /product="probable arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00485"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87186"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4L9"
FT                   /protein_id="EAP87186.1"
FT                   /translation="MSLYTPISNFLETLDTTTIATERKEGLNKLADFLQQQLKENKEAN
FT                   ITFICTHNSRRSHLSQIWAQTIAQHFNFKTITSYSAGTEATALFPTVLETLRNTGFKIE
FT                   NLSNAENSHYSIKYSENSHPIIGFSKTLDNSFNPESGFAAIMTCSQADGGCPFIAGAAL
FT                   RLPLTYEDPKAFDNTPQQEEKYLERSKQIATELFYVFTQLKTA"
FT   gene            123770..124819
FT                   /locus_tag="CA2559_00490"
FT   CDS_pept        123770..124819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00490"
FT                   /product="Arsenical-resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00490"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87187"
FT                   /db_xref="GOA:A3U4M0"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4M0"
FT                   /protein_id="EAP87187.1"
FT                   /translation="MSQTKKLSLLDRYLTVWIFVAMAIGVAIGYFSPTFPKFVNSFNSG
FT                   TTNIPIAIGLILMMYPPLAKVNYSLLPKVFKDTKILTTSLLLNWIIGPILMFVLAITFL
FT                   SDYPEYMVGLILIGLARCIAMVLVWNDLAEGSSEYGAGLVALNSIFQVFAYSFYAWIFI
FT                   TVLPPYFGFDGAIVNISIATIAESVAIYLGIPFVMGILSRVILVKLKGETWYTEVFIPK
FT                   ISPLTLIALLFTIIVMFSLKGELIVKIPTDVLIIAVPLLIYFTLMFIIGFFFTKASGAS
FT                   YDKTASVAFTAAGNNFELAIAVAIAVFGLNSGQAFAGVIGPLVEVPALILLVRVSFWLR
FT                   KKYFPKIKN"
FT   gene            124922..125695
FT                   /locus_tag="CA2559_00495"
FT   CDS_pept        124922..125695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00495"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87188"
FT                   /db_xref="GOA:A3U4M1"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4M1"
FT                   /protein_id="EAP87188.1"
FT                   /translation="MIAAVTLFLIVSISALITKIAAIALVHTGLSTESAKFQARSAYTG
FT                   TGMSTNETESIMNHPVRRKIIYNLMLIGNAGIVTAMSSLILTFVLPETIASRLYGLLII
FT                   VIGMLLIWLAVRSKWVNRGLSNIINKMLKRYTDLEIQDYAAVLHLKDDFKVIEANVDSD
FT                   GWMCNRTLQELNLREEGITILGVDRKDSGYYGSPSGEFKMLANDTVTIYGKSDGIQSLY
FT                   NRKKDFYAQEEHEKYVVKEEQRKAVEKFKIESKPD"
FT   gene            125843..126847
FT                   /locus_tag="CA2559_00500"
FT   CDS_pept        125843..126847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00500"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00500"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87189"
FT                   /db_xref="GOA:A3U4M2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4M2"
FT                   /protein_id="EAP87189.1"
FT                   /translation="MKIIPQLILLLQDTPKDETGEIDVNPQSIIEKLDTWLDGFIKALP
FT                   NILVGIAVFVIMLYLGRWIGKLVKRGLKNKGRRNFGDLLGAFTRYLITIAGIALALTIM
FT                   APNLSPADLIASLGVSSVAIGFAFQDILQNWLAGILILLRQPFEIGDQIEVNGYEGTVE
FT                   KVQVRSTIITTYDGQRVVIPNNTVYNNSVKVKTAHDYIRSQYDVGVGYDENYMEAMKIL
FT                   KNTVTSIEGVTSEKPVETLVWDQADSWLTIRVRWWTKSDRASVVHTWSKVLHDTQKAMD
FT                   DAGIDLPFPTQVEVQNAHDLKEAREDKDKDRELHKSTMSKKAEEAKKASEEEK"
FT   gene            complement(126901..127677)
FT                   /locus_tag="CA2559_00505"
FT   CDS_pept        complement(126901..127677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00505"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87190"
FT                   /db_xref="GOA:A3U4M3"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4M3"
FT                   /protein_id="EAP87190.1"
FT                   /translation="MYKVQSYQVAQGINIKMVRAKLNYTLLFAEADELFYQINDYQYLS
FT                   IFQFGIVSFFNVSDTEIKTIKHQIKNFGRGHVKDSLTEDIVVKITPNLLKVSFNAVELP
FT                   SLEDEMIRLVMLHTSQSVALDRYSEITEALLDEANVHSEELERSGRLKISSKNLKKFIG
FT                   KTLNLKNRISENLYIFDSPDVTWEDEQLATLDYHLKQTFDLKNRYFAIEKRITIIKENL
FT                   ELFKGIWDHRESSTLEWIIIILIVIEVIDMFVLKFF"
FT   gene            complement(127795..129327)
FT                   /locus_tag="CA2559_00510"
FT   CDS_pept        complement(127795..129327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00510"
FT                   /product="putative carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00510"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87191"
FT                   /db_xref="GOA:A3U4M4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4M4"
FT                   /protein_id="EAP87191.1"
FT                   /translation="MDISKIENIELQYLTIQDYEALKEATLQSYGGIPNSYWKLEEIGK
FT                   LISIFPEGQVIIKIDGKIAGCALSIIVDYDKIENQHTYDDITSDPTFKIHDKDGDVLYG
FT                   IDVFIKPDYRGLRLGRRLYDYRKELCETLNLKSIVFGGRMPNYHLHADKFSPKQYLDKV
FT                   KRKEIEDPVLNFQMSNDFHPVRILKGYLEGDQASGEFAVLMEWDNIYYTKPSKAVSTNK
FT                   SVVRLGLIQWQMRPYNDLDELLHQVEYFVDSVAGYRSDFAVFPEFFNAPLMAKYNDLGE
FT                   AEAIRELAKYTKEITNRLSELAISYNINIISGSMPEVKRNKLYNVGYLCRRDGSVERYE
FT                   KIHVTPDEAKVWGMQNGNKLKTFDTDCGKIGILICYDSEFPELSRLLSDEGMDILFVPF
FT                   LTDTQNGYSRVRLCSQARAVENECYVAIAGSVGNLPNVHNMDIQYAQSAVFTPCDFSFP
FT                   SNGIKAEATPNTEMILVADVNIDLLRELHNFGAVKNLKDRRKDFYTLERKKK"
FT   gene            complement(129494..130468)
FT                   /locus_tag="CA2559_00515"
FT   CDS_pept        complement(129494..130468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00515"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87192"
FT                   /db_xref="GOA:A3U4M5"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR036982"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4M5"
FT                   /protein_id="EAP87192.1"
FT                   /translation="MSNNKPISNFIEKYFLHFNAASVVDAAKGYETKLNEGSKMLVSLA
FT                   GAMSTAEIGKIFAEIIRQDKVHIVSCTGANLEEDLMNLVAHSHYKRIPNYRDLTPQDEW
FT                   DLLEKGLNRVTDTCIPEEEAFRRLQEHIVKIWKDAEAKGERYFPHEYMYKLLLSGVLEE
FT                   YYEIDLKDSWMYAAAEKNLPIVVPGWEDSTMGNIFASYVLKGELKASTVKSGIEYMTFL
FT                   ADWYTENSKNGIGFFQIGGGIAGDFPICVVPMLYQDMERTDTPFWNYFCQISDSTTSYG
FT                   SYSGAVPNEKITWGKLDIDTPKFIIESDATIVVPLVFAYLLEM"
FT   gene            complement(130458..131408)
FT                   /locus_tag="CA2559_00520"
FT   CDS_pept        complement(130458..131408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00520"
FT                   /product="arginase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00520"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87193"
FT                   /db_xref="GOA:A3U4M6"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4M6"
FT                   /protein_id="EAP87193.1"
FT                   /translation="MSTTKNYAGIPDEFANAETSKIVLIPVPYDGTSTWGKGADKGPEA
FT                   FLHASEQMELYDIETETEVYKQGVYLADPVTESETPKKMAKAVHDITKGHIKRNKFVTL
FT                   FGGEHSISIGAIRAFNECFEDLTVLQIDAHTDLRKKYEGSKYNHACAVYEANETTNLIQ
FT                   VGIRSMDIAETTVMNKDNVFFAHDMATDDYWMDNAVELMTDNVYITFDLDAFDPSIMPS
FT                   TGTPEPGGLLWYETLEFLKKVFTEKNVVGFDIVELCPNKNDKSSDFLAAKLYYKMLTYK
FT                   FENEAIDAAFDHESEYNASQKKQLSNKTQHDDYEQ"
FT   gene            complement(131411..132871)
FT                   /locus_tag="CA2559_00525"
FT   CDS_pept        complement(131411..132871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00525"
FT                   /product="putative arginine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00525"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87194"
FT                   /db_xref="GOA:A3U4M7"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4M7"
FT                   /protein_id="EAP87194.1"
FT                   /translation="MKTKYIDLIDQSFYFPQEEFKLNKNNLEFHGIDLMKLISEYGAPL
FT                   KFTYLPKISDNINRAKEWFRVAMKEHNYKGKYHYCYCTKSSHFQYVLHEALKNDIHIET
FT                   SSAFDIDIVESLKEQGKIKNDTFVICNGFKRDQYLENIARLINNGHENCIPVIDNYEEL
FT                   NLLGDVITKKYNIGIRIASEEEPKFEFYTSRLGIGYKNIVPFYNNQIKDNPQVNLKMLH
FT                   FFINTGIRDTAYYWNELVKCLKVYVSLKKICPTLDSLNIGGGFPIKNSLAFEYDYQYMI
FT                   SEIINQIKQVCDEADVPVPNIFTEFGSFTVGESGGAIYEVLYQKQQNDREKWNMINSSF
FT                   ITTMPDTWAINKRFVMLAVNRWNEEYERVLLGGLTCDSDDYYNSEQHMNAIYLPKYKKD
FT                   KPLYIGFFNTGAYQETIGGFGGLHHCLIPQPKHLLIDKDEEGNITTSVFSEQQTSEQML
FT                   SLLGYGNAQQTDNNNKSTTNFASKAYFL"
FT   gene            complement(133527..133625)
FT                   /locus_tag="CA2559_00530"
FT   CDS_pept        complement(133527..133625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00530"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87195"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4M8"
FT                   /protein_id="EAP87195.1"
FT                   /translation="MGTQKQSMKPQPKKAQPKKVETKAPQVTSKKK"
FT   gene            complement(133836..134381)
FT                   /locus_tag="CA2559_00535"
FT   CDS_pept        complement(133836..134381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00535"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87196"
FT                   /db_xref="InterPro:IPR021782"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4M9"
FT                   /protein_id="EAP87196.1"
FT                   /translation="MKRNSYLVLALGLFLVMSCKNNSKDTDTPETVTVNTTAKEIHKAA
FT                   PTTVEFSSDEVAIAYSGYNAIKTALVNTNFSEAKSKAETSLDTLRKTELKSGYIDALAL
FT                   LAVEDNIDGQREAFEAVTQEMTNLVEGNIATGKLYYQYCPMAFNNKGAYWLSNEEAIRN
FT                   PYFGDKMLKCGLVERDIE"
FT   gene            complement(134416..134850)
FT                   /locus_tag="CA2559_00540"
FT   CDS_pept        complement(134416..134850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00540"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87197"
FT                   /db_xref="GOA:A3U4N0"
FT                   /db_xref="InterPro:IPR026414"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4N0"
FT                   /protein_id="EAP87197.1"
FT                   /translation="MKTLIKLVCIGFLLVCLAAIRFFETSLFYDPLLNFFHSDYLKGVT
FT                   PEFHFGKLVGYTILRFLLNTAISLLILYVAFKDSSVLKFSALLYTIVFVALISVFCIML
FT                   LQVEQIDNFMPLFYVRRFLIQPVMVILLLPAFYYYKRQHD"
FT   gene            complement(134847..135461)
FT                   /locus_tag="CA2559_00545"
FT   CDS_pept        complement(134847..135461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00545"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87198"
FT                   /db_xref="GOA:A3U4N1"
FT                   /db_xref="InterPro:IPR019127"
FT                   /db_xref="InterPro:IPR026323"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4N1"
FT                   /protein_id="EAP87198.1"
FT                   /translation="MSNIFVETDVLICNNYVLICDTMRELFGKYKSVIRFILTFLGSYF
FT                   LLALVYQGYLKFGASDVYYPDYITHLVAQQSEAVINAFGYESVVEPHPDEASMKLYING
FT                   NYLARVVEGCNAISVMILFVAFIIAFFDTWKSTLLYILAGTALIYGLNIFRIAFLCIGI
FT                   FEYPEQYHLLHGILFPLVIYGIVFLLWLVWVNRFSRKKVNT"
FT   gene            135427..135909
FT                   /locus_tag="CA2559_00550"
FT   CDS_pept        135427..135909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00550"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87199"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4N2"
FT                   /protein_id="EAP87199.1"
FT                   /translation="MSTSVSTNILDNLKLEVETIIDNKNLSVDHRLTQICEALESKVDY
FT                   YDWVGFYFKNGDKPELKLRAYAGEETDHKIIPFGKGICGQVAVSNENFVVPDVKAQDNY
FT                   IACSIFVKAEIVIPLFVNGENIGQIDIDSHTADPFTDADTDFLVWVNKKVAELLEA"
FT   gene            complement(135925..137178)
FT                   /locus_tag="CA2559_00555"
FT   CDS_pept        complement(135925..137178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00555"
FT                   /product="ABC transporter efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00555"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87200"
FT                   /db_xref="GOA:A3U4N3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4N3"
FT                   /protein_id="EAP87200.1"
FT                   /translation="MLIYFRVLKESFNFAINALRNNMLRTFLSLLGVTIGIFSIIGVLA
FT                   AVDSLKQEITGSLSSLDNSTMYVMRFSFGPTEIPQWKREQFPDVTYEEYQYLKRNVSDI
FT                   EAITYTLNVAPETLKYQDNSVSSVNLAPVTDEYYDIEALQIAKGRFFNEQESNSGSPVI
FT                   VIGDEIANNLFGNFDPIGKQIRVYGQKLTVVGVLKKEGSGLFGDSKDTAAMLPVNLVRR
FT                   VFGDNNKSVFPAIILKPEPGVDIPEFTALLGQQMRRKRGLKPDEIDNFFVNQLQGFADF
FT                   IDNITGQMNIIGLIISGFSLLVGGFGIANIMFVSVKERTNLIGIQKSLGAKNRFILYQF
FT                   LFEAVILAVIGGLVGLFFVWIISLIASSFTGDFEFVLSPFNMFIGTAISAVIGLVSGIV
FT                   PAVSASKLDPVEAIRTGM"
FT   gene            137372..138904
FT                   /locus_tag="CA2559_00560"
FT   CDS_pept        137372..138904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00560"
FT                   /product="bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00560"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87201"
FT                   /db_xref="GOA:A3U4N4"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4N4"
FT                   /protein_id="EAP87201.1"
FT                   /translation="MSHTKKATSALISVFHKEGLEPIVRKLNDLGVTIYSTGGTEKFIK
FT                   GLGINCVAVEDVTSYPSILGGRVKTLHPKVFGGILNRQDNESDVAQMTEFDIPQLDIVI
FT                   VDLYPFEKTVASGASEQDIIEKIDIGGISLIRAAAKNFKDVICVSSMEDYSEFLDVISN
FT                   GNGETTLADRKRFAGKAFNVSSHYDSAIFNYFNSEHDVPALKISETKGKALRYGENPHQ
FT                   KGFFFGDFDAMFDKLHGKELSYNNLLDVDAAVNLMNEFNGDAPTFAILKHNNACGIAQR
FT                   DTVLNAYKDALAGDPVSAFGGILISNSEIDVATANEIHKLFCEVVIAPNFSKDAEKVLK
FT                   GKKNRILLIQKEAKLPETIVRTCLNGALVQDRDHITDAKENFSYATDTKPTEEQIEDLL
FT                   FASKICKHTKSNTIVLAKNKQLCASGTGQTSRVDALRQSIEKAKSFDFELDGAVMASDA
FT                   FFPFPDCVEIADQAGISAVIQPGGSIKDQLSIDYCNDHKIAMVMTGTRHFKH"
FT   gene            138945..139973
FT                   /locus_tag="CA2559_00565"
FT   CDS_pept        138945..139973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00565"
FT                   /product="putative rod-shape determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00565"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87202"
FT                   /db_xref="GOA:A3U4N5"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4N5"
FT                   /protein_id="EAP87202.1"
FT                   /translation="MGLFDFLTEEVAIDLGTANTLIIHNDKVVVDSPSIVARDRTTGKI
FT                   IAVGREAAMMQGKTHENIKTIRPLKDGVIADFDASEQMIKMFIQEIPALKKKFFRPDLR
FT                   MVICIPSGITEVEMRAVKESAERVKGKEVYLIHEPMAAAIGIGVDIMQPKGNMIVDIGG
FT                   GTTEIAVIALGGIVCDKSVKIAGDVFTNDIVYYMRTQHNLYVGERTAEKIKIQIGAATE
FT                   DLEVPPEDMSVQGRDLLTGKPKQVQISHREIAKALDKSILRIEDAVMETLGQTPPELAA
FT                   DIYNTGIYLAGGGSMLRGLDKRLSQKTDLPVYIAEDPLRAVVRGTGITLKNLSRYKGVL
FT                   LK"
FT   gene            140042..140815
FT                   /locus_tag="CA2559_00570"
FT   CDS_pept        140042..140815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00570"
FT                   /product="rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00570"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87203"
FT                   /db_xref="GOA:A3U4N6"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4N6"
FT                   /protein_id="EAP87203.1"
FT                   /translation="MFAISLAFTVESHSYHKSKWISSTNFLSGNVFGFGSSIDSYFNLR
FT                   DVNTTLVKENQQLRLQLERFKSIPIDTSFTDTATYNSPYKFYNATVIANSFSKKDNYIL
FT                   INKGQKDSIKPDMGVITPNGLLGIIENTSSNYSRIISILNSNLEINVGLKKSDHFGTLS
FT                   WNGESPYKAQLIDVGRLAPVKVGDTIITSGNSSIFPKGIPVGKISDFSLDQSKSYYKIN
FT                   VELFNDMTGIGPVYVIENLMKPELDSLKNSTILNE"
FT   gene            140808..141311
FT                   /locus_tag="CA2559_00575"
FT   CDS_pept        140808..141311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00575"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00575"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87204"
FT                   /db_xref="GOA:A3U4N7"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4N7"
FT                   /protein_id="EAP87204.1"
FT                   /translation="MNNPFIHIVRFVVLILLQVLLLNDINFLGYINPYLYILFIILLPA
FT                   GINQTRLLFFSFLLGITVDMFEDSGGMHACACLLMAYVRPLILRFSFGLSYDYQTLKFS
FT                   KTPFGSRLTYITLMVLVHHLTLFSLEIFNASHILSILKNTLFSGVFSILVIIITTTLFS
FT                   KKRT"
FT   gene            141308..143176
FT                   /locus_tag="CA2559_00580"
FT   CDS_pept        141308..143176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00580"
FT                   /product="putative penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00580"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87205"
FT                   /db_xref="GOA:A3U4N8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4N8"
FT                   /protein_id="EAP87205.1"
FT                   /translation="MRKLLLFSIIIITGFVFLGRLFYLQIFDDSFQALSANNALKVVYD
FT                   YPQRGYIFDRDGKLLVANQPSYDVMVIPRNVKPFDTLELCNILSITKDQLEERLTKAKI
FT                   WSPRLSSVVVPQLTKKEYAFLQEKMRKFTGFYIQKRSLRDYKIDDAANVLGYIAEVNNG
FT                   DIKKNPYYQSGDLIGKQGVEEQYEEILRGKKGVKYIQKDRFNRDIGPYKEGVYDTLPVK
FT                   GKDLTITIDSKLQDYAEQLMVNKRGGIVAIEPSTGEILALVTAPNYDPSMLVGRKRSRN
FT                   YTKLYYDSISKPLFDRGLQGEYPPGSPFKALTALIGLEENVVDTKERFSCHMGYSYGKR
FT                   GHMGCHSHASPLSMIPGIANSCNAYFANVYRRTIEKYDTPQEGIDRWKKHLSSFGLGNY
FT                   LGTDLPIGKKGLVPDSDFYNRAYRYPTYKWYATATLSNAIGQGEVLMSPIQLANMMAAI
FT                   ANRGWFYTPHILKEVNGKPIEDSNYTEKKYTTVSPENFEPVIEGLHDVYNYGTANFLKV
FT                   PGIEICGKTGTAENFTKIDGKKTQLTDHSVFIAFAPKENPKIALAILVENGYWGARYAG
FT                   RIASLLIEKYLKGEITRTDLEKWVLENSLQDEYAKPVSGEPFKINQ"
FT   gene            143176..144429
FT                   /locus_tag="CA2559_00585"
FT   CDS_pept        143176..144429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00585"
FT                   /product="putative transmembrane rod shape-determining
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00585"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87206"
FT                   /db_xref="GOA:A3U4N9"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4N9"
FT                   /protein_id="EAP87206.1"
FT                   /translation="MLRSIANFDWITILIFFVLVGFGWGNIYSASLSDAATGYLDLGQP
FT                   YGKQLLFIILSVFLIIIMLSIEAKFYEKFSGVIYIIALLSLIGLFVFGKTISGATSWYS
FT                   FGSFSLQPSEFAKAATALALAKYISDIETNVKNIKHQLKAFVIIALPALIIIPQPDPGS
FT                   ALVYAAFFFPLYREGLSGVYLAVGISAITLFVTTLLIGPLMVSICTATLLILIFLFNRK
FT                   RKPKLSHYLGLLIISVGLAYSVSYIFNNVFEQRHRDRFNIVLGKEVDSKGIGYNTNQSE
FT                   IAIGSGSWFGRGWTEGTQTKGNFVPEQHTDYIFSTVGEEWGFLGSTLVVVLFVALLLRI
FT                   IYLAERQKRQFNRIYGYSVAGILFVHFLVNIGMVTGIFPTVGIPLPFFSYGGSGLWGFT
FT                   ILLFIFIKLDSERLTFWS"
FT   gene            complement(144533..145084)
FT                   /locus_tag="CA2559_00590"
FT   CDS_pept        complement(144533..145084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00590"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00590"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87207"
FT                   /db_xref="InterPro:IPR025411"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4P0"
FT                   /protein_id="EAP87207.1"
FT                   /translation="MNSFKLLVLGVFVLVLSSCSSVRVAADYDKDANFDSYNTFAFFKP
FT                   GIDKAEINDIDKKRILRAIEAELTAKGFAKSENPNMLVSIFTKTKENVNIYNNNLGYGG
FT                   WYGWGWQPFYWGTGYNTVSSTTEGTLYIDFIDADRKELVWQGMGSAALVTSNNIERKEE
FT                   RIKEIVKEIIERYPPGSFKN"
FT   gene            complement(145111..147099)
FT                   /locus_tag="CA2559_00595"
FT   CDS_pept        complement(145111..147099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00595"
FT                   /product="urocanate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00595"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87208"
FT                   /db_xref="GOA:A3U4P1"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4P1"
FT                   /protein_id="EAP87208.1"
FT                   /translation="MTFKDEILQGIPEHLPAPKHYDATVNHAPKRKKILTAEEEKLALK
FT                   NALRYFEAKHHKTLLPEFKQELEKYGRIYMYRFRPDYKIYARPIEEYPGESEQAKGLML
FT                   MIQNNLDHAVAQHPHELITYGGNGAVFQNWAQYRLVMQYLATMNNEQTLVMYSGHPLGL
FT                   FPSHKEAPRVVVTNGMMIPNYSQPDDWEKFNALGVTQYGQMTAGSYMYIGPQGIVHGTT
FT                   ITVLNGFRKINKETKGGLFVTSGLGGMSGAQPKAGNIAGCITVCAEVNPKATYTRHSQG
FT                   WVDEVIDDLNTLSQRVVKAKQNKETVSIAYQGNIVEVWEHFDKENITIDLGSDQTSLHN
FT                   PWAGGYYPVGLTYEEANNLMANKPEAFKEKVQESLKRQAKAINKHTEKGTYFFDYGNAF
FT                   LLEASRAGADVMSTEANKEFKYPSYVQDIMGPMCFDYGFGPFRWVCASGKSEDLQKTDA
FT                   IATKVLEQLMKEAPKEIQQQMQDNITWIKGAQKNKLVVGSQARILYADANGRMKIAEAF
FT                   NTAINNGEIGPVILGRDHHDVSGTDSPYRETSNIYDGSRFTADMAIHNVIGDSFRGATW
FT                   VSIHNGGGVGWGEVVNGGFGMLLDGSKEAANRLRSMLFWDVNNGIARRSWARNDEAIFA
FT                   IKRAMESEPNLKVTLPNLVDDHLLNSL"
FT   gene            147355..147678
FT                   /locus_tag="CA2559_00600"
FT   CDS_pept        147355..147678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00600"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87209"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4P2"
FT                   /protein_id="EAP87209.1"
FT                   /translation="MIVIVNRFLLREGFNGITLWPFIILRSNSLKNDPILLNHERIHLR
FT                   QQLELLIVFFYVWYAVEFLLKWYKYGNRLIAYKNISFEREAFTNEANLSYLKNRGLWRF
FT                   WKY"
FT   gene            complement(147685..149172)
FT                   /locus_tag="CA2559_00605"
FT   CDS_pept        complement(147685..149172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00605"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87210"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4P3"
FT                   /protein_id="EAP87210.1"
FT                   /translation="MVNNYRLIIMLFIALLSYSSWSQVGINTTTPNNGSLLDVDARDKG
FT                   ILIPRINISDLSNIAPIAGLANALEISSAESLLVYNTNTSTGKGFHYWDGTTWIPLGDK
FT                   NLGKDDLTQSEEPRTYDMNGEDLNFTNGAFGINTPNPNGAFEATSTENYNAYTFTQDNS
FT                   LTGEKDVFTIEDQDVGGGGQDHSSVLKVLKSGNINTGDNGFSLIELANTGTNPGNNKYW
FT                   ISGRTTDEGAPLWGVDVTDNDYWSDGGITLGVTTNSNGTYSNGNFRVDSNGDTGIKNTN
FT                   PQEALHISGANETIRIESLNEANNNININSIPEPVYVDNEGNLILQPTLTQVYMDQNNL
FT                   NFLGNGVFMETTGARITQLVFSTTITLLESSLVNITYSLPTIITPFGESSGIIQDGHPR
FT                   NFRSYIRVGTDANDALANDSDRYGYASAIFVNDENESGGNISISNGWYYIVGNGFVELP
FT                   AGTHTIQLMGEIIGGDFGFRATFGTSDYERFQVIVHR"
FT   gene            complement(149338..150168)
FT                   /locus_tag="CA2559_00610"
FT   CDS_pept        complement(149338..150168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00610"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87211"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4P4"
FT                   /protein_id="EAP87211.1"
FT                   /translation="MSVFSQVGINTDSPAEDSILDIESTDKGILIPRINLPDANSISPI
FT                   TNIPEGNSEGLLVYNTNPGNEGFYYWKDNKWNGISGNTIGDIKNGFQIEDHGGWYILDG
FT                   RLISSLPPKAQAHAEAIFGVTATNLPDATDKFLKAKNGSETLASTEGSNTVSITQANLP
FT                   NYNLPTATTDVKGDHGHQYQDKGSDEIEVVVDLTFGDIMLTVAGIINVNLGPLLSSGTE
FT                   IYTEQVANKNSVSRNTASEGNHTHEVVVNSGGSNEPLNNVPSSLITNVFVYLGE"
FT   gene            complement(150363..150710)
FT                   /locus_tag="CA2559_00615"
FT   CDS_pept        complement(150363..150710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00615"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87212"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4P5"
FT                   /protein_id="EAP87212.1"
FT                   /translation="MLKKIFIVFILGFSLQSFSQINKALSEQLIENFTKSKNNSTIDKN
FT                   DNQTKIKRVNKGKTAILTPYNAKVHNAFIFEIKKSNKRHIPKLKSLSINEKLEKSQMKI
FT                   LSRILERKNSN"
FT   gene            complement(150713..152194)
FT                   /locus_tag="CA2559_00620"
FT   CDS_pept        complement(150713..152194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00620"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87213"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4P6"
FT                   /protein_id="EAP87213.1"
FT                   /translation="MKIKLQKYLIVTLLVLGVLPFTYAQVGINITDPNGGALLDVSSRE
FT                   KGVLIPRINITDLTTIAPISGLISFAEEMAAESLLVYNINDTTGRGFHYWDGTTWIPLG
FT                   DKNLGKDDLTQSEEPRTYDMNGEDLNFTNGAFGINTPNPNGAIEATSTENYDAYTFTQD
FT                   NSLTGEKDVFTIEDQDAGGGAQDHSSVLKVLKSGNINSGDNGFSLIELANTGSDPGANK
FT                   YWISGRKIDESAVLWGVDITDNDFWSKGGLTLGITENTNGTYSSGNFRVNSNGYTGINN
FT                   TNPLEALHISGTSETIRIESLNSTNNASNNGVDDAVVYVDSNGDLKIRPSLVQNSMPED
FT                   NLTTFIPASRDVTSSNGTLTQETLYTTSITLTQDALVEVVYQIGVNITDSSFNPITDGN
FT                   PRQYGTALFIDTNLVGYTSEAYTSRPSGLTASSRILSGTFFLNGNGYAQLTGSPAGTTY
FT                   DLSVIGFVAAGNGFGVNGEFGGNTGVDRFQIILHY"
FT   gene            complement(152383..155634)
FT                   /locus_tag="CA2559_00625"
FT   CDS_pept        complement(152383..155634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00625"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87214"
FT                   /db_xref="GOA:A3U4P7"
FT                   /db_xref="InterPro:IPR000998"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4P7"
FT                   /protein_id="EAP87214.1"
FT                   /translation="MKPRNFYFLIPFVVLLTYIFYYTNDTNSTSENINTKQEKNTYYER
FT                   ENLEDGDTFSIVAYDPSTGEIGSAGTSCVAQTIDFLGDLITNNSGAIIGGINTQAAYIA
FT                   QNQTIARNRMLAGDTPQEIVAYMAANDFQGNSSTRQYGVVGFDDFGNLTTAGLTGNGTG
FT                   SFADHITGVNYAIQGNILWDSDVLTDMETAFLNTNGTLADKLMAALKGAKRVGGDSRCD
FT                   TRGNSGRSSFIKVLRPGDSSPYIDITLGPVVDGVEPIDELECAFINATSPAICLQTVST
FT                   FPYVMDFEDFVWDKDISSCGSLNNNASWIRTQFATPSQNTGPATANQGEKYMFVESSDV
FT                   NSTSSFSKKAVIGSPCFQIPEFHSAQISFDYHMSGASMGTLNLTAQTSSGTEVIWTRTG
FT                   NQGANWVNDETVDLSDYAGRTVKFRFDATTGTSFTSDMAIDDIKITTVRVPINFEFDAG
FT                   VWTPNNPTLVDNPSTNIDNIEIVSGNPTFTNEVIANNVTISTGSTLDLGNATLSLSGNL
FT                   INNGSLNAGTGTLLLNGDSAQTVSGNAIALNNFTVASNSTKTLQTPVSISGTMNLSNGV
FT                   LNTNNQLSFLNTYDELSQTHTNGMLDEVTGGSIVGNVLVQRYFPAKRAYRLVASPVTTT
FT                   TTIRENWQTDGNVVQGFGTHITGAGGTTNGFDATGTNNPSIFTLNTVGQNYEVLPNTNA
FT                   NTLSVGNAYLLMVRGDRTIDLTDNNATPSNTILESIGELHIGNFNSPNISTVENGSSLI
FT                   ANPYQASVDMALVLQNTTNLNQRYYHVYDPTINSRGAFVTVDTQENTNSLTFGTGISLS
FT                   SANKFLQPSQAAFVNTVTNGAATLQFTEGFKDLSGNGTNVFFAELEQQSIGVALYNSED
FT                   ELKDGTRIIFSEEDTNAVTQLDAIKNPNLDENISTKIEEQEFSIQRRAFAIAEDEIEFS
FT                   ITNYREDNYKFKFQFEDLEPSTLVYLYDAYLNTQTPLNINGETIVNFNVNETNASRASD
FT                   RFKLVFQTNVLGANDINLNSSITISPNPASQFILISNPQSIGINSIVIYDLMGKQVIKR
FT                   TNGLNKIDISKLESALYLVEVNSTLGSFQKRLIVN"
FT   gene            complement(155667..156500)
FT                   /locus_tag="CA2559_00630"
FT   CDS_pept        complement(155667..156500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00630"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87215"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4P8"
FT                   /protein_id="EAP87215.1"
FT                   /translation="MKLILLFFIAAITFNSYSQVGIGTTDVNEDALLELDDANKGFLIN
FT                   RVSLNSRQDVVSVTPSATEGLMVYNTNNAGAGSDVVSPGFYFWNGSEWGKVFSEGYSRQ
FT                   FTQTETVRAEDQTTVYTLPGLDNDIVAPQSGTYQIYVIGYYAAGIRGNESNSYDANGTC
FT                   SVWLEIDDVKVAEAFIRSSSKRIRDDNTNSTRTFLALSRQGNIIYNVDLQEGQTYNFKV
FT                   RAKEWSQNNSDGPFSPTPNGRFGFWGLDSDLYQGSPGYTDTAARNMMTITLLRRY"
FT   gene            complement(156502..157323)
FT                   /locus_tag="CA2559_00635"
FT   CDS_pept        complement(156502..157323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00635"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87216"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4P9"
FT                   /protein_id="EAP87216.1"
FT                   /translation="MIMAPNITRYISVFSMLICFSFLSHSQVGINTDNPAPGALLDMNA
FT                   SDKGFLMTRVALVATDNQTPITPSPTTGLLVYNTATSGSGSTQVTPGFYYWDGTAWRRL
FT                   FNQGYTLQYKQTAARTVTTTGNTVITGLDTGNGFTVPFSGIYQVVIQVYYSCGAQSGTD
FT                   DAASQGSIGLWYNENGGGFQIPKEAYITSSSKYIGGTTFNHLGNQATIVHNLELSASSS
FT                   YRIVAVGREWLSVNTTERPVIGRQTNVTDYPGSSTDDAQLGTMTISLIKQY"
FT   gene            157564..158433
FT                   /locus_tag="CA2559_00640"
FT   CDS_pept        157564..158433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00640"
FT                   /product="putative D-cysteine desulfhydrase (DcyD)"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00640"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87217"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Q0"
FT                   /protein_id="EAP87217.1"
FT                   /translation="MINYQVLDLTKASTNLHGNKNFKLKLNLEKAKSTQKSTLISFGGA
FT                   YSNHISALAEIGKANGFRTVGVIRGEELGKNLQLTLSNNPSLQKAHLNGMHFKFISRET
FT                   YRQKNSSQFIKLLQNEFPNSYIIPEGGTNDLAVKGCEEILTQETSSFNFICCPVGTGGT
FT                   ISGIINASKSHQTVLGFPALKGDFLNSEIKKYTNKTNWRLITDYHFGGYAKINEALVTF
FT                   INNYKKSKNILLDPIYTAKMIFGLEDLIQLGYFPQNSRILAIHTGGLQGISGMNTLLSK
FT                   KGLPTIEI"
FT   gene            158437..159288
FT                   /locus_tag="CA2559_00645"
FT   CDS_pept        158437..159288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00645"
FT                   /product="hemagglutinin"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00645"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87218"
FT                   /db_xref="GOA:A3U4Q1"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Q1"
FT                   /protein_id="EAP87218.1"
FT                   /translation="MNFRVLVFFILSTFLLASCGSKKRVVTTKKEQKERQVYQEQPKNS
FT                   KNEPYEDTPAEIQDDVTKTIKEKTYKDKSSKYVADFAEIAMEEMRIYGIPASITLAQGI
FT                   LESGAGEGELTRKANNHFGIKCHGWKGGKVYHDDDKAQECFRKYYDAKYSFRDHSLFLT
FT                   ERKRYMGLFKLSKDDYKGWAKGLKEAGYATDPRYPNKLISLVERYKLYEYDAQVLGKTG
FT                   KDVKKVTENNNRYTVEKGDTLYRIAKKHNITVEQLKDFNGLTSNDISIGQVLYVKPLPK
FT                   DF"
FT   gene            159292..160572
FT                   /locus_tag="CA2559_00650"
FT   CDS_pept        159292..160572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00650"
FT                   /product="Glutamate-1-semialdehyde aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00650"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87219"
FT                   /db_xref="GOA:A3U4Q2"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Q2"
FT                   /protein_id="EAP87219.1"
FT                   /translation="MIYKRSSALFAEAQKVIPGGVNSPVRAFNAVGGTPIFIEKAKGAY
FT                   LHDADGNTFIDYIASWGPMILGHAHQPVIDAVVEKAKLGTSFGTPTEIETKIAELAVSM
FT                   VPNIDMIRFVNSGTEACMSAVRLARGFTGKEKIIKFAGCYHGHSDSFLIQAGSGAVTFG
FT                   SPNSPGVTQGTAKDTLLANYNDIEGVKTLIEANIGEIACIILEPVAGNMGCILPQDNFL
FT                   QKLRTLCDEHNILLVFDEVMTGFRLAKGGVQELYNVKADIVTFGKVIGGGLPVGAFAAR
FT                   KEIMNHLAPLGPVYQAGTLSGNPLAMAAGLAMLTEINTNTDLFKSLEDKTEYLHNGITE
FT                   ALEKNNITHTINRQGSMISVHFTDVNVTDFETAVKGNNDTFKRFFHHMLDNGIYIAPSA
FT                   FESWFLNDALSYEDLDKTIEAIASFKG"
FT   gene            complement(160691..162145)
FT                   /locus_tag="CA2559_00655"
FT   CDS_pept        complement(160691..162145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00655"
FT                   /product="putative plant auxin-regulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00655"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87220"
FT                   /db_xref="InterPro:IPR004993"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Q3"
FT                   /protein_id="EAP87220.1"
FT                   /translation="MELFIKYPNEVQHELLHQLLYKAKDTEMGKTYGFDTITNYKTFSE
FT                   RVPIQSYEQYTERIERSRSGENNIFWPTPIKWFAKSSGTTNAKSKFIPVSEDSLEDCHY
FT                   AGSKDLLCMYLNNNPEANLFTGKSLRLGGSKDLYKENGTVYGDLSAILIDNMPFWATYS
FT                   STPSNEISLMSDWETKMQAIVDETITQNVTSLAGVPSWMLVLLNNVLETTGKSCIHDVW
FT                   PNLEVYFHGGVSFEPYRDQYKAIMSSEKVKYYEIYNASEGFFAIQDKNDSRDLLLMLDY
FT                   GIFYEFIPMDSYGSEEESVIPLSEVELNKNYAIIVTTNGGLWRYKIGDTIRFTSLSPYR
FT                   IRVSGRTKHHINVFGEELIIENAEEALRKASQQTNCEIVDYTAGPIFMEGTEKGAHEWI
FT                   IEFKKAPESIEQFQKCLDDSLQTINSDYEAKRYNNMTLNMLTVHKAKDKLFYEWLKKND
FT                   KLGGQHKIPRLSNTRDYLDELLKMNI"
FT   gene            162249..163043
FT                   /locus_tag="CA2559_00660"
FT   CDS_pept        162249..163043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00660"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87221"
FT                   /db_xref="InterPro:IPR021246"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Q4"
FT                   /protein_id="EAP87221.1"
FT                   /translation="MQYQGVLTKMQTELASPVQYYLVFESSFIHMNQLIDKTLSIEFVR
FT                   YQCLACGKDKKIYRQGYCYDDFFNQPQAGDWIMKPELSTAHLDIEDRDLEYEKKVQLKP
FT                   HIVYLANSSNVKVGVTRKTQVPTRWIDQGAHEAIEIVEVPNRYLAGITEVALKEHVADK
FT                   TNWRSMLKNDIKDENLVTVRDHLKQYIPDEALPYFIESNSETNIDFPVVQYPEKVKSLN
FT                   LDKTPIFKGTLKGIKGQYLIFEDNTVFNVRNWEGYVVDLNIS"
FT   gene            163059..163868
FT                   /locus_tag="CA2559_00665"
FT   CDS_pept        163059..163868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00665"
FT                   /product="putative endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00665"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87222"
FT                   /db_xref="GOA:A3U4Q5"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="InterPro:IPR040255"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Q5"
FT                   /protein_id="EAP87222.1"
FT                   /translation="MNRKYIYPILTILAVSIIYIVNSYLDEKEREPLIKEAKELKETTN
FT                   SNFLPTSTTGAIVHHKYYSLSYSEDNEQAEWVAYELKKNHISRNDFKRPYFEVDNGVPT
FT                   VSADWRNYKNSGYDRGHFCPAGDRKFSKEAFTETFLTSNISPQDHDFNAGIWNRLEQKV
FT                   RYWATKYDGVYVVTGGILNDTEITIGDEHVTVPKYFYKLVLDYNNGKPKLVAFLFPHRE
FT                   SNKPLYDFVTTTDKIEELTGIDFFPHLEDDLEDKLEASNNYKGWSFR"
FT   gene            complement(164089..165723)
FT                   /locus_tag="CA2559_00670"
FT   CDS_pept        complement(164089..165723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00670"
FT                   /product="chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00670"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87223"
FT                   /db_xref="GOA:A3U4Q6"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Q6"
FT                   /protein_id="EAP87223.1"
FT                   /translation="MAKDIKFDLAARDGIKRGVDALANAVKVTLGPKGRNVIISKSFGA
FT                   PQVTKDGVSVAKEIELEDALENMGAQMVKEVASKTNDLAGDGTTTATVLAQAIVAEGLK
FT                   NVAAGANPMDLKRGIDKAVEALTKDLAKQSKEVGNSSEKIKQVASISANNDDQIGELIA
FT                   QAFGKVGKEGVITVEEAKGTDTYVDVVEGMQFDRGFLSPYFVTDSEKMTTDLENPYILL
FT                   VDKKVSSMKDLLPVLEPVAQTGKPLLIIAEDVDGEALATLVVNKLRGSLKIAAVKAPGF
FT                   GDRRKAMLEDIAILTGGQVISEERGFTLENATIEQLGTAETVTIDKDNTTVVNGSGDKD
FT                   MIKNRVNQIKSQIETTTSDYDKEKLQERLAKLSGGVAVLYVGAASEVEMKEKKDRVDDA
FT                   LHATRAAVEEGIVAGGGVALVRAKKVLEKLTSETLDETTGIQIVSKAIEAPLRTIVQNA
FT                   GGEGSVVINKVLEGKKDFGYDAKTEQYVDMLKAGIIDPKKVTRIALENAASVAGMILTT
FT                   ECALIDIKEDNAGGGMPPMGGGMPGMM"
FT   gene            complement(<165838..166113)
FT                   /locus_tag="CA2559_00675"
FT   CDS_pept        complement(165838..166113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00675"
FT                   /product="co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00675"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87224"
FT                   /db_xref="GOA:A3U4Q7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Q7"
FT                   /protein_id="EAP87224.1"
FT                   /translation="MALNIKPLSDRVLVEPQAAETQTASGIYIPETAKEKPQKGKVVAV
FT                   GGGKKDHDMTVKVGDIVLYGKYSGTELKLEGNDYLMMREDDILAVI"
FT   gene            complement(166262..166555)
FT                   /locus_tag="CA2559_00680"
FT   CDS_pept        complement(166262..166555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00680"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87225"
FT                   /db_xref="GOA:A3U4Q8"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Q8"
FT                   /protein_id="EAP87225.1"
FT                   /translation="MVQNPKGGGLSSSFGGGGTQQLGGVKKTTDFLDKSTWTLATVMLA
FT                   LILLSNINLFGGAVSTESRILDEDAVPATTLPQSTPATNDAETTTQATDSVQ"
FT   gene            complement(166624..167562)
FT                   /locus_tag="CA2559_00685"
FT   CDS_pept        complement(166624..167562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00685"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87226"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Q9"
FT                   /protein_id="EAP87226.1"
FT                   /translation="MNTTEFIALLQQPSKLTASQTRALEAIVEEFPYMQSARAMQLKGL
FT                   KDSESFSYNKELKTTAAHTVDRSVLFEYITSEEFSQNEIANTLQSRDDYLRNITVFEPE
FT                   EVITQKSVAIDDAIKMKLKEAHQVFDEDLFELPAKPLKKAPKEEDLSADEAVKVNQASE
FT                   EEIKDKLQIGKPLEFDKSESHSFSEWLQLTAVKPIDRSSETLENPVSDSKIGNRAESDE
FT                   KAKKFELIDNFIASNPKIVPKKTPLNANFLKDNEVPQESLMTATLARVYLEQKNYKKAI
FT                   QAYKILILKNPEKSSFFADQIREIETLIEKQ"
FT   gene            complement(167564..168082)
FT                   /locus_tag="CA2559_00690"
FT   CDS_pept        complement(167564..168082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00690"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87227"
FT                   /db_xref="GOA:A3U4R0"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4R0"
FT                   /protein_id="EAP87227.1"
FT                   /translation="MVNHTVMKLKLIVIICLAFSITSCGIYSFSGADVGEAKTFQVNYI
FT                   NNNASIVEPGIERTFRLELQDLIQNQTNLGLSTEGADLIYEGEITEYYIAPITAVAENT
FT                   AAQNRLTISVNIRFINTLEPENDLERRFSFYYDYPGGQQLIGSTLATALDEIYERLTQD
FT                   IFNATLANW"
FT   gene            complement(168095..169357)
FT                   /locus_tag="CA2559_00695"
FT   CDS_pept        complement(168095..169357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00695"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00695"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87228"
FT                   /db_xref="GOA:A3U4R1"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4R1"
FT                   /protein_id="EAP87228.1"
FT                   /translation="MESVQVTKQRFGIIGNDTKLNRAIEKAIKVSPTDISVLVIGESGV
FT                   GKESIPRIIHSLSHRKHAKYIAVNCGAIPEGTIDSELFGHEKGAFTGATQTRNGYFEVA
FT                   DGGTIFLDEVGELPLPTQVRLLRVLENGEFIKVGSSKVQKTNVRIVAATNVNMFEAINK
FT                   EKFREDLYYRLSTIEIELPPLREREEDIHLLFRKFASDFALKYKMPTVRLTDEATALLQ
FT                   NYRWSGNIRQLRNVAEQLSVLEQSREVDARSLREYLPDMGKNLPAVVSKTKKDSDFSNE
FT                   REILYKVLFDMKSDLNDLKKLTMELMKNGDSSQVKEDNESLIQKIYGEDDEVAEFEEEL
FT                   EDKFEVLQIPENNHPAERKEDKYHFAEEIEEEETLSLQDKELELIKKSLERHGGKRKAA
FT                   AQELGISERTLYRKIKQYDLN"
FT   gene            complement(169400..170848)
FT                   /locus_tag="CA2559_00700"
FT   CDS_pept        complement(169400..170848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00700"
FT                   /product="putative SAM/TRAM family methylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00700"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87229"
FT                   /db_xref="GOA:A3U4R2"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4R2"
FT                   /protein_id="EAP87229.1"
FT                   /translation="MEKILDEKLQGNSLVLEQDATNKRKLFIESYGCAMNFSDSEIVAS
FT                   IMAKEGFNTTPNLEDADLVLVNTCSIRDKAEQTVRKRLEKYNAVKRDHNPNMKVGVLGC
FT                   MAERLKSKFLEEEKIVDLVVGPDAYKDLPNLIKEVEEGRDAVNVILSKDETYGDVSPVR
FT                   LQTNGVSAFVSITRGCDNMCTFCVVPFTRGRERSRDPQSILDEVRNLSENGYKEITLLG
FT                   QNVDSYLWYGGGMKKDFSKATPMQQATATGFPQLLKMVAETFPNMRIRFSTSNPQDMTE
FT                   DVIKTMAAYSNICKHIHLPVQSGSDRILKEMNRLHTREEYFSLIDTIRAYMPDCSISQD
FT                   MIIGFPTETEQDHKDTLSLMEKVQYNFGYMYKYSERPGTMAGRKMEDDVPEEVKKRRLS
FT                   EVVALQRQLSQLQTEKNIGKTVEVLVERESKKSDKEWSGRTSQNAVAVFPKEHYKVGDL
FT                   VNVKIHDCTSATLIGNAIGYSGTN"
FT   gene            170987..172213
FT                   /locus_tag="CA2559_00705"
FT   CDS_pept        170987..172213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00705"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87230"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4R3"
FT                   /protein_id="EAP87230.1"
FT                   /translation="MKAFYRISLFVISLLIVSCVQDDNGDFIDYQVAIPVTQSLTDFRA
FT                   SVSIEDPQPIQQPGKIYTYEDYIFVNDFFQGIHIIDNSNPENPVKLSYLKIPANQDIAV
FT                   KDDILYADSGIDLVAFNISNITNITTVARLENVFPTYNELTPEGADFIDYSTFNADEDV
FT                   IVGFTIETRREVFYDTAVVEASNDAGSGNTGQGGSLARFNITGDFLYAVDNFSLNVFDI
FT                   TNLDNPQDLGEEHVGWQIETIFSYEDYLYIGSTAGMFIYSLDTPSSPTYQSEISHIVGC
FT                   DPVVVQGNFAYVTIRGGNLCGQDLSILEVINVEDKQNPFILEQYSLDQPYGLGVKDDLV
FT                   FVCDQGVGLRVFNASQTPVLEQIQLFENATALDVIPQDDKLIMVSETSIFQYLYTEDGL
FT                   TLLSEFNLL"
FT   gene            172284..173039
FT                   /locus_tag="CA2559_00710"
FT   CDS_pept        172284..173039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00710"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87231"
FT                   /db_xref="GOA:A3U4R4"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4R4"
FT                   /protein_id="EAP87231.1"
FT                   /translation="MFQELQRRIDTAKELDFGSIFQRSLDLFKETWVQGLILTLISIAI
FT                   TLPLIMLIYIPMIVYGIADPSAFEQGDLAALPIFIMAITLIVVIVIISALSFALQAAFF
FT                   KMIKKIDHKETNEDVNFFMYFKQPYLKKSLILSLALIGIALVSALLCYLPLIYAIVPLQ
FT                   FFVLFFAFHPELSISEVIKLSFKLGNKKWLITFGLILVAGILAQFVGMLLCFVGVFFTA
FT                   SFGYLPLYHIYKDVIGFDNQPEIFETNSI"
FT   gene            173136..175661
FT                   /locus_tag="CA2559_00715"
FT   CDS_pept        173136..175661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00715"
FT                   /product="DNA topoisomerase I"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00715"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87232"
FT                   /db_xref="GOA:A3U4R5"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4R5"
FT                   /protein_id="EAP87232.1"
FT                   /translation="MAKNLVIVESPAKAKTIEKYLGKDYKVESSYGHIADLPSKELGVD
FT                   VEGDFSPKYVVSKDKKDVVRKLKKLAKDAETVWLASDEDREGEAIAWHLFEELDLKSES
FT                   TKRIVFSEITKTAIERAIKNPRGINYNLVNAQQARRILDRLVGYEISPILWRKVKGGLS
FT                   AGRVQSVSVRLIVEREREILDFSPVGSYRVDAEFKTEDGASFKAKLPKNFDTKEDAEAF
FT                   LKDNLNADFKVGDLTKKPAKKSPAPPFTTSTLQQEASRKLYYSVSKTMTMAQRLYEAGM
FT                   ITYMRTDSVNLSDQAKKGAEKEIKKAYGDNFHKSRNYKGKSKGAQEAHEAIRPTDFSKH
FT                   TISGDSDQVRLYELIWKRAIASQMSDAQLERTNVKVEANTHDKQFTANGEMIKFEGFLK
FT                   VYLEGSDDEDQEQSGLLPNMKVNDTLVNSYITATERFTRPPARYTEAALVKKLEELGIG
FT                   RPSTYAPTITTIQNRKYIEKGTVDGVERDYAKLQLKNNKVSEKTMTETVGSDKGKLVPT
FT                   DVGMVVNDFLVQHFSSILDYNFTAKVEEDFDDIADGNEKWKDMMKDFYKDFHPKVKDVA
FT                   ENAEREVGERILGKDPKTGKPVSVRLGKFGPMVQIGSVEDEEKPLFASLGPNQSLQSIT
FT                   YEEAMDLFQLPKEIGEYNGEKVEVNNGRFGPYVRYGKTFVSLDKGEDPLDVSMDRALEL
FT                   IKAKEKADAPIYHYEDLPVQKGVGRFGPYIKWNGMFINVNKKYDFDNLTNDDIVELIEI
FT                   KKQKEIDKVVHNWEDEGIRVEKARWGRHNIIQGKIKVEIPKTVDAQKLTLEKAQEYIEK
FT                   KKPKKKATKKKTTAKKKTATKKKTTTKKK"
FT   gene            175751..176917
FT                   /locus_tag="CA2559_00720"
FT   CDS_pept        175751..176917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00720"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87233"
FT                   /db_xref="GOA:A3U4R6"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4R6"
FT                   /protein_id="EAP87233.1"
FT                   /translation="MSLEVLKPVSKNVLAHKTLLHEHTIGNAIKIHSQQEGLPSLANVN
FT                   IAIFGVLDSRKTQDYLGQEFDFDEIRTSFYELFPGNWHLNIADLGDLEKGHSVEDTYAA
FT                   VTAITKTLLKQNIIPIILGGGQDLVYAQYRAYDNEEYMVNLVNVDAHFDLGNADESMDN
FT                   RSFMSKIVIDKPYNLFNYSNIGYQTYYNAQEEIDLIERLYFDAIRLGEATHDIKTVEPV
FT                   MRDANIVSVDISSLNASSLGSHSHKYPNGFDGREICSITRYAGLSDKVSSFSICELQGK
FT                   TQNETSAMLVAQMLWYFIEGVTFRRNEHTISAKKEFIKYQVPIDEEILVFYKSPLSERW
FT                   WIEIPFFSDIDTKLNRSTLLPCNQQDYLEACNQNIPQRWWKARQKNEL"
FT   gene            177040..178404
FT                   /locus_tag="CA2559_00725"
FT   CDS_pept        177040..178404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00725"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00725"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87234"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR019866"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4R7"
FT                   /protein_id="EAP87234.1"
FT                   /translation="MKKVLMLFACVAFLASCGNGDRGQLVGAKGKRWHPEKPYGMTTVS
FT                   GGSFIMGKSDDDIAALKNAPTKTVTVRSFYMDETEITNSEYRQFVEWVRDSVVRMRLAI
FT                   LADELGETPGTGGIGEYAFLDQDPDNLTPYEQYMLDNYAGLGETGYEGRKINREIDLIW
FT                   ETEEYPDEYYVEVMDTMYLPQEESYNGQRTMDVSKFEFQYTWMDIQAAARAKKGKRSDF
FT                   IKRENVKIYPDTTVWIKDFSYSYNEPMHNDYFWHAAYDDYPVVGVSWQQAKAFCAWRTL
FT                   EHNSYRKEKGQHFVNTYRLPTEAEWEYAARGGIESASYPWGGPYTKNDRGCFMANFKPL
FT                   RGDYAADQALYTVEAKSFEPNDFNLYNMAGNVSEWVDSSYDPSSYEYSSSMNPNVNDVS
FT                   NKRKVVRGGSWKDVSYFLQVSSRDYEYADSARSYIGFRTVQDYLGNDLDLNRPPQ"
FT   gene            178486..179124
FT                   /locus_tag="CA2559_00730"
FT   CDS_pept        178486..179124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00730"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87235"
FT                   /db_xref="GOA:A3U4R8"
FT                   /db_xref="InterPro:IPR019852"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4R8"
FT                   /protein_id="EAP87235.1"
FT                   /translation="MAQSKSGKKLMNMVYGLGAAVVILGALFKIMHWPFGNEMLIIGLI
FT                   TEALVFTVSAFEPVDSELDWSLVYPELAGGAASGKKAVAPTDAEGVLSKKLDAMLKEAK
FT                   IDANLMSSLGDSIKNFEGAAKNMSPTVDAISSQKKYSEELTLAAAQMETLNNLYKVQVE
FT                   SAAKQSEANTAAAENAVALKAQMESLTQNLSSLNGVYGNMLNAMGNNRA"
FT   gene            179173..180711
FT                   /locus_tag="CA2559_00735"
FT   CDS_pept        179173..180711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00735"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87236"
FT                   /db_xref="InterPro:IPR019859"
FT                   /db_xref="InterPro:IPR022719"
FT                   /db_xref="InterPro:IPR022720"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4R9"
FT                   /protein_id="EAP87236.1"
FT                   /translation="MASGKQTPRQKMINLMYLVFIAMLALNMSKEVLTAFGLMNEKLVE
FT                   ANADTTQRNQLAMAGLAEKASEQPAKYAPLKEQADQINALTEELVGYIDGVKNKLTAEM
FT                   DDPTDYETMDKSNDLDELWYKGGKVTPEGQEFIDKMDTYRNGVVSVIGADLPKVRAEVE
FT                   KDFSTAPEKDRDGVEKDWLSYNYVGFPLVASITKLTQIQADAKTVESEILSDLLAGQLK
FT                   SDVSMTNYQAIVVPEKTAFFNGENFKGKVVLGRFDNSLNFDKVTVNGKDLEKTVGGQVV
FT                   LDFPAGNVGEQEIKGELQFKEGDSLVSIPITSSYAVIPKPNAAVISADKMNVVYRGVQN
FT                   PMTISIPGVGSVSANAPGLSPAGGAGKYNMNVTTLKQREVKINVSGKLPGGETVSDSKT
FT                   FRIKDIPRPVGTVRGEEGSIKMQRNGLEISTIGADLPDFDFQLKLNVTGFKFRVPGQPT
FT                   VRVNGSRLDSRAKSTLRRAKRGETVQIFDIEAGISGNSGYKLKKVSPVIIELTN"
FT   gene            180717..181616
FT                   /locus_tag="CA2559_00740"
FT   CDS_pept        180717..181616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00740"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87237"
FT                   /db_xref="InterPro:IPR019847"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4S0"
FT                   /protein_id="EAP87237.1"
FT                   /translation="MMAMTSNRLLLTLSGLLITSLGFSQANLLNAKTPDEIGVKTEEQI
FT                   KYDNDDPLEYGYVDDRDVLWSKTTWEIVDLDERVNFPLYYPIDTNNIGKDRRSLYDVLL
FT                   SNIKNGNIETIYTDSYFTEKRTLKDISAALSKVDTTDYGIEQYNAGEEIDAQYITRRDI
FT                   NAGDISEYHVKGLWYFDKRQGELKYRLLGIAPCAPDVNFIDEEDTQVVELFWVWFPGVR
FT                   EVLHNAKAFNRQNSSQPITFDHLLNSRRFNGVIYKEDNEYGDRTVEDYINNNALMQLLE
FT                   SDRIKEQIRNFEQDMWNY"
FT   gene            181686..182729
FT                   /locus_tag="CA2559_00745"
FT   CDS_pept        181686..182729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00745"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87238"
FT                   /db_xref="GOA:A3U4S1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4S1"
FT                   /protein_id="EAP87238.1"
FT                   /translation="MQETDYIIVGFGLSGLAVTRQLQSHNKKVVVIDKPSQNASKVAGG
FT                   MYNPVILKRFTLAWNANEQLPYALQFYKSIEDELKIKIINPLPVYRRFSSIEEQNNWFE
FT                   ASDKPLLNEYLNSDLKTTLNKNVNGNYGFGEVKQTGTINTEKLINAFKSKLSSNTNFIE
FT                   ENFNYDLLQVNKDSIIYNNLIARGIIFCEGIGVKNNPYFNTLDIRGNKGEYLIIKAPQL
FT                   NLEAAVKSGIFIIPLGDNTYKVGASYDRLDTTTNPTETKKIELKKQLDAILTTEYQIID
FT                   QVAGIRPTTKDRRPYIGSLKEHENVYLCNGLGSRGVITSPTISKHLVDHILKDLPIPSD
FT                   ISLERHY"
FT   gene            complement(182730..183791)
FT                   /locus_tag="CA2559_00750"
FT   CDS_pept        complement(182730..183791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00750"
FT                   /product="thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00750"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87239"
FT                   /db_xref="GOA:A3U4S2"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4S2"
FT                   /protein_id="EAP87239.1"
FT                   /translation="MISTDILIIGAGPTGLFTVFEAGLLKLKCHLIDALPQPGGQCSEI
FT                   YPKKPIYDIPAFPEVLAGDLVNNLMKQIEPFQPGFTLGERAQTIDKQEDGTFIVTTNKG
FT                   TKHHAPVVAIAGGLGSFEPRKPPISNIKDFEDRGVSYIIRDPEVYRDKKVIIAGGGDSA
FT                   LDWSIFLADVASEVTLVHRRSEFRGALDSVEKVSELSKLGKIKLVTNAEVVGINGSEKL
FT                   ESVVIQHKDKAAQDTLLEVDDFIPLFGLSPKLGPIADWGLEIEKNAIKVDNTLDYQTNI
FT                   PGIYAIGDVNTYPGKLKLILCGFHEATLMCQSAFQRINPDKRYVMKYTTVGGVHGFDGS
FT                   VKTAKKEVVQKIG"
FT   gene            complement(183859..184101)
FT                   /locus_tag="CA2559_00755"
FT   CDS_pept        complement(183859..184101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00755"
FT                   /product="NifU protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00755"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87240"
FT                   /db_xref="GOA:A3U4S3"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4S3"
FT                   /protein_id="EAP87240.1"
FT                   /translation="MEGQELYNSVQAALEEIRPFLQNDGGDISLVSIEDDKTVFVKLMG
FT                   NCVGCSVNQMTLKSGVEMTIKKHAPQIEKVINTAQ"
FT   gene            complement(184105..185235)
FT                   /locus_tag="CA2559_00760"
FT   CDS_pept        complement(184105..185235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00760"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87241"
FT                   /db_xref="GOA:A3U4S4"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4S4"
FT                   /protein_id="EAP87241.1"
FT                   /translation="MKIDKASVLKTLETISVSGEGKNMVESGAVTNVVTFADEVIVDLT
FT                   LTTPALHIKKRAESDIISAIHSGLDENAKVKVNIKIEAPQKTNEIKGKAIPGIKNIIAV
FT                   ASGKGGVGKSTVTSNLAVSLSKMGFKVGLLDADIYGPSAPIMFDVEAERPLSVTVDGKS
FT                   KMKPVENYGVKILSIGFFTKPNQAVVWRGPMAAKALNQMIFDAAWGELDFLLIDLPPGT
FT                   GDIHLSIMQSLPITGAVVVSTPQNVALADAKKGVAMFQQESINVPVLGILENMAYFTPE
FT                   ELPDNKYYIFGKDGAKNLADDLGVPFLGQLPLVQSIRESGDIGRPAALQTGTILESAFI
FT                   DITKNTVQETVNRNKDLPPTEAIKITTMAGCSAVKN"
FT   gene            185413..186192
FT                   /locus_tag="CA2559_00765"
FT   CDS_pept        185413..186192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00765"
FT                   /product="putative ribosomal large subunit pseudouridine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00765"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87242"
FT                   /db_xref="GOA:A3U4S5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4S5"
FT                   /protein_id="EAP87242.1"
FT                   /translation="MSRDGRRNDNASNKKNKPKVETVDGGIRLNKYIANAGICSRRDAD
FT                   IYITAGNVTVNGKTITEMGYKVKLSDEVKFDGRSITPDKKEYYLLNKPKDVFVSGSLNE
FT                   SGMTVLDIVGRATKARLSPIGKLERSAMGLVVLTNDGTLSKSLANPRHGIRQIYHVQLN
FT                   KELSQVDLEKIRQGITLEDGEIKVVDISYVENKSKREVGIEIKSTKSHIVQRLFKSLNY
FT                   EIKYLDRVVFGTLTKKDLPRGMFRHLTKQEIINLGMI"
FT   gene            complement(186189..187196)
FT                   /locus_tag="CA2559_00770"
FT   CDS_pept        complement(186189..187196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00770"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87243"
FT                   /db_xref="InterPro:IPR019861"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4S6"
FT                   /protein_id="EAP87243.1"
FT                   /translation="MTTQIKSALALLMLISGSFFVNAQEGIPVYSDYLTDNLYLLHPSM
FT                   AGASNASKVRLTARQQWFDVEDAPSLQTLSLNGRITDKIGVGGILFNDSNGNFSQTGAY
FT                   ATFAYHLLLSRNEIDLNQLSFGLSIGAIQGRLDESTFTMFDPIVTGIEQTDTYFNLDFG
FT                   VSYYFLDFFSHLTVKNALPANRDIFTEDLESNNQRRYLLSAGYTISPYGSDWSYEPSIM
FT                   FQSTDETQERSIDLNMKVYKAMDFGRLWGGLSYRRSFEGAEFTQDGVEVSNQKLQLITP
FT                   FVGVDYNNFMFAYTYSYQANSVVLSNSGFHQLTIGFKFNERRDRYDCNCPAINY"
FT   gene            complement(187205..194299)
FT                   /locus_tag="CA2559_00775"
FT   CDS_pept        complement(187205..194299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00775"
FT                   /product="iron-regulated protein FrpC"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00775"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87244"
FT                   /db_xref="GOA:A3U4S7"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR026341"
FT                   /db_xref="InterPro:IPR035914"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4S7"
FT                   /protein_id="EAP87244.1"
FT                   /translation="MKKLLPLLFLCFTFICNAQDVNMQNGSSSQCTGMFYDSGGPSGAP
FT                   QSNENLIYTFCPDFAEGAIQFDFTFFQTQQNVDIMTIYDGDDTTAPVIGMYSGNIMDPF
FT                   TVVASSLNPTGCLTVEYISNPTGNAPGWEAEVSCYVPCQIITPQIDSVTPSVFVNDIYR
FT                   TCLGDELTLTGSGTFSEGYDENPVFNWAFGDGTTAVGETVTHTYAASGGYEVILSITDQ
FT                   YNCTSVMPATQVIQVATEPDFTGTSAADSEICIGETTDITGNVSPVDFTVECTPPVAGT
FT                   TFLPDGDGVSYETCITVDCFNDGQTLDDISNFLQVCINMEHSYIGDLDIELTSPSGESI
FT                   FIRQQAGGGTFLGCPIDDTTSGPGTGRQYCFDPNATVDLTGAPTDGGCPSGTSITPGTY
FT                   MTDEPFTDLLGSTLNGDWCLTITDNITLDDGYIFEWFLDFDSSIVPPDQSFTPVITNEE
FT                   WQADPTIVATNGNVITVEPDTVGQNCYTYIAEDDYGCTYTETVCIDVLPTPVANMPQDI
FT                   VLCNEISPIVVDLTENDDDVLGTQTAADYTITYHESQADADMGMPLIADPTMFTPSSNP
FT                   QTIFVRIEDATSGNCYDTASFTISSFTAEVGLLDDLTQCDNGTPDTSLFDLTENELNAL
FT                   NGQDPNDFTVTYHTTQANADAGTPSILTPNAYLNTANPELIYVRVENNLNVDCYDTGRF
FT                   SLIVNVQPIANEPQDIELCSTGGGITFDLTENDDDVLGAQTASDVTITYHESQADADLG
FT                   TPIIPNATSYTAGSNPQTIFVRIEDANSGECFDTNSFVISSFEVSIGELEDFAQCESDG
FT                   PGTSTFDLTQNDDEALNGQDPNNYTVTYHSSQADADNDVAIAGDPTAYQNTSNPQTIFV
FT                   RVEENSSVDCFVTDTFTLTVNDTPIANMPPNLEQCSTGGPSQLFDLTQVEGDVLGGQDA
FT                   TQFSITYHNSQADADANIPIVEDPTAYPNMSNPETIFVRIENNIDSSCYDTTSFQLIVN
FT                   DRPSVAAAPQDLEECEDAMGNAFFNLETNTPIVLGAQDPNSYDVTYYESQLDADTPNAP
FT                   IGNTTNYTALSNPQIIYIRIQNTASPECYETVSFQIESFSVAIGEPDDLFACDEGTGGF
FT                   AEFNLTNNDNSVLAGQDPFLYTVTYHDTQAGADTNDTSIPDPTAYTNTTNPQTVFVRVE
FT                   NDENTTCYLTASFQLETTPSAPIQDPEPLEVCDTDNDGFSEFDLDSTSNGIALGNPDLV
FT                   VTFHPTQSDAINGVNDLSSPYGNVMEDTQTVYVRVEDDINGCVLFTELELIVYDSPLLE
FT                   TPDPLVLCDLGSDGEEVFDLTQAEMQILDGLDPALYDITYHETLMQAMDNMGAIGNPTA
FT                   YTNQGNPQTIYVRVTDPSNMADCNNIVELELRVRDLPAANQPEELEVCDDETGVDTEDE
FT                   VATFDLTTMDTVINGDANVDIFYYETTADIPGNPIADPESYVNIANPQTLEVRVEDEFG
FT                   CENFTTLTLVVNPNPSIADMIFEYELCDIDNDGVEEFDLESQTMMILNNEPDVSITYHE
FT                   TMAEAEMGTDAIDTTQPYQNTEANVDDIYIRAENDITGCTTIRQLDLIVTASPEIESLD
FT                   DLFQCDDDGDGEAIFDLTQNTPNALGTTQPDVTVSYHESETEAEDGTMPISMPQMYENQ
FT                   TNPQTIWIRLEGDDTQCVTVGSFEITVEALPVVNAPTALRICNDDYDDPAITTFDLTVK
FT                   DEEITGQSPVLSNIEVYYYESQADLDNDNPIADPAMYENTQNNQTIFVEVVDTATMGQC
FT                   SDTTTMTLTVLPLPSPSSTNENGELDQESCDDSDGIIDTMADFDLTASGDVIAMGENVD
FT                   LTYHLSEQDALDNINAIPAAEETAYNTVTRTIWVRVENGNQNNTCSVLVSFEVVVNANP
FT                   VLTDTSYTAALCEPEDTTPGITAFDAQEVTNNLVPDLLATPIADFTVTYHFTQAEADMG
FT                   VNAIPDGFLFSEAVNNPVYIRVVDNTTMTQCYNSDNLAELTITVDTQPEFVMGDVDDIF
FT                   LCADSAMDQDTSTMFDLTVRDGQIDGSMNPDTEVVYYASQADYDAGIEIDAADAVMYTN
FT                   TVNPQTIIAELFNPVTGCRSDGTVEFDLVVQSLPVLPAALQMPQGDIVCTDAQGNVLSP
FT                   FDIGYDLGATDGLEYTYDWTPDNIDADGDGNEDAIYTVTSLTQATTYSVVITRVNDPVS
FT                   GMPSCENGLDENGNPYTVTFTPSSAPFAANASVTETSFNEEAEYTVTVTPLGQDGQPLP
FT                   LEDYLYRIDDGPLQTSNVFTGVGPGSHIGYAVDVEGCGEVGDPFGIIDYPRFFTPNGDG
FT                   YNDTWNIIGIDGQPAAKIYIFDRYGKLLKQLSPTGNGWDGTFNGRVLPSDDYWFSVEFV
FT                   EPADGSIQEFRANFTLKR"
FT   gene            complement(194303..194761)
FT                   /locus_tag="CA2559_00780"
FT   CDS_pept        complement(194303..194761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00780"
FT                   /product="GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00780"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87245"
FT                   /db_xref="GOA:A3U4S8"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4S8"
FT                   /protein_id="EAP87245.1"
FT                   /translation="MKNITPKYWVLICFVLINLGVSAQINNIYKIPSDSQVVTLVEEVY
FT                   SENSEKEIFNRKARYNFIKNLLQKRIVVTSDKDILNKIEDEVYLSEVPVFNTFNASLKK
FT                   PLSFNLTNFNPLIYNINWYDVKPHYYKIDNQNLLLIVFPQEVNNTTER"
FT   gene            194920..195597
FT                   /locus_tag="CA2559_00785"
FT   CDS_pept        194920..195597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00785"
FT                   /product="GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00785"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87246"
FT                   /db_xref="GOA:A3U4S9"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4S9"
FT                   /protein_id="EAP87246.1"
FT                   /translation="MKLDDLLENVEERGDNHAGASRETPLRDNAFDLDDQEKITLIQDD
FT                   VKRILETLGMDLTDDSLKGTPLRVAKMFVKEIFGGLHPDRKPKASTFENKYQYGEMLVE
FT                   KNITVYSTCEHHLLPIVGKAHVAYISKGNVVGLSKMNRIVDYYAKRPQVQERLTLQIVE
FT                   ELQKVLGTEDVACVIDAKHLCVNSRGIRDIDSSTVTSEFGGQFKDKETKREFLDYIKLD
FT                   TEF"
FT   gene            195620..197107
FT                   /locus_tag="CA2559_00790"
FT   CDS_pept        195620..197107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00790"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00790"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87247"
FT                   /db_xref="GOA:A3U4T0"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4T0"
FT                   /protein_id="EAP87247.1"
FT                   /translation="MILEQAKNLQIYNSLSGQKEIFKPIDEHHVGMYVCGPTVYSNVHL
FT                   GNCRTFISFDLVFRYLKHLGYKVRYVRNITDAGHLENDAEVGEDRIAKKARLEQIEPME
FT                   VVQRYTVDFHNTLGKFNNLPPSIEPTATGHIVEQIEIIKDIIDKGFAYEANGSVYFDVL
FT                   KYNSSNNYGILSGRKLEDMIANTRELAAQSDKKNPQDFALWKKAEPQHIMRWPSPWSDG
FT                   FPGWHLECTVMSTKYLGEQFDIHGGGMDLKFPHHECEIAQGKAASGKDPVNYWMHANML
FT                   TLNGKKMAKSTGNYILPNEMFTGDNDILSKAYLPSVVRFSMLQANYRSILDFSDEALLA
FT                   SEKGYFKLMTAINMLDSLPTSNTSSIDVETWKNSCYTAMNDDFNSPVLIAKLFDAVKLI
FT                   NTVNDNKDTITKENLSILKETLNAFVFDVLGLENANSNTATDSSSDKLSGTLELLIQLR
FT                   AEARANKDFATSDKIRDELAKLDIELKDGKDGTVFNL"
FT   gene            197114..197326
FT                   /locus_tag="CA2559_00795"
FT   CDS_pept        197114..197326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00795"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00795"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87248"
FT                   /db_xref="GOA:A3U4T1"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4T1"
FT                   /protein_id="EAP87248.1"
FT                   /translation="MLRRFFIILIRGYQRYISPLTPKTCRYEPTCSQYTVEALQKHGAI
FT                   KGSWLGIKRIFSCNPFGGSGYDPVP"
FT   gene            complement(197327..198385)
FT                   /locus_tag="CA2559_00800"
FT   CDS_pept        complement(197327..198385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00800"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87249"
FT                   /db_xref="GOA:A3U4T2"
FT                   /db_xref="InterPro:IPR007358"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4T2"
FT                   /protein_id="EAP87249.1"
FT                   /translation="MINLYNAQIENLSIHRIGNKSRNESYFMSQSPYVLSDELTPLIKE
FT                   FFLKSFREKEETYYNFTHEADLEFHELFNVASKIFEQPEVAHEQSKKIASLLYETSSHP
FT                   HIKSGELYVVYFENVQLDNEKMSAIGIFKSELKSDFLQFKEKQDNLDLILEQGVNLNKL
FT                   DKGALIFNKNKEEGYKILSVDSNRYDTKYWLEQFLGVDVFADDNFFTKNYLKFCQNFAK
FT                   DVVNPAEDKKEEVMFMNRAVNHFAKNDKFEETSFLNEVIDNPDLIPEFKHYKVEKAPKY
FT                   KIEDLTEFPISNTAVSASRKSIKNTINLDTNIQIKMDFINPESAEKFVEKGWDEEKQMY
FT                   YYLVYFNKEEKN"
FT   gene            complement(198429..198947)
FT                   /locus_tag="CA2559_00805"
FT   CDS_pept        complement(198429..198947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00805"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00805"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87250"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4T3"
FT                   /protein_id="EAP87250.1"
FT                   /translation="MVYRFRVVLDTVEDVFRDIEILKTNSLEDLHNVITQSFGFDGTEM
FT                   ASFYVSDDEWSQGEEIVLFDMSEGVSKVRMMNETAIEDVFSQSNTKMIYVYDFLSMWTF
FT                   YVELADISEQAEGVDYPNLMYVHGQLPDSPPDREFEAEDLGGDEYENEFQDDLDIDDYD
FT                   NLDFDENWN"
FT   gene            199064..199342
FT                   /locus_tag="CA2559_00810"
FT   CDS_pept        199064..199342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00810"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87251"
FT                   /db_xref="InterPro:IPR009921"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4T4"
FT                   /protein_id="EAP87251.1"
FT                   /translation="MPIINKDYFMALTNNDIFKKLRVALKLRDDDIVQICALVDFKVTK
FT                   SELGAIFRKEDHPKYVECGDQFLRNFLNGLVIHLRGPMPDKREKKTT"
FT   gene            199446..201392
FT                   /locus_tag="CA2559_00815"
FT   CDS_pept        199446..201392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00815"
FT                   /product="threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00815"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87252"
FT                   /db_xref="GOA:A3U4T5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4T5"
FT                   /protein_id="EAP87252.1"
FT                   /translation="MINITLPDGSVKEFEAGATAMDVAKSISEGLARNVISASFNGTKV
FT                   ETTTPLHEDGSLILFTFRDEEGKKAFWHSTSHVMADALQQLYPGIKLTIGPAIDNGFYY
FT                   DIDFGDQKISENDFKKIEDKMLEIARGKHEFQLRSVTKAEALEFYKNENNPFKVELIEN
FT                   LTDGDITFCDHSNFTDLCRGGHIPNTGIIKAVKLLNIAGAYWRGDEKNPQLTRVYGVSF
FT                   PKQKELKEYLELLEEAKRRDHRKLGKELSLFTFSQKVGQGLPLWLPKGAALRERLENFL
FT                   KKAQKKAGYEMVVTPHIGQKELYVTSGHYAKYGEDSFQPISTPAEGEEFLLKPMNCPHH
FT                   CEIYNNSPWSYRDLPKRYAEFGTVYRYEQSGELHGLSRVRGFTQDDAHIFCTPDQLDEE
FT                   FKKVIDLTMYVFSSLGFENFTTQVSLRDPENPDKYIGKEENWEKAENAILSAVKDKGLN
FT                   YIVETGEAAFYGPKLDFMVKDALGRSWQLGTIQVDYNLPERFDLTYKGSDNELHRPVMI
FT                   HRAPFGSMERFVAILLEHTAGNFPLWLMPEQAIILSLSEKYENYSKKVLNLLENHEIRA
FT                   LTDHRSETMGKKIREAEVNKIPYMLIVGEQEENDGTVSVRKHGGEDLGTMTVEEFSKLV
FT                   NEEISKTLKTFEV"
FT   gene            201521..201988
FT                   /locus_tag="CA2559_00820"
FT   CDS_pept        201521..201988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00820"
FT                   /product="translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00820"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87253"
FT                   /db_xref="GOA:A3U4T6"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4T6"
FT                   /protein_id="EAP87253.1"
FT                   /translation="MRLVGDNVEMGIYPTRDAIKIAEEQGLDLVEISPNAEPPVAKVMD
FT                   YKKFLYEQKKREKAIKAKASKVVVKEIRFGPNTDDHDYEFKKNHGEKFLKEGAKLKAYV
FT                   FFKGRSIVFKDQGEILLLRLAQDLEDVGKVEQMPKLEGKRMTMFIAPKKTK"
FT   gene            202052..202249
FT                   /locus_tag="CA2559_00825"
FT   CDS_pept        202052..202249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00825"
FT                   /product="ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00825"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87254"
FT                   /db_xref="GOA:A3U4T7"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4T7"
FT                   /protein_id="EAP87254.1"
FT                   /translation="MPKQKTKSSAKKRFKLTASGKIKRKHAFKSHILTKKTKKQKLALT
FT                   HSTLVHKADEPNVKIMMNLK"
FT   gene            202358..202702
FT                   /locus_tag="CA2559_00830"
FT   CDS_pept        202358..202702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00830"
FT                   /product="50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00830"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87255"
FT                   /db_xref="GOA:A3U4T8"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4T8"
FT                   /protein_id="EAP87255.1"
FT                   /translation="MPRSVNSVASRARRKKVMKQAKGYFGRRKNVWTVAKNAVDKAMQY
FT                   SYRDRKTKKRNFRSLWIMRINAGARLNGMSYSQFMGAVKKNNIELNRKVLADLAMNHPE
FT                   AFTAVVNKVK"
FT   gene            202826..203674
FT                   /locus_tag="CA2559_00835"
FT   CDS_pept        202826..203674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00835"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00835"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87256"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4T9"
FT                   /protein_id="EAP87256.1"
FT                   /translation="MKFICLACLLVFSVSISAQYTEIATFEFQQFNGNTKENTNYNTTV
FT                   FNAGLLLGFNTNSNKTTTVFFRPSYQQRIITGPNPLSLYKPELITGISHNFNDSWKIQG
FT                   FALARLASNFNSIDNEHYQFGGGALATYKSSERLSYRFGAYARKQPKGVLAFPFIGLNY
FT                   RFGTNRWQLNVLLPQYAYLKYTVKESSWYAGLRLNYVTEQYRTELNNTSLHYIELTEFT
FT                   SEVFIEYYLTKGLVVYGRAGFLNYQKYELYNEQDLLLNPNTREVKDVLTGRIGLAYRIL
FT                   N"
FT   gene            complement(203671..204855)
FT                   /locus_tag="CA2559_00840"
FT   CDS_pept        complement(203671..204855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00840"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87257"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4U0"
FT                   /protein_id="EAP87257.1"
FT                   /translation="MDEDTQQDHLKAYGLTYWMLQKQQKVKWLLNYRGGSFLMADSQEL
FT                   RNECKIRGISFETLSDSKTEEILTMISSPSQNMEAVVLEKAPKIAVYSPKGNLPWDDAV
FT                   TMVLTYAEIPYEVVYDKEVLSDQLILYDWLHLHHEDFTGQYGKFYRAYRAAPWYIEEKQ
FT                   KAEALAQELGYSKVSEEKRAVALKIRDYVVGGGFMFAMCSATDSFDIALAAEDVDICEP
FT                   MFDGDASEAGYQNKIDYSKTFAFTDFTLERSPMVYEFSSIDTTPKRKIPRTTDYFTLMN
FT                   YSAKWDPIPTMLTQNHTSLVKGFMGQTTAYDSKEIKSNVLVMGENKTNNEARYIHGIKG
FT                   KGFFTFYGGHDPEDYQHRVGDPKTELELHPTSPGYRLILNNVLFPAARKKKQKT"
FT   gene            complement(204989..206527)
FT                   /locus_tag="CA2559_00845"
FT   CDS_pept        complement(204989..206527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00845"
FT                   /product="replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00845"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87258"
FT                   /db_xref="GOA:A3U4U1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4U1"
FT                   /protein_id="EAP87258.1"
FT                   /translation="MENVNQQTSKNYNRGQVISLEKGKLPPQATDLEEVVLGAMMIDKK
FT                   GVDEIIDILNPDVFYKQSHQYIFEAIFKLFENSEPVDLLTVSQQLKKDQKLEAAGGDFY
FT                   LVQLTQKVSSSAHIEFHARIILQKYIQRSLIKISNEIIEQSYDETTDVFDLLDTAESKL
FT                   YEVTQGNIKRSSETARELVIQAKKKIEDISNKEGLSGVSSGFERVDKLTSGWQPSDLII
FT                   MAGRPGMGKTALTLSMARNVAVDQNIPVAFFSLEMSSVQLITRLISSETGLSSEKLRTG
FT                   NLEKHEWEQLNVKVKGLEKAPLFIDDTPSLSIFDLRAKARRLASQHGIKLIMIDYLQLM
FT                   TAGGSQKGGNREQEISTISRNLKALAKELSVPVIALSQLSRAVETRGGSKRPLLSDLRE
FT                   SGAIEQDADIVSFIYRPEYYKIEEWDDEERTPTEGQAEFIIAKHRNGGLDNIRLKFEGH
FT                   LGRFANLETFDSPFEFQSALNKDDDNPFSTDMPSTSPEQAFGSNMNDDENDVPF"
FT   gene            complement(206696..207649)
FT                   /locus_tag="CA2559_00850"
FT   CDS_pept        complement(206696..207649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00850"
FT                   /product="Acetyl-CoA carboxylase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00850"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87259"
FT                   /db_xref="GOA:A3U4U2"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4U2"
FT                   /protein_id="EAP87259.1"
FT                   /translation="MEYLEFELPIKELEEQYEKAKNIGSESEVDVTATCKQIEKKLNET
FT                   KKDIYKNLTAWQRVQMSRHPSRPYTLDYIKAICGDTFLELHGDRNVKDDKAMIGGLGKI
FT                   GDQSYMFVGQQKGFNTKTRQYRNFGMANPEGYRKALRLMKSAEKFGVPVVCFVDTPGAY
FT                   PGLEAEERGQGEAIARNILEMTRLKVPIIVVIIGEGASGGALGIGVGDKVLMLENTWYS
FT                   VISPESCSSILWRSWEHKEEAAEALKLTAKDMKKMKLVDEIVKEPLGGAHRDRDKTFST
FT                   VKEKIASSYAEFKDLSPKDLVEQRMNKYSEMGVFKG"
FT   gene            complement(207734..208663)
FT                   /locus_tag="CA2559_00855"
FT   CDS_pept        complement(207734..208663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00855"
FT                   /product="predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00855"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87260"
FT                   /db_xref="GOA:A3U4U3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4U3"
FT                   /protein_id="EAP87260.1"
FT                   /translation="MPNAKLQSYLHFHVIVFIWGFTAVLGALISIDALPLVFYRMWLAS
FT                   GFIFLWILYKKKPLKMTAKQLLILASAGIVIALHWLTFFEAIKVSNVSITLALIATGAF
FT                   FTSIMEPIFYKRKVIWYEVFFGVLVIAGLYIIFNVETDYVLGIILALISAFLSAVFSLI
FT                   NGKLAQKGDASVISFYELLIGVIAITIYLGFDTFIGEASAGFTSEFFQLSNQDWLLLLV
FT                   LASVCTAYAFIASVAVMKYLSPYTIMLTINLEPVYGIILAFFIFGSKEEMNPEFYYGAL
FT                   IILSTVVLNGILKNKDGIGRFAKRRKMR"
FT   gene            complement(208650..209729)
FT                   /locus_tag="CA2559_00860"
FT   CDS_pept        complement(208650..209729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00860"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87261"
FT                   /db_xref="GOA:A3U4U4"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4U4"
FT                   /protein_id="EAP87261.1"
FT                   /translation="MKILDWYILKRYLGTFVTLLLLFIPIGITVNLAEKIDKILANDVP
FT                   FIEVAEYYLNFTIYFANLLFPLFLFLSVIWFTSKLANNTEIIAFLSSGVSFYRFLRPYL
FT                   IGATIVCLLALIMGMYLAPSASKGFNEFKYTYLKSGGDNQQETKNVYRQINEDEVIYAT
FT                   NFNPSRQSALNFTLEHFKDNVLEYKISASRLQYNKEDTTYTLTNFNKRLVGARGDSLIH
FT                   YRKLDTILPFEFDELTPNSYVAETLNFNELNKFIEDEKRRGSGNLNRYLVVAYKRWSTP
FT                   VSAYILTIIAVAVSAMKRRGGMGINLAIGIAVAFSFVFLDKVLGTIAEQSDFSPLVAVW
FT                   FPNVSFGILAIYLLYNAKR"
FT   gene            complement(209729..210859)
FT                   /locus_tag="CA2559_00865"
FT   CDS_pept        complement(209729..210859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00865"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00865"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87262"
FT                   /db_xref="GOA:A3U4U5"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4U5"
FT                   /protein_id="EAP87262.1"
FT                   /translation="MTFDLLSTDKNSQARAGTITTDHGKIETPIFMPVGTVGTVKGVHQ
FT                   RELKQDINPDIILGNTYHLYLRPQTEILEKAGGLHKFMNWDRNILTDSGGYQVYSLSSN
FT                   RKIKEEGVKFKSHIDGSMHTFTPENVMEIQRTIGADIIMAFDECTPYPCDYQYARRSMH
FT                   MTHRWLERCVAHLKKLPFKYGYEQTFFPIVQGSTYKDLRQQSADYIASVGADGNAIGGL
FT                   SVGEPAEEMYAMTDVVTAILPKEKPRYLMGVGTPINILENIALGIDMFDCVMPTRNARN
FT                   GMLFTAHGTINIKNAKWKDDFSPIDEMDITWVDTEYSKAYLRHLFSVNEFLGKQIATIH
FT                   NLGFYLWLTREARKQILAGTFRVWKDKMVKQMDKRL"
FT   gene            210995..211876
FT                   /locus_tag="CA2559_00870"
FT   CDS_pept        210995..211876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00870"
FT                   /product="transketolase, N-terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00870"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87263"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4U6"
FT                   /protein_id="EAP87263.1"
FT                   /translation="MRIFAENQPIPNMADIKALEDFVTQVRRDILRQVHRVNSGHPGGS
FT                   LGCAEFFTALYQEVMTHNSDFNMNGKDEDVFFLSNGHISPVFYSVLARSGYFPVEELNT
FT                   FRLINSRLQGHPTTHEGLPGIRMASGSLGQGLSVAIGAASSKKLNGDDKLVYALLGDGE
FT                   LQEGQNWEAFMYAAGNGIDNLIATIDLNGQQIDGSTDKVLPLGNLKEKFVAFGWDVLEI
FT                   KDGNNIKEVIDGLKLAKSKTGNGKPVLILMHTVMGNGVDFMMHTHAWHGKAPNDEQLET
FT                   ALKQNPETLGDY"
FT   gene            211895..212848
FT                   /locus_tag="CA2559_00875"
FT   CDS_pept        211895..212848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00875"
FT                   /product="transketolase, C-terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00875"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87264"
FT                   /db_xref="GOA:A3U4U7"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4U7"
FT                   /protein_id="EAP87264.1"
FT                   /translation="MKTYTNTGNKDTRSGFGAGLTELGKTNENVVALCADLTGSLKMDE
FT                   FKENHPDRFFQIGIAEANMIGIAAGMTIGGKIPFTGTFANFSTGRVYDQIRQSVAYSDK
FT                   NVKICASHAGVTLGEDGATHQILEDIGLMKMLPGMTVINTCDYNQTKAATLAIAKHEGP
FT                   VYLRFGRPKVSNFTPENGTFEIGKAVLLNEGTDVTIVATGHLVWEALLACEALEKDGIS
FT                   AEVINIHTIKPLDEEAIINSVKKTGCIVTAEEHNYLGGLGESVARTLSLNLPTPQEFVA
FT                   TEDTFGESGTPAQLMDKYGLNADAIIAKAKQVISRK"
FT   gene            complement(212921..213895)
FT                   /locus_tag="CA2559_00880"
FT   CDS_pept        complement(212921..213895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00880"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87265"
FT                   /db_xref="GOA:A3U4U8"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4U8"
FT                   /protein_id="EAP87265.1"
FT                   /translation="MKMNKILLPAILVLAVLVSCNDDDTEDFVPVPDRDRAEVDAEDQL
FT                   ELQTYLETHFYNYEEFENPSEDFDYVVRFDTIAGENIDKIALIDRPELYTKTVEEADID
FT                   YNLYVLKVREGVGRAPTAADSTYVTYRGELLTNDLFDSSVQPIWFDLPGGLTASGLIPG
FT                   FTAGITEFKDASGFVENTDGTITFNDDYGIGAVFFPSGIGYFSGSVGIIPTYSPLIFSF
FT                   KLFVSNQADHDNDGIPSFLEDATGENSEFESGEDTDSDGGPNYLDADDDNDGVLTRDEI
FT                   ISEDLNNDGVITIDEIIFTDSNNDGIADYLQADVDGSPEEEEE"
FT   gene            213973..214350
FT                   /locus_tag="CA2559_00885"
FT   CDS_pept        213973..214350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00885"
FT                   /product="heat shock protein 15"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00885"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87266"
FT                   /db_xref="GOA:A3U4U9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4U9"
FT                   /protein_id="EAP87266.1"
FT                   /translation="MRVEKYLWCVRYFKTRSLATKACNLGRVKIDGQNLKPSREVHPLD
FT                   EIEVRKNQINYKIRVLDTPKSRVGAKLVGLYLVDITPAENLEKLDLLSYTKSQQREKGT
FT                   GRPTKKDRRDIEGFIDDTDDI"
FT   gene            214340..214915
FT                   /locus_tag="CA2559_00890"
FT   CDS_pept        214340..214915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00890"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87267"
FT                   /db_xref="GOA:A3U4V0"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4V0"
FT                   /protein_id="EAP87267.1"
FT                   /translation="MTSNFWEQRYANNNTGWDLNTVSPPLKHYIDTLSNKTLFILIPGC
FT                   GNAYEAEYLHNQGFENVFIVDLAEHPLLEFSKRVPDFPKSHILHLDFFNLTQKFDLILE
FT                   QTFFCALHPEQRLHYAHHTSKLLNSNGCLVGLFFNKEFDKTGPPFGGNKKEYKNLFKNL
FT                   FKIKKLENCYNSIKPRQGSELFFIFEKK"
FT   gene            214919..215413
FT                   /locus_tag="CA2559_00895"
FT   CDS_pept        214919..215413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00895"
FT                   /product="pyrimidine regulatory protein PyrR"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00895"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87268"
FT                   /db_xref="GOA:A3U4V1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4V1"
FT                   /protein_id="EAP87268.1"
FT                   /translation="MTTAEILSAEDIEHKIRRMAFQIYEANINESSVIISGIYPNGHKL
FT                   AIKLKEAVEKVSNLTVTLCKLDIDKKNPIGTVKVDVSEDVYKNKSVILVDDVLNSGSTL
FT                   IYAVSHFLKVPLQQFKTAVLVDRNHKKYPVKADYKGISLSTSINENVVVTFSPKMKVTL
FT                   E"
FT   gene            complement(215405..215902)
FT                   /locus_tag="CA2559_00900"
FT   CDS_pept        complement(215405..215902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00900"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87269"
FT                   /db_xref="GOA:A3U4V2"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4V2"
FT                   /protein_id="EAP87269.1"
FT                   /translation="MGSGKSTLAKAISNVTDIPFYDLDDLIVKDTDISISDFFKKHGEI
FT                   AFRKKETEVLKALIESNERCVVALGGGTPCYANNLSLIKDSNSVTSVYLKLSLDALVNR
FT                   LWGNKINRPLISHIESKQELNDFVRKHLFERSFYYNQADVILGCDAKTESELTKEISTE
FT                   LF"
FT   gene            216032..216104
FT                   /locus_tag="CA2559_t07677"
FT   tRNA            216032..216104
FT                   /locus_tag="CA2559_t07677"
FT                   /product="tRNA-Lys"
FT   gene            216143..216215
FT                   /locus_tag="CA2559_t07679"
FT   tRNA            216143..216215
FT                   /locus_tag="CA2559_t07679"
FT                   /product="tRNA-Lys"
FT   gene            216224..216307
FT                   /locus_tag="CA2559_t07681"
FT   tRNA            216224..216307
FT                   /locus_tag="CA2559_t07681"
FT                   /product="tRNA-Leu"
FT   gene            216449..217342
FT                   /locus_tag="CA2559_00910"
FT   CDS_pept        216449..217342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00910"
FT                   /product="transcriptional regulator, MerR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00910"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87271"
FT                   /db_xref="GOA:A3U4V4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4V4"
FT                   /protein_id="EAP87271.1"
FT                   /translation="MVKQKFSIKDLENLSGIKAHTIRIWEKRYGALEPDRTDTNIRLYD
FT                   ITNLQKLLNISFLNDNGYKISRISKMSDEDVIKLVNRISASKSDENRAIAKFKISMINF
FT                   DEILFESTYQKLLSEKGFRDIFKDVFIPLLEEIGLLWQTKTINPCHEHFITNLIKQKLS
FT                   IEIEKAQNPNNYDDSKLFVLYLPPNEIHDLGLNYFHYEVLLENYRVINLGSSLPVCDLE
FT                   NILNLHETIIFATYFTVQPEDIPSYIKEFEEVICKESIKELWVMGRKHQGIDKSGFKNN
FT                   IKFFDTVSQAILQLQY"
FT   gene            217344..218810
FT                   /locus_tag="CA2559_00915"
FT   CDS_pept        217344..218810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00915"
FT                   /product="CrtI1"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00915"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87272"
FT                   /db_xref="GOA:A3U4V5"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014105"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4V5"
FT                   /protein_id="EAP87272.1"
FT                   /translation="MKKRIAIIGSGFSALASASYLAKEGHQVTIYEKNDTVGGRARQYK
FT                   KDGFTFDIGPTWYWMPDVFERFFNDFDKKPSDYYTLEKLSPAYKVVFSETESILIEDTL
FT                   TKIYAAFEAEEKGSSKQLEKFITKAKSNYDIAIKDLVYRPGVSPLELITPETIKKIGAF
FT                   FSTISKDVRKQFNNEKLIQILEFPVLFLGAKPSNTPAFYSFMNYADFGLGTWHPKGGMY
FT                   QVVLGMKTLAESLGVNINTNANVEEILVQNNSATGLVVNGDTITADIVLSGADYHHTET
FT                   LLPLKLRQYSETYWSKKTFAPSALLFYIGFDTPIINVEHHTLFFDVDFEEHSKAIYDDP
FT                   QWPENPLFYASFPSKTDSSVAPKGKEAGIFLIPLAPGIEDTEAIRETYFKKIMTRFENL
FT                   TNQTVQKNVIFKETYCLNNFIEDYNSYKGNAYGLANTLFQTAFLRPKLKSKTVKNLYFT
FT                   GQLSVPGPGVPPSLISGKLVAGLIQKHNKN"
FT   gene            218811..219650
FT                   /locus_tag="CA2559_00920"
FT   CDS_pept        218811..219650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00920"
FT                   /product="phytoene synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00920"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87273"
FT                   /db_xref="GOA:A3U4V6"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4V6"
FT                   /protein_id="EAP87273.1"
FT                   /translation="MKSIFDTVSRDCSKAVTNSYSTSFSLASKLLAPSIRQDVYNVYGF
FT                   VRFADEIVDSFHNYDKETLLNDFEEDLKKAVRDKISLNPILNSFQETVHKFNIEEEFYM
FT                   SFLRSMRLDLYKSKYLTKEEYEDYIYGSADVVGLMCLKVFVKGDQQKFDDLKEDAMKLG
FT                   SAFQKVNFLRDLKADLEDLNRSYFPNTNLQKLDENSKKRIIEEIELDFKAGLNGIQRLP
FT                   VEAKLGVYTAYVYYLRLLHKLKKTPSLEIRNKRIRVPNYEKAGLMAKSYVTCRLNLL"
FT   gene            219653..220105
FT                   /locus_tag="CA2559_00925"
FT   CDS_pept        219653..220105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00925"
FT                   /product="beta carotene hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00925"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87274"
FT                   /db_xref="GOA:A3U4V7"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4V7"
FT                   /protein_id="EAP87274.1"
FT                   /translation="MDILIWILVFLLTFCIMEFMAWFTHKYVMHGFLWKLHKDHHHKDH
FT                   NSWWERNDFFFIFYALVSIGCFVSWSFYNVWIGLPIGLGIFAYGVAYFMVHDIFIHQRF
FT                   KLFRNANNWYAKGIRRAHKIHHKHLGKEKGECFGMLFPPLKYFNRS"
FT   gene            220115..221266
FT                   /locus_tag="CA2559_00930"
FT   CDS_pept        220115..221266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00930"
FT                   /product="putative lycopene cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00930"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87275"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4V8"
FT                   /protein_id="EAP87275.1"
FT                   /translation="MSTKSFDFIIIGAGLSGLHLAHSFLNDPFFKDFSIAIIDKSSKSK
FT                   NDKTYCFWEKGKGNWDSILTKSWTSALVYGTSKKINVPLLPYTYKMVKSLDFYNFVLSE
FT                   IEASNTIQFFKDDVQYVNEDNIVTVTCNTNSFQAKHVFDSRVTEDFEKDKTATTLLQHF
FT                   KGCTISTKKPTFNPEVLTMMDYRLTYKNTTSFMYVLPITPTKALIEYTFFSPSLVEDHI
FT                   YDSHLKTYISNTLSITEYTIIESEKGIIPMTDYKFKKHHTDAITKIGTAGGWVKGSSGY
FT                   SFKMSEKKSKRIIENIKTGSHPTNGLYNNKFELFDVIFLKVLKDDNSYGPKLFQDFYSK
FT                   NEMAIALKFLDEETSFNEDLKIVWSLRSFKFVKAFFKTLFRFR"
FT   gene            complement(221249..221818)
FT                   /locus_tag="CA2559_00935"
FT   CDS_pept        complement(221249..221818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00935"
FT                   /product="Thiol-disulfide isomerase/thioredoxin-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00935"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87276"
FT                   /db_xref="GOA:A3U4V9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4V9"
FT                   /protein_id="EAP87276.1"
FT                   /translation="MKTIFKFLKKQWQNVLLLFFIVLLLIPQTRFKIQVFAQQLLAFSP
FT                   SIEETSKEVNLSNWEIVDANGMVLRVEHINKPLVVNFWATWCPPCVAEMPSFQNVYNDY
FT                   KDDVVFVFLSNEDVKTTKAFAEKHNYTLPFYTSTNSLPEAFNSDQLPTTYVLDAKDNLI
FT                   INHTGSANWNSKKFRSTLDELLSKPE"
FT   gene            complement(221820..222542)
FT                   /locus_tag="CA2559_00940"
FT   CDS_pept        complement(221820..222542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00940"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00940"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87277"
FT                   /db_xref="GOA:A3U4W0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4W0"
FT                   /protein_id="EAP87277.1"
FT                   /translation="MTSIGQRIKSLRKEKKYSQQFIAEKLNISQSAYSLIESAHNNVMI
FT                   GHVLTLSKLYDVSTDFILKGETNLIHMNIENGFIPFINVEAVAGNLNELQGAHSQSEYD
FT                   RYRIPGFKSSSNHLLFEVEGDSMTPTFYPNDILICEAQHSISDVADNSLVVIGTEKGLL
FT                   TKRVKKEYGYCYLESDNKHYSPIKIENEEIKAILSIKGKVTSKVNTNTKVETDKFEHME
FT                   SNLKQLEYQIERLSQQIK"
FT   gene            complement(222846..225113)
FT                   /locus_tag="CA2559_00945"
FT   CDS_pept        complement(222846..225113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00945"
FT                   /product="aconitate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00945"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87278"
FT                   /db_xref="GOA:A3U4W1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006248"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4W1"
FT                   /protein_id="EAP87278.1"
FT                   /translation="MAFDIDMIKKVYDQMTERVDKAREVVGKPLTLSEKILYSHLWDGN
FT                   ATQAFTRSKDYVDFAPDRIACQDATAQMALLQFMQAGKPNVAVPTTVHCDHLIQAKQGA
FT                   KADLKRANETSNEVFDFLESVSKKYGIGFWKPGAGIIHQVVLENYAFPGGMMIGTDSHT
FT                   VNAGGLGMVAIGVGGADAVDVMAGMPWELKFPKLIGVKLTGKLNGWTAAKDVILKVAGI
FT                   LTVKGGTGAIIEYFGPGAKSMSCTGKGTICNMGAEVGATTSTFGYDESMERFLRATDRS
FT                   DVADAANAVKDYLTADPEVYETPEDYFDEVIEINLDELRPHLNGPFTPDLATPVSEMKD
FT                   KAKKNDWPIKVDWGLIGSCTNSSYEDLTRAASIAKQAVDKKIVAKSDFGINPGSEQIRY
FT                   TAERDGILKIFEDLNATIFTNACGPCIGQWDRSDLKGDEKNTIVHSFNRNFSKRADGNP
FT                   NTHAFVGSPEMVAAIAISGRLDFDPLNDTLLNEDGEEVKLDVPSGIELPPKGFDVEDAG
FT                   YVEPVSDGSDVDVKVAEDSERLQLLTPFEPWDGKNLTDAKLLIKAFGKCTTDHISMAGP
FT                   WLRYRGHLDNISNNCLIGAVNAYNKQTNFVKDQLTGEYDAVPKVQRHYKEKGIPTVVVG
FT                   DHNYGEGSSREHAAMEPRHLGVKVVLVKSFARIHETNLKKQGMLGITFANEADYDLIQE
FT                   DDTFNFIDLEDFAPDKQLTIEIVHEDGSKDTIKANHTYNLPQIEWYKEGSALNLIKKQN
FT                   RS"
FT   gene            complement(225359..226312)
FT                   /locus_tag="CA2559_00950"
FT   CDS_pept        complement(225359..226312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00950"
FT                   /product="methanol dehydrogenase regulator-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00950"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87279"
FT                   /db_xref="GOA:A3U4W2"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4W2"
FT                   /protein_id="EAP87279.1"
FT                   /translation="MSDVSAVKHLVEKHTQLKKEIAKVIVGQEQVIEEILISIFSGGHA
FT                   LLVGVPGLAKTLMVNTISQALGLDFKRIQFTPDLMPSDILGSEILDKNREFKFLKGPVF
FT                   SNIILADEINRTPPKTQAALLEAMQERSVTVAGTNYPLSLPYFVLATQNPIEQEGTYPL
FT                   PEAQLDRFMFSINLDYPSFQEEVDVVKATTGDHKATVNPLFTAQEIIDFQQLIRRIPVA
FT                   DNVIEYAVKIVGKTRPKSSEASNLVQEFVDWGAGPRASQNLILAAKTHAATRGKYSPDI
FT                   EDVQAVATGILRHRMIRNYKAEAEGISIEQIIKDLF"
FT   gene            complement(226316..227806)
FT                   /locus_tag="CA2559_00955"
FT   CDS_pept        complement(226316..227806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00955"
FT                   /product="putative exported peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00955"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87280"
FT                   /db_xref="GOA:A3U4W3"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4W3"
FT                   /protein_id="EAP87280.1"
FT                   /translation="MQLKIMNLRFSTKYLTVAALIGATVSLTAQETTSDSTAVQTKQVI
FT                   VTESSTAVTETAAVQDTVKKPFKKFKVDGVAAVVGEYVVLDSDIDKAYIELKSQGISVQ
FT                   DITRCNLTGKLLEDKLYAHHAVIDSIMVNDAEVNAYVDQQIDYMKRQLGTMEKVLNFYQ
FT                   KDNEGEFRAELFEINKQNKLAGEMQRSIVDGIEITPEEVREYFNGIPKEDRPLFGDEIE
FT                   IAQIIIQPEIPQAERQRVIDRLNEMRRDVLDNGASFATKAVLYSQDTGSRANGGQYSLT
FT                   RKDPFVKEFKDAAFSLQEGEISEPFETEFGFHILMVDKIRGQTVDVRQVLLVPDTTPES
FT                   VNAARKQIDSLKTEINKGTITFEDAAVQFSTEEETKQDGGQLINPATGDTRFELTKIDP
FT                   TIYNQVVNLDENEISPILTEEDRVGRKKFKIMTVTDRYEEHIADYAQDYLKIKELALKE
FT                   KQLKAIEAWQEEKIDDTYIKINGDYRNCDFASDWLKQN"
FT   gene            complement(227769..228644)
FT                   /locus_tag="CA2559_00960"
FT   CDS_pept        complement(227769..228644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00960"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87281"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4W4"
FT                   /protein_id="EAP87281.1"
FT                   /translation="MKTKLNYILAIFCGVFLLQSCDYFNFDFGPEDEREVVARVNKSFL
FT                   YREDISNLTTATTSKEDSTVIVNNYIDRWATQQLLIDRAKLNLNLERQKKFDKLVDDYK
FT                   NQLYTKAYTDAMVVKKIDSVITENQVKEYFEANSTAFSLNETLYKLRYVRLPDGSSSIN
FT                   QVKREIARFNSEDKQSLMNSVVEYPQYNLNDSIWRESRQLLEDLPVLKEAQPWQLNTAD
FT                   RYVQLKDSLGVYLIYIKDIKERGEQAPLSYIKPTVEQIILNKRKQELIKNLRTDITKDA
FT                   IKNNEFEIFN"
FT   gene            complement(228634..230592)
FT                   /locus_tag="CA2559_00965"
FT   CDS_pept        complement(228634..230592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00965"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00965"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87282"
FT                   /db_xref="GOA:A3U4W5"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4W5"
FT                   /protein_id="EAP87282.1"
FT                   /translation="MKLYRFLFVFCLLIAGNTIAQELDKQIIMTLDGEPVYASDFVRVY
FT                   QKNLDLVQDESQKDVDEYLKLFIDYRLKLREAYEQGLDTTLKFQREFKTYRNQFARNFL
FT                   TDNNVSEALVQEAYDRTVNEVNASHILIRVNQNATPEDTLKAYSKIKDIREKAVNGRSF
FT                   ETLAKTYSEDPSAKKNGGELGWFTALKMVYAFEEQAYTVPVGDVSEPFRTRFGYHILKV
FT                   NDRRASAGEVEVAHIMVSPKPKDTVFNPKDRIEELYLKVKQGEDFGVLAKQFSDDRNSA
FT                   RREGKLDRFGSGKLNSEVFEKKAFSLTKAGQVTEPFETQYGWHIIKLIDRFPIPSFNEM
FT                   RGELEKKVTKDSRANLISDALVAGLKDHYSIGDFSEAKSFFSAYVTKDVKDGNWAISDN
FT                   STLDQPLFKLRDSVFKYRDFAKFIYNKQVNKGLSGDKNTAINNWLKEYVDGKVLAYHRD
FT                   HLEQEDKEFSNIVSEYRDGLLLFDLMEMNIWNKAKKDTLGLKTYYETNKQNYLWDKRVN
FT                   VTMAKVNNKTDAKKVRNLMKKGVSEVDVKSQINSDESMTTLFSNGTFNVEDEVLPKKLK
FT                   IKQGISKVYEEDNYYTVVNIKDVLPAGPKTFKEAKGTIVSDYQDYLEKNWIAALRTKYS
FT                   VNINDDTVNLIKTKLED"
FT   gene            230745..231197
FT                   /locus_tag="CA2559_00970"
FT   CDS_pept        230745..231197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00970"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87283"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4W6"
FT                   /protein_id="EAP87283.1"
FT                   /translation="MKYSSQIIIELPREKTISIFDNAENMKHWQRGLIHYKQLSGDFGA
FT                   EGAKMQLDYKMGKRELTMIETIIKNDLPDLLITSYDTKGVYNIQTNRFEITSNGHTKWT
FT                   SESEFRFNNLMMKIMGFLMPGAFKKQSLKYMKDFKAFAEDNKSVLD"
FT   gene            231279..231971
FT                   /locus_tag="CA2559_00975"
FT   CDS_pept        231279..231971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00975"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00975"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87284"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4W7"
FT                   /protein_id="EAP87284.1"
FT                   /translation="MKKLLVLITVLSSISLFSQNAINQFDSNGKRHGLWKKTYEGYDQL
FT                   RYQGTFEHGKEVGEFMFYKPKYGKQPSAIKTYSKDTDLVLVSYFTKKGKLISKGQLKDR
FT                   LRTGKWEYYHNNTDAIMMIEHYKDDKLHGKKTAYFDNGNITEEYNYINGNKEGDYKLYS
FT                   LNGVLLQHLNYKNNELHGAALFYNGKGEVTKKGQYKNGRKDGYWQYYDQGNLTEEIFFP
FT                   INTSRKKG"
FT   gene            232065..233255
FT                   /locus_tag="CA2559_00980"
FT   CDS_pept        232065..233255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00980"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00980"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87285"
FT                   /db_xref="GOA:A3U4W8"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4W8"
FT                   /protein_id="EAP87285.1"
FT                   /translation="MKSVVVGLSGGVDSSVSAYLLKEQGYEVIGLFMKNWHDDTVTISD
FT                   ECPWLDDSNDAMLVAEKLGIPFQTVDLSEEYKERIVDYMFNEYKNGRTPNPDVLCNREI
FT                   KFDVFMKIAMSLGADYVATGHYCRKSSIEKDGETIYQLLSGKDNNKDQSYFLCQLSQEQ
FT                   LSKTLFPIGELQKSEVRKIAAEQDLVTADKKDSQGLCFIGKVRLPDFLQQQLKPKEGDI
FT                   VEIDSTLDQYAKDTKEDFNTTEEELAYLSKKFTYNFEDGKVVGKHQGAHYFTKGQRKGL
FT                   GVGGTPEPLFVIDTDVEENIIYTGQGKQHPGLYRRGLFVSPHEIHWIREDLKLDTGDTM
FT                   NVMARIRYRQTLEKATLHQTEHGLYVIFDNPQSAIAEGQFVAWYQDEELIGSGVIS"
FT   gene            233265..234209
FT                   /locus_tag="CA2559_00985"
FT   CDS_pept        233265..234209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00985"
FT                   /product="putative dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00985"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87286"
FT                   /db_xref="GOA:A3U4W9"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4W9"
FT                   /protein_id="EAP87286.1"
FT                   /translation="MTTNRITELFNIKYPIIQGGMIWASGWKLASAVSNAGGLGLIGSG
FT                   SMYPEVLREHIQKCKKATDKPFGVNIPLLYPNMEEIVQIIIDEGVKIVFSSAGNPKTWT
FT                   SHLQSHGITVVHVVSSVKFALKAQEAGVNAVVAEGFEAGGHNGREETTTLALIPMVKEQ
FT                   LDIPLIAAGGIANGKSMLSVMILGADGVQVGSRFVATPEASSHQNFKDLVLKAKEGDTQ
FT                   LTLKELAPVRMLKNKFFNQVIELYSKNPSKEDLIELLGRARAKKGMFEGDLDDGELEIG
FT                   QISGLIHDIKPAGKIVEDMVSEFKIAKEMLPTF"
FT   gene            complement(234199..234744)
FT                   /locus_tag="CA2559_00990"
FT   CDS_pept        complement(234199..234744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00990"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87287"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4X0"
FT                   /protein_id="EAP87287.1"
FT                   /translation="MGNFKTLAVFLLLGMVSLGYTQQKISYDDHPVLTWSDFKGAPVYD
FT                   SEFHANTNSGFSYTWSYKTTNGEVDLQYEVYSTFYPNGSWVHPDHKTDKLLKHEQAHFD
FT                   ISEIHARKLRKAMQAYKPGRNIRKDLQKLYNDIELERVKMQGEFDLESAHSMNSQAEMK
FT                   WQAHIAKELDKLKEYAKK"
FT   gene            complement(234737..235138)
FT                   /locus_tag="CA2559_00995"
FT   CDS_pept        complement(234737..235138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_00995"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_00995"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87288"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4X1"
FT                   /protein_id="EAP87288.1"
FT                   /translation="MTSKITYNGNLRTTCEHIKSGNTFITDAPTDNNGKGEAFSPTDTV
FT                   VTALASCMLTVMGIKADQLNVDMINATAEVVKIMASNPRRISKIDMVIKLPKSYDEKTK
FT                   SILEHTANTCPVHFSLHPDIEKNISFVYG"
FT   gene            complement(235138..237093)
FT                   /locus_tag="CA2559_01000"
FT   CDS_pept        complement(235138..237093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01000"
FT                   /product="LysM-repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01000"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87289"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4X2"
FT                   /protein_id="EAP87289.1"
FT                   /translation="MKTILASLIFFLAFNLQTNAQEFLTYTVNQDDTATSLAKRFNTTI
FT                   QEIYRFNPDAKNGLRKGAVLVIPKSTSAQNNTANSQDRTPKTFKTHKVKRKETLYSLSK
FT                   EYNVTVDEIKRYNKWLYAEQLKRKDKIRIPVYPNVVISDTQTVDDPRFIIKEEPVVKIV
FT                   RTPSGKTTHTVQAKEGKYGISRKYGMTIAELEAMNPDMEEPIQPGQVLNVKGEASTEST
FT                   VITDERFTFYEVKPKENFFRLEQRFNISEDSLIALNPKLEEGLKVGMIIKIPKKNTSIA
FT                   FGNDELVNLEASIRNYDAKTVALLLPFNSHKITNDSLSNTEERIKRDRVMRISLDFYSG
FT                   ALVALEEGKQKGLSTTLRVFDTEQSTSKVRAIINDNNFNDVDVVVGPLLNSTVEEASAL
FT                   LNRKDIPVISPLSSRKANGRENLIQSRPTDDMLHEVMLSYLEAMHTDQNIVILADDNAS
FT                   SIKSLITSKFPTASTLKKQEDNFVYQNDVSKQLVSGKDNWFIVATEDVALLSNLLSYLN
FT                   AYRSKHNIQLFALEKTSAFDSEDVSNDHLSNLKFTFPSVDKEFDYENKAKFIIDYNAKY
FT                   GIAPNKYAVRGYDIMYDTLLRLANSDTYMESLENNIATEYIENKFSYVENGISGYMNNG
FT                   IYIMQYGENLTLKPVE"
FT   gene            complement(237103..238632)
FT                   /locus_tag="CA2559_01005"
FT   CDS_pept        complement(237103..238632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01005"
FT                   /product="bifunctional GMP synthase/glutamine
FT                   amidotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01005"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87290"
FT                   /db_xref="GOA:A3U4X3"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4X3"
FT                   /protein_id="EAP87290.1"
FT                   /translation="MQNNVLILDFGSQYTQLIARRVRELNIYCEIHPFHKVPEDLSTFK
FT                   AVILSGSPFSVRGEDAPQPDLSNIKGKLPLLGVCYGAQYLAHFFGGKVEASNVREYGRA
FT                   NLSVIKDKEALFASITENSQVWMSHSDTIKELPDNAVRLASTADVLNAAYRIDGEETYC
FT                   IQFHPEVYHSTDGKQLLENFLVHIAGVEQSWTPGAFVDLTVNELKEKIGEDKVVLGLSG
FT                   GVDSTVAAVLLHKAIGKNLYCIFVNNGLLRKNEFVDVLDQYKDMGLNVKGVDASARFLK
FT                   ALEGKSDPEEKRKEIGRVFIEVFDDEAHDIEDVKFLAQGTIYPDVIESISVNGPSATIK
FT                   SHHNVGGLPDFMKLKIVEPLRMLFKDEVRRVGKEMGISPKLLGRHPFPGPGLAIRILGD
FT                   ITAEKVRILQEVDAIFINGLREWELYDKVWQAGAILLPVQSVGVMGDERTYEQVVALRA
FT                   VESTDGMTADWCNLPYEFLQKTSNTIINRVKGVNRVVYDISSKPPATIEWE"
FT   gene            239267..240379
FT                   /locus_tag="CA2559_01010"
FT   CDS_pept        239267..240379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01010"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87291"
FT                   /db_xref="GOA:A3U4X4"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4X4"
FT                   /protein_id="EAP87291.1"
FT                   /translation="MPLVFTRFSSEAWSAIFIIFATTTLINSKLPNPRQIFAIGLLLGI
FT                   AFLFRYQSAFISIGLIAWLLYNKRLNLKGFLQMSSAILIIALIGILIDTWFYDKWIITA
FT                   WNYFNFNIIEDGASTFGTKPFLWYPYAIIKYTFLPIGILIGLSFLYLLLERRKSIFLFI
FT                   FLPMFVVHCLIPHKEVRFLFPLAFIVTPVVFLFIQYVFKSTRGIFPNKFAIPTLAIISI
FT                   ICITLANSIGLVALVSKTAGARSIHTGKYIYDNFKGDAITLHQTQFAAPYAPFGVPLNF
FT                   YKIENLTTKTIITPCDITLKDINPNNINLVTFAFKDKLDTTCLSENTTLEFTKLTQSWP
FT                   DWLVTLNEFYTAYETPEQTYLYKVDLKRQD"
FT   gene            complement(240362..241975)
FT                   /locus_tag="CA2559_01015"
FT   CDS_pept        complement(240362..241975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01015"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87292"
FT                   /db_xref="GOA:A3U4X5"
FT                   /db_xref="InterPro:IPR011199"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4X5"
FT                   /protein_id="EAP87292.1"
FT                   /translation="MPIDCIPFEDTGYFSNLVCDYLKQEEKLASFYRSFPSDAAFLTHA
FT                   KERNKQFPKTHRRILVEVLKEQYQNIETSSETQQAIQLLAEDTTVTITTGHQLNLFSGP
FT                   LYFLYKIISTINLSEKLSENYKDINVVPVFWMATEDHDFEEINHFTLHGKKFKWSPERY
FT                   SDNANGAVGRFTTEGLEDVLKLLKAELGVGHQAEYLVKLFEDTYLNHNTLAEATRYLTN
FT                   ELFAKYGLVILDADHPKLKQLFVPTVLDELQHQTSYKAVTNTSKHLESANYPVQVSARE
FT                   INLFYLTETSRERIVNVDGTFGVVDSDKIWNTDQELFEEVSAHPERFSPNVIMRPLYQE
FT                   TILPNICYIGGGGELAYWFELKTYFDKVEVPFPVLLLRNSVLLRTDKQYGKQQKLRVSN
FT                   EELFLKQHELINRKVRQISNINIDFSTQKAHLKDQFEAMYALAEKTDATFLGAVKAQEV
FT                   KQLKGLDHLEQRLLKAQRLKLKDEVSRLVALQNELFPLKSLQERTINFSEFYLEYGDQL
FT                   INELKENLDPLSHEFSILTL"
FT   gene            242078..244549
FT                   /locus_tag="CA2559_01020"
FT   CDS_pept        242078..244549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01020"
FT                   /product="Conserved secreted Zn-dependent enzyme from
FT                   deacylase/carboxypeptidase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01020"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87293"
FT                   /db_xref="GOA:A3U4X6"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4X6"
FT                   /protein_id="EAP87293.1"
FT                   /translation="MKQLTLLFAFLCSITISAQLKSPEAFLGYEIGQQFTRHADVVNYF
FT                   EHVAQFSPMVSFSTYGKTNERRPLTYAIVTSENNLSNIEAIRTNHLKNTGILSGDSTTD
FT                   KAIVWLSYNVHGNEASSTEAAMATLYKLITEKQDWLENTIVIIDPCVNPDGRDRYANWY
FT                   NQVKATPYNIAQDATEHHEPWPGGRPNHYLFDLNRDWAWATQIETQERLKVYNQWLPHV
FT                   HVDFHEQGINDPYYFAPAAEPFHEEITDFQRDFQTKIGKNHAKYFDENGWLFFTKERFD
FT                   LLYPSYGDTYPTFMGAIGMTYEQAGHGRAGLGINTDEGNVLTLKDRVAHHTTTGLSTIE
FT                   VASNNAAELNAEFNAFFNNATNNASYVLNGSQDKIDAVTNLLDKHEIVYNFGNSGYVSG
FT                   YNYNTQKNGSMKMTTSSLIISANQPKGKMATTLFEPQTKIADSLTYDITAWSIPYAYGL
FT                   DAVVTTKSVSGNTSRQRSDISNSPMTTSAGYITKWDSMKDARFLSELLKAGINVRFSEK
FT                   AFTNANTDFEKGSLIITRSDNTSLENFDTLVTTIANTQQRQLNPVTSSFANNGPDFGSP
FT                   HIKRINKQKIAVLTGDYTSSLSYGELWHFFETQLHYPITSINTNNFSGIHLGDYDVLII
FT                   PDGYYGSYFDESKLDTLKEFVKNGGKIIALANALQIFSDNDSFSLKQKTQEQEDTNNEL
FT                   LPYNMRERQSTNDFIIGSIFKTTLDTSHPLAFGYKNTYNSLKLSADAYQFLDSGYNVGY
FT                   INGTAQNISGFAGKNALKNQDNTMVFGEERLGKGSIIYMVDNPMFRSFWENGKLLLVNA
FT                   IFYVNNSKVRI"
FT   gene            245113..251130
FT                   /locus_tag="CA2559_01025"
FT   CDS_pept        245113..251130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01025"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87294"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR026341"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4X7"
FT                   /protein_id="EAP87294.1"
FT                   /translation="MFQNLNAQTQVYADAVVSQNNVLNSNYAIAENGSFATLNSSGGLL
FT                   AGGGAYTGEIELEFSSTIPANTTTFVRIDFDNDLLNVLLGGALGDLLADTVGTIALGDH
FT                   FFNVEARDNATTVLSASSATGATDRFRVVVDRNGYFYIAITPDADYNRVYIEDATSTLL
FT                   LGQENSMNVHHAFFYNELGNNVTPLYSDFDESGLGLDVADLADSGVVNPQFAIDNNNSS
FT                   FSEISLGTVSLGAGIQQNIYFAREYSNTDEFSITLKSEPALVAVGIQNNVVITALNDGA
FT                   EVFSTTLGDVLNIDLLGLFENGEIVTVPFAPNINFDAVSISLSSLQPVGATQSINIYGI
FT                   SIAGELLPGEVDNRVFADTVSNENNATNSGSAVGDNGNFAVLESFGGIAVGIGSYTGDI
FT                   ELQYPEVVPANTTSYIRIDFDDDVLNSLLGGSLGDLLADIVGTIALGDHFFNVEARNNT
FT                   TTVLSESSSDLSTDRFRVVVDEFGFFYIAITPDSDYDRVYIEDVTNALLLGETNTMNVH
FT                   HAFYYSSTTPCATNNLLTDFDDSGIGLDLLELQNSGVTNPQFAIDENDSNFSQLSLGVV
FT                   SVGAGIQQNIYFSKDYSPQSEISVRLKTDPSLLTVGLVNNVVISALDDGTEVFSTTLSS
FT                   GLDVDLLGLLSDGEIVDVTFAPNLTFDTVTVSLTSLEVVTVAQSLDLYGVSIIDTSIPD
FT                   ADAEQTFCLLDDPTVADLEVNSGQNIIWYDAPVGGTAYSTTDPLIDGEVYYASQTIDGC
FT                   ESTLRADVTVTVNDTATPTTTESNQEFCIQDNPTVADLQVNETGVTWYDMATGGTAFNP
FT                   TDALIDGQSYFGALTVDGCDSTTRLEVIVTIANTPPPTTTEPNQEFCIQDNPTIADIQV
FT                   NETGVIWYDMATGGTAYDSTDALTNGQTYYASQTLNNCESASRLAVVVTIFETPTPTTD
FT                   NTEQEFCSQDVPTIADLMVNEADVTWYDMATGGTAYDPTDELVNGQSYFASILADNCES
FT                   ATRLEVVATINTTPPPTTDDIAQEFCIQDNPTVSDIDVNEPGIVWYDMETGGTALPVDE
FT                   PLVDGVTYYASQTINNCDSTSRLAVQVEVIETPTPTTDSTDQEFCIQDNATIADLHVNE
FT                   SNVTWFDMATGGTAYDPTDGLVDGQSYYASIVADNCESASRLEVSVSIFETQTPTTNEA
FT                   IQEFCSQDNPTIADLQVNEPNITWYDMATGGTAYNATDALVDGQTYFASQLSNNCESAT
FT                   RLEVTATIYSTPPPTTTDSTQDFCTQDSPTVGDIQVNEPNVTWYDMATGGNAFSNTASL
FT                   INGQTYYGSIIENDCESVTRLAVTVTINDTQAPTTVDSTQDFCIQDNPTIADLQVIGTA
FT                   VIWYDMPTGGTVFNSTDTLDDNTIYYATQTQNGCESEDRLAVSVSIFNTPPPTTTNSTQ
FT                   EFCISNNPTVADLQVNESNVIWYDAPTNGTAFSNTASLINGQVYYGSQTLNGCESVSRL
FT                   AVTVIIRNTAPPTTLNNMQEFCIQDNPTIADLQVNESDVIWYDMSSGGTILSPSEPLIS
FT                   GQTYYGAQNINGCESNTRLAIGVTIFNTPPPTTANDTQTFCAANNPTVGDIQVNELNIT
FT                   WYNSAAGTTPLNDSDALVDGQIYYASQTLNGCESVTRLAVTTNITNTPPPTTVNANQEF
FT                   CEVNNPTIADIEINETNITWYDMPTGGTAYNLTDALTDGFTYYASQTVDGCESSTRLEV
FT                   NVSIFSSDSATITSSASGDVCLNTVITYTTEPGNTNYMWDFTGGMVVAGGGIDDNTIEI
FT                   LWDTQDNTTVSVSYDAANACSSGGPVTINEIVSVCGDLAITKTVDETSPTIGSEVTFVI
FT                   NVTHSGPNDFFDITIDEVLPSGYELISSNATVGTYTSAIGEWFIPTLMTNQTASLTITA
FT                   EVLGDGDYLNIATIESSTPEDTNPSNNSAEASVDPLCLFVYSQFSPNGDGMNENFTISC
FT                   IERFPNNEIQIFNRYGSLVYKKVGYRNDWDGTANVSSVSSNGELLPAGTYYYVIKMNDQ
FT                   EDNRMSGWVYLIK"
FT   gene            251170..252126
FT                   /locus_tag="CA2559_01030"
FT   CDS_pept        251170..252126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01030"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87295"
FT                   /db_xref="InterPro:IPR019861"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4X8"
FT                   /protein_id="EAP87295.1"
FT                   /translation="MKNRSQFKSFNTKASVGCIVLLAILFGFTNTTSAQQTPQFTQYMY
FT                   NTMSINPAYAGSLQTLDIVGTYRDQWRGIDGAPVTQNLGIHSPLRNEKVGVGLNLTNDK
FT                   LGPAKQFFADANFSYTVQVNPTAKLAFGLKTGVRIFNVDFTEGDFVNPNDQLNNNIDNR
FT                   ASVNLGGGLYLHSNNWYLGLSIPDFLSDDFYDDNDEAVAEEEIQYFLIGGYVFDFSQDL
FT                   KFKPAFLAKYLDGTPLVVDVSANFLLYDRLTLGASYRFEDSFSGVVGFEVLKGFFAGYS
FT                   YDASTTELSNYNDGTHELILRYTAPPKIEIIESPRFF"
FT   gene            252190..254082
FT                   /locus_tag="CA2559_01035"
FT   CDS_pept        252190..254082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01035"
FT                   /product="OmpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01035"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87296"
FT                   /db_xref="GOA:A3U4X9"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4X9"
FT                   /protein_id="EAP87296.1"
FT                   /translation="MSQSSLKNADKLFKTQAYTKAAEAYKEFLAEYEGEVEIQTLLNAG
FT                   DANYFIYNTSKAKQYYQRAFNRKPDIKEPYISRYVRTLRSEEDYEFAHKVALKALKESN
FT                   DDEALNTYKKQYEAFLELLNSEEDSEYRLMNISANSKYSDFAPVIFGDSIVFSSSRTGN
FT                   SKELYSWNEQPYLSLYIASKGEDGDLIDAKPFSKSSKSDYHDATLAIMPDTNIVFFASS
FT                   NINKNKLILDSERENNFKLYSGELKNGVIKNREELNFNSDSYSVGHPSISDDGKYFFFA
FT                   SDMEQGYGGSDIYYCKITPSGKLTTPKNAGPEINTSGNDFFPHMKDGVLYFASNGHVGF
FT                   GGLDVFQIEFNRDTEDFTNLQNLGKTVNTSYDDFSMVFNTDGMTGYLASNRTQGVGDDD
FT                   IYYFTKEPIPCDQILFGNIKDLRTKENLAEVTVTIKDSLNETISILKTDADGNYEIKLP
FT                   CLTKVTILAEKEDYFEQEKIGETGDVDGEENESIDFELERAKDMIVVDETTKQEKIDLE
FT                   TIYFDFDKADITPKAAAVLDKAVKLMNFYPDMVINIESHTDSRGSKKYNYSLSDRRAKA
FT                   TQQYIYSQGIAEERIVSAQGYGEQRLLNECKDGVKCSDEEHDVNRRSDFIILKR"
FT   gene            complement(254222..254632)
FT                   /locus_tag="CA2559_01040"
FT   CDS_pept        complement(254222..254632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01040"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87297"
FT                   /db_xref="GOA:A3U4Y0"
FT                   /db_xref="InterPro:IPR025635"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Y0"
FT                   /protein_id="EAP87297.1"
FT                   /translation="MIQRIQSVYLLLVIIISGALPFFVTLWKDAEGAAVVALDEPFVFG
FT                   MYIGSSALAIIALLAFKNRKLQFVLGRLNIILNFILLGLFVYWSLRVPGEMNISEKGIG
FT                   MLLPIISIVFLVLANKAIMRDENLVKSVDRLR"
FT   gene            254812..256551
FT                   /locus_tag="CA2559_01045"
FT   CDS_pept        254812..256551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01045"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01045"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87298"
FT                   /db_xref="GOA:A3U4Y1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Y1"
FT                   /protein_id="EAP87298.1"
FT                   /translation="MLDINALKAKKLPELQEMAKTLEVPKYRSLKKLDLVYQILDYQAA
FT                   NPHKVKEVLSDDKQSDSQKTNSETTKKSSDSKPKQATTKDSSTKAEQKTKPARAPRANQ
FT                   KNPRPKPAKGATSSQEDKKQKPIAKESKETKPAPANKRPNPKAQQNSNSSKTDSRSNND
FT                   TKSSNDNRHPKSDNRNNSKNDNRNSKQNNKGNRDTRNRYKEPDYEFDAIIESEGVLDMM
FT                   QDGYGFLRSSDYNYLSSPDDIYVSQSQVRLFGLKTGDTVHGQVRPPKEGEKYFPLIKIN
FT                   KINGLKPSVVRDRVSFEHLTPLFPQEKFNLAERQSTISTRIIDLFSPIGKGQRGMIVSQ
FT                   PKTGKTMLLKDVANAIAANHPEVYQIILLIDERPEEVTDMQRNVKGEVVASTFDKEAHE
FT                   HVRVANIVLEKAKRLVECGHDVVILLDSITRLARAYNTVQPASGKVLSGGVDANALHKP
FT                   KRFFGAARNIEGGGSLSIIATALTDTGSKMDEVIFEEFKGTGNMELQLDRKIANRRIFP
FT                   AIDLTSSSTRRDDLLLDEKTIQRMWIMRKYLADMNPVEAMEFINDRFKQTKNNEEFLIS
FT                   MNG"
FT   gene            complement(256680..256928)
FT                   /locus_tag="CA2559_01050"
FT   CDS_pept        complement(256680..256928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01050"
FT                   /product="30S ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01050"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87299"
FT                   /db_xref="GOA:A3U4Y2"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Y2"
FT                   /protein_id="EAP87299.1"
FT                   /translation="MANHKSALKRIRNSETKRLRNRYQHKTTRNAIKKLKEADKEEATK
FT                   LLPSVNSMIDKLAKNNVIHSNKAGHLKSQLAKHVAAL"
FT   gene            complement(256952..257023)
FT                   /locus_tag="CA2559_t07719"
FT   tRNA            complement(256952..257023)
FT                   /locus_tag="CA2559_t07719"
FT                   /product="tRNA-Glu"
FT   gene            complement(257084..257155)
FT                   /locus_tag="CA2559_t07717"
FT   tRNA            complement(257084..257155)
FT                   /locus_tag="CA2559_t07717"
FT                   /product="tRNA-Glu"
FT   gene            complement(257224..258702)
FT                   /locus_tag="CA2559_01055"
FT   CDS_pept        complement(257224..258702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01055"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01055"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87300"
FT                   /db_xref="GOA:A3U4Y3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Y3"
FT                   /protein_id="EAP87300.1"
FT                   /translation="MGKNLTPRNEDYSKWYNELVVQADLAENSAVRGCMVIKPYGYAIW
FT                   EKMQAQLDKRFKETGHQNAYFPLFVPKSLFEAEEKNAEGFAKECAVVTHYRLKTDENNP
FT                   GKLIVDPEAKLEEELVVRPTSEAIIWNTYKGWIQSYRDLPLLINQWANVVRWEMRTRLF
FT                   LRTAEFLWQEGHTAHATREEALAETEQMNNIYAEFVENFMAIPVIKGAKTESERFAGAV
FT                   ETYCIEALMQDGKALQAGTSHFLGQNFAEAFDVKFTSKEGKQEYVWASSWGVSTRLMGA
FT                   LIMTHSDDKGLVLPPNLAPIQVVIVPIYRNDEQFNAISEEAKLLTEELRAVGISVKFDG
FT                   RDTHKPGWKFAQYELQGVPLRIAIGPKDLENGTVELARRDTLTKEFVKREDVVAKAKGL
FT                   MTEIQDTLLKKALDFRNDHITEVDDFKEFKKVLKNKGGFISAHWDGTTETEDRIKEYTK
FT                   ATIRCIPFNGKKEEGICVLTGKPSSQRVLFAKAY"
FT   gene            259792..261306
FT                   /locus_tag="CA2559_01060"
FT   CDS_pept        259792..261306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01060"
FT                   /product="putative hemin receptor"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01060"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87301"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Y4"
FT                   /protein_id="EAP87301.1"
FT                   /translation="MKKIFITMAVCITAISMKAQDVSDAVLFSSENVTGTARYRAMSGA
FT                   FGALGGDLSAIGNNPASSAVFLNSTASLSISGYTISNDSFYGDGLAINDDTSGKLNQLG
FT                   GVFVFNNRDENAAFKKFTLGLNYNLTQNLDDEYFAFGETQNSIDQFFLENAQGIPLDLL
FT                   QLQDGESISSLYSFLGETQGYAAQQAFLGFQGFIIDPEMDDPDNTTYISNLTNGNFLQD
FT                   YAYRSNGLNGKFSINGGAQINDDLYLGVNLNTHFIDYERQTVLFETNNNSGSGINEIFF
FT                   ENNLRTFGNGFSAQVGGIYKVSPMFRLGLSLETPTWYNISEETTQYLDTFSNDEGSAVV
FT                   NPNVINIYPEYNFKTPGKYTLSGAILFGKQGLISLDYSYKDYSNTEFDSQFNSSNTFAD
FT                   LNNNIKNTLQGATSINIGGEYRIREWSLRGGFRYQESPYKDETTIGDLKGYSAGFGYDF
FT                   GNIKLGLAYDIYEQDRSPQLYSIGLTNRANINTTNSSFTATLSFGL"
FT   gene            complement(261377..263959)
FT                   /locus_tag="CA2559_01065"
FT   CDS_pept        complement(261377..263959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01065"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87302"
FT                   /db_xref="InterPro:IPR026341"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Y5"
FT                   /protein_id="EAP87302.1"
FT                   /translation="MMILNNEPDVSITYHETMAEAEMGTDAIDTTQPYQNTEANVDDIY
FT                   IRAENDITGCTTIRQLDLIVTASPEIESLDDLFQCDDDGDGEAIFDLTQNTPNALGTTQ
FT                   PDVTVSYHESETEAEDGTMPISMPQMYENQTNPQTIWIRLEGDDTQCVTVGSFEITVEA
FT                   LPVVNAPTALRICNDDYDDPAITTFDLTVKDEEITGQSPVLSNIEVYYYESQADLDNDN
FT                   PIADPAMYENTQNNQTIFVEVVDTATMGQCSDTTTMTLTVLPLPSPSSTNENGELDQES
FT                   CDDSDGIIDTMADFDLTASGDVIAMGENVDLTYHLSEQDALDNINAIPAAEETAYNTVT
FT                   RTIWVRVENGNQNNTCSVLVSFEVVVNANPVLTDTSYTAALCEPEDTTPGITAFDAQEV
FT                   TNNLVPDLLATPIADFTVTYHFTQAEADMGVNAIPDGFLFSEAVNNPVYIRVVDNTTMT
FT                   QCYNSDNLAELTITVDTQPEFVMGDVDDIFLCADSAMDQDTSTMFDLTVRDGQIDGSMN
FT                   PDTEVVYYASQADYDAGIEIDAADAVMYTNTVNPQTIIAELFNPVTGCRSDGTVEFDLV
FT                   VQSLPVLPAALQMPQGDIVCTDAQGNVLSPFDIGYDLGATDGLEYTYDWTPDNIDADGD
FT                   GNEDAIYTVTSLTQATTYSVVITRVNDPVSGMPSCENGLDENGNPYTVTFTPSSAPFAA
FT                   NASVTETSFNEEAEYTVTVTPLGQDGQPLPLEDYLYRIDDGPLQTSNVFTGVGPGSHIG
FT                   YAVDVEGCGEVGDPFGIIDYPRFFTPNGDGYNDTWNIIGIDGQPAAKIYIFDRYGKLLK
FT                   QLSPTGNGWDGTFNGRVLPSDDYWFSVEFVEPADGSIQEFRANFTLKR"
FT   gene            complement(263956..267048)
FT                   /locus_tag="CA2559_01070"
FT   CDS_pept        complement(263956..267048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01070"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87303"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Y6"
FT                   /protein_id="EAP87303.1"
FT                   /translation="MSVQELVEDVLISGSCANVSNFNSGTGTVFNGIGYFDGNGSDFPF
FT                   AEGIVLSTGSATAAVGPNDTGGFGSQNTDAPADPDLDLAVPTTDARQDRTFISFDFVPF
FT                   VNEISFNFVFASEEYDGGFQCTYTDAFAFLLTDSEGNVQNLAVLPGVAPPNNIVSVTNV
FT                   HPDVPGSCGPQNEEFFGQYNTGAAAATSPTEFIGQTTVISAMGNVNPGETYRMKLVIAD
FT                   DRDGVYDSAVFLEGGSFNLGANLGDDITIEAGTASCNDQTVTLDVSESSANAISFAWYQ
FT                   DGVLIPDETDPVLVVTEEGVYTVEVEYNVNCVATDDVLIEFAPQPVANAPQDIQLCDDG
FT                   VTPVVFNLTENDDDVLGGQDATMFNISYHETMENAEMDMAPIPNPDMYPPTGNPQTIFV
FT                   RIEDAATESCFDTAQFEIQSFFVSIGELDDLIECDTDNNGTVIFDLSVNDDNALDGQDP
FT                   NEFTVSYHNTQADADTGDNPIGPNYNSTVSTETIFVRVENNTNQTCYESGSFQIQFFQQ
FT                   PIIASQPQDLELCDDGTGNGDFNLESNTPIVLGSQDPNQFTVTYHETQVDADMGENPIT
FT                   DSNTYSNTENPQTIFVRIENIDNTDCYETSTFILSFFQVTIGVLEDLFACDQGSGGTAL
FT                   FNLTENDDNALDNQNSLDYSITYHDTQAGADTNDTSIPDPTMYTNTINPQTIYVRIESD
FT                   GSTDCYETGTFQIEATPSAPIQDPEPLEVCDTDNDGFSEFDLDSTSNGIALGNPDLVVT
FT                   FHPTQSDAINGVNDLSSPYGNVMEDTQTVYVRVEDDINGCVLFTELELIVYDSPLLETP
FT                   DPLVLCDLGSDGEEVFDLTQAEMQILDGLDPALYDITYHETLMQAMDNMGAIGNPTAYT
FT                   NQGNPQTIYVRVTDPSNMADCNNIVELELRVRDLPAANQPEELEVCDDETGVDTEDEVA
FT                   TFDLTTMDTVINGDANVDIFYYETTADIPGNPIADPESYVNIANPQTLEVRVEDEFGCE
FT                   NFTTLTLVVNPNPSIADMIFEYELCDIDNDGVRSSTLRARR"
FT   gene            267313..268230
FT                   /locus_tag="CA2559_01075"
FT   CDS_pept        267313..268230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01075"
FT                   /product="NifU-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01075"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87304"
FT                   /db_xref="GOA:A3U4Y7"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Y7"
FT                   /protein_id="EAP87304.1"
FT                   /translation="MSFSIDIQSTSNPSILKFETNKFLSRHDSFEFHNIDEAKPSPLAQ
FT                   KLFYLPFVKTVYIAQNFIAIQKYDIAEWSDVQDEVKSQILEYLNSGEDVIIDKTPQKKS
FT                   VPVTIYAESTPNPSVLKFVANKKLVVQSEEFKSIDDTANAPLAQALFNFPFVKEIFIDE
FT                   NYVSIQKYDMAEWGDITTELRDFISQHIMSGKPVVTEHRANKLAPQTNGGTTEKPQLDL
FT                   SHLDDTSKAIVEILDEYIKPAVASDGGNIMFDSYDEETKSVKVILQGACSGCPSSTMTL
FT                   KNGIETMLRDMLNGKVEHVVAING"
FT   gene            complement(268305..270554)
FT                   /locus_tag="CA2559_01080"
FT   CDS_pept        complement(268305..270554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01080"
FT                   /product="phosphate sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01080"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87305"
FT                   /db_xref="GOA:A3U4Y8"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Y8"
FT                   /protein_id="EAP87305.1"
FT                   /translation="MDNIYIIMLVALFALAITDLVVGVSNDAVNFLNSAIGSKAISMRT
FT                   IMIVASIGVAVGAIFSSGLMEVARKGIFLPGMFYFDEIMVIFTAVMLTDVLLLDFFNSL
FT                   GLPTSTTVSIVFELLGAAVAMGFIKIYQSDDSFALIYQYINTEKATEIIVGILLSVVIA
FT                   FSIGALVQYLSRVVFTFKYEKKIKLFGALFGGVSMTAITYFILIKGMKTISFISDDIKT
FT                   YINENTLIIIGISFVIWALISQVLMKVFKIDILKAIIVVGTFALALAFAGNDLVNFIGV
FT                   PIAAWQSYDIYISSGVPANELIMSGLAGSVETPEFLLILAGAIMVITLWFSSKARSVVD
FT                   TGVNLSRQGEGVEKFSPNFLSRTIVRYSVLLGAALETVIPKKVQETIDSKFEKVEIPKS
FT                   KKLEAPAFDMVRASINLVVASILISIGTNLKLPLSTTYVTFMVAMGTSLADRAWDRESA
FT                   VYRVAGVVNVVGGWFVTAIVAFIAAAVFSSILYFGGLVALVLLIILAVALIVRSAMAHK
FT                   KKVREEKAVKHYNLSDIITINEITNDTSNNISSVLSGINKSYSGVVTNLGYHDLSKLKK
FT                   ENKRVGKLVKEVDELKGNIFYFIKSLDDNNIGASQFYIHIADHLHDMVHSTKTITNNSY
FT                   NHVNNNHKNLKFNQIRELKGIDKKMQVLFDDITNTFDSHSFERINVIIDDKQELLNHVS
FT                   DLIQKQITRIRTSETSPKNTKLYFGILLETKDLIVSTMNLLQLFQEFYNDARRTL"
FT   gene            270711..270911
FT                   /locus_tag="CA2559_01085"
FT   CDS_pept        270711..270911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01085"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87306"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Y9"
FT                   /protein_id="EAP87306.1"
FT                   /translation="MSVLKVIEVLANSDKSWEDAARKAVKHAGKSVKNIRSVYINEQNA
FT                   VVKGDEITEFRVNAKITFEVD"
FT   gene            271004..273049
FT                   /locus_tag="CA2559_01090"
FT   CDS_pept        271004..273049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01090"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87307"
FT                   /db_xref="GOA:A3U4Z0"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Z0"
FT                   /protein_id="EAP87307.1"
FT                   /translation="MSSKINTNNLLSKETSPYLLQHANNPVNWVGWSSKVLNKAKEDNK
FT                   LILISIGYAACHWCHVMEHESFEDISIAEVMNANFINIKVDREERPDVDQVYMKALQLM
FT                   TGQGGWPLNIVALPDGRPIWGATYLPKKQWKGSLHQLADLYRSNSEHMITYAEKLSKGM
FT                   AQVSLVTKTDSNTDISKAFLKDSLQTWSNQFDYTYGGTQRSPKFMMPNNYQFLLRYAHQ
FT                   TKDKSLLDYVILTLNKISYGGVYDHIGGGFSRYAVDSKWHVPHFEKMLYDNAQLVSLYS
FT                   KAYTLTKDPWYKTVVTNTLNFIETELTRDNGSFYSSLDADSLNTEGKLEEGAFYVWTKA
FT                   ELKSLLNEDYPLFEAYYNINEYGHWEHNNYVLIRTKSNSEIANDFSIPISTLDKKLTSW
FT                   KALLNNNRQKRAQPRLDDKSLTSWNALMINGYIDAYKAFQINDYLEIALKASNFILDKM
FT                   LQKDGSLTHSYNKNEAKINGYLEDYAFTIEAFISLFEVTFNSKWLSKAEELTTYALKHF
FT                   YDEEQHIFYFNSNLDDALVTRPIEQQDNVIPASNSTMAKNLFKLSHLLGIKSYKEIAEQ
FT                   QLKTVLQDAKTYASGYSNWLDVIMNFSFPYHEIVITGKNASNYVKDLNLNYIPNSITAA
FT                   TEKENNDLLIFKNRYVDEQTLIYVCKDNTCNVPTDKVSSAVKQCLE"
FT   gene            273131..273973
FT                   /locus_tag="CA2559_01095"
FT   CDS_pept        273131..273973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01095"
FT                   /product="mechanosensitive ion channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01095"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87308"
FT                   /db_xref="GOA:A3U4Z1"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Z1"
FT                   /protein_id="EAP87308.1"
FT                   /translation="MDLENIKNYDEIISKYFDKVLGYLPNILLAIVIFIVGWWIIKITT
FT                   GWLRKFFLKKDYDPTLENFLLSLTNWALKVLLFVTVVSQLGVQTSSFVAIIGAAGLAIG
FT                   LALQGSLANFAGGVLILLLKPFKVGDFIKGQGIEGTVKEISIFNTKLLTFGNQLAIIPN
FT                   GKLSNDNIINYTEEGKRRENLVFGISYDDDVKLAKDILLKLTLEQETVMAEPAPMIVLA
FT                   ELADSSVNLSLRYWALNDDFWALRWHILEEGKARLEAAGISIPYPQRDVHMYAEDVKS"
FT   gene            complement(273970..274638)
FT                   /locus_tag="CA2559_01100"
FT   CDS_pept        complement(273970..274638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01100"
FT                   /product="putative glycoprotease family exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01100"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87309"
FT                   /db_xref="GOA:A3U4Z2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Z2"
FT                   /protein_id="EAP87309.1"
FT                   /translation="MALILSIETSTTNCSVALGKDGVLVSLKEDYNDQYSHAERLHVFI
FT                   MEILEENKKKLSELDAIAISKGPGSYTGLRIGVSTTKGLCFSLDKPLISIGTLNSLAHQ
FT                   INSDGLIVPMLDARRMEVFSSIYNSDFKLQREIEAQILDETSFVEELNLGKVTFVGNGA
FT                   PKFKEVCKHPNAIFVNKLPSAREMVPLAEAKYKSDTFEDVAYFEPFYLKDFVAGKKKAN
FT                   "
FT   gene            complement(274641..275921)
FT                   /pseudo
FT                   /locus_tag="CA2559_01105"
FT                   /note="membrane fusion efflux protein"
FT   gene            complement(275926..277257)
FT                   /locus_tag="CA2559_01115"
FT   CDS_pept        complement(275926..277257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01115"
FT                   /product="putative outer membrane transport/efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01115"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87312"
FT                   /db_xref="GOA:A3U4Z5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Z5"
FT                   /protein_id="EAP87312.1"
FT                   /translation="MKGFFSIVCIVLFAVSGQAQDKTWTLAECINYALENNISIKQSEL
FT                   NLEAAEIDKSDAIGNFLPSINTSASLSKNTGSSINPVTNTFENTSFTSATGGINAGLTL
FT                   FDGLRNFRQLQRSKLNRLASQYSLDKMKDDISLFVANAYLQVLFNKETVNVLRSQNEIT
FT                   IQQLERTQELVDAGSLPAGDLLEIRATNADEKQRLIVAKNNVRIALVSLAQTLLIKDYD
FT                   NFQIADDDYNIIDDGLLSKPVSVIIAQAEEERNEVKLAEQNKAIAEKDVEIAKGAYLPT
FT                   LSAFFQYNTRWADNDFFNRDFRTQLYENDGLGYGLQLSLPILNGFATKNSVKRSKINVL
FT                   RAEYNLEQAKLDLESNVYQAYVDAEGAKEAYEAALVALESQSQANTYAQERFDVGLTNA
FT                   FDFSQSKIRLQNAEIEAKRTKYDYIFKLKVLELYFGVPASELKF"
FT   gene            complement(277319..278440)
FT                   /locus_tag="CA2559_01120"
FT   CDS_pept        complement(277319..278440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01120"
FT                   /product="membrane fusion efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01120"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87313"
FT                   /db_xref="GOA:A3U4Z6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Z6"
FT                   /protein_id="EAP87313.1"
FT                   /translation="MKKSVTIIILIVIALGFSISLYYLYSKNQEDPIIYTTETPTTETI
FT                   VKQTVATGSIVPKEEILIKPNISGIIDEVAIEAGDIVKQGDLIAKLKIVPNVNNLASSK
FT                   NQISTAKIALDNQKKIYDRQKALFDKGVISANEFDQANTSYLQAKQTYDAANQTYQIVK
FT                   TGSARGLGVSANTEIRATVAGMVLDVPVKTGNQVIESNNFNDGTTIATLANVNNMIFEG
FT                   KVDESEVGKVSEGLPLEITVGAIENKTFDAVLDYIAPKGVSENGAIQFEIKGTLQKQDS
FT                   TFIRAGLSANASIILAKAENVLAIKEALVQYDPKTQLPFVEIETGEQSFERRDVKLGIS
FT                   DGINVEVLEGLSKDDKIKVWNQVKPVQGFSGRG"
FT   gene            complement(278470..279729)
FT                   /locus_tag="CA2559_01125"
FT   CDS_pept        complement(278470..279729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01125"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01125"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87314"
FT                   /db_xref="GOA:A3U4Z7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Z7"
FT                   /protein_id="EAP87314.1"
FT                   /translation="MFSKDRWDEIIEALSSNWFRTILTAFGVLWGIFILVVLLAAGKGL
FT                   ENGVKSDFGGIATNTMFMWTQGISKPYKGLPKGRQFNYKTDDVQAIRDNVPNLRFISPR
FT                   NQLGGFGGTNNVVRGLKTGAFNVYGDYPEIIQQEPMDITSGRFINYGDIEEKRKVAIIG
FT                   EGVKTAMYGFAEDPLGTYIKINGVNFMVIGTYKKKGGNGDAEEEQKQIYVPFTTFSQAF
FT                   NRGNNVGWMAITAEDGSSITEIKPQIFELLKERHTIHPEDDRAIGNFDLYEQFSKVNGL
FT                   FIALRFVAYFVGILVLLSGIIGISNIMLIVVKERTKEIGVRRALGATPWNIRGQILMES
FT                   IVLTIISGMLGIAFATLVIYGANQMLEANGPVDMFANPSVNLTVVLIALTILVVSGLLA
FT                   GLIPAQNAIKIKPVDALRTE"
FT   gene            complement(279731..280975)
FT                   /locus_tag="CA2559_01130"
FT   CDS_pept        complement(279731..280975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01130"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01130"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87315"
FT                   /db_xref="GOA:A3U4Z8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Z8"
FT                   /protein_id="EAP87315.1"
FT                   /translation="MFNIERWQEIFQTIAKNKLRTFLTGVSVASGIFILVILLGFGQGM
FT                   ENGISKEFQNDASNRISVWSGVTTVEHKGLNPGRFIQMKNKDFEFITKKYSDKIENKSS
FT                   LYRIWNGLATHGKESGSYRVEGVHPDYQFLENETLTAGRYLNQNDIDHNEKVVVLGHKV
FT                   KRDLFKEEDAIGKQLQVSGVNFKVVGVYTDPGGEREEARIFLPITTSQKVFNGGNIIRN
FT                   MAFTLQPKENFEEALIESEQFSAEIQDYLKQVHTIAPNDMSAINVNNTLEQTKRFYDLI
FT                   WMIRTFFWGVGICTIIAGVVGVSNIMLIIVKERTREIGVRKALGAQPWSIIGMILHESI
FT                   FVTAIAGFTGLVFSMALLEIIGPNIEMDYILNPSVNFNVAITTVFILIIAGAIAGFFPA
FT                   WRAASIKPIEALRDE"
FT   gene            complement(280968..281669)
FT                   /locus_tag="CA2559_01135"
FT   CDS_pept        complement(280968..281669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01135"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01135"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87316"
FT                   /db_xref="GOA:A3U4Z9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3U4Z9"
FT                   /protein_id="EAP87316.1"
FT                   /translation="MIEITNLHKSYKTGANSLHVLKGINFSVKEGELVSIMGSSGSGKS
FT                   TLLNILGMLDEADEGSYMLDNVPIKNLNEKIAAKYRNKFLGFIFQSFNLIGYKTALDNV
FT                   AMPLYYQGMKRNERIDRSMAYLEKVGLADWATHLPNQLSGGQKQRVAIARALASDPKVL
FT                   LADEPTGALDTKTSYEVMDLIQGINDEGKTILVVTHEDDIAHMTKRIVNLKDGLIIDDS
FT                   KVNQVKAIQHV"
FT   gene            complement(281752..281982)
FT                   /locus_tag="CA2559_01140"
FT   CDS_pept        complement(281752..281982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01140"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87317"
FT                   /db_xref="GOA:A3U500"
FT                   /db_xref="UniProtKB/TrEMBL:A3U500"
FT                   /protein_id="EAP87317.1"
FT                   /translation="MKSYNYKLLAVIAFCLLLPIVADAQCAMCRAVLESEGDGGMAKGI
FT                   NNGIVYLMIFPYLLVGGIAFAIYKYKKRNKA"
FT   gene            complement(281993..282529)
FT                   /locus_tag="CA2559_01145"
FT   CDS_pept        complement(281993..282529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01145"
FT                   /product="YozB"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01145"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87318"
FT                   /db_xref="GOA:A3U501"
FT                   /db_xref="InterPro:IPR007352"
FT                   /db_xref="UniProtKB/TrEMBL:A3U501"
FT                   /protein_id="EAP87318.1"
FT                   /translation="MATRTKTDKIVIPVIVALSLVVPLVVLLLMNLNVRYNLLGLEVGT
FT                   FPFFHAVINACTALLLLAGYFLIKIGDMKWHRNVMITAFALSCVFLVSYVISKISNDPV
FT                   PYGGEGILRPIYFFILISHIVLSGIIVPLVLFTMYRGLNKQYIKHKKVARWTFPIWFYV
FT                   SVTGVLVYIFMLPYY"
FT   gene            complement(282513..283244)
FT                   /locus_tag="CA2559_01150"
FT   CDS_pept        complement(282513..283244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01150"
FT                   /product="YpmQ"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01150"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87319"
FT                   /db_xref="GOA:A3U502"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3U502"
FT                   /protein_id="EAP87319.1"
FT                   /translation="MKRKYSYIGLGIIILIFGIIVIPKIIETLSEGTVVKENRTESVKN
FT                   SDLAFVTRDGEKRKVPPFKFINQDGDTITNQDYIGKVYVAEFFFTSCPTICPIMNSNLV
FT                   AVDQEIGDENFGIASFSIDPRKDTPEVLKDYEKQYGITNPNWNLMTGDRDAIYDLARTG
FT                   FTIYAEENPEVPGGFEHSGYFALVDQEGYLRSRKDEFGNVIIFYRGSVPQGIDPTQADE
FT                   EPQIDILIEDIKILLDHGNKN"
FT   gene            complement(283253..283930)
FT                   /locus_tag="CA2559_01155"
FT   CDS_pept        complement(283253..283930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01155"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87320"
FT                   /db_xref="GOA:A3U503"
FT                   /db_xref="UniProtKB/TrEMBL:A3U503"
FT                   /protein_id="EAP87320.1"
FT                   /translation="MQLETIKDNRNSPVKYAVLIALFVLPLVIYLLSASGEELFNLLPQ
FT                   LTKDVSNLEEFEDLEGNNVSLDNKITILGFFGDTPESKKGNALNLNEKIYKRNYKFDDF
FT                   QFVILISEEGKDQAIELRNKIEAYTSTEKWIFAVGSKDAISNVFNSLKTDMSLSPNYST
FT                   PYVFIIDKEQILRGRENDEDNGLMYGYNSADIAEISNKMVADVKVILAEYRRALKKYNS
FT                   DRK"
FT   gene            complement(284070..284429)
FT                   /locus_tag="CA2559_01160"
FT   CDS_pept        complement(284070..284429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01160"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87321"
FT                   /db_xref="GOA:A3U504"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="UniProtKB/TrEMBL:A3U504"
FT                   /protein_id="EAP87321.1"
FT                   /translation="MAHDTAHGKDPIKRIWFVFALLSIVTIVEVILGIIKPAFLIENTF
FT                   IKMKLLNWIFIILTIYKAYYITWAFMHMEGETKGLRRSVVWTAIFLVCYLVTILLVEGD
FT                   YIYEVYRTGHQAWDF"
FT   gene            complement(284448..285428)
FT                   /locus_tag="CA2559_01165"
FT   CDS_pept        complement(284448..285428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01165"
FT                   /product="probable cytochrome-C oxidase subunit III
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01165"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87322"
FT                   /db_xref="GOA:A3U505"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A3U505"
FT                   /protein_id="EAP87322.1"
FT                   /translation="MEATAVSTGTEGKTWGGGNQPLKASYGKLMMWFFIVSDALTFSGF
FT                   LASYGFSRFKFIDSWPIADEVFNHFPFLHGVDAPMYYVALMTFILIGSSVTMVLAVDAG
FT                   HHMKQKKVILYMFLTIIGGAIFVGSQAWEWKNFINGEYGAVETHGGQILQFVDNTGHRV
FT                   ALENIAVAVPGEREQHQKKNGVWYNGEKELPTYSMNEIIKGFEAKPEILVRTQILDENG
FT                   QKTILSREESLAKLKAEGRNIVEGANLKHNEYGTPLFADFFFFITGFHGFHVFSGVIIN
FT                   IIIFFNVIIGTYERRGSYEMVEKVGLYWHFVDLVWVFVFTFFYLV"
FT   gene            complement(285567..286145)
FT                   /locus_tag="CA2559_01170"
FT   CDS_pept        complement(285567..286145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01170"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87323"
FT                   /db_xref="GOA:A3U506"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A3U506"
FT                   /protein_id="EAP87323.1"
FT                   /translation="MDLTQGTEQEKTARSKKMMLWFGIISMVMMFAGLTSAYVVSSERQ
FT                   DWLNDFTLPASFIWSTLAIVTSSITLFIAKKQLRANNRKGATYSLLATLVLGVIFVGLQ
FT                   LQGFEDIINLGFYFTGSESSITTSFIYVLVLAHLAHIAAGLIVLLVLIYNHFKQRYTAE
FT                   QMLGFELGATFWHFVDVLWLYLFVFLYFF"
FT   gene            complement(286145..287038)
FT                   /locus_tag="CA2559_01175"
FT   CDS_pept        complement(286145..287038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01175"
FT                   /product="cytochrome c oxidase assembly factor (CtaA) +
FT                   protoheme IXfarnesyltransferase (CtaB)"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01175"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87324"
FT                   /db_xref="GOA:A3U507"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:A3U507"
FT                   /protein_id="EAP87324.1"
FT                   /translation="MAETALHNTTTSWSSDFKEITKMRLAISVVFSSVAGYFLGATVLD
FT                   FVDVLLLAIGGYLMVGASNAYNQVIEKDLDALMDRTKNRPLPAKRMSVQMALFIATAFA
FT                   ISGVAVLYYINPKTAMFGALSILLYVLVYTPLKTKTPLAVFVGAFPGAIPFMLGWVAAT
FT                   NEFGIEPGTLFMIQFFWQFPHFWAIGWWLFDDYKKGGFAMLPTGKRDTKTAIQVILYTF
FT                   WTVLISLVPAFGMTGRLYLTPIAAVIIGLLGVFMMYYAIMLYKKRTPKSAKQLMFASVS
FT                   YITLLQIIYVLDKFIR"
FT   gene            287220..288104
FT                   /locus_tag="CA2559_01180"
FT   CDS_pept        287220..288104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01180"
FT                   /product="Zn-dependent hydrolase, glyoxylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01180"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87325"
FT                   /db_xref="GOA:A3U508"
FT                   /db_xref="InterPro:IPR001018"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A3U508"
FT                   /protein_id="EAP87325.1"
FT                   /translation="MKALTHTLALIFLSSPLFLHSQKVSINSEKLSNHVYMITGQGGNI
FT                   GLFEDTDALLMIDSQFGKLTPQILAEIKTISPKPIKTLLNTHHHGDHTGGNENIVNKGA
FT                   SVFAHKNARVRLLKSIEDKTKSSKKALPILTFSTELNLYFDTTQVLIFHPETAHTDGDA
FT                   IIYFVEENVLHTGDVFFNSRYPYIDLDSGGSVIGAKKAIEHMLMLINAETQIIPGHGKR
FT                   ATKTDLEKTLAMYNTCISRIENEINRGATQEDVSQNRALTEDLDGKFYTEGAFISPEKW
FT                   RRTIYLSLTSEKN"
FT   gene            complement(288109..290202)
FT                   /locus_tag="CA2559_01185"
FT   CDS_pept        complement(288109..290202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01185"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87326"
FT                   /db_xref="UniProtKB/TrEMBL:A3U509"
FT                   /protein_id="EAP87326.1"
FT                   /translation="MKTFYTLFLLLPFLVCAQTATTSSERYPVFNECESVALSNLENCF
FT                   DATLKSFIYSNFQIPDGIETKDLKTDVTVIFEVDTEGIFNVIYTEAVYEELQEATLAVF
FT                   EKLPKIQPASYNSRAIDMQFRMPIKLPLSRMLNPTINEIDDPVKAITTVSPNTIKNEYD
FT                   DVEVRPFKNRQASSQINIPLSHEVYSRFDDDMNQVGTNNHTASKPLLYKEVQRYYDFEK
FT                   ENKKLHYDKSSWFGRKFFNEHLIRLQGKDYWFTLDVAADLQLGRDLDRDLTTYNNTRAA
FT                   VFQGGLGKNLNFHTVLYESQGRFAGYYNDFARSLKPDGGNPAIIPGRGIAKEFGEDAFD
FT                   YPIATGYLSYSPSKFFNVQFGHGKNFIGDGYRSLLLSDNASPYPYFKLNTTFWKLKYTN
FT                   TWMSLRDVRPAVTADGSFRTKYMANHYLSINVTKRLNIGLFENVIWENDNDRGFDLNYL
FT                   NPVIFYRAIEFSTGSRGGNAIIGLTGKYKWSDSFNTYAQLLIDEFSSGDITGGEGSYKN
FT                   KIGYQLGIKYFNAFNVPNLIVQAEYNQVRPYTYSHNSITLNYGYNNQSQAHLWGANFRE
FT                   YIGILRYKHKRYYGLGKLIYGERGFDFKDGVVYGGNIFTSEDDRPADNGNNLLQGNKAT
FT                   SFYGELELGYIINPATNFKVYATAIYRDFSVDEDVSDVIQTQNTVWLNFGVRTDLFNWY
FT                   YDY"
FT   gene            complement(290322..291101)
FT                   /locus_tag="CA2559_01190"
FT   CDS_pept        complement(290322..291101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01190"
FT                   /product="TonB"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01190"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87327"
FT                   /db_xref="GOA:A3U510"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A3U510"
FT                   /protein_id="EAP87327.1"
FT                   /translation="MLVDSVFIVTLKPFIMNNKHDANVRKSTLVNFQLGLIVALVTTVL
FT                   VMEIKSAVPVVKPDDVAVDNSEVETYFNPEFVIVKDKVEKKQPLKKVQKIIDVIDVIDD
FT                   DTPTELFEDTELTTEPDITEIEPGDLVEKTEDPEIAPVPFVKVEFVPIFPGCEGLTTNA
FT                   ERRACMSSKINTIVQRKFDGDLASDLGLSGQQRIYVRFKIDKTGNVVDIQGRSTHPKLT
FT                   KEGERMAGLIPKMKPGQQSNKPVEVIFDLPIVFNVKD"
FT   gene            complement(291165..291884)
FT                   /locus_tag="CA2559_01195"
FT   CDS_pept        complement(291165..291884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01195"
FT                   /product="TonB"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01195"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87328"
FT                   /db_xref="GOA:A3U511"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A3U511"
FT                   /protein_id="EAP87328.1"
FT                   /translation="MEPKKNPKADLRKNSVLYFQIGLILILFLTWQAIEMKTYPDEIDI
FT                   GQVQVDDLLDEDVPITEIQNTPPPPPPPPPPAPEVIEVVEDEAEVEETIIESTETNQEE
FT                   IVEVEEVEEAVEEEIADVPFAVIENVPIFPGCEGETNNAARKKCMSEKVDKFVKRKFDQ
FT                   ELGGELGLSGIQRIYVAFKIDKSGNITNVRARAPHPRLAKEAENVVKALPKMTPGKQRG
FT                   KAVGVLYSLPIVFQVLD"
FT   gene            complement(291917..292327)
FT                   /locus_tag="CA2559_01200"
FT   CDS_pept        complement(291917..292327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01200"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87329"
FT                   /db_xref="GOA:A3U512"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:A3U512"
FT                   /protein_id="EAP87329.1"
FT                   /translation="MVKNAVLLSIVFTILVAIASLVKPTSFPKTGVSFSDKIAHTAIYF
FT                   ILTILWLFSMMRQKVSQYPFSKIGIAILLLVIGYGIFIEFLQDTLTDYRSFDYYDMLAN
FT                   TLGACLGFLIFRGFQQQIVNLKSVENSMLDKN"
FT   gene            complement(292320..292697)
FT                   /locus_tag="CA2559_01205"
FT   CDS_pept        complement(292320..292697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01205"
FT                   /product="glycine cleavage system protein H"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01205"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87330"
FT                   /db_xref="GOA:A3U513"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:A3U513"
FT                   /protein_id="EAP87330.1"
FT                   /translation="MNIPQELKYTKDHEWIKIEGDVATVGITDFAQGELGDIVYVEVET
FT                   VDETLDREEVFGTVEAVKTVSDLFLPLTGEIIEFNETLEDEPELVNSDPYGKGWMVKIK
FT                   FSEASEVEDLLDAEAYKELVG"
FT   gene            complement(292727..300118)
FT                   /locus_tag="CA2559_01210"
FT   CDS_pept        complement(292727..300118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01210"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87331"
FT                   /db_xref="InterPro:IPR025684"
FT                   /db_xref="InterPro:IPR026377"
FT                   /db_xref="UniProtKB/TrEMBL:A3U514"
FT                   /protein_id="EAP87331.1"
FT                   /translation="MANFYFKIPALKTAILLFALLGAYSVTAQEETEQDSTSTGYSLGK
FT                   IELSDPNSILNKYTYDVDLDRYVYTQKLGEFNISYPLILTPDEYQRLIFQEEMRKYFNE
FT                   KSDALSGKKEGTEEEQKNLLPNFYVNNNFFESVFGGREIEVIPTGTVEVDLGVLYTKQD
FT                   NPSFSPRNRSNLTFDFDQRISLSLLGKVGKRLQVTANYDTEASFDFQNQIKLEYTPTED
FT                   DIVRKIEIGNVSLPLNSSLIQGAQSLFGAKVEMQFGKTTITGVYSEQNSERNTVNVEGG
FT                   DAVQDFEKFILDYDENKHFFLSHYFRDTYDRSLANYPFINSNVQITRIQVWVTNRTNNT
FT                   QSLVDARNIVAIQDIGESDQNNIGLDNQPAGFVNEAPGSFPDNENNDFNPFGIGNPQQQ
FT                   SILNNQIRDVATIGQGFGTQVTEGRDYGVLENARQLQNNEYTINTQLGYISLNQRLSND
FT                   EILGVAFQYTVGGQVFQVGEFANDGVEATASNPDTDLDGILDSVDADVDGDGTNDNGQD
FT                   TDGDGINDASDVDQTNGQDANNDGIDDAALPPNMSAIVNQTLVVKMLKSPITNVNEPIW
FT                   DLMMKNIYSLDAFDVSAEDFRFNILYTDPQPLNYIQSVGADPLPDDVEQTTLLRVLNLD
FT                   KLNAYNDPVLEGDGFFDYVPGLTIDPQNGRIIFTSTEPFGEYLFNKLRLNPSEDYDDEM
FT                   DGSDNELLTYNSNQREYVFKKLYTTTKIQAEQESAEKNKFQLKGRYKSSGVDGIPIGGF
FT                   NIPQGSVTVTAGGRVLQEGVDYVVNYQFGRVQILDESLLASDVPIQISTESNALFGQQT
FT                   KRFTGLNVEHRFNENFLIGGTYLNLNERPITQKANYGYEPINNSIYGFNINYSTEVPWL
FT                   TRFANHLPNIDTEVESNFSIRGEFAYLQPGSPSGDNFRGETVTYVDDFEASQTSISILT
FT                   PLSWELSSVPTGPNGFDGGFGNGDLRVNDRRARINWYTVDPIFYSNQRPDGVSDADLSD
FT                   YKTRRVFIDEIFPETTIVQGQPQVLFPMDIAFYPEERGQYNYATGANGTNTLPNPEQNF
FT                   GGITRQITNTNFEQSNVEYIEFWLLDPFIYDENAGSTGGTISFNLGSISEDVLKDGRKQ
FT                   YENGLPEDGGTAQTQSTAFGKVPQNQSLVYAFDTEGQARVNQDVGFDGLDDAEEASRFG
FT                   DFAGLADPSNDNYNYFLNAQGSITERYRQYNGTQGNSPTDVSQDNRGNTTFPTVEDVNR
FT                   DNTMNTIDSYLQLNVPIAPNQMSPDTNEFVTDVRELDVNTVDGGTLPTRWVQFRVPLQF
FT                   PQDSNDPLREVVGGIGDLRSVRFMRMFLQDFQENIHLRFATLDLVRGDYRRYNVAIQPD
FT                   GNNPTTDDALFEVTSVSEEMTSNYEPPPGVIREEFVNNNQSVLEDEQSLALTVSGLKPN
FT                   DSRAVYKNFQVDMRQYEKLQMFLHAESLPNETPLEDDEMVAFIRMGLDFTDNFYQVEIP
FT                   LKVTTPNATNAAEIWPSENELQLPLDLLQTVKATVLGSDQFAQTDLNFFNENGEVSLDN
FT                   VSGELRVGIKGNPSFGNVRVIMLGVKNTNDNNLDETSGQVWFNELRLSGLKNEGGWAAV
FT                   VNMDANVADFMNVSATGRRSTVGFGSIEQGPNQRSREDVQSYDVTTNVSVGQLLPKNWG
FT                   VQIPFNYTRGEELITPQYDPEFLDLELDDRIDAAQDSQTADAIKERAEDYTRRQSVSII
FT                   GLRKNRVVSTEPGAEPKTPMPYDIENFTLSGTYNQTDHRDFEIEESIDQNVRVGATYEY
FT                   AVPEVTIEPFKKIAVLDSSAYFKPIKDFNFNPLPTSISLGSNIQRQYNRQRFRSFLGEG
FT                   NIIPQLYQRNYLYDWQFALNWKLSKSLNFNYTTGNNFVVRNYVNDDLTQDQTIGLWDGF
FT                   FETGTPNIHTQNLQLNYELPLNKIPLLEFVKSTYSYESSYQWQRGSEIFNNLQDQGIPR
FT                   LGNTVQNSMKHELNSTLDLQRLYNYVGLKKKQKKTNARRTSTNRRDLRQGQTSTPRLAA
FT                   QGNQDNTPSNKLSGADKAINTGIGLLTAVKKLQVSYIERQGTFLPGYTPTVGFIGSVRP
FT                   TVGFTLGSQRDVREEAARRGWLTLYDQFNQQYQEVENRELNIQATVDLLPDLKIDLNAA
FT                   RNYSETFQENYRVTGSGIGDYQYNSLTPNTFGNFSISTVLIATAFSQSDQDSSEAFDTF
FT                   RENRLVVARRLAAQNGQDPTDVDENGFPSGYGRGNQAVLLPAFLSAYSGKDVNSVSLGA
FT                   FRDTPLPNWTIKYTGLMRLKWFKDNFKRFSLNHAYNSVYTLSQFQTNIDFDTNNPFGDN
FT                   NRDQAGNFKNRTLFSNVNITEAFSPLVKIDMETNNSIKILAEIRKDRALSLSFDNNLLT
FT                   EISGNEYIVGLGYRIKDLKIATRVAGKRRILSSDLNFKADISYRRNKTIIRYLDLDNSQ
FT                   TTAGQNIWTINFTTDYALTKNLTALFYYDHSFSTYEISTAFPQTTIRGGITLRYNFGN"
FT   gene            complement(300124..300705)
FT                   /locus_tag="CA2559_01215"
FT   CDS_pept        complement(300124..300705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01215"
FT                   /product="Holliday junction DNA helicase motor protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01215"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87332"
FT                   /db_xref="GOA:A3U515"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/TrEMBL:A3U515"
FT                   /protein_id="EAP87332.1"
FT                   /translation="MITQLAGQLIEKNPTNIIVDCGGVGYFVNISLHTFGLIKNEECVK
FT                   IFTHLQVREDAHTLFGFAEKAEREVFRLLIGVSGIGASTARTMLSSLTPQQVTEAISQG
FT                   DVATIQSVKGIGLKTAQRVIIDLKDKILNVVGLDEVLPSQGNTQKEEALSALETLGYTR
FT                   KQSDKVVAGILKTDPEASVETIIKLALKKL"
FT   gene            complement(300776..303076)
FT                   /locus_tag="CA2559_01220"
FT   CDS_pept        complement(300776..303076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01220"
FT                   /product="NADP-dependent malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01220"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87333"
FT                   /db_xref="GOA:A3U516"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A3U516"
FT                   /protein_id="EAP87333.1"
FT                   /translation="MSKESKRREALVYHAKPTPGKIKVVPTKKYSSQRDLALAYSPGVA
FT                   EPCLEIEKDKENVYRYTTKGNLVAVISNGTAVLGLGDIGPEASKPVMEGKGLLFKIFAD
FT                   IDVFDIEVDTKDVDAFVETVKNIAPTFGGINLEDIKAPEAFEIERRLKEELDIPVMHDD
FT                   QHGTAIISAAALINALELADKKIEDVKFVVSGAGSAAIACLNLYLLLGAKPENMSVFDS
FT                   NGLLHSERGDITIQQEKFCSKKMYGSLAEAFVNADVFLGLSVGNIVSPEMIKSMANDPI
FT                   VFAMANPNPEIDYDLAISARKDIIMATGRSDHPNQVNNVLGFPFIFRGALDVRATKINE
FT                   EMKMAAVKSLAKLAKEPVPEQVNIAYGETRLNFGRDYIIPKPFDPRLIAQVPPAVAKAA
FT                   IKSGVARKEILDWQKYEDELYDRMGNDNKVTRLLHNRAKMNPKRIVFAEADHLDVLKAA
FT                   QIVHDEGMGIPILLGRREVIKELMIELDFDSEEVTIIDPKSDEEKGHLENYANQFWKAR
FT                   QRKGVTLYDAQKLLRERNYFAAMMVQLGDADAMLSGYSRAYPTVVKPILEIIGKLKGVT
FT                   KVATCNLMNTSKGPIFISDTSINIDPTAKDLAKIAQMTNHTVKMFGMEAIIAMVSYANF
FT                   GSSKDAHATKVREAVDLLHKVAPDVIVDGELQVDFALNRKMREEKFPFSKLSNRKVNTL
FT                   IYPTLDSANGTYKLIKELTGEDSIGPIMMGLEKPAHVIQLGASVEEMVNMAAVAIVDAQ
FT                   DKQKRQQMKLEIQ"
FT   gene            complement(303176..303607)
FT                   /locus_tag="CA2559_01225"
FT   CDS_pept        complement(303176..303607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01225"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87334"
FT                   /db_xref="GOA:A3U517"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:A3U517"
FT                   /protein_id="EAP87334.1"
FT                   /translation="MSIWDKFKEKTSEDFIDDVVTEDKMKEDVSEVSAEDVEVVIDKEE
FT                   AINKKLSGSASLKKYVELGRLMLALIKDSSSGKYKQVPWYTIATIAFSLLYVLNPMDIV
FT                   PDFIPGLGYLDDITVLSIGLGWIESDLHRYLDWKLESTS"
FT   gene            complement(303699..304634)
FT                   /locus_tag="CA2559_01230"
FT   CDS_pept        complement(303699..304634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01230"
FT                   /product="fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01230"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87335"
FT                   /db_xref="GOA:A3U518"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A3U518"
FT                   /protein_id="EAP87335.1"
FT                   /translation="MENKKIDILCIGEALVDFIGHQPDVSLSLTKDYHRYIGGSPTNVA
FT                   MNMARLGLNATLIATIGKDGLGDYILERLNEVQVNTALIRKDESKPTSSIFISRTSGTP
FT                   EFIPYLSADSEIIDAQIPDHILEQAKLFHTTSFSLSRNPAQKTILNAAKKALRFNCKLS
FT                   IDVNYSEKIWPDRSEAIKVLGKYFSKNPLVKISQDDISRLFGVTITIEEALQKIHDYGV
FT                   DLICLTLGKDGVIVSQNGQPSIIKPAKEIKEVKDATGAGDAFWSGFLFSYIKNFSLSKS
FT                   LDVAQSLSALKLQHVGRLPNNINILSSLLH"
FT   gene            complement(304634..305803)
FT                   /locus_tag="CA2559_01235"
FT   CDS_pept        complement(304634..305803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01235"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87336"
FT                   /db_xref="GOA:A3U519"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024746"
FT                   /db_xref="UniProtKB/TrEMBL:A3U519"
FT                   /protein_id="EAP87336.1"
FT                   /translation="MTNNPYNKAKELLVEASSDFGFLASANNISNYKRVWARDGVICGL
FT                   AALLDGDNILVSTFKKTLITLADHQHNLGHIPSNVYYGKSGVELSFGGLAGRVDTISWF
FT                   IIGVANYVHFTGDTEFLDEMIPKINKGLWLLNAWEFNNNHLIYVPRSGNWADEYITEGH
FT                   TFYDQVLRLWALRTINHLTPKIEYQEKINIVTKKLVINYKSGTHNNVFHPKAYSKMPES
FT                   KFWQASITPSGYQNMFDAFGNSLAIFLELGETSFRNKVIQYSEVLRKKLPLGLLPAFWD
FT                   PIKKGDKQWDLLENNCKYEFRNYPYTFHNGGTWQMVNSFYGVSIVENNSINAQQVLSNI
FT                   EALNEVEDYAFYENFNTKTKEPNGVPKCTWSASGQIILSQYLKGKKLLK"
FT   gene            complement(305806..307092)
FT                   /locus_tag="CA2559_01240"
FT   CDS_pept        complement(305806..307092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01240"
FT                   /product="sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01240"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87337"
FT                   /db_xref="GOA:A3U520"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3U520"
FT                   /protein_id="EAP87337.1"
FT                   /translation="MSAIYKYLGANEADIPMLWLAGPVTGLIVQPIIGALSDGTWSPKF
FT                   GRRKPFFLIGAVLASIALLIMPYSTTIWMAASLLWILDAGNNIAMEPYRAFVSDKLNKK
FT                   QHSLGFLMQSFFTGLGTTLANFTPAILISLGFFLASDRMANGIPVSTYWAFFIGSFASI
FT                   ATILYSVLTTKEFPPTQEELNALKLDKERGNILTRVWIDIVDAFKNMPLTMKQLIPVKF
FT                   FTWYAMFCYWQYLTSSLSLSLFGTLDETSEGFSQAQVLTGQVNGTYNIICFVVAFALVP
FT                   LAYKIGAKGVHFVSLLLGGIGLLSIPFLGVDNILFSVTNPFGSGQIEIASIYLFTIGLG
FT                   VAWASMLAMPYQLLAGSIPKEKTGVYMGIFNMFIVIPMIIQIVTMQYFVYDLLGQNPIN
FT                   VLNLAGVFLVLAAIFTLFIKVGPKNLIVK"
FT   gene            complement(307202..307543)
FT                   /locus_tag="CA2559_01245"
FT   CDS_pept        complement(307202..307543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01245"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87338"
FT                   /db_xref="GOA:A3U521"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3U521"
FT                   /protein_id="EAP87338.1"
FT                   /translation="MKFFVSIICVLLFTSLTFSQSNPLVIKEKTPLIIYGSNTCHYCID
FT                   TKLFLKEKNIEFIFYDIDLSVSKLNEMLKKLSTNGVDISNVKLPVIDKSGKLFMNDSKF
FT                   QDFLKMLVQ"
FT   gene            complement(307623..310271)
FT                   /locus_tag="CA2559_01250"
FT   CDS_pept        complement(307623..310271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01250"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01250"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87339"
FT                   /db_xref="GOA:A3U522"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A3U522"
FT                   /protein_id="EAP87339.1"
FT                   /translation="MNLRFKNLVFLLLLCLGANEIVAQSTIKGKVKDENGMPLPGVNLV
FT                   LKDTTSGAVSDFDGNYEIVNIADGTYTLNVSFLGYSKITKFITVTGEDIIQNFIMSEDS
FT                   ESLDQIIITGVTNPKSKIESSISITSLGLKTIENSAPRTTAEIFRTVPGIRSESSGGEG
FT                   NSNIAVRGVPISSGGSKYVQLQEDGLPVLLFGDMSFATADIFTRFDANVKRIEAIRGGS
FT                   ASTLSSNSPGAIINFISKTGKVEGGSLSTNFGLDYNSFRTDFDYGTPIGEDLYFHMGGF
FT                   YRVGEGIRDAGYTANNGGQFKFNITKEFETGFVRLSAKYLNDRAIGYLPMPIQVTGSND
FT                   NPTFNNAPGFDATQGTLHTPFLSQNIGLGANGELRRSKVADGMHPVSTSIGLLADFELV
FT                   DGWKIKNNGRFSVNNGSFVSPFPASVGTAENVLAGDFATDNGWNSFTYANDGSAVSDTQ
FT                   LVTPVVLFDTKLNNFNNFMNDLRLSKSFDKLDVTLGFFKSYQNVSMSWLWNSYLLEASS
FT                   DNARLINIADASGASLSDNGLFAYGAALFGNCCQRNYDTNYNISAPYAQISYEASEKLN
FT                   FDGSVRLDLGKVDGTFSGPVGSAFDVNRDGVISAPEQNVQSINNANPTVVDYDYNYVSY
FT                   SFGVNYKLKDNQAVFARYSKGASAKADRILFASDANGDPLNYLDGDDVNALDFLSQAEL
FT                   GYKQGFKNGTLYATAFYSKTTEEGGFEASTQEIIENDYKSFGLEVEGSYRVNNFDFRAG
FT                   VTYTKAEIDSGDNEGNTPRRQPDFIYNLLPSYNFGANKQNTIGLSFIGQSEAYAQDSNA
FT                   LVLPAFVIVNSFVRFGITEGLSANISANNIFDTLGITESEEGAITEGQVNYIRARPVPG
FT                   RSISLGLSYNF"
FT   gene            310452..311477
FT                   /locus_tag="CA2559_01255"
FT   CDS_pept        310452..311477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01255"
FT                   /product="putative LacI-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01255"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87340"
FT                   /db_xref="GOA:A3U523"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A3U523"
FT                   /protein_id="EAP87340.1"
FT                   /translation="MPVTLKDIAEKLNISITTVSKALKDYPDVSKKTKRLVKETASLLN
FT                   YKPNSFAVNLRTKESKTIGLIIPEIVHHFFSSVINGIINQAEKKGYLVIILQSNESYEL
FT                   EKKQIDLLLAKRVDGILISLANESTDYSHLNEILNQNVPLVMFDKIAKLVNCSKVIIND
FT                   RQAAAIATQHLIDIGCKHIAHFRGPLLPQNSIDRFLGYKKTLLDNNLKYDSSLVYISDD
FT                   MSFENGKTNISKMLSEHEHVDGIFINTDLVAVGAIAELNNRGIKVPEDIAIVGFSNWFM
FT                   SSVISPKLTTINQPGFDMGKQSFKLLYKEIKASKKNNPLVPKTVVLDTDLIIRETTSST
FT                   R"
FT   gene            complement(311474..312403)
FT                   /locus_tag="CA2559_01260"
FT   CDS_pept        complement(311474..312403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01260"
FT                   /product="putative iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01260"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87341"
FT                   /db_xref="GOA:A3U524"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3U524"
FT                   /protein_id="EAP87341.1"
FT                   /translation="MNTKAQYSAFIKNEAKRLGFMSCGISKAEFLEAEAPRLEEWLSKN
FT                   RHGEMQYMENYFDKRLDPTKLVEGSKSVVSLLLNYYPSETQTKESYKISKYAYGTDYHF
FT                   VIKDKLKTLLHSIQEEIGDVHGRAFVDSAPVLDKAWAAKSGLGWIGKHSNLLSKQAGSF
FT                   YFIAELIIDLELDYDTPVTDHCGTCTACIDACPTQAIIEPYKVDGSKCISYLTIELKNE
FT                   IPNGFSNQMDDWMFGCDVCQDVCPWNRFSKPHNEPLFNPHPELLTKSKSEWQELTKEVF
FT                   AEIFKKSAVKRTKFTGLKRNINFLNSED"
FT   gene            complement(312406..312657)
FT                   /locus_tag="CA2559_01265"
FT   CDS_pept        complement(312406..312657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01265"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87342"
FT                   /db_xref="UniProtKB/TrEMBL:A3U525"
FT                   /protein_id="EAP87342.1"
FT                   /translation="MQLKQLIDSIPKGFSKTVYKSQTYSLIKTTYNTGDSIKIFAEELG
FT                   GTDVISANIYSLNSNYILKPCEMPKQKVLNFLNHKQDF"
FT   gene            complement(312657..313679)
FT                   /locus_tag="CA2559_01270"
FT   CDS_pept        complement(312657..313679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01270"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01270"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87343"
FT                   /db_xref="GOA:A3U526"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:A3U526"
FT                   /protein_id="EAP87343.1"
FT                   /translation="MNENLDPSGESFSKEEFDIERALRPLSFSDFAGQDQVLENLKIFV
FT                   EAANQRNEALDHTLFHGPPGLGKTTLAHILANELNVGIKVTSGPVLDKPGDLAGLLTNL
FT                   EPRDVLFIDEIHRLSPVIEEYLYSAMEDYKIDIMIETGPNARSVQINLNPFTLIGATTR
FT                   SGLLTAPMRARFGISSRLQYYSTELLSTIVERSSSILNVPIDLEAAIEIAGRSRGTPRI
FT                   ANALLRRVRDFAQIKGNGRIDMSISKFGLKALNVDANGLDEMDNRILSTIIEKFKGGPV
FT                   GITTLATAVSESAETIEEVYEPFLIQQGFIMRTPRGREVTEAAYKHLGKIKGSVQGGLF
FT                   "
FT   gene            313816..314322
FT                   /locus_tag="CA2559_01275"
FT   CDS_pept        313816..314322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01275"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87344"
FT                   /db_xref="GOA:A3U527"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3U527"
FT                   /protein_id="EAP87344.1"
FT                   /translation="MKPTEKAPNLSLPLVNDTEWELYSQNPEHFTLLVFYRGLHCPVCK
FT                   KQLEELSSKLEDFKNEGVNVVAISMDTEKRAKLSQEKWDTGNLPIAYGLSEEDAKTWGL
FT                   YFSKAISDSEPELFSEPGLFLIKNDHSLYFSSIQTMPFARPKVEDLIKAFQFIKDKDYP
FT                   ARGKA"
FT   gene            complement(314395..316221)
FT                   /locus_tag="CA2559_01280"
FT   CDS_pept        complement(314395..316221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01280"
FT                   /product="Cytochrome-c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01280"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87345"
FT                   /db_xref="GOA:A3U528"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A3U528"
FT                   /protein_id="EAP87345.1"
FT                   /translation="MSAVAVAHDDHSHDDHGHHHKETFITKYIFSQDHKMIAKQYLITG
FT                   LIMGAIGIGMSILFRLQLAWPEESFWVFEFFLGKWAEGGVMDPGVYLALVTIHGTIMVF
FT                   FVLTAGLSGTFSNLLIPLQIGARDMASGFLNMVSYWLFFISSVIMLCSLFVESGPASAG
FT                   WTIYPPLSALPQAIPGSGTGMTLWLSSMAVFIASSLLGSLNYIVTVINLRTKGMSMTRL
FT                   PLTIWAFFVTAIIGVVSFPVLLSAALMLIMDRSFGTSFFLSDIYIAGEVLQHQGGSPVL
FT                   FEHLFWFLGHPEVYIVLLPALGITSEIIATNSRKPIFGYRAMVASILAIAFLSTIVWGH
FT                   HMFISGMNPFLGSVFTFTTLLIAIPSAVKSFNYITTLWKGNLQMNPGMLFSIGLVSTFI
FT                   SGGLTGIILGDSTLDINVHDTYFVVAHFHLVMGISALYGLFAGVYHWFPKMFQGRMMNK
FT                   NLGYVHFWVTAIGAYGIFFPMHFIGMAGLPRRYYTNTAFPYFDDLTDVNVAITIFAIIT
FT                   ASVQLVFIYNFVHSIFYGKVGSQNPWKSNTLEWTADQKHVHGNWSGQIPHVYRWPYDYS
FT                   KLNEDETDYVIPGQDWVGQHIPMQENEEEMNH"
FT   gene            complement(316248..317327)
FT                   /locus_tag="CA2559_01285"
FT   CDS_pept        complement(316248..317327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01285"
FT                   /product="Cytochrome c oxidase, subunit II:Cytochrome c,
FT                   class I"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01285"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87346"
FT                   /db_xref="GOA:A3U529"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:A3U529"
FT                   /protein_id="EAP87346.1"
FT                   /translation="MTVFLTIIVLALLAVTGWQMSKIFQLSQGNQNVGNDSEVANDKDN
FT                   RINGYLSIMFLIFLYVISIYCFWNYSEFYLPEASSAHGADYDTLMFITIALIMFVQVIT
FT                   QFLLFYFSNKYAGKKGQRALFYADNDKLEFIWTIIPVVVLAGLILYGLFTWSDIMNVEE
FT                   TEDTMVVELYAYQFAWRARYSGDDNTLGKANVRYIEGINALGVDPSDNYGKDDVITTEL
FT                   HLPVNKPVLFKFRSQDVLHSAYMPFFRAQMNVVPGMITQFGFTPTVTSEDIQESEFMIK
FT                   KVRKINEIRRENSKDLVAKGEEPLDSYEFEYYLLCNKICGKSHYNMQMKIVVESEEDFN
FT                   AWMAEQKTLSEELSAQASN"
FT   gene            complement(317362..318738)
FT                   /locus_tag="CA2559_01290"
FT   CDS_pept        complement(317362..318738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01290"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87347"
FT                   /db_xref="GOA:A3U530"
FT                   /db_xref="UniProtKB/TrEMBL:A3U530"
FT                   /protein_id="EAP87347.1"
FT                   /translation="MYTLSSKLKLIAIIFMIVGAIGLIYGFIAAPSTLEEVEEMMAAEA
FT                   HHGGGHGEEASHETTTHDIETTQNTSEQTHNETATGDNHEADSHEVSHAEHVFHQLQNK
FT                   PWAAVYVAAFFFFMIPLGVLAFYAIQFAAQAGWSPVLFRVMEGITAYLLPGSLIMFALL
FT                   LLSGFHLNHLFVWMDPEVVAHDELIQGKAGFLNVPFFLIRAAIYIIGWNVFRNLLRKYS
FT                   LKQDESDNNSYYKKSFRLAAGFLVFFIVTESMMSWDWIMSFDPHWFSTLFGWYVFASMF
FT                   VSGITVIALVTIYLKSRGYLEYVNNSHIHDLAKFMFGISVFWTYLWFSQFMLIWYSNIP
FT                   EEVTYFITRIDDYNLPFFGMLVLNFIFPILVLMNSDYKRVNWFVVMAGVAILVGHYIDI
FT                   FNMVMPATVGGSWFIGIPEISAVLFFGGLFVLVVFTALTKVPLVPKRNPYLKESKHFHY
FT                   "
FT   gene            complement(318763..319458)
FT                   /locus_tag="CA2559_01295"
FT   CDS_pept        complement(318763..319458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01295"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87348"
FT                   /db_xref="GOA:A3U531"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A3U531"
FT                   /protein_id="EAP87348.1"
FT                   /translation="MNTKQMKSIFNIVLILGISISLTSCFDKEKPNYQYMDNMYEPVGY
FT                   EAYGAYNVFENEQEAKLPAEGTVPRGWAPYDYEDSAEGKANAKANLKNPIAYSDDNLSS
FT                   GKQLYTIYCAICHGDKGDGKGTLAKREKILGIPSYNDQGRAITEGDVYHVMYYGLNTMG
FT                   SYAAQTSEEERWQIAHHVMKLKDALDGKPERQTVNDDSQVENTATNETSMTTEVSVMET
FT                   ENELNEEQE"
FT   gene            complement(319448..319981)
FT                   /locus_tag="CA2559_01300"
FT   CDS_pept        complement(319448..319981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01300"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87349"
FT                   /db_xref="GOA:A3U532"
FT                   /db_xref="InterPro:IPR021776"
FT                   /db_xref="UniProtKB/TrEMBL:A3U532"
FT                   /protein_id="EAP87349.1"
FT                   /translation="MSSKVIHAIYTDDDILMQAVKQTREAKYHIEEVYTPFPVHGLDKA
FT                   MGLEPTRIAIASFMYGLVGLTVAVLMMNFIMIEDWPQNIGGKPSFSYIENMPSFVPIMF
FT                   ELTVFFAAHLMVITFYMRSKLWPFKQAENPDVRTTDDHFLMAIDVANHNVEDMTKFFYD
FT                   TGALEISIVSNDEH"
FT   gene            complement(319984..321765)
FT                   /locus_tag="CA2559_01305"
FT   CDS_pept        complement(319984..321765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01305"
FT                   /product="molybdopterin oxidoredutase membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01305"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87350"
FT                   /db_xref="GOA:A3U533"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:A3U533"
FT                   /protein_id="EAP87350.1"
FT                   /translation="MHYEAPIRQPLVTGDKSYHDVTVDVAAPVEGKANKSWWIVFSIAL
FT                   VAFLWGIGCIIYTVSTGIGTWGLNKTVGWAWDITNFVWWVGIGHAGTLISAVLLLFRQK
FT                   WRMAINRSAEAMTIFSVVQAGLFPIIHMGRPWLAYWVLPIPNQFGSLWVNFNSPLLWDV
FT                   FAISTYLSVSLVFWWTGLLPDFAMIRDRAVKPFQKRIYSILSFGWSGRAKDWQRFEEVS
FT                   LVLAGLATPLVLSVHTIVSFDFATSVIPGWHTTIFPPYFVAGAVFSGFAMVNTLLIIMR
FT                   KVSNLEDYITVQHIELMNIVIMITGSIVGVAYITELFIAWYSGVEYEQYAFLNRATGPY
FT                   WWAYWSMMTCNVFSPQFMWFKKLRTSIMFSFIISIVVNIGMWFERFVIIVTSLHRDYLP
FT                   SSWTMFSPTFVDIGIFIGTIGFFFVLFLLYSRTFPVIAQAEVKTILKSSGENYKKIRAD
FT                   KGDDAKLYTPVVREPMVNSTSGFNEHTDISTESHNETVNADALVDTEAQKDKIDNLLDK
FT                   IGSFDPATQKADDLKKISGVGPVMEQKLHQLGIYTFDQVSRMTKTEYDLLDSIIDSFPG
FT                   RAERDDWAGQANTLKNK"
FT   gene            complement(321797..324910)
FT                   /locus_tag="CA2559_01310"
FT   CDS_pept        complement(321797..324910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01310"
FT                   /product="molybdopterin oxidoreductase, iron-sulfur binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01310"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87351"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR030948"
FT                   /db_xref="UniProtKB/TrEMBL:A3U534"
FT                   /protein_id="EAP87351.1"
FT                   /translation="MSSNKKYWKSVEELEDSNPVVETLRQNEFPSEIPTDDFLGNDKTM
FT                   ENSSTSRRDFLKYVGFSTAAASLAACEGPVIRSIPYVVQPESIVPGVANYYASTIADGF
FT                   DFASVLVKTREGRPIKIDRNLEDGAVGSVNARVNASVLSLYDNNRLKRPMANGEAVSWE
FT                   AFDKQVGDKLNSLGGKQIVLLTQTFASPSTDRIIKEFSSKYANVKHVVYDTVSDEAALN
FT                   AFEGRYGSRALPNYDFSKAETIVSVGADFLGDWQGGGNDKGYAKGRVPKNGKMSRHIQV
FT                   EANMSLSGANADKRIPATPSQQKAILAAMYGYIVGGSTSGLDAKFDDAVVKAVSQLRNS
FT                   GGNAVVLTGLQDEDAHTLAMAINEKLGSIVMDVKNPKMIRQGNAKAVKQLVVDMNSGAV
FT                   GGLLIAGVNPAYSLPNAKEFIEGLKKVDVAVSFSSKEDETAKLCDYVAATPHYLESWGD
FT                   VQMTKTHFSLMQPTIKPLYDTRQFQETLMQWSGNTTKYYKYIKDTWSSVLGTTSWSDAL
FT                   HDGVFVSSTVISADDSAVASQEETESVQSTSASTAARRLAQSATNSGSGLELTLYTSTA
FT                   LGDGQQANNPWLQEFPDPITRASWDNYLLVSKADADRLELKNTHVANGALNGSYVTIKA
FT                   DGVELNNVPVIIQPGQAIGSAALALGYGKKESIQKEMQTGINAYPLYKDFNTVQNISIS
FT                   KESGMHEFACVQLQNTLMGRGDILKETTLEIFNTKDKHVWNKMPEVSKDHIEYDVTSPE
FT                   VDLWDEFDRSVGHHFNLSIDLNSCTGCGACVIACHSENNVPVVGKEEVRKSRDMHWLRI
FT                   DRYYSSDMTEEKAEEEGYSGVGLFGDGVTDMFTEMEDPSAVSPQVVFQPVMCQHCNHAP
FT                   CETVCPVAATSHGRQGQNHMAYNRCVGTRYCANNCPYKVRRFNWFLYNKNDEFDYHMNN
FT                   DLGRMVLNPDVVVRSRGVMEKCSMCIQMTQKTILDAKRDGRAIKDGEFKTACSAACESG
FT                   ALVFGDINDKGSEINELKEDDRMYHLLESVGTKPNVMYQTLVRNTKEA"
FT   gene            complement(324968..326251)
FT                   /locus_tag="CA2559_01315"
FT   CDS_pept        complement(324968..326251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01315"
FT                   /product="Cytochrome c3"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01315"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87352"
FT                   /db_xref="GOA:A3U535"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR029467"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR039118"
FT                   /db_xref="UniProtKB/TrEMBL:A3U535"
FT                   /protein_id="EAP87352.1"
FT                   /translation="MVFFVSLSTNSFAQAQADPVQTGEEQVQDEGAGDPAKGKELFNSL
FT                   CAACHKRYKNATGPALNGVTDRHERGWIYEWVKNNADLRASGDAEAIAIFEEWGGSVMN
FT                   NFPQLSNNDIDNILAYVEEPKAEAPVNTGSTGGGSSEGGNGVSNNLVLGILAFVLLMLI
FT                   SVLFLVNKTLRRFATEQGVALPVKEKRTPIWKSFIENQFLVLVTAVFLLLASGYFVYGY
FT                   FMQVGVDQGYEPIQPIHYSHRIHAGLNEIECKYCHSSARVSKHSGIPSLNVCMNCHKSI
FT                   SEVADASSEFTSVTDEYSKEFYDNEIQKLYDAVGWDGQKYTGETKPVKWVRIHNLPDFA
FT                   YFNHSQHVSVAGIECQKCHGPVEEMEIMSQHSPLTMGWCINCHRETNVKMEGNAYYEKI
FT                   HEELAKKYGVEQVTAAEMGGLECGKCHY"
FT   gene            326332..326451
FT                   /locus_tag="CA2559_01320"
FT   CDS_pept        326332..326451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01320"
FT                   /product="translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01320"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87353"
FT                   /db_xref="GOA:A3U536"
FT                   /db_xref="UniProtKB/TrEMBL:A3U536"
FT                   /protein_id="EAP87353.1"
FT                   /translation="MILALSYLKYIVNALLKSGTKVILKDLLGNVTATIINNL"
FT   gene            326523..326915
FT                   /locus_tag="CA2559_01325"
FT   CDS_pept        326523..326915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01325"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87354"
FT                   /db_xref="GOA:A3U537"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="UniProtKB/TrEMBL:A3U537"
FT                   /protein_id="EAP87354.1"
FT                   /translation="MSRLNIQILYKTLFFILVSSQISIAQQGNIKVEQDAKLPQLLEKR
FT                   IDMSKNNELGERFKIQLYYGNNQKASNTITSFRSKFGEWPSEVVYETPNYKVWVGNFRN
FT                   KLEADRALLKIKEQFPSAFIFKPERG"
FT   gene            327133..328053
FT                   /locus_tag="CA2559_01330"
FT   CDS_pept        327133..328053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01330"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87355"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:A3U538"
FT                   /protein_id="EAP87355.1"
FT                   /translation="MRNIYLKLMVIALIIGVTKQTYSQDSEVIYEAIDNGSGVALGVAI
FT                   SSADNGIGTFSGDGVQLAGTARIINQITISCFVTTDTAFIPGEFTVRLYTDCPVTGSSG
FT                   SEGMCGADGAGSLIEGSEVTINLTSAPTAANPIVIDMPNVDISSETDDTIWVMFNSQRD
FT                   NINGVLNGIAMTGSDALTEINAFSSCSTASTSSCARRIIGAASNNFVVSISATEILNTG
FT                   TEKLSNAVTLFPNPIYNEATVSFEDTISPKMVNVYDVTGKLVLHKYTYNLENNFKLDMT
FT                   NLKSGIYFMNFEAEEGTITKCIIKL"
FT   gene            complement(328132..330963)
FT                   /locus_tag="CA2559_01335"
FT   CDS_pept        complement(328132..330963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01335"
FT                   /product="putative translation initiation factor"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01335"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87356"
FT                   /db_xref="GOA:A3U539"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:A3U539"
FT                   /protein_id="EAP87356.1"
FT                   /translation="MAEARTMRLNKVLREFNISLDRAVEFLKEHGHEIDARPTTKISGE
FT                   VYDVLFDEFQTDKSKKRESKEVGEEKRKEKERLRLEREKEQEEKERKAEVVRGKASLDG
FT                   PKQVGKIDLNKKPEAKEETPEPVKEPVKETPKEEAKPEPKKEVEVVRAGAKLSGTKQVG
FT                   KIDLDAPKKPVAKKEAPKKVEPKKEEPKKETPKVVAKEAPKKEEAPKQEAVKEETKDAP
FT                   EASKDDNRVTTNYKKLDGPNFTGEKIDLSQFKKPAKKKDDKKTSDNSPKKRRRRISKDT
FT                   RPSSRGGANKGGNNRRGGGKRQIVKEEPTEAEVQKQVRETLEKLQGKSNKGKGAKYRRD
FT                   KRDQHRTKSEEDLAQQEIENKTLKVTEFVTVSEVAIMMDVPVTKVISACMTLGMMVTMN
FT                   QRLDAETLSIVADEFGYEVDFVSAEEEESIEEFVDAPEDLVHRAPIVTVMGHVDHGKTS
FT                   LLDYIREENVIAGESGGITQHIGAYAVELESGQKISFLDTPGHEAFTAMRARGAQVTDI
FT                   AIIVIAADDDVMPQTKEAISHAQAAGVPIIFAINKVDLPTSNPEKIKEKLASMNLLVED
FT                   WGGKIQSHDISAKKGTGVKELLEKVLLEAEILELQANPTRLAQGTVVEAFLDKGRGYVS
FT                   TILVQTGTLKIGDYVLAGTNSGKVKAMQDERGHIVKEAGPSTPVSILGLDGAPQAGDKF
FT                   VVMEDEREAKDIASKRTQLQREQSVRTQRHITLDEIGRRIALGDFKELNIILKGDVDGS
FT                   VEALTDSFQKLSTEEIQVNILHKGVGAITESDVLLASASDAIIIGFNVRPAGNARQVAD
FT                   QEEIDIRTYSIIYDAINDLKDAMEGMLSPVMKEEITGTAEIRETFKISKVGTIAGCMVT
FT                   TGKIYRNSGIRLIRDGVVVFTGELDSLKRFKDDVKEVSKGYDCGLQVKNYNDIKEGDIV
FT                   EAYQEVAVKKKLK"
FT   gene            complement(331017..332249)
FT                   /locus_tag="CA2559_01340"
FT   CDS_pept        complement(331017..332249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01340"
FT                   /product="transcription elongation factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01340"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87357"
FT                   /db_xref="GOA:A3U540"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A3U540"
FT                   /protein_id="EAP87357.1"
FT                   /translation="MENIALIESFSEFKDDKLIDRVTLMAILEEVFRSALKRKFGEDDN
FT                   FDIIINPDKGDLEIWRNRVVVEDGMVEDDNSEISLTQARKIEPDFEVGEDVSEEVKLID
FT                   LGRRAILALRQNLIAKIHEHDNTNIYNQFKELIGEMYSAEVHHIRHRVVILLDDEGNEL
FT                   IMPKDRQIPSDFFRKGESVRGVIESVELKGNKPAIIFSRTSPLFLEKLFEQEIPEVFDG
FT                   LIQVKKVVRIPGEKAKVAVDSYDDRIDPVGACVGVKGSRIHGIVRELGNENIDVINYTS
FT                   NDQLLINRALSPARVTSVKLNSETMRAEVMLKPEEVSKAIGRGGHNIRLASQLTGYEID
FT                   VFREGVEEDVELKEFSDEIDAWIIAEFSKIGLDTAKAILEQDLDDLVRRTDLEEETIRE
FT                   VVQILREEFDQ"
FT   gene            complement(332258..332719)
FT                   /locus_tag="CA2559_01345"
FT   CDS_pept        complement(332258..332719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01345"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87358"
FT                   /db_xref="GOA:A3U541"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="UniProtKB/TrEMBL:A3U541"
FT                   /protein_id="EAP87358.1"
FT                   /translation="MLKEKVDKLLQAVLDDNPSLFLIDYNITNDNSIGILIDGDNGVTV
FT                   EDCITVSRAIEHNLDREEEDFSLEVGSIGATASLTLPRQYVKNIGRVLSVKTETEKIEA
FT                   ELVSADDNEIALKWKAREPKPVGKGKHTVEKEAVIPYEKIVEAKVMIKF"
FT   gene            332873..333703
FT                   /locus_tag="CA2559_01350"
FT   CDS_pept        332873..333703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01350"
FT                   /product="universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01350"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87359"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A3U542"
FT                   /protein_id="EAP87359.1"
FT                   /translation="MKNILVPTDFSEQAENALKVAAQFAKTYNADIYLLHMLELPMQLI
FT                   DPTSNNNSQNLPESLFFMKLAHKRFEEVLASDYLEGVTVHETVHFHEAFDGIMEVSKEH
FT                   DCDLIIMGSHGATGFKEMFIGSNTEKVVRYSEIPVLVIKQEIPNFRVDNFIFATDFSEE
FT                   TKRPFNEAVKFANKIDANIHLVYINTANKFKTTEEAEKKMSNFLEGMESKTFNLHIYND
FT                   RTIEEGILNYAQSIDAGLIGISTHGRKGLAHFFNGSLSEDIVNHAKRPVITFKI"
FT   gene            complement(333693..335237)
FT                   /locus_tag="CA2559_01355"
FT   CDS_pept        complement(333693..335237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01355"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87360"
FT                   /db_xref="GOA:A3U543"
FT                   /db_xref="UniProtKB/TrEMBL:A3U543"
FT                   /protein_id="EAP87360.1"
FT                   /translation="MLLKILPLAKNILKKYIKAILVILGVLLVLVIGANYYAKLQLKKA
FT                   LSEVSAKNDFSYETLDVNVLLGKVSIDNVSFKSKSFELESPSIKLKGFGYWYYITSKDV
FT                   SVSTLQIDAPKLKVIKGAEKDTVTSTKNQSFEGDVSIGNIKTSNGYLDVINEGDEKNIS
FT                   IKLSNINLKSFKTSQEILKNGLPFNYKSLSGSLDSVYVKMNFYQDLKVQSIKIEDNNFN
FT                   VNNLSITPKYERAEFQNVIPYEKDLITLNVPELKLNDLKIDTLNDKLSLKTPSIVVVNA
FT                   DCNIYRDKTHTDDVRIKPMYSEMLRNLNFGLDINTLEIQSSKLVYEERAEGTKKIGKVL
FT                   LENLNATIKDINNTSKNDGGKLTTANISTNFMGTSQLNVNWQFDINNLNDTFNIKGEAK
FT                   QVSADAMNMFFVPAVNVKAIGTLNELYFNYSGDKNDALGDMRIDYSTFKVEVLRKDGSS
FT                   ENRLLSGIVNLFLDNNEKDGRVTKQDVSVTRDKTKSFWNYFWLCIRNGALQSLTKS"
FT   gene            335256..335885
FT                   /locus_tag="CA2559_01360"
FT   CDS_pept        335256..335885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01360"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01360"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87361"
FT                   /db_xref="GOA:A3U544"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A3U544"
FT                   /protein_id="EAP87361.1"
FT                   /translation="MKIVCIADTHNRQDDLIIPDGDIIIHAGDLTEGGTKREVSQFISW
FT                   FSSLPHTHKVFIAGNHDYYLEDIDLKKFTENLPKGVHYLHNSALTLGNINFWGTPQVPS
FT                   LTRWAFKEPFYWNDIPKETDILISHVPPYEILDLHDRNFHLGDKVLAKRVDKLSLKYHI
FT                   FGHVHDAYGLTRIKNTIFVNASSVDSTGRYFNPPIILDVSSKDLLE"
FT   gene            335938..337158
FT                   /locus_tag="CA2559_01365"
FT   CDS_pept        335938..337158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01365"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01365"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87362"
FT                   /db_xref="GOA:A3U545"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A3U545"
FT                   /protein_id="EAP87362.1"
FT                   /translation="MRWLIFIVIYILIDIYAFQALKTITPNKIWHYSYLILSLLVVGNL
FT                   IFQNIVPQEGSVVSGNRSYAFGLMLAMLAPKLILVIFMFGEDIIRFFVATYYRFFSTET
FT                   SFTIPSRRKFISQVALGIAAIPFASLLYGMIQGKYNFRVLKYELSFDDLPEAFNGYQIT
FT                   QISDIHSGSFDNFEKIKYAVNLINEQQSDAIFFTGDMVNNKASEMDPWKVLFGSFKAKD
FT                   GVFSILGNHDYGDYVDWANEKEKAENLLNLKNIQKEMGYDLLLNEHRSIQRGKDSIKIV
FT                   GVENWGAGGFVKHGDIEKASEGLSERDFKILLSHDPSYWQQNIKSNPKNFQLTLSGHTH
FT                   GMQFGIEIPGVIKWSPVQYRYKNWAGIYEELGRRINVNRGFGYLGYPGRVGIWPEITVI
FT                   TLKAKDA"
FT   gene            337213..337509
FT                   /locus_tag="CA2559_01370"
FT   CDS_pept        337213..337509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01370"
FT                   /product="thioredoxin C-2"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01370"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87363"
FT                   /db_xref="GOA:A3U546"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3U546"
FT                   /protein_id="EAP87363.1"
FT                   /translation="MSKFGELIDLDIPVLLDFYTEWNEQSTAMHPVLRDVAAALGDSAK
FT                   VIKIDVDKNSELAEALRVKGLPTLMIYKNGEMKWRQSGEQDANTLIGLVKEYV"
FT   gene            complement(337516..338172)
FT                   /locus_tag="CA2559_01375"
FT   CDS_pept        complement(337516..338172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01375"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01375"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87364"
FT                   /db_xref="GOA:A3U547"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A3U547"
FT                   /protein_id="EAP87364.1"
FT                   /translation="MTLPYIPKLVQWCFPKRIWHFSRKEKSIYLTFDDGPIPKVTPWVL
FT                   QQLSTYNAKATFFCIGENIKKHPKLFSEIISKGHAIGNHTQHHYNCKSTEHLKYINDVS
FT                   LCEYEIHTALDKEKEPIVTTKKLFRPPYGRLSLRASKTLRKLGYKIVMWDVLSVDYNAA
FT                   VSKEKCLENVLRHTKNGSVIVFHDSLKAENNLRYALPKVLAYYSEKGYAFKAIKD"
FT   gene            complement(338292..341621)
FT                   /locus_tag="CA2559_01380"
FT   CDS_pept        complement(338292..341621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01380"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87365"
FT                   /db_xref="GOA:A3U548"
FT                   /db_xref="InterPro:IPR021280"
FT                   /db_xref="UniProtKB/TrEMBL:A3U548"
FT                   /protein_id="EAP87365.1"
FT                   /translation="MKDFNFSKWNTILGWFAFAVALITFTLTVEPTASFWDAGEYIATA
FT                   SKLEIGHPPGAPLYQMLGAVFSVFALESSQIALMVNMMSVLASAFTILFMFWSISILIR
FT                   KISGKAETLSAGQKTAVLGSALVGSLAFTFTDSFWFNAVEAEVYAMATFILSVIFYVGL
FT                   LWERDMLKPRGNRWLILICFIVGLLFGVHFMGLLAIPAIGYLYFFKNYKEVTAKNFIIA
FT                   TVIIVAILMFIFKLLLPYSLSFFAISEVFFVNTIGLPFNSGTIIALLVVIAGFYFGITY
FT                   TRKKGFVHVNTLLLCVLFILIGFSSWTMLPIRANAGTVINENNPANARELLAYYNREQY
FT                   GESHLFYGPQFTEMYSGLDENNPYSDAKPKYEQDEKTGKYVIVNDWENANQNLDDNHKG
FT                   FLPRMWSPEHKANYLGFIGELEFTVKPEYRDQQELLNAVADVKTKYALGQIDAEDYDQF
FT                   LTQFGQYLDIEKPSFAANIGYMIEYQFGYMYWRYFMWNFTGRQDDVQGKMDDLHGNWLS
FT                   GIKFIDELRLGSQDNLPSDVKNNKARNTYFFLPFLLGLLGLVFQFTKDKKNFWVLLVFF
FT                   LFTGLALKVYLNERPFEVRERDYALVGSFYVFAMWIGFGVYALYDMLKDKITTKMLAPA
FT                   VTVVCLLAVPVVLASQNWDDHDRSDRYTAQSMAKMYLDSCDENAILFTIGDNDTFALWY
FT                   AQEIEGYRRDVRVVNTALFATDWYIDQMRRKAYESDRIPTTLEHKNYVYGVNDAVWYQK
FT                   DPRVRDTLLIKDWIKYIKSDNETTKAELRSGQIVNTFPTKNLRLPVSGSNAIEHGIVKE
FT                   KDREKIAPYIDITLKGDIIYKNRLIMLDVIANNEWKRPIYFTGGSYGDDDYLWMKDYLQ
FT                   LDGMCYKLVPIRTPIDKRNPYDMGRIDTDKMYNIVKEWDWGNGNDPDIYHDPETRKNGL
FT                   VYRSNLAKLIEELIKVKDFERAEEMLDLGMEQMPVDYYGFYTLLEPFISGYYEIGKPKK
FT                   ARDIWRQVATKYQENLTYYSGFKESRQFRYAEDIITDIERYRSLVDILIIYQDEELVKP
FT                   EAEKFNNYLRLFRHFYGEDEEMNPEEELTPEEQQYIEGFEQEFGTETTPKIDSVNNLDS
FT                   IN"
FT   gene            341797..341869
FT                   /locus_tag="CA2559_t07683"
FT   tRNA            341797..341869
FT                   /locus_tag="CA2559_t07683"
FT                   /product="tRNA-Gln"
FT                   /note="Corrected as Gln-tRNA from Thr-tRNA"
FT   gene            complement(341915..343816)
FT                   /locus_tag="CA2559_01385"
FT   CDS_pept        complement(341915..343816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01385"
FT                   /product="conserved ferredoxin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01385"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87366"
FT                   /db_xref="GOA:A3U549"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3U549"
FT                   /protein_id="EAP87366.1"
FT                   /translation="MSRIEHNMSLTGGQPPKALNTIQKISTAVGVVGLGILLLALLNVN
FT                   FPNKTIALSLSLLMMLAGIVAFSYGAYSNKHEGIKNDGVMFKSITSRGLWGWILGIAMT
FT                   GFYVVLYFYPQYLGLVSDGDNTGVIALFDPLSKLLSGNPASQWFLYGTLYTLAIFAFGI
FT                   KFIWKYRNNTYEVVRTISVMFFQTAFAFIIPEILVRLNQPYYDFKNIWPLNYELFAGYK
FT                   IDEFLSAGNVGLIMLIFGLLSIFVITPILTYKYGKRWYCSWVCGCGGLAETAGDPFRHL
FT                   SDKSQTAWKIERWVIHSVVVFVTVMTVAVVFSYLQGNESSSISEWSNLDNKVVFMSEEG
FT                   DKPIGDKILAAQQANAKGVVFINKSSSTPTIQSSVPLTIDYIVVNEAEQEEALKKAKNG
FT                   ENVVLQNALVQSPDFEVAANQDVKVYDDFLISKEFFIWFIVILLTLVFGWAMLFKREEL
FT                   AKDAQYGAIGYFVVVISLLLITYFSSPGKLFLFDAYQLRKAYGFLIGAIFSGVIGVGFY
FT                   PIFGSRVWCRFGCPMAAILGFQQRLLSKFRITTNGGQCISCGNCSTYCEMGIDVRAYAQ
FT                   KGENIVRSSCVGCGICSAVCPRGVLKLENDSMNGRINSNDILLGNDVNLMDYLKQHN"
FT   gene            complement(343813..345126)
FT                   /locus_tag="CA2559_01390"
FT   CDS_pept        complement(343813..345126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01390"
FT                   /product="NADH oxidase (noxA-4)"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01390"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87367"
FT                   /db_xref="GOA:A3U550"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3U550"
FT                   /protein_id="EAP87367.1"
FT                   /translation="MKHIVIIGNGISGITAARHIRKLSDYRITVISSETEHFYSRTALM
FT                   YIYMGHMKYEHTKPYEDWFWEKNRIELKQGYVVSVDTENKQLQFKNNDLLGYDKLILAT
FT                   GSQTATYGWEGLSLNGVQGLVNIQDVQALENNTENCKHAVIIGGGLIGVELAEMLSTRK
FT                   IPVTFLIRESYFWNSVLPENDAKHISEHILSHGISLKPETNLDKILGDNNGNVRAVLTD
FT                   SGEEISCDVVGICTGVKPNINFLEGSGIATDKGILVNRKLETNVKDIYAIGDCAQQHEA
FT                   IGYRKPVEAVWYTGRMMGETVAQTICGKTMPYNPGNWFNSAKFFDVEYQTYGWVFNDEN
FT                   KKEGETHFHWKNPEGNQWLTIAYHEETLKFLGINTFGIRMKHETFDSWLNENQNVAHVV
FT                   DNLRKANFDPEFYKKLESNIQISFKNHLSSKTTNTTKL"
FT   gene            345363..346079
FT                   /locus_tag="CA2559_01395"
FT   CDS_pept        345363..346079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01395"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87368"
FT                   /db_xref="InterPro:IPR006869"
FT                   /db_xref="UniProtKB/TrEMBL:A3U551"
FT                   /protein_id="EAP87368.1"
FT                   /translation="MKKLLLIALCILTGVSHAQSTASFFKKADLVFNTYVKQNKVDYKA
FT                   ISEDSDLLDDALNDAKNISVSLLNSKTYQAFWINTYNLLVIKGISDSYPIKSPLDIDGF
FT                   FDTTTYSVGGKKVTLNDIENKLLREKFPNEPRFHFVLVCGALSCPPIIDHAYSPNFLDK
FT                   QLQEQTVKAINNPNFLKVNDTSVAFSQIMEWYNEDFTKNGQSLIQFSNAFRSTKIPEDA
FT                   KVTFYPYDWTLNDITK"
FT   gene            complement(346185..346694)
FT                   /locus_tag="CA2559_01400"
FT   CDS_pept        complement(346185..346694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01400"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87369"
FT                   /db_xref="GOA:A3U552"
FT                   /db_xref="UniProtKB/TrEMBL:A3U552"
FT                   /protein_id="EAP87369.1"
FT                   /translation="MIQKPNNIIISDSRRPIWHLLIAAACYTCVVVLLYTFFANFRFGE
FT                   SLSKMKSISGMLQSAIVLTGVAVRFSMQTNIVFDIDNNRYKKQYAISRITFGRWKDFKS
FT                   LDYISVFKYKAYEYQVSLWYDRNQHWKIVSYEDKKAAINQGMLLADKFGIGVWDSTVAN
FT                   NGKWIA"
FT   gene            complement(346765..347043)
FT                   /locus_tag="CA2559_01405"
FT   CDS_pept        complement(346765..347043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01405"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01405"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87370"
FT                   /db_xref="GOA:A3U553"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:A3U553"
FT                   /protein_id="EAP87370.1"
FT                   /translation="MFLEIVTPEAVILTSEVESVTVPGINGEFQMLDNHAPIVSILEKG
FT                   KVRFNGDVSISENVRKLFKKDENGKWTFAVKGGVIEMKDNKVIVLAD"
FT   gene            complement(347124..348629)
FT                   /locus_tag="CA2559_01410"
FT   CDS_pept        complement(347124..348629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01410"
FT                   /product="ATP synthase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01410"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87371"
FT                   /db_xref="GOA:A3U554"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:A3U554"
FT                   /protein_id="EAP87371.1"
FT                   /translation="MSKVTGKVAQIIGPVVDVAFDTEGELPKIYDSLEIKREDGSILVL
FT                   EVQSHIGENTVRTISMDSTDGLSRGTAVEATNAPIQMPIGDVYGRLFNVVGDPIDGMED
FT                   MPKTGDNGLPIHRNAPKFEDLSVSTEVLFTGIKVIDLIEPYAKGGKIGLFGGAGVGKTV
FT                   LIQELINNIAKGHGGLSVFAGVGERTREGNDLLREMLESGIIKYGDDFMHSMEEGGWDL
FT                   SKVDKTAMKDSKATFVFGQMNEPPGARARVALSGLTIAEYFRDGAGDGQGKDVLFFVDN
FT                   IFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGAMQERITSTKKGSITSVQAVYVPADD
FT                   LTDPAPATTFAHLDATTVLSRKIAELGIYPAVDPLDSTSRILTADILGNEHYDCAQRVK
FT                   ELLQRYKELQDIIAILGMEELSEEDKMAVGRARRVQRFLSQPFHVAEQFTGIPGVLVDI
FT                   KETIKGFNMIMDGELDHLPEAAFNLKGTIEEAIEAGEKMLAES"
FT   gene            complement(348889..350736)
FT                   /locus_tag="CA2559_01415"
FT   CDS_pept        complement(348889..350736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01415"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01415"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87372"
FT                   /db_xref="GOA:A3U555"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A3U555"
FT                   /protein_id="EAP87372.1"
FT                   /translation="MCGIVGYIGHRDAYPIILKGLQRLEYRGYDSAGIALWDGSEIQLC
FT                   KTKGKVEELKQKCESSATIKGNIGIGHTRWATHGVPNDVNSHPHYSNSGDLVIIHNGII
FT                   ENYDPLKQELTKRGYTFKSDTDTEVLVNLIEDVKKNEKVKLGKAVQIALNQTVGAYAIA
FT                   VFDRKKPNEIVVARLGSPLALGVGEDEFFIASDASPFIEFTKNAIYLEDGQMAVVRNHK
FT                   DLKIWKIKDDSLVAPYIQELQLNLEQIEKGGYDHFMLKEIYEQPDAISDTYRGRMLVNE
FT                   NLIRMAGIDDNIEKFLNAKRIIIVACGTSWHAGLVAEYIFEDIARIPVEVEYASEFRYR
FT                   NPIINKDDVVIAISQSGETADTMAAINLAKENGAFVFGVCNVVGSSISRETHAGAYTHA
FT                   GPEIGVASTKAFTTQITVLTLIALRLAKQKGVLSNSQFNEHLRELEQIPEKVKKALESN
FT                   EHIEVVASKYKDAKNFLYLGRGFNFPVALEGALKLKEISYIHAEGYPAAEMKHGPIALI
FT                   DSQMPVVVIATRKGHYDKVVSNIEEIKSREGKIIGIVTEGDVEVRKRADYVIEVPETLE
FT                   SLTPLLTTIPLQLLSYHIAVMLDKNVDQPRNLAKSVTVE"
FT   gene            complement(350749..352344)
FT                   /locus_tag="CA2559_01420"
FT   CDS_pept        complement(350749..352344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01420"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87373"
FT                   /db_xref="InterPro:IPR025366"
FT                   /db_xref="UniProtKB/TrEMBL:A3U556"
FT                   /protein_id="EAP87373.1"
FT                   /translation="MTITKNFIKVAALLVAIFYLGSCEEEEFNTVGSDLIPSENFDALL
FT                   FDGTQMVTSQQDIVGVQTNGLPTYLLGVYNDEIYGQTSASVLTQLVMASANPTFGDNVE
FT                   LDSVVMSIPYFSTPTAAEGDTTFYSLDSIYGSGPIKLSVQESGYFLRNVDPNSGDGFSN
FT                   AQLYYSNQQQEFENNLRDFVFFEDDNFEFSNEELVLKRLNEEDDDEDETNDTIVERVTP
FT                   RLRVKLDSTYFKNNIIDKEGSEELLNNNNFKNFFRGLYFNAEAVNPNGSMALLNFGSTN
FT                   ANITLYYRSDLEESNGGTEGETTSDNTTKTFVLNFGDIIVNTYKTPFTPSQNNQNLYIK
FT                   GATPNIAEIELFSDEDQLDSLKQLDWLVNEANLTFYVNQQLADNGEKEPERIFVYDLNN
FT                   NTILFDYTIDFTQNATDPVNSRILHLGRLTRTQNESGSTTDEEETGIFYKIKMTEYVKN
FT                   IIQNDSTNTRIGVAVSPNVEILGDLNAKTSNSSEDVTVPFAAPLSPEGTVLHSNLSPNE
FT                   DKRLKLRIYYTEPN"
FT   gene            complement(352350..353075)
FT                   /locus_tag="CA2559_01425"
FT   CDS_pept        complement(352350..353075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01425"
FT                   /product="putative glycogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01425"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87374"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:A3U557"
FT                   /protein_id="EAP87374.1"
FT                   /translation="MINSIGGQIRIFMPRFGNINERRHQLHEVIRLSGMNLVINDLDMP
FT                   LIIKVASIPKERMQVYFIDNEDYFKRKATLTDEDGNLFPDNDERAIFFAKGVIETVKKL
FT                   NWSPDIIHVHGWLASLLPLYLKNYYGNEPLFKDAKIVTSVYNSGFEGTLDEDMAQKIMF
FT                   DGIEDTSVAHIVEPTFNGLMKTSMDFSDAIVLGSEDLSDELVAYAEASKKPVLEYKGLE
FT                   SFSQPLQEFYSTKVLNDKE"
FT   gene            353277..354128
FT                   /locus_tag="CA2559_01430"
FT   CDS_pept        353277..354128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01430"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01430"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87375"
FT                   /db_xref="GOA:A3U558"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:A3U558"
FT                   /protein_id="EAP87375.1"
FT                   /translation="MPTFKDATSLQAFLNSQRTGNNTVGFVPTMGALHKGHLALVTSAL
FT                   SQNEIVVVSIFVNPTQFGNAGDLKNYPRTLSKDETLLKTLHNDIIVFAPNAEDLYNGNI
FT                   TSNSYNFGAIANEMEGKYRQGHFNGVGTVLELLFDIVKPDYAYFGEKDFQQLQIVRKLI
FT                   SLTKQPVTIVGCPIYRENSGLAMSSRNERLSKERREASAFIYKTLQKVKEDFKYKSARQ
FT                   LNEWVKSEFDKQEALELEYFEIANIDTLKTIKRKHKNNKYRAFIAVFVEDVRLIDNVSL
FT                   NY"
FT   gene            354137..354487
FT                   /locus_tag="CA2559_01435"
FT   CDS_pept        354137..354487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01435"
FT                   /product="aspartate 1-decarboxylase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01435"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87376"
FT                   /db_xref="GOA:A3U559"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A3U559"
FT                   /protein_id="EAP87376.1"
FT                   /translation="MLVTVVKSKIHRVKVTGADLNYIGSITIDEDLMDAANLVEGEKVQ
FT                   IVNNNNGERLETYAIPGPRGSGEITLNGAAARKVAKGDILILITYGMMTMDEAKNFKPS
FT                   LVFPNEENNLLK"
FT   gene            354566..355462
FT                   /locus_tag="CA2559_01440"
FT   CDS_pept        354566..355462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01440"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01440"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87377"
FT                   /db_xref="GOA:A3U560"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A3U560"
FT                   /protein_id="EAP87377.1"
FT                   /translation="MVSSATPEEREKLWVNIVEADKFWIAVSLILGLLSHASRAYRWKF
FT                   LLEPLGYKPKFYNSFMAVMVAYLANLGIPRSGEVLRGATISTYEKVPFEKAFGTIVSER
FT                   IADLIMLLLVVATAILLQTDTLLNYFNDQDINPLMAVGIIVVLVVGVLVGVRILKSSTH
FT                   KFFVKLRTFAEGLLDGMKSILHMKNKWAFIFHTVFIWLSYVLMFGVIKYCIPGTENLSI
FT                   AGILAAFAVGSFAISATNGGIGVYPFAIGAILIYFNIDKQDGEAFGWILWGSQTLLNIV
FT                   LGGLSFLLLPILNRKKT"
FT   gene            355499..356644
FT                   /locus_tag="CA2559_01445"
FT   CDS_pept        355499..356644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01445"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01445"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87378"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3U561"
FT                   /protein_id="EAP87378.1"
FT                   /translation="MKYYFLLFTLLFSFSAISQVKYETIYSEKLGEDREIKIQLPRNYE
FT                   SNSEKRYPIFIVLDGDYLFEPVAGNVDFYSYWEDMPEAIVVGINQLETRIDDGYFDDTN
FT                   YFPSNSGANFFEFIGLELLPYLDTNYRTAKFVIAVGHDYTSNFINYYLFKDPALFQGYI
FT                   NLSPDFAPMMAERLTEKLSTIKQKTWFYMATGTDDIKSIREDVIYTDKQLSLVDNAAVN
FT                   YYFDDFEGATHYSLVGRAIPKAIEDIFSIYRPISNKQYKEELLNIEGSLYSYLIEKYNV
FT                   IEELFGLDNTIRINDFQAISAAIEKLEKWNDYEELGRLARKEHPDTMLGNYYLGRFYEE
FT                   TGEPKKAMRTYQSAFLLQEVGNLTKDLMLEKSDAIKADFGY"
FT   gene            complement(356713..357594)
FT                   /locus_tag="CA2559_01450"
FT   CDS_pept        complement(356713..357594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01450"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87379"
FT                   /db_xref="UniProtKB/TrEMBL:A3U562"
FT                   /protein_id="EAP87379.1"
FT                   /translation="MNIKKYNKMNHLISNKMRGILVLVISLNFCYSASSQEIKGEIIGS
FT                   VSGVFSTLDYSLNGASLRNGKGGQVGVHYGYHLSENYSLQLGLEFQSVSSSSRYEVIRG
FT                   SYNATDSEGEDFEFRYRGTNFQEQQKAQFVSIPLVVQYETSGVSRFYIAVGGKVALPID
FT                   TYYETDIKTLNTSGFYRQYNVELFDPEFAGFGTYRNINVNDQDLELKTAFSATLELGIK
FT                   QMLSSNNSIYIGLFFDYGINDLYDGEEFEDLVNYSNDIPSEFTYNTILGTSNASEVKLN
FT                   AYGVKLKYSLGI"
FT   gene            complement(357622..366891)
FT                   /locus_tag="CA2559_01455"
FT   CDS_pept        complement(357622..366891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01455"
FT                   /product="cell wall associated biofilm protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01455"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87380"
FT                   /db_xref="InterPro:IPR003410"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="InterPro:IPR039005"
FT                   /db_xref="UniProtKB/TrEMBL:A3U563"
FT                   /protein_id="EAP87380.1"
FT                   /translation="MNKITLWCSALFIIIGSFTATSQTEGTDFPSGPTTDSNFTFNLVA
FT                   GANTFSGSLDTPTDSQDNWQIVIGAGQTITSITYTIQNNFGISNGFFAFGPNQEAFVTY
FT                   PPSFSGSISSSPFFTSPGTYAAAVVANIAESASWSVTINVTQAPVAGPPTVTSNIIGVG
FT                   FSENGPAIALNNQVSISDSSNITQMVITERSGAAGSDENDILTLSNSNGYSISSSADKS
FT                   QWTITGNGSAAQATAALRSVMYQNTGQNPTIFGTNNGRGYNLSVTNALGLTTNIDSSEY
FT                   YSLGFALIINDAPTSVINNTLTANNLDSTVITSTHLLGLDPDDRETGLVFTVSNVPSNG
FT                   NLRLNGIILSINGTFTQSDINNNRLTYENTNGSASTDSFVFNLSDGGEDGAAAISGRTF
FT                   SITIESGDTTAPRIDSIVRVDPINRETNENRISFDITFNEPVSNISLNDFELIGSSSLI
FT                   SDFSQQATTRYRLAYENGNLSNINGIVSLGLSSGYSITDLAGNSLVNTTPIGVNEDYLL
FT                   DNLGPVVTSVTVPVSATYTTGQNLDFIINFNENAIVNTFGGTPQLSIVIGTITKQAAYV
FT                   SGSGSNGLLFRYTVLDGDLDTDGVEVGTLMINGGSIADTLGNNANLTLSNIGNTNGVLV
FT                   GNPCTNPDTPAISASSENVCPGESVVLTITGNLNDATQWAIYSGSCGGTLVGTTTTTTF
FT                   EVTPNSNTQYLVRGEGGCAISAGCGSVTVMAEDTEAPTVICPEDIVVSNDPGNYGAIVT
FT                   YPSAITADNCSSELFVSYSQESGTFFPVGSTQVTVTVNEGNSPEATNTQILTLGNGNDG
FT                   EAIAFNPTNGVLFHASGISDGNQYFEPINLSTLTVGANIAPGNTYPAGIEQEVVGMVYY
FT                   PPLNGFVAMDRDENIALINTDNGTFSLLSTLDRDYIRGYAVNGNSVFGVDPFSSALVEF
FT                   DPTTGVTLSTVPVVIDGVEITSGSNGLSTSPITGITYIVYKLSGGLRGLASIDLSTGIG
FT                   ESIGSTGTKIAGISFSADGTLYGVSGDGANPAETLYRFDSISSNSATCTFNVIVNDTEA
FT                   PTITCPDDIIVNSDPGSCEAIVNYNFPTTTDNCSVNSTSDNITFSFTGAPESFIVPAGV
FT                   TEIFIQSWGAQGQAITVDDYQNSVGGLGGYSEGILSVTPGETLEIYVGGTGTNGVGGFN
FT                   GGGTGGVALAGGGGSNGFGGSGGGSSDVRQGGSDLINRVIVAGGGGGGGRSYVNGSCVP
FT                   CGVGGDGGDGGGITGVNGEDPADPNYNSYFNPGSGGSGATATAGGSGGMGTQGTNGNPG
FT                   AFGLGGNGLPANYGVASGGGGGGYYGGGSGAIPTSGSGAAAGGGAGGSSYLGTLTNSVT
FT                   TTGIRSGNGEIILSYEGCVEISQTEGLPSGSAFPVGITTNTFIATDASGNTSTCSFTIT
FT                   VEDSEGPIADVLILDDVVGECQVNSIGAPTATDACEGQVIGLTDAIFPITENTTITWTY
FT                   QDSSGNMLTQTQNVLITDTTPPVANMMTLEDINEQCQVDSLVAPTATDNCSGQINGTSN
FT                   TAFPISESTTITWTYEDEAGNISTQTQEIIIEDTEAPTVTCPENIVVSNDPGLCGAVVN
FT                   FDIPEFSDNCVIDNDVQVTLSFTGSSTFGSPYTESGMVITAFASEHIDAPWPVGCGDGQ
FT                   GMLIHSNTGNTWEYNGGETFTPSSFIACQTGMRFTALPSMATFIPEETGLNVFPSNEDW
FT                   RNITGLIWENTSTSDVSLDNFILNESGIQQTAGLPSGSEFPIGTTTITYEVTDNSGNQT
FT                   TCSFDVTVNDTEAPVVECQDVTVELDNNGVATITQDDVIANLISSSVTYSIDQSGTFAP
FT                   IDISANSTQVVLSDDSVSGAIPLGFDFSFFNNDYSEYYISSNGFLKFGSGLDNGCCGGQ
FT                   LLPNTSTPNNLIAFAWDDLFPQGSGSITYATTGVAPNRIAVLQFTDIPFCCNSTPQVTT
FT                   QVKLFESTNVIEIHSTSVTGSPMTQGIENIDGTIGLTVAGRNSANWNTQNDFVAFVPEG
FT                   DQSVADNCGLVYDIALSQDTFTCDDIGENTVTITVTDEAGNVGTCDAVVTIEDNSVPVA
FT                   TAMDITVQLDENGTVTITGDDINNGSTDNCIESITVTPNSFNCSNTETPVEVTMTVTDI
FT                   GGNIATDTAMVTIEDTILPIANAMNATVQLDENGVATITVQDINDGSSDICGIETLSVS
FT                   PSTFDCSNLDTPVEVTLMVTDNNGNSSTDTAMVTVQDNLAPAADLLVLEDVMAQCQVDN
FT                   ISAPTATDNCVGSVIGTTVTTFPITEQGTTIVTWTYEDESGNTSTQTQNVIIEDITSPT
FT                   PDVMTLSDVEAECQVDTLVAPTATDNCVGDVTVTNDANLPISTQGTTVITWTYEDENGN
FT                   TSTQTQNVVIEDVTSPTPDVIALSDIEAECQVDALVAPTATDNCSGDVIVSNDADLPIT
FT                   TQGTTVITWMYEDVNGNSSSQTQNVVIEDVTSPIPDMMTLSDVEAECQVDALVAPTATD
FT                   NCAGDVIVSNDADLPITAQGTTVITWTYEDVNGNVSTQTQNVVIEDVSGPVADAGTLED
FT                   ITAECIVESIIIPSATDNCTGPVQGTTDTVFPIEVQGITEITWTYEDDNGNITTQTQNV
FT                   IIEDVTAPVPIVAVLPDISEDCAVLSLPIPKALDNCSGSVSGVTTTVLPITTPGTTVVV
FT                   WSYTDDVGNVSTQTQNVTVNNSPLDQVVFNDESFIYDGDIQDIEVLNLPNGASVVYSTT
FT                   PSTGIPNGAINAGIYTVSAVITPPSTSPNCDEITLTATLTIDRSTQEIVFNPIPVKEIG
FT                   VDPDFQLMAEASSGLPITYTYTYTGTNQPADVSAEGFVTLLATGQVTITANQEGDSNYL
FT                   PATPVSQELIIESSNANINTITIDGQVYNDPDNLVNYIIDCGSTVNSVQVVIDAEPSAI
FT                   VTPATVFEIETPVPGIYLQDVVVTSQNGSMVRTYTIRVEKQFLFNDIAEQKFDNVLLVN
FT                   NNPNTNGGYSFVAYEWYKDNVLVGTEQYYSAGATTSDLLDPNATYFVKMTTVSGDVLQT
FT                   CAINIELQHSYSISVTPNPTTQLNRTLNVSADIPATELDNMIYTVFNMSGKVLKQGRYD
FT                   AISHTVRLPETIQSGIYMINFSSPNVNKVIKLIVE"
FT   gene            complement(367181..373900)
FT                   /locus_tag="CA2559_01460"
FT   CDS_pept        complement(367181..373900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01460"
FT                   /product="cell wall associated biofilm protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01460"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87381"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="InterPro:IPR031549"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A3U564"
FT                   /protein_id="EAP87381.1"
FT                   /translation="MKHTYLMFKYLLVVCIVFLSIQQSNAQDATANPSSIEFGNLDVGQ
FT                   QSTEVTFLTNNTSNNWTIIEFDITGPDANQFGQSNNPGAPFGPEGEVIVEANFNPTTPG
FT                   NKNATLIVTYGTDFSTPVGTVDIPLSGSAGEIFEPIAEVTNVNFGTHDIFVNVTDEITL
FT                   SNTGNADLMVSSLDFTTDANFIEDFSLESGISFPFTLIEGESRNFEVTFNAIAREQTSS
FT                   PNTAVRGIDIQIDTNDPNNPTIFSNLQAEILLPQIEVQMSPFEFDGQEVGVPTTRTVDV
FT                   NNTGDGTLVLSNLYFSAGSPSTGANDDFIVTDPSSLPFNIPGNSTYPVEVQFTPSATGE
FT                   RSTFFRIETVNSDALSSIFTRGFGQESGISITPNPIDFADVDFGSFSAENFNIENTGTA
FT                   DLELSSGSISGAHASDFEITTSNEPLTIGTGNTVILQVLFTPSGVGNRTATLTYTSNAP
FT                   SSPHVIPLLGNGAETFIELSTNSIDFGDTNVGTPATQNLIISNTEEASVDLVVSELNLS
FT                   GETTQFNIGGVTLPISISPGNNIMVPITFEPSEIGEKTATLSVVSDDDSSPNTVSLSGN
FT                   ALEALLTVNRAMINFQDTQIITNTRTELVSVGNMGNTGLEITGISFSGEDADDFSVTDV
FT                   SFPINISEQASLSFQVVFAPQTRTLKTATMTIETSAGNADVALMGETTGPKLSTAGTLD
FT                   FGTLNLTDTRTAVTSLTNSGESDLIIDGISVNGANASDFNLEGLSFPITLAPSESQEVN
FT                   VTVNPSDSGVREAILQVSTNDTATVNQSVNLSANITNRATISFANNPFTFPQTDTGETT
FT                   FSLIPVTNTGSKPMTLVGAYTFASDNSSIFRVTTYEDGTDIYPLEIAPGETKDIRFQFS
FT                   PDGNQDSYATTAAIVTAQAEGPTTNFDFLCGTCIPSGYVHKFYTTGGANRAKLNFDEDI
FT                   DGMDETTIISFPDTSIGRVSEQILTARNTGNLPLEIFAFANDGEFTLERVGIEEGESFA
FT                   VTLQPNETAQFKITFAPEGDLGDTSGNVIIISDISNGDNGFTNHVIQVNGTRVEPEEVA
FT                   VGGLVFKSDSRTLQPDGVTWLMSGNVHAGKLEYGGDVLVNTTAMTVTSLEEIDVFVNDI
FT                   PEIGDFGGDRVLLQSGMIEQTVDNVDPVLNVGVGATAASVSTLFTLVGIPVEISQFKLI
FT                   DETVGGVRKQGIEMGGVISLPEEIFGTNANITMDRIRIDDVDGVNVMGSAMIAPNIRIL
FT                   NTFDLRNASINFDTFTNSFGGSAEVRLNLLNKGVNIAASIQIINGGLDSVSLEIEVSPG
FT                   IPIANTGFSLAGGNGFIEGLQIPPLSLGLGVDIEPTVSPIDLRLDNMQVAYTLGTSLTA
FT                   SGTIQLYRQDIGGGNVTIKANGVSVGAFVNLYGVFKGNASMLVEHRNDELFFESTANLS
FT                   ITIPSVEVTFGCVACEAINRFLPLTVASVEATFNNTTMRGKLTVAQVLELAVALQRRSN
FT                   GTYRTNFEANLGIFNLSFFNGQSPSSFNNQFYFENDEELQLISDGKEGASLVIPASSQS
FT                   SFAPMDIPFTLNESARNIIVRVQGASGTPDYILILPDGTEVTPTNAESLGYLATTYEED
FT                   NKAFYILQNTPVGEYNIRIDDGDTYEIDIYGAEFAPELTVTSVTQNAPNDEVTFTWEDE
FT                   DFDSDANVSFYYDTDDKDANGNLIVEGISENDNTDSFTFNTSALKNGTYYIYGTINDDI
FT                   EDAETSRAPAMSYGTESFTINRETDVDATTLFGELNNNIFELSWSPVEDAELYNVYITE
FT                   GNETVTLFSDNENVGNTSSFDFTEIEAGRQYNFAVTAVKEGDDEIFVESPLSNVVTFNF
FT                   ISPDENNLPRIITESLPDYTDACSEYSETITSSDVDSEDILTLSLAIAPEGMTLSENTI
FT                   SWRPTVEQLGQNQVVFEVNDGNGGIVQKQLIIAVLEVDDEEPIPSLETLEDIAAECSVS
FT                   LTAPTATDSCSGTITATTEDAMEYTEQGDYIVTWTYTDEVGNTVEQTQNVTILDTLEPE
FT                   VLTQNISVVLDEMGSVNITASQIDAGSSDNCSLQDLTLDVTSFSCDDLGENTVMLTATD
FT                   AVGNISSGIAVVTVEDFTAPVFNQDTLPEDTTRGADLNNEYNLEDFTAGITFEENCIAT
FT                   ISQSPEIGTTFTPGTYDISLTVIDMGGNEDLYTFELTVEDHVLGIAEVNSTNFSLYPNP
FT                   TKTYIMVTNPDNVQIQNIQVFDLSGKQVKTLSVNSFNSEIRIETSNLAKGMYLLKINSN
FT                   TVQVVKTLLKE"
FT   gene            complement(373997..374389)
FT                   /locus_tag="CA2559_01465"
FT   CDS_pept        complement(373997..374389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01465"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87382"
FT                   /db_xref="UniProtKB/TrEMBL:A3U565"
FT                   /protein_id="EAP87382.1"
FT                   /translation="MNLHTVAVYHSSELYAYSVTQYLNTKGYIATGFCLKSTDGITFTN
FT                   LPNVDIVLLERKLYQNSQKYLKQSKASLNMIIIEDGFLNNDLSILKFDHIKGYVFPTDT
FT                   FESISKCVNDVLVTNSSQNKQLRSNT"
FT   gene            complement(374475..375128)
FT                   /locus_tag="CA2559_01470"
FT   CDS_pept        complement(374475..375128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01470"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01470"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87383"
FT                   /db_xref="GOA:A3U566"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A3U566"
FT                   /protein_id="EAP87383.1"
FT                   /translation="MPLKPSEISIVIADDHPMLLKGLYDELTKHNYNVVSQALQGMQAL
FT                   EAVLSERPDVALLDIDMPLLTGFDVVKMAKEKGVLTKFIVLSFHKESEYVAQAKSLQIE
FT                   GYLLKEDSFFEIERCIQTVLSGKTCFSKSFDTKAIIDAEDELGKLKLLTPSETLILKKI
FT                   ANQNSTNAIAEQLSVSSRTIEKHRSNIIEKLGLKQVNTKLSNWAMTNKVIILAL"
FT   gene            complement(375128..377134)
FT                   /locus_tag="CA2559_01475"
FT   CDS_pept        complement(375128..377134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01475"
FT                   /product="histidine kinase sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01475"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87384"
FT                   /db_xref="GOA:A3U567"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3U567"
FT                   /protein_id="EAP87384.1"
FT                   /translation="MKNFLWYILVLLSFLNSSAQQANLNDSFALKLSETRNVDEHFVMS
FT                   EDKFGVFHLDSIKKYSRVYINLERYDEALVYSNVLSNFYIYKTLQHKEAFKTLNNFEKH
FT                   LANVTIPSEIGKYYVAYSEAAGYLEQLQNAVLLSKQGITYLEKVKDSSLYEYGYLYLKS
FT                   AENLSKLNEISESAEHFEKASALFIHQKDTLFYLWSQNGLATLFGRNGLNDQAKKARQV
FT                   IYEQGPKIGEEQVVAMAHLQAGVEAVFLDDHEELYHYREALKFKNEKSDIQEIVSVLVL
FT                   SYASEAYARANKIDTAKVYLRRLNKIMEGKSFNSQLKTNYDFAKAYIALSENRLQDAER
FT                   IGLELVKHIQNSKDAGLSLKINSLLSIIYERKGNNAKALEYYKVYSKVNDSIKTASTRN
FT                   RFAYVQTQFETAKKDLEIETQKQNIELLDSENKVKSQWIIFGGLGLLGAFCLVVIIRSR
FT                   NFAKKEKQQQEQYSQELIEAGEAERTRVARELHDSVGQKLMLLTRQTKTFGDTPMLTLA
FT                   NTTLEELRSISRGLHPSILNRLGLTSAITSLVNETDANTDIFFTNDIENIDHKISEDQA
FT                   LHIYRIIQEALGNIVKHSKSPSASVKVFNKDKTIVVLIKDNGIGFSTANKLLTSNSLGM
FT                   KTLFERAKIIKGILTINSEPQKGTTISLTIPVK"
FT   gene            377174..378535
FT                   /locus_tag="CA2559_01480"
FT   CDS_pept        377174..378535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01480"
FT                   /product="putative DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01480"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87385"
FT                   /db_xref="GOA:A3U568"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A3U568"
FT                   /protein_id="EAP87385.1"
FT                   /translation="MAKTKTTFFCQNCGTQYSKWQGQCSACKEWNTIAEEVIQKAEKSD
FT                   WKTATAPKKRVAKPQKVADISYTQEQRYNTKNNELNRVLGGGLVPGSLTLLGGEPGIGK
FT                   STLMLQIALQLPFKTLYVSGEESAQQIKMRAERIDNSESNCFILTETKTQNIFKQVEAI
FT                   EPDIVVIDSIQTLHSDYIESSAGSISQIRECTTELIKFAKETATPVILIGHITKDGNIA
FT                   GPKVLEHMVDTVLQFEGDRNHIYRILRAQKNRFGSTHELGIYEMQGSGLREVANPSEIL
FT                   LSKNEDDLSGTAIAATLEGMRPLMIEIQALVSSAVYGTPQRSATGYNAKRLNMLLAVLE
FT                   KRAGFKLGAKDVFLNVTGGISVDDPAIDLAVVAAVLSSNEDIHVPKDICFAAEVGLAGE
FT                   IRPVPKIEQRILEAEKLGFASIMISRYCKLPKETYGINVVKAAKITDVVHYLFG"
FT   gene            378714..379847
FT                   /locus_tag="CA2559_01485"
FT   CDS_pept        378714..379847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01485"
FT                   /product="peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01485"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87386"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A3U569"
FT                   /protein_id="EAP87386.1"
FT                   /translation="MNKQIFITLSVCLVIVSCKQLTKATDFITQPTAKEIYARDFEDTD
FT                   VVFNTWTKNFEVSKNDSLKINLPYLEQVQLHSTNLQSYSYNINLSEGELFNLQIESDVD
FT                   SIQFFSELFKIEGDSITSFKSLIKSKPNETNMSVPIKESATYKLIIQPEIYASTKASLK
FT                   IFTSPTYYFPVAGKTSKAIQSFWGASRDGGKRSHKGVDIFVERGTPVIAAVDGYVSSTG
FT                   NKGLGGKQVWLRDGLFGASLYYAHLDSIATQSGKKVKIGDTLGFVGNTGNAKYTPPHLH
FT                   FGIYKGYNGAVNPLPFIKNAEIPETDNLFVAITPKAIIKNSVANIRIGPSSKFDKITQL
FT                   KRNDTITVLGKQDDWLHIKTGDGQKAFVFKTLTQSLP"
FT   gene            379923..381284
FT                   /locus_tag="CA2559_01490"
FT   CDS_pept        379923..381284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01490"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01490"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87387"
FT                   /db_xref="GOA:A3U570"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A3U570"
FT                   /protein_id="EAP87387.1"
FT                   /translation="MSLFGKIKGTLSLLKDIDIEAIAKLNSKIDLKEVMDKVGSLDDDQ
FT                   LNGLMKMLTRKAKRGQHKLPPIDGDFYDLSLKLTPEQREIQLKVRNFMEDEVRPIANEY
FT                   WKKAEFPQQIIPKLATLNIAGIAYKGYGCPEQNFVMEGIIAIEMARVDVSMSTFFGVHS
FT                   GLAMGSIYLCGSEEQKLEWLPKMQRMEAIGAFGLTEPNVGSAISQGMETTCQRDGDTWI
FT                   LNGQKKWIGNATFADVTIVWAKDVDDKQVKGFLVRKGTPGFSPEKIEDKMALRTVENAL
FT                   ITITDCRISESDRLQEANSFKDTAKVLKMTRAGVAWQAVGCARGAYESAVKYCKKREQF
FT                   GKPIATFQLIQNHLVEMLANLTAMQTLCYRLSELQDEGLLKDEQASLAKVFCSMRTRDV
FT                   VSRAREVMGGNGILLEHDVARFVADAEAIYSYEGTKEINSLIVGRAITGYSAFV"
FT   gene            complement(381381..381857)
FT                   /locus_tag="CA2559_01495"
FT   CDS_pept        complement(381381..381857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01495"
FT                   /product="putative transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01495"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87388"
FT                   /db_xref="GOA:A3U571"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A3U571"
FT                   /protein_id="EAP87388.1"
FT                   /translation="MSKVNYYTEEGLKKLRDELDLLRDVERPKASQAIAEARDKGDLSE
FT                   NAEYDAAKEAQGMLEMKISKLEGVLSNARVIDDSQLDTSKVLIHSSVKIKHQGNGAEMT
FT                   YKLVAQSESDLKSGKISVDSPIGKGLLGKQEGDVAEVTTPNGTIKFDVIKVWRD"
FT   gene            382085..382519
FT                   /locus_tag="CA2559_01500"
FT   CDS_pept        382085..382519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01500"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87389"
FT                   /db_xref="UniProtKB/TrEMBL:A3U572"
FT                   /protein_id="EAP87389.1"
FT                   /translation="MKNLFIATLLIAILSSCSTDDSARDNNPNLVDLNFGAVYNLTLPQ
FT                   YNQLNFEGNSFQDYSVGISGINIFYIGNDQYLAFELSDPNHPVSDCSRLVVTGLTARCQ
FT                   CDDNNAYNLTNGQQTEGGPGTYSLRMYRAELNGDILTVSN"
FT   gene            complement(382521..384932)
FT                   /locus_tag="CA2559_01505"
FT   CDS_pept        complement(382521..384932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01505"
FT                   /product="putative TonB-dependent transmembrane receptor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01505"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87390"
FT                   /db_xref="GOA:A3U573"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A3U573"
FT                   /protein_id="EAP87390.1"
FT                   /translation="MKTVSILLCALFVSASTFAQEFQLSGNVTNSKNEPIEGVSIFIKG
FT                   ITTGTETNALGNYNFSLEKEQYTIVVSYVGMITQEQTINLEEDVTANFVLLEDSEILDE
FT                   VLVRSVRVTADSPITYSNISKEEIEDRNLGQDIPILLNYQPAVVTTSDAGAGVGYTGIR
FT                   VRGSDATRVNVTINGIPYNDAESQGTFWVNLGDFASSTENIQLQRGVGTSVNGSGAFGA
FT                   SLNILTDAVKDEAYGELSGSVGSFNTRKATLRFGTGTLSDHFSVSGRLSKIDSDGYIDR
FT                   ATSDLKGYFLQAAYKDDNTLIKAITFGGFEETYQAYYGVDEATLQSDRTFNTVGQQFDR
FT                   EGNFEGFYENEVDNYRQDHYQLLWNERYNNNWSTNVALNYTRGAGYFEQYVDEFYYSNI
FT                   LFSGDAQLDFFGVDPVTIDGEEFTTTDYVRRRWLDNNFLAVNASVNYKNESLDVTTGAF
FT                   YSTYKGDHYGEILSTEIPIGFLPYDRYYDGDSEKNEFSAFSKATLKFGDKWSVYGDAQI
FT                   RLVDYEAIGGSDDLDVDESYTFFNPKLGTNYKLNTENSLYLSYARANREPNRTDFENGN
FT                   PEPEQLDDFELGWRLNNPKFQISTNVYYMNYNNQLVLTGEIDDVGSPIRANSGSSYRLG
FT                   LEVDASVQILKNLIWNPNMAISTNKNRDFVTSLDGSLVNLGNTEISYSPNVIAGNAIKY
FT                   IPVKNLELQMLNKYVGEQYLSNVEAPLSKLDSYFTTDLNVQYTFSTNSLFKEIVITGLV
FT                   NNIFSEEYVNNGYYFTFDGGNEDGSITTFEGAGFFPQAKANFLLGATLKF"
FT   gene            385290..387731
FT                   /locus_tag="CA2559_01510"
FT   CDS_pept        385290..387731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01510"
FT                   /product="two-component system sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01510"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87391"
FT                   /db_xref="GOA:A3U574"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3U574"
FT                   /protein_id="EAP87391.1"
FT                   /translation="MDKTKNRFTFKIILSYVTLGVLALVVGFFLYSEFKFLLKTNTTTT
FT                   EDEKFIETGTLINQVYETDGFSRLALLTGEESDFELYQQKADSLFNKIEEIKTLTDIQF
FT                   QKQQLDYVKELLLQKTKNIEQLRILKLTNSKDSSFDDIAEEFNKLESSMGKLTVETFIN
FT                   NPNDLTERERRIWSNYVEYLNQSEERDTATVKTKVVDSMITATRFILAEAKRENSKSRE
FT                   ALQQKENELIRNDLNISAQLRQIITAFDAEIARKNQIQATKKSASVDRTSTILKYSGVL
FT                   GIFIILLFTYIILNDFFKAERFKISLKKSKDYSEELLKSREQLISTVSHDLKTPLNTIV
FT                   GYSDLIENTDLTEKQLYYVNQITNSSLYVTKLVDDLLDFSKLEAGKLHIETIPFSLESI
FT                   IQQTVETSKDVHQQKNVAIHLYVDQAISNQVFESDPLRIRQILSNLIGNAFKFTEEGSV
FT                   TVYAKILEQKAQEFEIEIKVVDTGIGISKEKQELIFKEFQQAEADTIKRFGGNGLGLAI
FT                   SRKLTNLLHGTLTVDSTPNQGSTFTLVLPLKLSESKLKSEITTLTKAVKSLTVVVIDDD
FT                   TSMTKLLEELFGQMNITCHSFNAFEDFVASQNFEYDFVLTDVEMPKTNGFQVLEQLKRH
FT                   FKANYNGQPIVAMTGSREYTVRSFKEQGFSGLLHKPFPKEKLYSALNQLFPEHMGIPIK
FT                   IESEKETTQQSTLFNLSLLNSFLSTEDALEEVLFSFYNEVNIDLQRMALAVKTEDYTAV
FT                   NDIAHKMLTLTRQLEAKEVVKILDVLEYVTQENLRQETLTSLFNSLQEKVENLVTALKN
FT                   R"
FT   gene            complement(387732..389168)
FT                   /locus_tag="CA2559_01515"
FT   CDS_pept        complement(387732..389168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01515"
FT                   /product="rteB, two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01515"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87392"
FT                   /db_xref="GOA:A3U575"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3U575"
FT                   /protein_id="EAP87392.1"
FT                   /translation="MITLKTKGVETFYFYNSYIYEMIQRILVVEDDVAFGKMLSKFLER
FT                   KGFQVSTALNGNHARKQMEEQKYELLITDLKLPDDSGLNLLEYCQSVSADTNIILMTSY
FT                   AEVSTAVEAIKKGALDYISKPFRPEELLMVIEQAENKSKTNATLNVETSPKAKTVKHKT
FT                   SELPDSSSFVKGISESSKKFNEYLKLVGPTDMCVLIQGESGTGKEVAANAIHNFSKRSN
FT                   ENFVAVDCGAIPKEIAASEFFGHVKGSFTGAINDKKGHFEAAHKGTLFLDEVGNLSYEN
FT                   QVQLLRALQERKIKPVGSNKEIEVDVRIISATNEDLLKAVADGKFREDLYHRLNEFSVH
FT                   IPSLKERSDDLFLFTEFFLEMANKALDKNVVGLSKEVEEAFKSYNWPGNLRELKNIIKR
FT                   AVLLTTGQLVPIDVIPREVVNFKGQAPITTQDFSKDTNEKQLIINALKEAGYNKSKAAR
FT                   LLNVTRKTLYNKMEHYNLEL"
FT   gene            complement(389230..389553)
FT                   /locus_tag="CA2559_01520"
FT   CDS_pept        complement(389230..389553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01520"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87393"
FT                   /db_xref="UniProtKB/TrEMBL:A3U576"
FT                   /protein_id="EAP87393.1"
FT                   /translation="MKKIILTAAIALGTLTAMNAQEKKTETMAMTKTEVKTTVAVQDNY
FT                   KAITAEKLPQAVKEAFASDFKGATLTKAFANDKDEYKLVITTADKAEKTVYANSKGEWI
FT                   KKQ"
FT   gene            complement(389593..389919)
FT                   /locus_tag="CA2559_01525"
FT   CDS_pept        complement(389593..389919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01525"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87394"
FT                   /db_xref="UniProtKB/TrEMBL:A3U577"
FT                   /protein_id="EAP87394.1"
FT                   /translation="MKKIIYTAVIALGAIGFTNAQATTPVAANTEASVEVKAESLLQEK
FT                   YVEIKATDLPQEVQTALSKDFEGATLNKAYINSKNEYKLTLTTAEDTEATVYATAEGEW
FT                   IKKK"
FT   gene            complement(390214..390621)
FT                   /locus_tag="CA2559_01530"
FT   CDS_pept        complement(390214..390621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01530"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01530"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87395"
FT                   /db_xref="GOA:A3U578"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:A3U578"
FT                   /protein_id="EAP87395.1"
FT                   /translation="MNTSQLIEEVEFNTTTSSGPGGQHANKTETAVELRWNINSSQAIS
FT                   EKERFILLEKLSSRLTKDNVLIIVAQDSRSQHKNKDIVIKRFLELIKKNAKQKPPRKKT
FT                   RPSKMAKLKRLNSKKKTSEKKANRQKPRLDY"
FT   gene            complement(390621..392207)
FT                   /locus_tag="CA2559_01535"
FT   CDS_pept        complement(390621..392207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01535"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87396"
FT                   /db_xref="InterPro:IPR025393"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3U579"
FT                   /protein_id="EAP87396.1"
FT                   /translation="MRGTIKANILDFTAQQLKQIENHGLTLKQVENQLQTFMEGIPFIN
FT                   LTDCATIENGILQISDDKKQTYIKLYNSKLDDIEVIKFVPASGAATRMFKSLYRFLDTY
FT                   NPSKESINAFINKTKDNTLKLFFVGLEKFPFYEAILQQLKKTCPNYNSLSDDDKKVCIV
FT                   ECLLGETGLNYGNLPKGLVPFHKYKEHTASAFAEHLFEASKYAAPNKKAHLHFTISNNH
FT                   YNKFKSEYDRIKDIVSNKTDTTFITTESYQKKSTDTVAVNLDNTPFIDDDGNLVFRPGG
FT                   HGALIENLNEQDADIIFIKNIDNVVTYQYEEDVANYKKMLGGLLLEQRQTSFKFLEMLD
FT                   ENANPTEEFIHEIVYFLQDNFNNILSEDFEKFSLKYQIEYLREQLDKPIRVCGMVKNEG
FT                   EPGGGPFWVKHESGKISLQIVESVQINKEDPRQLSCLNDATHFNPVDIVCSVRNYKGEK
FT                   FDLLKYVDYKAGFINQKTINGQDIKALERPGLWNGSMAHWNTIFVEVPLSTFNPVKTVV
FT                   DLLKESHQISN"
FT   gene            complement(392192..392746)
FT                   /locus_tag="CA2559_01540"
FT   CDS_pept        complement(392192..392746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01540"
FT                   /product="possible transcriptional regulatory protein nadr
FT                   (probablyasnc-family)"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01540"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87397"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:A3U580"
FT                   /protein_id="EAP87397.1"
FT                   /translation="MEKYFKQQTSDCLKIVLYGPESSGKTTLVNLLAEHFKTVSVPEFM
FT                   RIYLQDKWDRTQTVCEKEDLIPIAKGQINTENELSNVANKYLFCDTNLREIKVYSKAYY
FT                   NEYCPKEILGAVNDHHYHLYLLTYIDTPWEADDLRDKPDERKAMFLKFKDELDANNCNY
FT                   VILQGNVETRLKTAIEHCEAL"
FT   gene            complement(392707..393339)
FT                   /locus_tag="CA2559_01545"
FT   CDS_pept        complement(392707..393339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01545"
FT                   /product="putative membrane transporter involved in
FT                   nicotinamidemononucleotide transport"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01545"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87398"
FT                   /db_xref="GOA:A3U581"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:A3U581"
FT                   /protein_id="EAP87398.1"
FT                   /translation="MSPIFEFFFGQYRGYETHIIGLEVAGIVFGLISSICSMRNSVWVY
FT                   PTGIVSTLIFVYILLKFNLLGDTIINGYYFVMSIYGWYIWTRKVTPTQTTPITKATKND
FT                   YTNSLGIFLSTMLFIYIIYYVFEKFEGWVSYIDILTTGLFFVGMWMLAKKKLENWLFLL
FT                   MGNVISVPLYFYKGLTLSSFLYVIFVIISIFGYLAWKNILNNRLQTA"
FT   gene            complement(393323..393583)
FT                   /locus_tag="CA2559_01550"
FT   CDS_pept        complement(393323..393583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01550"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87399"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:A3U582"
FT                   /protein_id="EAP87399.1"
FT                   /translation="MNISVELTLTPLQDDFEPAIINFIKSLRASGLKVLENPLSTQVYG
FT                   EYDEVMGILQKEMKIALEAVERGLLYIKIVKSDRHDYEPHF"
FT   gene            complement(393604..394488)
FT                   /locus_tag="CA2559_01555"
FT   CDS_pept        complement(393604..394488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01555"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01555"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87400"
FT                   /db_xref="GOA:A3U583"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:A3U583"
FT                   /protein_id="EAP87400.1"
FT                   /translation="MAHKAGFVNIIGNPNVGKSTLMNAFVGEKLSIITSKAQTTRHRIL
FT                   GIVNGEDFQIVLSDTPGIIKPAYQLQENMMDFVKSAFEDADVLIYMVEIGEQSLKDEAF
FT                   FKKITNAEIPVLLLLNKIDTSDQHQLEEQMQYWKEKVPTAEIYPISALEGFNVSEVLNR
FT                   IIEVMPESPAFYPKDQLTDKPERFFVNEIIREKILMHYKKEIPYSVEVDTEEFFEEEEI
FT                   IKMRSIIMVERDSQKGIIIGHKGSALKRVGVEARKDLEKFFGKQVHIELYVKVNKNWRS
FT                   NDNQLRRFGYLNK"
FT   gene            complement(394533..395399)
FT                   /locus_tag="CA2559_01560"
FT   CDS_pept        complement(394533..395399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01560"
FT                   /product="alpha/beta hydrolase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01560"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87401"
FT                   /db_xref="GOA:A3U584"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3U584"
FT                   /protein_id="EAP87401.1"
FT                   /translation="MKTKTQLLVLILIGVLFASCTALQYRETTEEVYLRHKAINIPTEI
FT                   TTFNSKVIDRNIRVQAVKESNNNINVIFFHGSPSSMAAWRDYLIDTSLVKKANLYAVDR
FT                   PGYGYSGFGDELTSIKTQAKVMNELINDYNLENVILVGTSYGGPLAARIAVLNTRVKAL
FT                   IMVSPALDPNQEKKIWASRLTQWWLTRWLVPTGYRVAGDEKTTHAKELEKIEDGWETLK
FT                   IPVVHIHGTEDKVVPFGNINYSKEVFENITVIPISNAGHEIAWQTPELVKPEIEVLITT
FT                   LIEDIKP"
FT   gene            complement(395498..398122)
FT                   /locus_tag="CA2559_01565"
FT   CDS_pept        complement(395498..398122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01565"
FT                   /product="putative TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01565"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87402"
FT                   /db_xref="GOA:A3U585"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A3U585"
FT                   /protein_id="EAP87402.1"
FT                   /translation="MKTLIFTLGCLFITAFTFAQSSVSGTITDSNGGPLPGVNIIEKGT
FT                   SNGTSTDFDGNYTLTVPNDAVLVISFVGFETQEISVNSQTTINVTLQEGNTLDSVQLVG
FT                   SRSPKRTATDTPVAIDVIEVSDIVTQAGKIEINELLQYAAPSFNANKQSGSDGADHIDP
FT                   ATLRGLGPDQTLVLVNGKRRHQSSLINIFGTRGRGNTGTDLNTIPAASIKRIEILRDGA
FT                   AAQYGSDAIAGVINIVLKDNVDEFSGSVSYGAYNTNAKGDFPDGTPNTDGNRLDTDRDG
FT                   NAIGDDQSLDGGSLKVSGNYGVAIGEEGYANFTTEYVNKNKTLRPGYDFRRGFGEAAIE
FT                   GFNIFGNLSFPVSDQTEVYAFGGRNYRDTDAYAFTRNGGERVVTEIYPNGFTPRITSII
FT                   TDNSFAAGVRSELGNDWKVDLSNTYGKNVFHYYIKGTLNASLEENSPTEFDAGGHSLSQ
FT                   NTINLDFSKYYADIANGFNLAIGTEYRTETFTIFAGETGSYATYDTNGQPITDPQTQQQ
FT                   PIDPGTGNPRPGGSQGFPGYSPENVVDRSRSNVSLYVDTELDVTEKFLLAGAVRFENYS
FT                   DFGSTFNGKLASRYKLTDNINLRGSLSSGFRAPSLAQVYYNLRFTDFQGGTATESLLSA
FT                   NNSPVTRSFGIGELKEETATNASLGFTAKAGDFTATIDGYFVSVKDRIVLTGTFDAPQI
FT                   DNVNEAQFFVNGVDTETTGVDIILSYRKLLDDSSISATLLGNINSIEIKDVNNGNLDED
FT                   TFFGARERAFLLASAPDSKFALNMSYVKNKFNTALGITRYSEITLIDFAETEDVYDAKF
FT                   TVDLNFGYEITDQVKLSIGSNNLFNEYPDQQNDGETEGGGYWDSVQMGFGGAYYYTRLD
FT                   FTF"
FT   gene            complement(398257..398757)
FT                   /locus_tag="CA2559_01570"
FT   CDS_pept        complement(398257..398757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01570"
FT                   /product="transcription elongation factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01570"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87403"
FT                   /db_xref="GOA:A3U586"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A3U586"
FT                   /protein_id="EAP87403.1"
FT                   /translation="MSRGFVKEDDQEEAPIIPPRAALPNGVTNYVTPNGLQELKTELKQ
FT                   LAEEQANLGIKDDQERRRAIAVITAKMNQLKERLASARLLDPKDQPKDEVRFGATVKLK
FT                   NKTSNLVQEFQIVGVDEANIKKQKIAFVAPLVSAIIGAKVNENVSFNLGGEVRELEILS
FT                   ITY"
FT   gene            complement(398763..399224)
FT                   /locus_tag="CA2559_01575"
FT   CDS_pept        complement(398763..399224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01575"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87404"
FT                   /db_xref="GOA:A3U587"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A3U587"
FT                   /protein_id="EAP87404.1"
FT                   /translation="MQPNNFTTDFFGIGILNGKTPENLGVLWRTAQNLGASFIFTIGKR
FT                   YAHQASDTHNSVKSMPYYHYKDFNDFFDHLPKGVRIVGVEKTETAIQLEDFEHPRRCVY
FT                   LLGAEDHGLTREAIDRSHFLIQFKSEFSLNVAVAGSIVLYDRSRNKPFQ"
FT   gene            complement(399292..399510)
FT                   /locus_tag="CA2559_01580"
FT   CDS_pept        complement(399292..399510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01580"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87405"
FT                   /db_xref="GOA:A3U588"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="UniProtKB/TrEMBL:A3U588"
FT                   /protein_id="EAP87405.1"
FT                   /translation="MDFNYIELIGYIASALVLFSFFFRNIIRLRIVNSFGCAFFVVYGI
FT                   LLGSIPIIITNVAILLVNGYYLFIKKK"
FT   gene            complement(399564..399636)
FT                   /locus_tag="CA2559_t07715"
FT   tRNA            complement(399564..399636)
FT                   /locus_tag="CA2559_t07715"
FT                   /product="tRNA-Met"
FT   gene            complement(399782..399916)
FT                   /locus_tag="CA2559_01585"
FT   CDS_pept        complement(399782..399916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01585"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87406"
FT                   /db_xref="InterPro:IPR025990"
FT                   /db_xref="UniProtKB/TrEMBL:A3U589"
FT                   /protein_id="EAP87406.1"
FT                   /translation="MLLDTSVRQQVYVEDCEVCCNPIEVEVKFENHELVQFEPQNLGQ"
FT   gene            complement(399994..401349)
FT                   /locus_tag="CA2559_01590"
FT   CDS_pept        complement(399994..401349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01590"
FT                   /product="putative outer membrane protein TolC"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01590"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87407"
FT                   /db_xref="GOA:A3U590"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A3U590"
FT                   /protein_id="EAP87407.1"
FT                   /translation="MKYKNMSAFLLLAITFSVTSFSQDLLSKEEAISQMLVNNFGIKIA
FT                   ENQVEVADNNQSVLNSGYLPTLTGNANAQYDRSNETREFPGAFNEDGSPRPNTEIEGAE
FT                   SQSYNASLNVNYLLFDGLGRFYNYKQLKETYNLTELQARETIENTTLQLFSVYFDVARL
FT                   TENLEVFKQALEISQKRVTRSQYGFDYGQSTKLEVLQAEVDVVTDSVIVLNAKQQLLNA
FT                   KRDLNVVLNRELETIGFQVDTLVEFENDLLLESFVEKAEFNNVTLLQAESQTRISDFEI
FT                   KANKALLLPSVGLTGSYGWNRVNSPASAFFPGSVSRGNNLTVGANLTWNLFDGGRSIVG
FT                   IKNAKILNDSQKLQEQQFELQVNRDIANALGNYRNLLKIYKIQEQNVETNQNNLERSRE
FT                   RLNLGQISSIEFRQAQINLINVQTNKNLAKYDAKLAELELLRLTGQLLNVEF"
FT   gene            complement(401349..404564)
FT                   /locus_tag="CA2559_01595"
FT   CDS_pept        complement(401349..404564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01595"
FT                   /product="RND family efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01595"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87408"
FT                   /db_xref="GOA:A3U591"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A3U591"
FT                   /protein_id="EAP87408.1"
FT                   /translation="MIIAFIIFGVVGMLRMQSSFFPLLESEIITISVTYPGAAPEEIEE
FT                   GIVLKIEDNLKGLVGVDRVTSTSRENGGSITVEIDPDENIDVMLSEVKNAVDRVPNFPT
FT                   GMEPLVVAKQENIRETIDFFISGDDVDLATLKQIARQVEYDLRAMDGLSQITIDGYPDE
FT                   EIEIAVRENDLLAYNLSFAEVADAVSRANIITTGGNIKTDAEDFLIRADNRSYYGNELN
FT                   KLIVKSQPNGTQIYLEDVATVKDRFSETPNASYINGRVAVSVNISTTNNEDLISAAEKV
FT                   RAYTEEFNEKYTALQIIIEDDRSITLNQRTQLLIENGAVGILLVLFFLSLFLNTRLAFW
FT                   VAFGLPIAFLGMFMFAGSFGVTINVLSLFGMIIVIGILVDDGIVISENIYQHYEMGKKP
FT                   VQAAIDGTLEVLPPILSAIITTILAFSTFLFLDSRIGQFFGEVSTVVILTLVVSLVEAL
FT                   IILPAHIAHSKALVRETEEEKRNKKGIAKFFLKMRKFNEYGDKFMSYLRDKLYEPVLRA
FT                   TLKNRFLSFAILGTLLLLTIGSLMGSVVKVTLFPSIASDRVSINLLMPEGTNPRKTDSI
FT                   ISLVEDAAWRVNEEFTKRQTGNIDVVKNIVRRVGPGNNKASLRVNLLPGEERDFGSPEI
FT                   TNAIRDEVGEVYGVEQLTFGSGGNFGGSPISVSLLGNNLEELEGAKEELKTILQEKSTL
FT                   KDVTDTDPEGIKEISITLNDNAYALGLNLREVMSQVRAGFFGLQAQRFQRGQDEIKVWV
FT                   RYDRENRESINDLDDMRIITQDGNRVPFGEIADYTIRRGTESIAHLEGLREIQVNADLG
FT                   DPNASATDILADIDENILPEILSKYPSVSVSYEGQNREAEKLTNSAINVFPVILFLIYA
FT                   VIAFTFRSYSQPLLLIIMIPFSIIGVAWGHYLHGFPVNILSLLGIIALVGIMVNDGLVL
FT                   IGKFNSYLREGMSFDKALTEAGKSRFRAIFLTSLTTIAGIAPLLIEKSRQAQFLKPMAI
FT                   SISYGIFIATFLTLLILPLLISLTNSAKTKGKWLLTGKTYSKESVERAIMEKNDEEKRQ
FT                   KELDEANGNSISERNTNTNDEVQ"
FT   gene            complement(404618..405790)
FT                   /locus_tag="CA2559_01600"
FT   CDS_pept        complement(404618..405790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01600"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01600"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87409"
FT                   /db_xref="UniProtKB/TrEMBL:A3U592"
FT                   /protein_id="EAP87409.1"
FT                   /translation="MRKTILYIIAGVLLIAAFFAMRAIADSKDKEAPKIKKVVKTVFVD
FT                   TIKNTDVPIIIPANGNLVAKRRVELYAEVQGIFKNSSNLFKAGQEYKRGQTLISIDASE
FT                   YYASVQSSKSNLYNQITAIMPDLRLDYPDVFPKWEAYLNSFNINETTPKLPEISNDKEK
FT                   YFINGRGILTTYYNVKNLEQRLGKYRISAPFTGVLTEALVTEGTLIRAGQKLGEFIDTS
FT                   TYELQVSLNKDYADLLEVGENVELSNINKTKTYKGKVSRVNASIDQATQTVSAFIEVSN
FT                   NTLKEGMYLQAELEARTIKNAISIDRGLVNDRNEIFTVKDSTLVSLTVNPVYFSDKKAV
FT                   VKGVPNGEVILSKPVSGAYNGMLVKVVSNEPSAETNSVKQDSLTVTETTK"
FT   gene            complement(405904..407130)
FT                   /locus_tag="CA2559_01605"
FT   CDS_pept        complement(405904..407130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01605"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87410"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:A3U593"
FT                   /protein_id="EAP87410.1"
FT                   /translation="MRKTILFVIALLIISNVLSSQNVDNLYYLSPEILVGKTLPANTDF
FT                   PNTNLQTALFFSFGMYNLDNEQDWAVRLNYPKTGLSLAVIDFGNPDQVGQAITVMPFVE
FT                   FSVFKKHSDNFNLNVGYGASYMNTQYDFEANPLNRAITTKVNWSFRSFLYYNVLKDKLT
FT                   NWRLGLGYIHHSNGHTRLPNQGLNSLLASVSATINTSKVESVKPHKPKLEQKSETYTSS
FT                   RFGLGYNTLSDSINTKKEVYTVAFEIGKVINKTFKFGGGFYARYYQHFYDYIKDEEALI
FT                   NSQYPNFKDNAFAYSTNYGVFGTAELLLGHFGVELDLGLNLYKPFYKLEWQITQGYRAD
FT                   SGNYVYADLDSYYKLKRTISSRLGVKYYLITNNKSPQHNLFLSAHINANLGQADFSEIS
FT                   LGYTYRFKN"
FT   gene            407225..407596
FT                   /locus_tag="CA2559_01610"
FT   CDS_pept        407225..407596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01610"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87411"
FT                   /db_xref="GOA:A3U594"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A3U594"
FT                   /protein_id="EAP87411.1"
FT                   /translation="MKSYYNIGLFILRVGFSALMLTHGIPKFLQLVQGDFSFGDPLGIG
FT                   ATISFFLTVFAEFVCSILVLIGYKTRLACIPLIVTMLVAVFVVHLNDPIGSKELGLVYL
FT                   LAFTAIALMGPGKFGFDRR"
FT   gene            complement(407813..408286)
FT                   /locus_tag="CA2559_01615"
FT   CDS_pept        complement(407813..408286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01615"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87412"
FT                   /db_xref="UniProtKB/TrEMBL:A3U595"
FT                   /protein_id="EAP87412.1"
FT                   /translation="MKAATVKQLKDELEMRSPVELMQLTLRLSKFKKENKELLTYLLFE
FT                   AADEEEYIKEIKVEVDEAFSEINTSRGYFIKKGIRKILKRLKTYIRYSGKKETEAELLI
FT                   YFCKKMKTFSPSVFKNRVLANTYERQLTMALNAIDKLHEDLQYDYRILIEELD"
FT   gene            complement(408316..409611)
FT                   /locus_tag="CA2559_01620"
FT   CDS_pept        complement(408316..409611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01620"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01620"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87413"
FT                   /db_xref="GOA:A3U596"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A3U596"
FT                   /protein_id="EAP87413.1"
FT                   /translation="MKTNFVAEMTWRGMLHDVMPGTEEQLLKEPTAAYIGFDPTADSLH
FT                   IGSLVQIVILMHYQRAGHIPIALVGGATGMIGDPSGKSAERNLLDEEALAKNVAGIKEQ
FT                   LSRFLDFSENSENKAELVNNYDWMKDFSFIEFARDIGKHITVNYMMAKDSVKKRLSSES
FT                   TVGMSFTEFTYQLFQGYDFLHLYREKNCLLQLGGSDQWGNITTGTELVRRVAGGKAYAM
FT                   TSPLLTKADGTKFGKTEGGNVWLDKNRTSPYKFYQYWVNATDEDAENFIKIFTFLSQEE
FT                   ISELVLKHNEAPHLRLLQKTLAEHVTKMVHGQEDLDNAIKASQVLFSKTFKNDISQLDE
FT                   ATFLDVFEGVSQTEISKAKLEEGLDMIAALSAETNFLKSNGEARRALKANSVAVNKEKV
FT                   TEAYTLTTDDIINDNYVILNVGKKNTYILKVS"
FT   gene            409694..410695
FT                   /locus_tag="CA2559_01625"
FT   CDS_pept        409694..410695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01625"
FT                   /product="dihydroflavonol 4-reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01625"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87414"
FT                   /db_xref="GOA:A3U597"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3U597"
FT                   /protein_id="EAP87414.1"
FT                   /translation="MILVTGGTGLVGSHLLFQLLQNSTETIRAIHRQDSNLEHVLSVFK
FT                   LYDEEQAEKLFKKIDWAEANILDIPLLSEAFKGITHVYHCAGFISYDVRDAKIMRRINI
FT                   EGTANVVNLCLHHDIKKLCHVSSIAAIGSTINDKPITEDTVWNPELSHSHYAWSKYGGE
FT                   MEVWRGSQEGLNVLIVNPGVVIGPGFWKSGSGLLFTKVANGLKYTPILTTGFVDVFDVV
FT                   KPMISLMESNYQKERYILVSESLRFDSVVNKIANALQKQPPKKTLESWMVFMGWAFQSI
FT                   GHTLFNTKKTITYDSIKGVFSKSVYSNNKLKDALNYNFKLIDESIKDTAAHY"
FT   gene            complement(410692..411168)
FT                   /locus_tag="CA2559_01630"
FT   CDS_pept        complement(410692..411168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01630"
FT                   /product="dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01630"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87415"
FT                   /db_xref="InterPro:IPR025381"
FT                   /db_xref="UniProtKB/TrEMBL:A3U598"
FT                   /protein_id="EAP87415.1"
FT                   /translation="MKYKLIILCAALAVSCQSIERSSKPDKLIAEDRMVDIFYDLSLIE
FT                   ASKRLGNHDVDVKELDLNTFIYEKYDIDSTQLVQNTTYYSDNIPKFKSVFARVENRLKV
FT                   LKTELDSLRSKENRKKDSLKRAAENVRKDSLSSSLEIAKKLNSKISNSEGRDRN"
FT   gene            complement(411168..412508)
FT                   /locus_tag="CA2559_01635"
FT   CDS_pept        complement(411168..412508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01635"
FT                   /product="dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01635"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87416"
FT                   /db_xref="GOA:A3U599"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A3U599"
FT                   /protein_id="EAP87416.1"
FT                   /translation="MDKILIKNAHIVSDGKILLGDVYIESGIIKEVADHISAKSPDVNV
FT                   FDAEGNYLLPGVIDDQVHFREPGLTQKENIHTGSKAAVAGGITSFMEMPNTNPQTTTIE
FT                   KLEEKFEIAAKTSYANYSFMFGGTNDNLDEIVKVNPKTTAALKLFLGSSTGNMLVDDET
FT                   VLEKIFKNSPLMICAHCEDEDAIKANLATYTERYGDDIPIEFHPIIRSEEACYKSSSRA
FT                   VELAKKTGAKLHVFHVSTAKELELFDSKKPLKDKKITAEVCIHHLWFNDSDYDAKGTLI
FT                   KWNPAVKTKKDQDALLKGLLDGKLDVLATDHAPHTKEEKKNPYTKAPSGGPLVQHALPA
FT                   MLEFYHEGKISLEKIVEKMCHNPAILFDIEQRGYIKEGYKADLVMVDLNAPWTVQEDNI
FT                   FSKCGWSPFEGSTFRSRITHTFVNGNLVYKNFRHYDVLKGERLTFDR"
FT   gene            complement(412511..413230)
FT                   /locus_tag="CA2559_01640"
FT   CDS_pept        complement(412511..413230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01640"
FT                   /product="dolichol-phosphate mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01640"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87417"
FT                   /db_xref="GOA:A3U5A0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5A0"
FT                   /protein_id="EAP87417.1"
FT                   /translation="MKSLVIIPTYNENLNIERLLRNIFSQQRKFDVLVVDDNSPDGTAA
FT                   TVKFLMEEFPNQLFIEERQGKLGLGTAYIHGFKWALKRDYNLIFEMDADFSHNPNDLHR
FT                   LYNACVKQQADLAIGSRYVTGVNVVNWPMSRVLLSYIASKYVRFITGMNIHDTTAGFVC
FT                   YTRNVLETIDLDKIAFVGYAFQIEMKFKAYLKKFKIVEVPVIFTDRTKGESKMSGNIIY
FT                   EAVFGVFKMKFKSLFKK"
FT   gene            413323..413994
FT                   /locus_tag="CA2559_01645"
FT   CDS_pept        413323..413994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01645"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87418"
FT                   /db_xref="GOA:A3U5A1"
FT                   /db_xref="InterPro:IPR025367"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5A1"
FT                   /protein_id="EAP87418.1"
FT                   /translation="MKDLQAIPLQEPTNLWITASIMICLGLICLCKILYEERFLRFLAL
FT                   PIEPRYFIIKKNEHKLSFLFNTLLFTFNCLVAGIVLNLIARDHYPELLTREFIFFIQVV
FT                   FGFGVLMLVKYFAEKMLANLFLMENIIEDYLFFKFSHRHYLALAIFPLCIIDVYTHLLG
FT                   GYAFLIISVAFLIINLLFILKYYRKKGLLIFNNLFYFILYLCALEIAPYFILYKVVTIL
FT                   N"
FT   gene            414013..414759
FT                   /locus_tag="CA2559_01650"
FT   CDS_pept        414013..414759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01650"
FT                   /product="possible uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01650"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87419"
FT                   /db_xref="GOA:A3U5A2"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5A2"
FT                   /protein_id="EAP87419.1"
FT                   /translation="MKVKTILVSQPEPKIENSPYFELEEKQKVKIDFIPFIHVEGVSSK
FT                   DVRQQKVDLKNYTAIILTSRNAVDHFFRIAEELRYTVPDSLKYFCQSEAVAYYLQKYVV
FT                   YRKRKIYVGKRTFQELTPLIKKHKNEKFLLPSSDMLKPMVPETLDELGVSWKQAIFYKT
FT                   VVSDLSNLRDVFYDILVFFSPSGIKSLFENFPDYQQNNTRIAVFGNTTIKAAEDHGLKV
FT                   NIKAPSPETPSMTMALKKYITEVNKK"
FT   gene            complement(414839..416449)
FT                   /locus_tag="CA2559_01655"
FT   CDS_pept        complement(414839..416449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01655"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01655"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87420"
FT                   /db_xref="GOA:A3U5A3"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5A3"
FT                   /protein_id="EAP87420.1"
FT                   /translation="MVTNTNTTKSISLEPYGIKDTTTHYQLTPSQLHETAIANGQGQEA
FT                   SSGALAINTGEFTGRSPLDRFIVKDDVTKDEIWWGNINIPFDADKFDALYDKVTDYLSG
FT                   KEVFVRDSYACADEKYKLNIRVVNEYPWSNMFAYNMFLRPSEDELKNFKEEWLIVNAPG
FT                   FMADPEVDGTRQHNFAILNFGKKIALIGGTGYTGEIKKGIFSALNFILPVQKETLPMHC
FT                   SANVGEDGDTSIFFGLSGTGKTTLSADPNRKLIGDDEHGWTKEDTIFNFEGGCYAKVIN
FT                   LSKENEPDIYNAIKPGAILENVVLDENGDVDFADTSITQNTRVSYPIYHIDNIQEPSIG
FT                   KNPKNIFFLTADAFGVLPPISKLSPGQAAYHFISGYTAKVAGTEAGVDEPMPSFSACFG
FT                   APFMPLHPTRYAEMLSQKMKDSGVNVWLVNTGWTGGPYGVGKRMALKYTRAMISAAMDG
FT                   SLEEANKDNYHTHSVFGVKQPRTCPNVPTDVLSPRKTWNNDQGYYKKAYTLAESFRQNF
FT                   LKFEEYANEEILAGAPNVK"
FT   gene            complement(416528..416917)
FT                   /locus_tag="CA2559_01660"
FT   CDS_pept        complement(416528..416917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01660"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01660"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87421"
FT                   /db_xref="GOA:A3U5A4"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5A4"
FT                   /protein_id="EAP87421.1"
FT                   /translation="MDKRFLIAGSFFGLTAVIIGAFGAHALQKVLDVAQLNTFETGVKY
FT                   QMYHALLLVFLGLFSVKTSKSKTVLLWLLIIGVILFSWSIFGLATNSLTGFNFKKIAIL
FT                   TPLGGTLLITAWALIFYKALTLKNQ"
FT   gene            416987..418357
FT                   /locus_tag="CA2559_01665"
FT   CDS_pept        416987..418357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01665"
FT                   /product="saccharopine dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01665"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87422"
FT                   /db_xref="GOA:A3U5A5"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5A5"
FT                   /protein_id="EAP87422.1"
FT                   /translation="MRKILIIGAGKSTSYLMSYLLDHAEKEQLEITVGDLYVANAQKAI
FT                   GNHKHAKAITLDVFNKKNRQEAIDQVDLVISMLPARYHIEVAKDCITFGKHMVTASYVS
FT                   QEMESLNQSAINKGLVFMNEIGVDPGIDHMSAMQVIDRIRDKGGKMLLFESFTGGLVAP
FT                   ESDNNLWNYKFTWNPRNVVVAGQGGVAEFIQEGQYKYIPYNKLFRRTEFLEVDGYGRFE
FT                   AYANRNSLKYRSIYKLEDALTLYRGTMRRVGFSKAWNMFVQLGMTDDSYTMEDTMDMSY
FT                   REFVNSFLPYSPSDSVELKMRHSLKIDQDDIMWDKLLELDLFNDKKKIGLKSATPAQIL
FT                   QKILMEKWSLAPDDKDMIVMYHKFGFELDGKKHQIDSTMVALGQDQTYTAMSKTVGLPV
FT                   AIAALKILNKEITTPGVQIPITKEVYEPILKELEEHGITFKETERKYLGYNPDGVSA"
FT   gene            418403..418873
FT                   /locus_tag="CA2559_01670"
FT   CDS_pept        418403..418873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01670"
FT                   /product="putative AsnC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01670"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87423"
FT                   /db_xref="GOA:A3U5A6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5A6"
FT                   /protein_id="EAP87423.1"
FT                   /translation="MKLKNEQVVIDGIDKKILRSLISDARTPILEIARNVGISGAAIHQ
FT                   RLRKLEKSGLIAGSKFVINPKVLGYHTMAFIGVFLDKAMSNPKAVKQLEAIPEVIECHY
FT                   TTGNWSIFLKILCRDNSHLMEVLNKEIQAISGVSRTETFISLEQQIERQIKI"
FT   gene            complement(418940..419326)
FT                   /locus_tag="CA2559_01675"
FT   CDS_pept        complement(418940..419326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01675"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR021474"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5A7"
FT                   /protein_id="EAP87424.1"
FT                   /translation="MEVQGTVKLINDTQTFGSNGFRKREIVVTTEEQYPQHIMIEFVQD
FT                   KTNLLDNFNVGQQVKISINLRGREWVNPQGETKYFNSIQGWRIENLQPQNNAGSSNAAP
FT                   MPPVDEFEPAGNNLNQDDHDDLPF"
FT   gene            complement(419336..420214)
FT                   /locus_tag="CA2559_01680"
FT   CDS_pept        complement(419336..420214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01680"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87425"
FT                   /db_xref="GOA:A3U5A8"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5A8"
FT                   /protein_id="EAP87425.1"
FT                   /translation="MENILSIDPKNETVGTVHGHLLSAISPRPIAFASTVDAQGRPNLS
FT                   PFSFFNVFGANPPIVIFSPARRVRGNTTKHTLENAKEVDEVVINIVNYNMVQQMSLSST
FT                   EYAEGVNEFEKAGLTMLKSDLVKPFRVAESPVQLECKVKQIVETGTEGGAGNLIICEVV
FT                   KIHINKNVLDKNGSIDQHKIDTVARMGGNWYSRANMGMFEVEKPLRTLGIGVDNLPQTI
FT                   RESKILTGNDLGRLGNVETLPTKELIEDYIIKNSLGEFVKNATVEDLHKQAKQHLENNN
FT                   TTYAWYILLAK"
FT   gene            420311..421474
FT                   /locus_tag="CA2559_01685"
FT   CDS_pept        420311..421474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01685"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01685"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87426"
FT                   /db_xref="GOA:A3U5A9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5A9"
FT                   /protein_id="EAP87426.1"
FT                   /translation="MNFSNERNIQRWLILVSALVFIGLIFFNASLFFQQLKNDERNKMR
FT                   IWAMALEEFISFDIDNPNDGANLDLVTEIVTSNVTIPSINTDGNGNIMQSANISEEDES
FT                   NPDRMQRILLEMKSENDPIKVNLGDGEIQYVYYGNSPTLNRLKYYPLALIVFLLLLIGV
FT                   IYFFYRTARSSEQNKLWAGMAKETAHQIGTPLSSLVGWTEILKTEHVNPEYIEEIEKDI
FT                   ERLKVITDRFSKVGSKPTLSKVDIVKVTEETFGYLKNRSSKLIEFKSEIPNSSIEVMLN
FT                   EPLFSWTIENLVKNAIDAMKGKGQLSLRLIEDQKVVKIEISDTGKGIPKSKFKKVFETG
FT                   YTSKKRGWGLGLSFAKRIIEEYHNGNIKVLKSDLGKGTTFGIKLRKV"
FT   gene            421486..421851
FT                   /locus_tag="CA2559_01690"
FT   CDS_pept        421486..421851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01690"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87427"
FT                   /db_xref="GOA:A3U5B0"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5B0"
FT                   /protein_id="EAP87427.1"
FT                   /translation="MQLTAMKELFSTLREAPLNNHCPKCFSRDGLQVTFKQKHLKTMWY
FT                   NKRTDEVTSTLFCNTCNQQIFPVDWDEDIERVYEYQRKASPPKPSYFKPSKNLYIAIGL
FT                   SLVALGGIAAYAFIAMV"
FT   gene            complement(421855..422268)
FT                   /locus_tag="CA2559_01695"
FT   CDS_pept        complement(421855..422268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01695"
FT                   /product="Predicted thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01695"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87428"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5B1"
FT                   /protein_id="EAP87428.1"
FT                   /translation="MSAEKFPLTLTLRIDWSETDAYKHVNNVTFIKYMQSARVNFWEET
FT                   GLATYHTDTNKGPMLVSTKCDFKQQLTYPGNVIIKTRVTHIGTTSFSLEHYILNESNQV
FT                   SAIGQDVAVCFDFNTQKTFEIPEWLREKMEEFS"
FT   gene            complement(422268..422657)
FT                   /locus_tag="CA2559_01700"
FT   CDS_pept        complement(422268..422657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01700"
FT                   /product="HIT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01700"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87429"
FT                   /db_xref="GOA:A3U5B2"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5B2"
FT                   /protein_id="EAP87429.1"
FT                   /translation="MASIFTKIINGEIPSYKIAEDENFFAFLDINPNAKGHTLCIPKKE
FT                   VDKVFDLDEETYNGLMSFSRKVAIALEKAINCKRVGVAVIGLEVPHVHVHLIPLNDMKE
FT                   MSFKHKVSLEEDEFKAIAERIRTFL"
FT   gene            complement(422706..423029)
FT                   /locus_tag="CA2559_01705"
FT   CDS_pept        complement(422706..423029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01705"
FT                   /product="Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01705"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87430"
FT                   /db_xref="GOA:A3U5B3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5B3"
FT                   /protein_id="EAP87430.1"
FT                   /translation="MDIKITIIDREGEAHVVDAPTDMNMNLMEVCKMHELPVEGTCGGM
FT                   AMCASCHCYILDKAHVLQEKSYDEEDMLDQAFFVEDNSRLGCQIPITKELDGMEIKLAP
FT                   QAD"
FT   gene            complement(423029..423415)
FT                   /locus_tag="CA2559_01710"
FT   CDS_pept        complement(423029..423415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01710"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87431"
FT                   /db_xref="GOA:A3U5B4"
FT                   /db_xref="InterPro:IPR009325"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5B4"
FT                   /protein_id="EAP87431.1"
FT                   /translation="MKLFKGTKIYSILGGVCPVCHEESMYKEPNPYKITKIMHMHERCS
FT                   NCGTKYKIEPSFFYGAMYVSYPVGIAFATAAFVIAYYMLNVSLLNSFFVIVATMIVFMP
FT                   LIMRLSRNIWINFFFSYDKQKAKH"
FT   gene            423460..425391
FT                   /locus_tag="CA2559_01715"
FT   CDS_pept        423460..425391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01715"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01715"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87432"
FT                   /db_xref="GOA:A3U5B5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5B5"
FT                   /protein_id="EAP87432.1"
FT                   /translation="MLNIHELSISFQGEFLFEDITFRLNAGDRVGLVGKNGAGKSTMLK
FT                   ILSKDLEPDTGQIAIEKDISIGFLRQDIDFVEGRTVLEEAYQAFEEIKRLEKQIDDINT
FT                   QLAERTDYESQGYEQLMIDLNDIQHQYEIIGGYNYQGDTERILQGLGFKREDFNKKTDT
FT                   FSGGWRMRIELAKLLLQNHDIMLLDEPTNHLDIESILWFESFLKQFSGVAVVVSHDKMF
FT                   LDNVTNRTIEISLGKIYDYNTYYSKYLVQRKELREQQLATQKNQQKQIEHTEKLIEKFR
FT                   AKASKATMAQSLIKKLDKVERIEVDEDDNSVMTVSFPVSVRPGKVVIEAEGISKSYGDK
FT                   QVLKNIDLLVERESKIAFVGQNGQGKTTLAKIIVDEISHQGHLKLGHNVQIGYFAQNQA
FT                   DYLDGTKTVLQTMEDAANEKNRTKVRDILGSFLFRGEEVDKYVRVLSGGERNRLALAKM
FT                   LLSPFNVLVMDEPTNHLDIKSKNVLKDALENFEGTLLLVSHDRDFLQGLTSSIYEFKDH
FT                   RIKEYLGDIDYYLSERKVEDMRAVEKRDKQPTASKNTDDTTASQDNKQSYEDQKKVKSL
FT                   SNRLSKVEKNINQLEKEIKAIDLELELNYDKTIAQDNFFDNYQAKKKKLTTYMQDWETI
FT                   QLELEQFS"
FT   gene            425523..426218
FT                   /locus_tag="CA2559_01720"
FT   CDS_pept        425523..426218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01720"
FT                   /product="putative amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01720"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87433"
FT                   /db_xref="GOA:A3U5B6"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5B6"
FT                   /protein_id="EAP87433.1"
FT                   /translation="MLLTSLKDTHLVVLPEMFTTGFTMNAEQASEISEGETLAWLQQWA
FT                   KRINAAITGSVAVNENGNYYNRLYFVYPDGSFKTYDKKHLFTLANEHHTYDAGKERLIV
FT                   EYLGWKICPLVCYDLRFPVWARNTEDYDALIYVANWPKIRTHAWDTLLKARAIENISYC
FT                   IGVNRIGLDGNGYEYVGHSAVYNSLGELVSSEELETDLLQTVTLEKSHINKTRSHLKFL
FT                   QDRDAFTLK"
FT   gene            complement(426205..427818)
FT                   /locus_tag="CA2559_01725"
FT   CDS_pept        complement(426205..427818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01725"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01725"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87434"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5B7"
FT                   /protein_id="EAP87434.1"
FT                   /translation="MSVFFRFIFTVVLLSAVLVSCAKRGSPSGGDKDETPPKFVKANPE
FT                   PFTTNFNEDEIRIFFNEYVKLKNSQQQIVISPPIDPAPYITPLGSPNKVVKINFNDSVL
FT                   KPNTTYTVNFGRSIEDNNEGNPLEFFKYVFSTGAYIDSLKLEGSVKDAFKRVPEQFITV
FT                   ALYELNENYKDSIIYNEIPRYITNTLDSATTFQFENLKEGTYKLVAFKDNNNNYKFEPK
FT                   VDKVAYLQDTITLPTDKTYELTVFKEELDLKFLKPKQIGKQHILFGYEGRPSNTNITLL
FT                   TDTPDNFEYRVLKDRTTDSLHYWFKPFLEETDSLVFKVESGTYNDTLITRFKDQFADTL
FT                   EIAKADNINILLNKAFTVSGNTPLALINPELISVVDKDTLNIPFEASLDTIKNTVNVNF
FT                   EPTESNRYQITFLPEAITDFFNATNDSLSYSVPTKEFSDYGDLFLTVQNVKSYPIIAQL
FT                   LDNKGEVIYEKYKETESVFEFTKIDPKKYFIRIIYDTNANGYWDTGSYLDKRQPEPVVF
FT                   YPEEIEIRANSEIYQTFILK"
FT   gene            complement(427876..428556)
FT                   /locus_tag="CA2559_01730"
FT   CDS_pept        complement(427876..428556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01730"
FT                   /product="putative amidophosphoribosyl-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01730"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87435"
FT                   /db_xref="GOA:A3U5B8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5B8"
FT                   /protein_id="EAP87435.1"
FT                   /translation="MINDFIQLLFPNACVVCNATLPKDLNTLCVACSDDLPEAPMFYNS
FT                   PTQVEKMFYGRLPLEHGVSLLTFEKKGTTQKLMHQLKYRGDEQISEYLGKWMAQKLLKT
FT                   EWHKTITAVVPVPIHPKRKKKRGYNQVTLFGKAIASALNVPYEDQILIKTGITKTQVFK
FT                   KRIARWGQLDNTLTINDLNSLKGQHVLLVDDIITTGATIEACGAKLLETENLKLSVATM
FT                   AITL"
FT   gene            428628..429512
FT                   /locus_tag="CA2559_01735"
FT   CDS_pept        428628..429512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01735"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87436"
FT                   /db_xref="GOA:A3U5B9"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5B9"
FT                   /protein_id="EAP87436.1"
FT                   /translation="MTEEKNSKALKILTAVLTIGIIALGVYTMKFYNENQQTISRLENE
FT                   KADLESDLSELIIKYDTAISKNDVMAKDLYEAKQRIERLLDSIKGLDNTNYAAISRFRS
FT                   QIKKLEREKDKLFKTVDSLSRQNQRLATAVDSTNSVLKERIVLTDSLVQQNEILNEKVA
FT                   AGSKMQLTKLSAEGVIIKNSGDIANTKRHRRADKIRTCFTIAKNLIAEPGEKKLYAQII
FT                   NPKNNLIGDNKQEMFEEKVLMYSATTKVFYENEELDICILVDADENNIISGVYQVNIFQ
FT                   DADLLATTSFTLK"
FT   gene            429580..431115
FT                   /locus_tag="CA2559_01740"
FT   CDS_pept        429580..431115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01740"
FT                   /product="glycyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01740"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87437"
FT                   /db_xref="GOA:A3U5C0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5C0"
FT                   /protein_id="EAP87437.1"
FT                   /translation="MANQDTTFKNVISHAKEYGYIFSSSEIYDGLNAVYDYGQNGVELK
FT                   KNIREYWWKSMVQIHQNIVGLDAAILMHPTTWKASGHVDAFNDPLIDNKDSKKRYRADV
FT                   LVEDYAEKIHQKAEKEIAKAKKRFGDAFNEEEFVTTNPRVLRYRQEQKEILERLAKSLT
FT                   DGDLADVKLLIEELGIACPASGSKNWTDVRQFNLMFGTKLGADAETATDLYLRPETAQG
FT                   IFVNFLNVQKSGRMKIPFGIAQTGKAFRNEIVARQFIFRMREFEQMEMQFFVRPGEELK
FT                   WYEHWKETRLNWHLSLGLGKENYRFHDHEKLAHYANAAADIEFDFPFGFKELEGIHSRT
FT                   DFDLKAHEEHSGKKLQFFDPELGENYVPYVVETSIGLDRMFLAVLSKSLVEEDLGNGNS
FT                   RTVLKLPSILAPTKVAVFPLVKKDGLPELAEQIVEDLKWDFNVLYDEKDAVGKRYRRQD
FT                   AAGTPFCITVDHDSLEDQTVTIRHRDSMEQSRVNISDLKSIIGKALDFKTWLG"
FT   gene            complement(431112..431564)
FT                   /locus_tag="CA2559_01745"
FT   CDS_pept        complement(431112..431564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01745"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87438"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5C1"
FT                   /protein_id="EAP87438.1"
FT                   /translation="MKFLIVILGFVTIVNGACESGKKATAETAKVETQNNLKKISWSAY
FT                   TRGKQELISVTEISLVVNENGTVTKEKNITSEDWKALNSLVEKLDLNEISNLEAPSQKR
FT                   FADADLASKIEINTNSASFTSSEFDKTQPPKTLVPLTNMIKNLAGY"
FT   gene            431661..433670
FT                   /locus_tag="CA2559_01750"
FT   CDS_pept        431661..433670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01750"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87439"
FT                   /db_xref="GOA:A3U5C2"
FT                   /db_xref="InterPro:IPR008754"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5C2"
FT                   /protein_id="EAP87439.1"
FT                   /translation="MKNFTRLACFSLCFILSLSAWAQKDPQGVKGPNGLVRCLTTEMDT
FT                   ELSNRYPEQTISKEEFEEWLAPKIEEFKVNQALTSLQQPVLTIPVVIHIIHDGDPINVA
FT                   GGELSENISYAQAVSQVDVLNEDFRRLMGTPGAGETNYNAGVDVEIEFCLATQDPNGAA
FT                   SNGVNRVNLCQESWSTADIDGIVKPETIWDPTKYMNMWSVNFTDSSLLGYAQFPNSSGL
FT                   GGLNTNNGPADTDGVVSNYNAFGTLAQDDGSFILNNTYNLGRTMTHEVGHYLGLRHIWG
FT                   DGACSVDDFCDDTPNSDGANFGCAMDSSCGSMDMSENYMDYSDDSCMNTFTEDQKTRML
FT                   TVMMNSPRRMELPTSIGCSAGTASTNDIEVRLTCFTENICEVGFSPGIEIINKGTAAVT
FT                   EATITYSVNGDAAQTYEYTGNLNQFDIASINLPSVDGINGNNTVNVSVTDVNGTTDEVA
FT                   SNNLDSDEYIYANDGDITEYNATTYFLELVTDDYGSETTYEVTDASGNVLYEGGPYEDN
FT                   TTINDEFTVENNECFQFTIFDAFGDGICCGYGDGSYSLTTGDGTVVIEGGQFEDSESVA
FT                   FRANQSLSVKENAFANFAIYPNPADNVLNISLNNTNELPETVKVFNTLGQAVVTKSVTN
FT                   SSDLNVNVSSLQKGIYFVRIENETTSGVVKFVKN"
FT   gene            complement(433723..437148)
FT                   /locus_tag="CA2559_01755"
FT   CDS_pept        complement(433723..437148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01755"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01755"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87440"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5C3"
FT                   /protein_id="EAP87440.1"
FT                   /translation="MRILTFILLFCVVTVGVAQQTVGSMKTKTLVVRDSVFIDSVSINP
FT                   NRFQLLDTTGKPIDTAFYNVDFSLAKITFSNTFLNTAANDTLKASYLPYPDFLTKRYFQ
FT                   LDKSIIVENNDDLNKLYQLNQQEKGVKTFTPFDGLNTSGSISRGIRVGNNQNTVLDSQL
FT                   DLQISGQISPRVGLRASIQDSNIPLQEGGYSQNLDEFDQVFIELFSDNWSIRAGDVNLV
FT                   QNESFFASFEKKVQGISLGATLNPEGNSTNLFAAGALVRGVFTESKFQGQEGNQGPYKL
FT                   TGPNGELFVLIVSGSETVYVNGVPLVRGENKDYVIDYNAGEIMFNSTYPITSEMRISVQ
FT                   YQFSERNYTRIIATGGGNYESDNLKIGAFVYSENDSKNQPLQQNLNAQQVAILADAGDD
FT                   MSQMFTSSVQPSEFSENRVLYRLETINNQPVYVFSTNAEDELFQIQFSNVGANNGDYIL
FT                   SDASAINRIYEYVAPVNGVPQGSFAPVIQLEAPTKLQIGVVNGRYKPSEKTNLYFEIAG
FT                   SKNDLNLFSDIDDDDNDGVATKFDFRQRIVTNDSLWNLDAFGTFNYIQDEYQSIQRIYN
FT                   IEFERDWNLQTPIGSQAYVIGGLELSNQKQGIVNYSFQQLDYKDNFSGSRHVFNSALTF
FT                   GRLKTFVNSSYLNSEGSEIDSEFLRANINAVYGFKKSWIGAKYSAENNQQRQVATDSLT
FT                   GDSQRFMNYEVYTGVGDSTNVFAEIGYRYRVNDSVQSNELTRVSNSNNYYLKSRLINTS
FT                   NTKLAVFANYRVLEDETEDDNDDVSLNSRIVYSQFIANKKISLNTTFETNSGTLPQQEF
FT                   TYVEVDTGEGQYTWNDYNNNGVQELEEFEIAQFQDEARFIRVLLPNQVFIRTHQNKFSQ
FT                   TLSLNLRSWEKETNGFKKFMSHFYNQTAYLIDRKIRRDGEAFDINPFNDNDEKELALNL
FT                   SFRNSIFFNRGKQKYTTSYSYVSTKAKNLLSTGLQENIQQSHQINFNHKFAESWLISIE
FT                   NQLSTTESISQNFESRNFNIEGVSIDPKLSYLLSRQTRFDIFYNYNFQDNLIGGKEQLD
FT                   QQKFGLGFSYANQQQFAISGEFNYIQNDFSGSAFSPVAYQMLEGLQPDKNYTWQFLTQK
FT                   KLTKYLDLNLSYNGRKSENLDAIHTGSVQLRAYF"
FT   gene            437268..438032
FT                   /locus_tag="CA2559_01760"
FT   CDS_pept        437268..438032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01760"
FT                   /product="exodeoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01760"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87441"
FT                   /db_xref="GOA:A3U5C4"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5C4"
FT                   /protein_id="EAP87441.1"
FT                   /translation="MKIVSYNVNGIRAAMRKDLISWLSQTDADVVCLQEIKANPDQFDE
FT                   TEFHDIGYKYCYWYPAQKKGYSGVALLCKTKPNHVEYGTGIATMDFEGRNIRADFNDVS
FT                   VMSMYLPSGTNSARLDFKLNYMDEFLEYSKNLRHSIPNLVVCGDYNICHKPEDIHDPVR
FT                   LKNVSGFLPVERDWLTKFIDSGFIDSFRVFNDQPENYTWWSYRANARANNKGWRLDYLM
FT                   VTPPLQEKLKRSVILKDAVHSDHCPVLLELDL"
FT   gene            438060..439025
FT                   /locus_tag="CA2559_01765"
FT   CDS_pept        438060..439025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01765"
FT                   /product="putative flagellar motor protein MotB"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01765"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87442"
FT                   /db_xref="GOA:A3U5C5"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5C5"
FT                   /protein_id="EAP87442.1"
FT                   /translation="MNTIKLATVALTGSLLLTSCVSSKVYKDLEGKYADVKRENRSLKD
FT                   DLSKFKTSSEEFETSLDVMTDKYASLKAEHDQLESDYNATKQSYESLQKSYDALEANSS
FT                   KALAENSKQNRALIAELEDKKKALAEERATLDKLKADLETRSNRINELESVIAAKEAKM
FT                   QALKTAVSSALGDFEGKGLTVEQRNGKVYVSMENKLLFNSGSWAVGSEGRRAVNQLGEV
FT                   LASNPDIAVLIEGHTDNVPYGGNGPLQDNWDLSTKRATSIVNILRENSQIDPQNLTAAG
FT                   RGEYLPIASNDSATGKAKNRRIEVILTPKLDEISKLLNDI"
FT   gene            439066..440103
FT                   /locus_tag="CA2559_01770"
FT   CDS_pept        439066..440103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01770"
FT                   /product="Aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01770"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87443"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5C6"
FT                   /protein_id="EAP87443.1"
FT                   /translation="MEYNKIPGTDIKVSKICLGSMTWGEQNTEVEGHQQIEYALEQGVN
FT                   FIDTAEMYSVPGKPETQGSTERIISSWLAKTGKRKDIVLASKITGPSPTFKHIRQPLDF
FT                   SKSSIEDALHKSLKRLNTDYLDIYQLHWPERHTNFFGQRDYTHKPSEAWEDNFNEVLNT
FT                   LEGYVKDGKVRQVGLSNETPYGVMRCAEEARKGNLKVVTVQNPYNLLNRKDEIGLSEVL
FT                   LREQIGLLPYSPLGFGQLTGKYLEGKTPENGRVTLFPQYSRYHNPNAFEATRRYNEIAK
FT                   SHNLSLTQMSLAFIRQKPFVTSTIIGATTLEQLKENIGSYNVTLSEEIINAIDEVHNDI
FT                   PNPAP"
FT   gene            complement(440116..441012)
FT                   /locus_tag="CA2559_01775"
FT   CDS_pept        complement(440116..441012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01775"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01775"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87444"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5C7"
FT                   /protein_id="EAP87444.1"
FT                   /translation="MSSQKRFSRAYKEAKRISFNDDSKLVFFSDCHRGDNSFADDFANN
FT                   KNVYFHALKHYYKEGFTYCELGDGTELWENIEFDTILRAHKNVFELLKAFYLENRLHIV
FT                   YGNHDMVLRDQSYVKKHIYTYFDHRTGKDLPLFPSIQFPEALVLAHEISKQEIFCVHGH
FT                   QADFMNYVGWRINRFLVRILWKPLQIVGIADPTSPAKNYKELIKVERRTKKWIVNNNNL
FT                   LTITGHTHRPRFPEPGDIAYFNDGSCVHPRSITGLEIERGNISLIKWDIATTNEGFLKI
FT                   ERVLLEGPTPLKDYITT"
FT   gene            441164..443386
FT                   /locus_tag="CA2559_01780"
FT   CDS_pept        441164..443386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01780"
FT                   /product="putative patatin-like phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01780"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87445"
FT                   /db_xref="GOA:A3U5C8"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5C8"
FT                   /protein_id="EAP87445.1"
FT                   /translation="MLCLILNSAYSFGQDNLDATKDIKVGLVLSGGGAKGLAHIGALKL
FT                   IEESGVRIDYIGGTSMGAIIGGLYASGYSANQLDSIFKKTNFNTLIQDNLPRSAKTFYE
FT                   KEDAEKYALTLPFDGFKISFPSGLSKGQNVYNYMNKLTTHIGDLNDFSKLPIPFFCMAT
FT                   NIENGKQVLLEEGSLPLAISASGAIPSIFSPVAIEDQILTDGGVSNNYPIEELKKKGVD
FT                   VIIGINVQDSLVDRKNLSSAFEILTQVNNFRTIQDMESKREKTDIYIRPDITKYNVLSF
FT                   DDGDSIIKNGYKAALLKFEDLKRVALRQKPKKASKVDVKSSDVLYIKDIIVTGNKNYPR
FT                   SYILGKLKIRDYTLITYEDFNYGINNLSATGNFNRVNHQLIPDGDGYRVSIDVIESNEK
FT                   MLLRLGLHYDDLYRTAGLLNITRKRLLFKNDITSLDFILGDNVRYNFEYYIDKGRYWSV
FT                   GVKSRYNSFEKNINFSLIRENTNIPNFDVNQIEVNFEDLTNQIYGQTLFRQQFQLGLGL
FT                   EHKYLRIDSETIGLDENTQLRGIIIENSHIFSTFGNLRLDTFDNKYYPTNGVFFDGDFH
FT                   LYAFSSDFNNDFEEFSIAKGKIAYVFSPLHKFAFKIGSEAGFKIGNSNMNTLDFFLGGY
FT                   GNKPINGIVPFYGYDFISLSGDSYIKGTLDLDFEVFNKNHIIASANFANVEDGLFKNGN
FT                   WLTSPDFSGYALGYGIETLLGPVEVKWSYSPEVDESQYFFVVGFRF"
FT   gene            complement(443383..443709)
FT                   /locus_tag="CA2559_01785"
FT   CDS_pept        complement(443383..443709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01785"
FT                   /product="6-O-methylguanine DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01785"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87446"
FT                   /db_xref="GOA:A3U5C9"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5C9"
FT                   /protein_id="EAP87446.1"
FT                   /translation="MKEPSFFDRVYDVAKLIPYGKVTSYGAIAKAIGAAKSARMVGYAM
FT                   NNAGNIEDVPAHRVLNRNGVLTGKHHFNGTNLMQQLLEEEGHIIIDNQVQNFSDVFWDP
FT                   MKEI"
FT   gene            complement(443711..444346)
FT                   /locus_tag="CA2559_01790"
FT   CDS_pept        complement(443711..444346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01790"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01790"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87447"
FT                   /db_xref="GOA:A3U5D0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5D0"
FT                   /protein_id="EAP87447.1"
FT                   /translation="MALTKLFIITYIAALVGVIPPGLVNMSVAKTCVERGRKNGMFAAL
FT                   GASVTVLFQALIAILLAKYIFDNPFVRNILLRTGLVIFGIMAIYFFVKAKQHHPEFKVP
FT                   KQAGSRSFFKGFGVSALNIFPIPYFCVISTAFNAKGTVDYGNLEILLFMLAAGLGTFTT
FT                   LYFYVLSFLKIESKTQTFSKYSNYFMAALMAILVVIALIRIYYPFHIE"
FT   gene            complement(444352..445023)
FT                   /locus_tag="CA2559_01795"
FT   CDS_pept        complement(444352..445023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01795"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01795"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87448"
FT                   /db_xref="GOA:A3U5D1"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5D1"
FT                   /protein_id="EAP87448.1"
FT                   /translation="MGSKNKLKRFKENETFENVFQPTREDVVSGNFKHKGSWASFFGNS
FT                   NPVIVELGCGKGEYSVGLAKKYPEKNFVGIDIKGARFWRGAKTAIEDEMPNVAFVRTQI
FT                   ELVEDIFAANEVDEIWITFPDPQIKYKRTKHRMTNTEFLQKYKRILKPGGVVNLKTDSE
FT                   FMHGYTLGLLHGEGHEVLEANHNVYKNEYSPEDVIGIQTFYENQYLEQGKPITYIRFRI
FT                   N"
FT   gene            445072..446169
FT                   /locus_tag="CA2559_01800"
FT   CDS_pept        445072..446169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01800"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87449"
FT                   /db_xref="GOA:A3U5D2"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5D2"
FT                   /protein_id="EAP87449.1"
FT                   /translation="MYIYFLKKVLKATGFMLKKKILVAPLNWGLGHATRCIPIINALIS
FT                   DGFEPVLASDGAALALLKKEFPNLAFHELPSYNITYSKKGALFQFKMLLESPKLLKSIY
FT                   AEQKALKKILKTANFHGIISDNRMGIRSTTIPSVFITHQLNVLSGSTTKFSSKLHRRYI
FT                   KKFDECWVPDLEGSQNLSGKLGHLKNSTLRIKYLGPLSRFNKQLLPKTYDLLAMVSGPE
FT                   PQREMLEDIFKVELKLFKGNVLLIKGKIEDKQTIEKDGNLTIYNYMMGKELEDAFNQSD
FT                   LVISRSGYTTLMDVAKLGKPAFFIPTPGQFEQKYLAKRLKKMKLAPACKQHKFKVEKLK
FT                   QVANYDGLGHLGNQWVNFSDFFKLF"
FT   gene            complement(446113..447033)
FT                   /locus_tag="CA2559_01805"
FT   CDS_pept        complement(446113..447033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01805"
FT                   /product="PhoR"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01805"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87450"
FT                   /db_xref="GOA:A3U5D3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5D3"
FT                   /protein_id="EAP87450.1"
FT                   /translation="MVIQLRIEKFIYKRVKGIYDSVSLLDATTLQRTQVTTDMATLKSE
FT                   VERFAKGKKLEIEALKIRESYRKEFLGNVSHELKTPLFTVQGYILTLLDGAMKDKTLRK
FT                   KYLNRAMKGVDRLIYIVKDLDMITKLEAGDLHLDKENFLISELIHSVYELLEMKAAKKN
FT                   ITLLYDFDSNTDVMVCGDKERLQQVLTNLVVNSIKYGEKDGTTEITVEDFINNKILVRV
FT                   TDNGEGIKQENIPRLFERFFRVDKSGNRKEGGSGLGLSIVKHILEAHEEKIYVESEFGV
FT                   GSEFSFTLEKLEEVTEVDPLITEMT"
FT   gene            complement(447205..447885)
FT                   /locus_tag="CA2559_01810"
FT   CDS_pept        complement(447205..447885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01810"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01810"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87451"
FT                   /db_xref="GOA:A3U5D4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5D4"
FT                   /protein_id="EAP87451.1"
FT                   /translation="MDNKNITILLVDDEPDILEIVGYNLSSEGYNVITASDGKEAVKLA
FT                   KKRKPQLIILDVMMPEMDGVEACEQIRKIPDLDTIITFFTARGEDYSMLAGFDAGADDY
FT                   ITKPIKPKVLVSKVNALLRRIVEDSTNDNVVKIGDLIINREEYKILKGKEEILLPRKEF
FT                   ELLSLLASKPGKVFKREDILDRVWGNEVVVGGRTIDVHIRKLREKLGDKRFKTVKGVGY
FT                   KFVS"
FT   gene            448051..450834
FT                   /locus_tag="CA2559_01815"
FT   CDS_pept        448051..450834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01815"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01815"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87452"
FT                   /db_xref="GOA:A3U5D5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5D5"
FT                   /protein_id="EAP87452.1"
FT                   /translation="MIRVFQILIFVFSTIVVAQDVGSVAGSLSDKDNNNEPLPFANVII
FT                   KGTSKGTTTDFDGNYLLDNIAVGTYTIEFSFVGYETLEVPNVVIEAGKVTNITTALGAS
FT                   AAALDEVIIKTTARKESEVALLLDQKKAVTIKQSIGADELSRKGVSDAAAAVSKISGIS
FT                   KQQGGGNVYVRGLGDRYLNTTYNGLTVPSNDIEKKNIDLGLFSSDVIQNIGVSKTHAAN
FT                   FYGDFAAGNVDIVSKEYTGKFFITAETGSSINTRAVDKNFVKSEGTSFFGYYNRYDNNP
FT                   FAVVVSHGVDPESASGPVAFTGAITTGNSWNVGEESRLSVFGTVSFSNDFEYRRGTQVD
FT                   FTTVEKKRFPDSEEFEYSTNTTAMANIGYKINNNHRLTFNSLFINDATDEVGYFGIGGN
FT                   GTNRDAILNTDKGFYQMNVQFDQDMVFVNQLTGKSRLNDKLEVEYGIGFNNVLARQPDR
FT                   KRISVERYDLALDNDPNTNPFFYSNIAFDNQRYFQEITDNELNARVNLNYKHSEELTFN
FT                   FGYNGRSKTREFENVRYGYDFINGTSTEVPDINNLDAVFSPENIGELYDIFVFNAIDPS
FT                   QGITNRNNPGLPENIYEGELNVQSAYVDAEIKSGEKWTFVPGLRLEYFDQRIDYDVINV
FT                   IATDPGFREADELFILPSLNIKYALTEDQNLRFSASRTVSTPEFKEVAPFVYEDVTQRI
FT                   GGNPDLLTDPAFSSILNLDLKYEWFFGRSELFSLGAFAKQINDPVNLVVANDATGTQRF
FT                   ARTGDKAEVLGAEIEIRKNLMVDEDENSIFSTGANVTVMHTKQDLKSSQGFISTTFDRD
FT                   SDELQGASPLLINADVSYSPTFGTYKPVANLIVSYFSDRIDALGSGQLGNITEKSVTTL
FT                   DFVWKNQIGDHLEINASAKNLLDPTIERVRENNGGDITISNYKRGINVGLQLKYNF"
FT   gene            450874..452046
FT                   /locus_tag="CA2559_01820"
FT   CDS_pept        450874..452046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01820"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87453"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5D6"
FT                   /protein_id="EAP87453.1"
FT                   /translation="MKKNLLLTGLTAVAMFFASCSDDDTSQINITNGGDGGNGNQDNVI
FT                   GGTLSEDLTLTANETYTLSSALIVPTGRTLTINEGVVVKANAGSDVYIAVQQGATINAS
FT                   GSASNPIVLTSNVATPNAGDWGGLIILGRAPINSVAGGDATSTSEIGNLPYGGSIENDN
FT                   SGTLRYVRVEYSGGSADASSENNGFSFYGVGSGTTIEYIQAFEGKDDGVEFFGGTVNAS
FT                   FISVVGAQDDSVDWTEGYTGSLTNVYVRHGVDHDKGIEGDGFNTDIGNNSDSGFFSAPN
FT                   ITNITIVGRGSSNENEAIRLRAGTRALFTNVELSGFAEAFDLDDEDGENITGSGVTANE
FT                   TGVTDILFTDVTLRLKNDTGAEFTEDDFFSGIDNGTGTDYDTWSAGWVRN"
FT   gene            452211..454175
FT                   /locus_tag="CA2559_01825"
FT   CDS_pept        452211..454175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01825"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01825"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87454"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="InterPro:IPR036415"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5D7"
FT                   /protein_id="EAP87454.1"
FT                   /translation="MKKITFLLTFLFASTLMLAQTVALEESFETDGNGTRYTTTTPEFT
FT                   DGFNDFFLRTDGSDINSSYEVSGADGSFFFAAHDIDGEGAAPIQSLDFTGIDISGLSNL
FT                   SFVMLAAEDDDSANQDWDADALVFVEVQVDGGGYTKILQFASQGGTNTEPGLDTDFDGV
FT                   ADSTPLSSAFQTFNVDLGVTGTVADLRVTFANLDAGDEDISIDHLRLIDNFTVTPTVTI
FT                   TAPTDGQVFADGTTSVDLEFTTANAPAGSTVNVIVDGVTTQDAASPFAIPTSNGETYNV
FT                   TVELKDSGNATLDSNAISFSVAFPCDLFLGDATTNCDTQTAGTDTYTTSIPFTNGGTST
FT                   YTINTGGVGVVGGDDPSAVAEGTITITLVDEGTDFTVNILGDTADSGCDLTRFISAPTC
FT                   VATAACPGEGAIIITEILQNPDGTDTNKEYFEVYNTTATPIDMMGWIISDAGSDSFTVE
FT                   TSVIIAPNSYAVFANEGDAALNGGITNVAYEYDGMALANGDDEIILSCSGTVIDQVFYD
FT                   GGAEFPDPDGASMELAIDALNSTDNDLGSNWGTATSTYGDGTDMGTPGAPNDFVLATEN
FT                   FNKQTFVLFPNPTANGSVTINTTNSSDATVAIYSILGKKVVSQKLTNNTLNVSALQSGI
FT                   YLVKVTQDGAVSTQKLIVR"
FT   gene            454283..455260
FT                   /locus_tag="CA2559_01830"
FT   CDS_pept        454283..455260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01830"
FT                   /product="possible acyl protein synthase/acyl-CoA
FT                   reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01830"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87455"
FT                   /db_xref="GOA:A3U5D8"
FT                   /db_xref="InterPro:IPR007534"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5D8"
FT                   /protein_id="EAP87455.1"
FT                   /translation="MLREDIFKITSELEFNTLALRVFKFQYEANAVYQKFCKLLDKHPS
FT                   NVNSLRDIPFIPIEFFKSHDILSSKEPIVKTFTSSGTTGSQTSKHFITDLTIYEDSFNI
FT                   AFQEFYGNPEDYAILALLPSYLERDGSSLIYMANNLIADSKHPKSGFYLHNLEDLAQTL
FT                   KALDASGQKTLLIGVSFALLDLVDAYSFQLENTIVMETGGMKGRRKEMIREELHEILSK
FT                   GFGVNHIHSEYGMTELLSQAYSNGQGVFNCPKHMKILIRDPEDALTYLNKGKTGGINVI
FT                   DLANLNSCSFIATQDLGKQISETDFEILGRFDHSDVRGCNLMVL"
FT   gene            455260..456294
FT                   /locus_tag="CA2559_01835"
FT   CDS_pept        455260..456294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01835"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01835"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87456"
FT                   /db_xref="GOA:A3U5D9"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5D9"
FT                   /protein_id="EAP87456.1"
FT                   /translation="MAEQNNNLGYGCLSFCISVIVAAVFTAIIYANIKYNILLIFIGTL
FT                   FIANRVTPLLFRKTASTSTFKTGKTAGFIILGIISAGLFYLYNSTSKDRNIIDTVENTI
FT                   DTRFLKTGTDSVKVFTHNRTWRDYYGASYSSEFMVREQDYHRLKNQTDNFKYTGQATFW
FT                   GDLYTLVSTNDDSSLDLVYNAFESLKTSENLNAKQFADMVVTMVQDMPYALVLEGACLA
FT                   PEFYEEDFAELLRECPSCCIGNKRFGLQNPVSYLANLKGDCDTRTVLIYTILSHFGYDI
FT                   AILNSDYYMHSILGINLPTSGQYKTYRGKKYYVWETTSQNFTMGTLPQNFKDLNKWYIV
FT                   LTNN"
FT   gene            456298..456813
FT                   /locus_tag="CA2559_01840"
FT   CDS_pept        456298..456813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01840"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87457"
FT                   /db_xref="GOA:A3U5E0"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5E0"
FT                   /protein_id="EAP87457.1"
FT                   /translation="MNSHLLGLAILEIVIAVIISVIIIYASYSILKRLFFRGTDLKQNN
FT                   MAFIVFTSGIILSVGIILSEIIPSITNVIRLSMSTNQSITITDILLYSGLYLIIGFVFA
FT                   VIINFSVFVLFSTLTKGINEFKDIQQNNIGTSILVVAILIAITLILKDSISLLISALIP
FT                   YPETTNFL"
FT   gene            456905..457357
FT                   /locus_tag="CA2559_01845"
FT   CDS_pept        456905..457357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01845"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01845"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87458"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5E1"
FT                   /protein_id="EAP87458.1"
FT                   /translation="MKKIALLAFTTLLLVACASQNIGPNVNGNGYMADGYDVTEYFNDN
FT                   ATEGFDRYSTTYNGAKYKFVNQNNLDKFKANPEKYEPQYNGYCAYAVGAQNKKISINPE
FT                   SYEIRDGKLYLFYDNIFADTKKKWDEEGPEQLQSKADENWKTLKNN"
FT   gene            complement(457438..457935)
FT                   /locus_tag="CA2559_01850"
FT   CDS_pept        complement(457438..457935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01850"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01850"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87459"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5E2"
FT                   /protein_id="EAP87459.1"
FT                   /translation="MKINTMTPRIETLKPTVLVGMHNTMSIAANTTQQLWQRFMPKHKS
FT                   ILNRGDAILYSAEVYPSVDYFKSYNPEAEFQKWAAVAVHSSQSIPETMDMLMVQGDYAV
FT                   FTYTGLASDVYKAYQFIYSKWLPASKYKLSNRPHFAKMDSTYNPNDPSSQEELWIPIQL
FT                   KE"
FT   gene            complement(457925..458500)
FT                   /locus_tag="CA2559_01855"
FT   CDS_pept        complement(457925..458500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01855"
FT                   /product="MCBG-like protein (microcin resistance protein)"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01855"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87460"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5E3"
FT                   /protein_id="EAP87460.1"
FT                   /translation="MEHQFIADQELSQKDFTVEAFAVGDYESCTFKNCNFANVNLSQVK
FT                   FIDCEFEACNLSSANIYETGFQDVAFFECKMLGLQFDKADTFGFSIIVKDCQLNHASFY
FT                   KVNLNSSSFEGCNFQQADFSEASLKGITLTNCNFQLAVFDGTNLEHANFKGATNYTINP
FT                   EKNRITKAKFNYPEVLGLLEAYQITVED"
FT   gene            complement(458527..459498)
FT                   /locus_tag="CA2559_01860"
FT   CDS_pept        complement(458527..459498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01860"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87461"
FT                   /db_xref="GOA:A3U5E4"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5E4"
FT                   /protein_id="EAP87461.1"
FT                   /translation="MHSFFIKVIIKATRTFKDEDHGDYYSDYEIAKRYREFIRLSKRFF
FT                   KNFILIVAGIFSASFGFKGFLLTNDFIDGGATGISLLLAALTVVPLYALIILVNLPFVI
FT                   LGYKIMGKSFAIKTAFAIAGLAICVAVVPFPNVTNDDLLVAVFGGFFLGAGIGLAIRGG
FT                   AVIDGTEVLAIYLSRKFAVTIGDVIIIINVLIFSVAAYFLSIEIALYSMITYIAASKTL
FT                   DFIIEGIEEYIGVTIIASQSDRIKKMIIEKLGRGVTIYKGKGGFIQDGLSKDHDIIYTV
FT                   ITRLELNNLNSEIERIEPSAFIVMNSIKDIKGGMIKKRPLKH"
FT   gene            complement(459561..460007)
FT                   /locus_tag="CA2559_01865"
FT   CDS_pept        complement(459561..460007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01865"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01865"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87462"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5E5"
FT                   /protein_id="EAP87462.1"
FT                   /translation="MKKAILLILACVALSSCALKPIPSQFNFVKTNLEEVSLDSLGNGT
FT                   IMVYNGANFLHKIDNTARLNIWIDEKPLGQIRPSEYVIINLKDGKRLFKAVHIDMVKMS
FT                   SLHDVIVDAETKVIEIKPTVTSNKLTVTNAFPEKFEKFKYAEKR"
FT   gene            complement(460108..460548)
FT                   /locus_tag="CA2559_01870"
FT   CDS_pept        complement(460108..460548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01870"
FT                   /product="histone acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01870"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87463"
FT                   /db_xref="GOA:A3U5E6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5E6"
FT                   /protein_id="EAP87463.1"
FT                   /translation="MKAITIVNRALTPKESNQVNLGFDTLMREEHVALEKTEPIHFVAI
FT                   QEDYLIGCAIGLAHKNGDVFSGWFHLTDLFVEKEFRNLGIGASLLKELEAHCKAIGVTK
FT                   IWLWTSGAASVRFYNRHEYSQFAELEQWYSDGSSRIGLRKTI"
FT   gene            complement(460583..461623)
FT                   /locus_tag="CA2559_01875"
FT   CDS_pept        complement(460583..461623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01875"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01875"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87464"
FT                   /db_xref="GOA:A3U5E7"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5E7"
FT                   /protein_id="EAP87464.1"
FT                   /translation="MKSPTPKQIIRMLLFVGTAISLYFVPWPIVTAWITPLPNTIQEQV
FT                   NNAKDYGFDGIVVYVDKGQDKEPEFYTSGYKNRALQTPADPQALFKIASVSKLYVALSI
FT                   AKLERSGKLSIHKTLSHYLPELEGSIDNAKDITLKMMVTHRSGIPNYTDVPNFWANPPS
FT                   SEQKILELVLNTPANFKPDQDYEYSNTNYLLLGRVMDRVLGYSHLQYIQLEILNPLQLN
FT                   NTYTSLNDVNIEDVMSGYYVGYEEDLKTDYIGSMLATAQDLGKFIRALNDGSAFSDAKE
FT                   QEIYTSLYKFNHTGLIPGYQTIAEYHQDINTVVIQFTNTVNFNGYNWNLSEIMYSRILK
FT                   ILKSKD"
FT   gene            complement(461916..462359)
FT                   /locus_tag="CA2559_01880"
FT   CDS_pept        complement(461916..462359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01880"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87465"
FT                   /db_xref="GOA:A3U5E8"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5E8"
FT                   /protein_id="EAP87465.1"
FT                   /translation="MKLDEASAFFKNLIIESDNKTEIKIYKNFISIFTDLNNRDLSEEQ
FT                   LKSIEEKLDSLNFNENSDNRKKHFKQKLNLFVGYLKEKLSLISKGYYTAIGMSLGMSFG
FT                   VAFGAAFKNVSYGLIFGMLIGMLIGIAKDSKAKKEGKVLSTNL"
FT   gene            complement(462605..463138)
FT                   /locus_tag="CA2559_01885"
FT   CDS_pept        complement(462605..463138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01885"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01885"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87466"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5E9"
FT                   /protein_id="EAP87466.1"
FT                   /translation="MDELNTKMNDEIRVRGQIIALSLKLEDILTKIIYSTFKPICENEE
FT                   VLNLYLEEFILPIAFGKKISLFKQVLKTEKYQTKIKLYLESNSSITKNRNISTAKELTN
FT                   FLDLNLSETLKTRNLIAHGLNVNDLVAEEVDLDNGNIIFANKLKSEILNKNSLKDFSEN
FT                   TLLISFIILMINRF"
FT   gene            complement(463383..466454)
FT                   /locus_tag="CA2559_01890"
FT   CDS_pept        complement(463383..466454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01890"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87467"
FT                   /db_xref="InterPro:IPR032774"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5F0"
FT                   /protein_id="EAP87467.1"
FT                   /translation="MKINILIVFLVLLNFSAYSQDCNSLLKNGENYAAGDNAISWCDFE
FT                   TQTDYVKCMCDREINYQNQVKEEKRIGDKYNSDLKNLRGQRENAASSGNYKLAIEYIDQ
FT                   QIDLVIKNPVNHPQYFIDNELRTLRSQKKQYENQLGNNENSQNNEQRDSYTQKSNDVTS
FT                   NKNNQPNDAQDFIDNQKAATVKYDAALEKLGNTLTTQFTEMSNNWAKEQDYINQISSFS
FT                   QIKSTSVTGIIKEARQKQKQLEDVFNKKARDLDKDLATARTRVLAAAKNETQAAVGELL
FT                   TTTATVLARRKLEKEERNARQNLERQKERELSKIAEKLKEKYLPIRQNALKAATLALSE
FT                   DAEEFYLKQYEFAACMMKDADEIIRGGNYCKDPGNRSFKNNSKNISGETYYNTFSRKSN
FT                   SSNESIKQKAPYFLELALQKKPNNPKWLYEKSQLKNIELIEKLAILKKVIALDNKNVAY
FT                   GTAYDSTLKEYKKFLEQERIFEEQKAKYGSDIVKKTIIQASNSNYNWAERENVKLVYVP
FT                   KRNETFFINKQGKTILNTSKYDTVTDFFEGLALVSKDERYGFINIKGETIIPLKYKNAR
FT                   TFDEGMAFVVDVETYLAGFINKNGETVIPFEYIDVSSFSEGLAFATKLKDGKKRTQDYV
FT                   PESDKNSFYIDRKGNVKISGKFDKGVSFINKSAVVKKSKTSTFMGGGNDKYKYIDTNGE
FT                   YLFNEGFDIARPFNNKGYAIVANEKFASGLRWFIIDSKGEKTSKITFGNEPKFINNVAI
FT                   ANIGGSSDYTSKYVIIDDTGKVLTNKEYKRIESFKDGLALAKDEYDQSIYLNLLGEEID
FT                   NDDEILFKRKENEVLEIEELKDLKSIDELENSLKEIYIQVWKTDDGFLVQHNNQNSNNR
FT                   GFFNWKGENIIPVKYPWLTPFSDGLAVFSEVKGKYGYMNLQGDSVIDPIYDFAEMHSEG
FT                   IAIVTLNKKMGFIDTNGKIVIPIEYQAVFAFTEGLARICDNGKCGYINENAEIVIPLKY
FT                   IMVEPFKNGKAKVSLKKPKKNDYFYINKFGEKVE"
FT   gene            466782..467114
FT                   /locus_tag="CA2559_01895"
FT   CDS_pept        466782..467114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01895"
FT                   /product="Single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01895"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87468"
FT                   /db_xref="GOA:A3U5F1"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5F1"
FT                   /protein_id="EAP87468.1"
FT                   /translation="MQTLRNNVQLIGNLGQDPEIINLESGKKLAKFSIATNESYKDKNG
FT                   EKVEQTYWHNIVAWGKTAEIVENYVCKGKEVAITGKLTNRSWDDKDGNKRYTTEVVCSE
FT                   LLMMSK"
FT   gene            467248..469344
FT                   /locus_tag="CA2559_01900"
FT   CDS_pept        467248..469344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01900"
FT                   /product="ATP-dependent DNA helicase recQ"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01900"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87469"
FT                   /db_xref="GOA:A3U5F2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029491"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5F2"
FT                   /protein_id="EAP87469.1"
FT                   /translation="MTSTTSSITQLLKTHFGYDSFKPNQEAIINDVLSGKDTLAIMPTG
FT                   GGKSLCYQLPALAKEGTALVISPLIALMKDQVDALRANGITAAYYNSSQPEEEQQHVLQ
FT                   QLTKGELSLFYVAPESLPNLRHTISTITLNLIAVDEAHCISAWGHDFRPAYTKLGSLKQ
FT                   EFPQIPIIALTATADKATQDDISKQLNISHAKKHLASFDRQNLFLDVRPGQSRIKQILK
FT                   FLGPRGAQSGIIYCLSRKSTEKLAQKLKQAGYKAKAYHAGLSPEDRANIQEDFVNDTTP
FT                   IIVATIAFGMGIDKSNVRWVIHYNMPKNIEGYYQEIGRAGRDGLKAHTLLFYSYADVIQ
FT                   LRRFTEGTATEEFQLAKLERMQHYAEALSCRRKALLNYFGEHLTKDCGYCDVCQNPPKY
FT                   VDGTVIAQKVCSAVARVKEQEGVTMIVDVLRGAKNAQVFDKGYQHIKTYGAINNVSWND
FT                   LQQYIIQLINLGVLEVYFHENGRLVLTPLAKAILFEGQNIQLAHTEDVKALKDAKTTKV
FT                   TKNDSLFEQLRNKRSAIAAEKNVPAYIIFSDASLKDMIKKQPTTIKAFADISGVGKAKL
FT                   ESYAEPFIDVIKTYKAQQKPKVDTYQQTLQLYTQGMPVEDISKERDLSLNTIYSHLLKL
FT                   HLEDKLSLNLNEFVTDEELSKVKTASKTLNHPEGLKPYYLHFEETIPYWKLKFALTMLE
FT                   DQEK"
FT   gene            complement(469332..470063)
FT                   /locus_tag="CA2559_01905"
FT   CDS_pept        complement(469332..470063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01905"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01905"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87470"
FT                   /db_xref="GOA:A3U5F3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5F3"
FT                   /protein_id="EAP87470.1"
FT                   /translation="MILDAILVEDEARSRDILRNYITKYCPNINLVGEASGVDEGLELI
FT                   RNHQLDLVFLDVEMPYGNAFDLLEKVGDRTFETVFVTAYDHYAKDALNAHASYYLLKPI
FT                   NIDELIKAVDYVVAIKTKESQLKDKVLSANIKAVDGKITIPTQEGFEVLQVNNILYCEA
FT                   DNNYTTIYLEDTKKVVSKTLKYFEDALTDSGFARIHKSYLVNVNAITKYIKGKGGQVEL
FT                   KNGKVLSVSASKKADLLNYFS"
FT   gene            complement(470063..472252)
FT                   /locus_tag="CA2559_01910"
FT   CDS_pept        complement(470063..472252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01910"
FT                   /product="Autolysin sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01910"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87471"
FT                   /db_xref="GOA:A3U5F4"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5F4"
FT                   /protein_id="EAP87471.1"
FT                   /translation="MKHIFIILFFICSVPCCVAQIGEQTIVRGTVLEEGTYNPFSNANV
FT                   EVVGGAYTTTNAAGEFRLQARIGEELVIRHEDFETVYHTIGRNDNIKLTVAPNKTKPKA
FT                   VKRNKQVTQERFQQYLDSAKNVLKKDAKISIEYVAKALATDQEQTLSKLQKAKAYELLG
FT                   DIYTYWKQHDLAVSNYKFAIRDNVSTQRQLKLAKAYTLNKNYQESISLYNELKNKSLSN
FT                   YNEVLRLEGLGDTYKNTGDLNKAITQYQQALTLAEKHLFTPKVTDLNSKIAEAYDAKGA
FT                   TKPAEDYYENSLNLANKETRKRAAEEKTKVADFYSKNRSYREEIQLRQEALKDIEVLSE
FT                   DAVEKEQEIDNESALTPQKQNYKIANAYAAQENIEDAIPYLQKSIKEAKTNNDLVVQKD
FT                   ATRKLGELYRAKGDITKAEETFKDYEVVVDQLYVQKEQEISQAARFSRDLTLKQTRIES
FT                   LEKDRALNESRYQLAVENQSLVNQSNRRQKWIIGVLIALALALLVAAYLMYRNNKQQKF
FT                   ANNLLALKSLRSQMNPHFIFNALNSVNSFIATNDERAANRYLSEFSGLMRAVLENSEED
FT                   FIPLSKEIELLQKYTKLEHFRFQDKFDYDILVDDAIPTNQFKIPPMLLQPYVENAVWHG
FT                   LRYKEDKGNLLVHFQLKDEHTVVIIIEDDGIGRAQSKAIKTDNQKKQKSQGMSNIQRRI
FT                   SILNDMYSDTIAIAISDKDQTNHTGTRVAVTLKKH"
FT   gene            472469..473641
FT                   /locus_tag="CA2559_01915"
FT   CDS_pept        472469..473641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01915"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01915"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87472"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5F5"
FT                   /protein_id="EAP87472.1"
FT                   /translation="MKINALPIIVSCLSLIGCVNANSKPETLLADAPEVTHQLHTPATN
FT                   ETPKIQVALLLDTSNSMDGLIDQARAQLWDIVNELSLAKCYGKAPTLSIALYEYGNSNL
FT                   SKYDGYTRKILEFTQDLDDVSKALFSLTTNGGNEYCGTVVQTAVNNLEWENEDETLKLI
FT                   FIAGNEPYTQGQINYVDASQNAKEHDITVNTMFCGSYNHGVSSYWRDGALLTGGDYMAI
FT                   DHNKAIVHVASPYDDAILKLNTKLNNTYIPYGAKGLEKAEVQISQDDNAMSYNESSAIK
FT                   RAVSKSSHLYTNKSWDLVDAVNENEVTLSKLNTAQLPKALAGKSTAEIEAYIVLKTKER
FT                   KQLQEKIQQLNTKRKNYIAKETTTLNKANNLQSAMLAAIKKQAEAKHFYW"
FT   gene            473744..474208
FT                   /locus_tag="CA2559_01920"
FT   CDS_pept        473744..474208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01920"
FT                   /product="Inosine monophosphate dehydrogenase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01920"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87473"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5F6"
FT                   /protein_id="EAP87473.1"
FT                   /translation="MGISNYMGRRAKPTKGSKEQITVSDYMSRKLVTFTPSQNVMEVIQ
FT                   TLVKHKISGGPVVNDQNELVGIISEGDCIKQISDSRYHNLPMDDATVEKHMVRDVETID
FT                   GNMNIFDAANQFLSAKRRRFPIVEEGKLVGLISQKDILKAALNLKQQNWK"
FT   gene            complement(474210..474887)
FT                   /locus_tag="CA2559_01925"
FT   CDS_pept        complement(474210..474887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01925"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01925"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87474"
FT                   /db_xref="GOA:A3U5F7"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5F7"
FT                   /protein_id="EAP87474.1"
FT                   /translation="MDTETILLIAGFAFAFIIIICSYYFSKRNVVLRQLTKVKSTSLVS
FT                   VRHNQKVKVFGKVKAGTDVLTAPLSKRKCVYYYVEVKEKNGNNGSRTIFKEERVKNFMI
FT                   EANGAFAVIKPQTNLKTVTSYVVQDISHSTGFLNDASPRLRHFIRTRNIGATTLFGFNK
FT                   NLEYKESSIEIGERIAVLATAKWKKLNTPIEGYNYSSILELEGTQDDKLIITDDPEAFK
FT                   DKL"
FT   gene            complement(474893..475246)
FT                   /locus_tag="CA2559_01930"
FT   CDS_pept        complement(474893..475246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01930"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87475"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5F8"
FT                   /protein_id="EAP87475.1"
FT                   /translation="MIAKRVCLECGTKLMGRVDKKFCHDGCRNAYNNNINKDSKNLIRN
FT                   INNRLRKNYRILEAFNPKDKTKTTRTKLLAKDFDFNYFTSTYTTKAGKVYYFVYDQGYL
FT                   ELDNDFFALVKRH"
FT   gene            complement(475321..475596)
FT                   /locus_tag="CA2559_01935"
FT   CDS_pept        complement(475321..475596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01935"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01935"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87476"
FT                   /db_xref="GOA:A3U5F9"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5F9"
FT                   /protein_id="EAP87476.1"
FT                   /translation="MKKFIVILFFSCAILLCLGFWKLDTEDVALGHKLIGTACLLGMFI
FT                   LIPCFIYYRWKGKNVRDYMLTDEAFKRMKEFNKDKEKNKRNPNNSK"
FT   gene            complement(475599..477347)
FT                   /locus_tag="CA2559_01940"
FT   CDS_pept        complement(475599..477347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01940"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01940"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87477"
FT                   /db_xref="GOA:A3U5G0"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5G0"
FT                   /protein_id="EAP87477.1"
FT                   /translation="MYRSHSCGELNSDHIGNQVTLSGWVQKVRDKGFVVWVDLRDRYGI
FT                   TQLVFDEERTSLEILNRAQELGREFVIQAKGKVIERESKNKNIPTGDIEVLVEELTVLN
FT                   AAKTPPFTIEDDTDGGEDLRMKYRYLDIRRTPVRENLIFRHKVTIAVRNYLSDLGFIET
FT                   ETPYLIKSTPEGARDFVVPSRMNEGQFYALPQSPQTFKQLLMVGGMDKYFQIVKCFRDE
FT                   DLRADRQPEFTQIDCEMAFIDQEDILNTFEGLTTHLLKELKGVEVTEFPRMTYDDAMKR
FT                   YGNDKPDIRFGMEFGELNEVAQHKDFGVFNSAELVVGIAVPGAASYTRKEIDALVNWVK
FT                   RPQVGALGMVYVKCNEDGSYKSSVDKFYDQEDLAKWAEVTGAKPGDLICVLSGDTHKVR
FT                   TQLSALRMEMAERLELRKSDEFAPLWVIDFPLLEWDEDTKRYHAMHHPFTSPKPGQLEL
FT                   LETNPGEVKANAYDLVLNGNEIGGGSIRIHDSKTQALMFDYLGFTPEEAKAQFGFLMDA
FT                   FQYGAPPHGGLAFGLDRLVAILGGQETIRDFIAFPKNNAGRDVMIDAPAKIDEEQLKEL
FT                   HLKLNL"
FT   gene            477622..480555
FT                   /locus_tag="CA2559_01945"
FT   CDS_pept        477622..480555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01945"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01945"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87478"
FT                   /db_xref="GOA:A3U5G1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5G1"
FT                   /protein_id="EAP87478.1"
FT                   /translation="MKHLYFSKKLILLVLLIFPLAMVAQTVTGKITKAGSGETVPFVNV
FT                   IEKGTNNGAVSDIDGNYTIELRATPATLVFSSLGFTTQEISVSSAGTVNASLEESAAAL
FT                   DEVVVTGLGTSVKRKNLANAVSTVSAEELVGTTGQTSVDGALYGKVTGVNITSSSGAPG
FT                   GGFALRLRGISSINGNNQPLIIVDGVYINNVEIPSGLRFASGANRGNEENSSNRLADID
FT                   PNDIEDIEILKGSSAAAIYGQRGNAGVIIITTKRGKTGKTKINFKQDVGITRIANPLGL
FT                   RPWTRQSVVDTFGEDEALKYDATLAANGSLYDYEDIIYGETGIITETALSATGGNEKTS
FT                   FYVGGSYRDEEGIIKRTGFDRFSIRTNVDHKLSDVFDFTSTTNYVRSNSSRSFTGNENE
FT                   GGLSYGYTLAFTRPWNNLFPDENGNYPNNPNYPGNPLDTRDRATNEDQNDRIIQGLTLN
FT                   TKLYTDDVNRVKLVLSGGLDYLANQTYVYVPEDHQGQIASGQLGFVAQGKNNFTQINTQ
FT                   AIAIWNHDAMEGDLGLTTQLGTTYLQQQSNLVNSIGSQLAAGQTNVSQSVNQSIIQFVS
FT                   DERDFGYFGQVEGNYKDQVIATLGYRLDKSSRNGDPNKFYGFPKASVAVNLNNFDFWNI
FT                   DSINQFKLRAAYGETGAPAGFGATFTSLGSSNIGGNSGQSLGGLRGDPDVEPETASEFE
FT                   IGFDMGFLNNRINLEATYYNKNVDDLILSRSLPASSGFTTETTNLADLMNEGIELAVRS
FT                   DVVDTENFKWNTGVQFYLNRSEVTRLDVPAFAQPGAGFGTGLGTFYIEEGQPVTQLVGR
FT                   VDGELLQVGNVEPDFQMAFNNSLTLFNNVDVSFLLQWKKGGENLNLSRFLTDLGQTSPD
FT                   LETPEGQDRLGQPANALRFVEPAGYVRLREAAVYYRLPSATVNNIFGETVDTVKFGLSA
FT                   RNIFTITDYSSYDPEVSVNGGAGLSSGIEVTPFPSSRQFYFHFNVSF"
FT   gene            480568..481911
FT                   /locus_tag="CA2559_01950"
FT   CDS_pept        480568..481911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01950"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87479"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5G2"
FT                   /protein_id="EAP87479.1"
FT                   /translation="MKNIFKKISIIGTVALAAMTFGSCEFDEVVDPNAPSLGGVQENAT
FT                   IGQLNELVVGIESTTRNGLGVETTASGTMARELYLFDADPRNTGDLLGKNGIGLDNNSF
FT                   YSVSQWNGNYRAIKNTNILLNAIDNTESIDDTERNGYAGFAKTIQAYELIQILKSYGMA
FT                   RTDVADELNLGPILDFNAAIADVRALLEEANTNLSNAGTSFIFPLAGFSTSVSDFQEFN
FT                   RGVAALAAVYAGDGNGALTALASSSLNLDATTLEELNAGPKHVFSQQANDQTNPVFRGP
FT                   STPENPNNGDQIVVHPSFIADATPGDARVERKTALRPDPSTQDELTGDFETRLYATNVS
FT                   PIDILRNEELILLYAEASILAGSPGDAVTALNVVRNVSGNIGDYTGPTTTDALTEELLR
FT                   QRRYSLWSENHRMFDLRRYNMSDMLPIDRAGDQIFNVFDIPLSENTGA"
FT   gene            482104..482442
FT                   /locus_tag="CA2559_01955"
FT   CDS_pept        482104..482442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01955"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01955"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87480"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5G3"
FT                   /protein_id="EAP87480.1"
FT                   /translation="MTALVFTGALFAQDVKPEFEEQGDLIKGTFFYEDGAVKQKGTYKD
FT                   GKLHGKWVAYDKTGAKTAVAQYANGEKTGKWFFWNNGNLTEVDYTNNTIAEVTTWDNSK
FT                   TLVVRDRP"
FT   gene            complement(482558..486055)
FT                   /locus_tag="CA2559_01960"
FT   CDS_pept        complement(482558..486055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01960"
FT                   /product="multidrug resistance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01960"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87481"
FT                   /db_xref="GOA:A3U5G4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5G4"
FT                   /protein_id="EAP87481.1"
FT                   /translation="MSSNKAQKNADKEFGMSSWAIDSKTTIWVMIAIFLALGVSAYFTL
FT                   PRESFPEIEETKVYISTPYPGNTAEDIERLIVDPLEDRLKNVSNVVEIISTAQEDYAII
FT                   TVEFDEEITVEQAKTKVKDEVDAEKASEDWPTFNDAKVEPNVFDLNIAEETPILNINIE
FT                   GDYQVEQLKEYAEYLEDEIEDLPQIKQVDIRGAQEKEVEVAVDIYKMMAAQVSFDDILN
FT                   AIRGGNMTISAGNLIKSGQRRTIRVLGEIQSPEQLNNFVVKSQNGAVYLKNIANVTFKE
FT                   EDNTTYAREFGESVVMLDVKKRSGKNMVEAVDQIKVIVEETKANVFPPDLKVTLANDQS
FT                   EKTINQVDDLVNNIIFGIILVVTVLMFFLGFRNALFVGFAIPMSMFIAFFILQLLGYTM
FT                   NTMILFALIMGLGMMVDNGIVVVENVYRLMDEEGMSRIEAAKKGIGEIAVPIIISTLTT
FT                   VAAFVPLGMWPGVMGEFMKYFPITLSIVLGSSLFVAIFMNSMLVSQFMSTDEKIISKKS
FT                   LRRITFIGLPLGLLVFFVGGPVRGLGTLMIVTIILLWLYKFFIKGWAINFQRKTLVALE
FT                   NRYKRFLQYALKGRRAWAFAAGTFGLLFIVFILFGISVGSGRTSIEFFPDNKPNQIIVY
FT                   IEYPEGTDIKKTNEIAKDIEERVYAVLQDDMYMEDGRNYMVESAVSQVGEGAGNPQTDG
FT                   GNSAEMPHRAKITATMREYKFRKGKDSEVLRQKVQDTLEGVYPGVAISVEKDSNGPPAG
FT                   YPINIELEGPDYDELILVAEQMKNFINASNIEGIAELKIDVNRSKPAMQVVVDREKAGE
FT                   LGVTTGQVGNQLRRSIFGDKAGVYKKDGEDYDIYVRFNEDNRYNTSALFNQNITFRDPA
FT                   TGQIKEIPISAVAKQKNTSSFSAIKHRDAERVVTVYSALEPGYTDAAAIVAQIQEKMKE
FT                   FQDLPQEIKIDYTGQIEEQNKQMAFLMSAFFSGLGLIMLILVFQFGSISKPTIIMIAIF
FT                   LSLIGVFGGIIITGASFVIMMTMMGIISLAGIVVNNGVVLLDYIQILIDRRMVKLGMSD
FT                   GDLLPREEMTDIIIEAGRARLRPVLLTAITTVLGLIPLAIGLNIDFFGLFGSLNPDVYM
FT                   GGDNVIFWGPLAKSVIYGLIVATFLTLIIVPVLFYLVHRNKLRFRKRFNKEKLHDIHQ"
FT   gene            complement(486126..487331)
FT                   /locus_tag="CA2559_01965"
FT   CDS_pept        complement(486126..487331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01965"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01965"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87482"
FT                   /db_xref="GOA:A3U5G5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5G5"
FT                   /protein_id="EAP87482.1"
FT                   /translation="MQYLEKDIQKTNQQKTMRSILKLIVLSLIIVSCGGNKNESVDSLI
FT                   AEGNIEALKEKRSALNEEQRTAAMQVKKIDSVLELKSGNKNLPLVSTIVVKDTLFNHYL
FT                   ELQGSVETKQNIVISPEYNGLLERIYVKEGQRVNKGQLLAKIDDGGISQQLAQMETQLA
FT                   LAKTTFERRQRLWEQNIGSEIEYLQAKAQYEGQQNSVAQMRSQVGKTTIRAPFSGTIED
FT                   VIAEQGTVVASGQTQIMRLVSLEDMYIEAEIPEDYLTSVSENTPVTINFPILNKTVDSK
FT                   VRQASNYISPSNRTFRIEVAVPNKDKSIKPNLTARLKINDYTSEKALLIPLSVISENAD
FT                   GEQYVYIAEGEDTPVAKRQIIETGRSQGQNIEVLSGLSNGDFVIKEGARTVKEGQELQI
FT                   KN"
FT   gene            complement(487332..488702)
FT                   /locus_tag="CA2559_01970"
FT   CDS_pept        complement(487332..488702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01970"
FT                   /product="outer membrane efflux protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01970"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87483"
FT                   /db_xref="GOA:A3U5G6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5G6"
FT                   /protein_id="EAP87483.1"
FT                   /translation="MTYRIVMLLLFVSSVAFSQEAPKSYSFSLEEAVNYALDSSYTAIN
FT                   ARRDVAKALKQKWETTADGLPQINGSVDYQNQLKQPVTFIPAEFSGGEPGTFTPVTFGA
FT                   KQSANLTATLSQVIFDGSYLVALKASTAFLEFSENANEKTRLEVRKGVINAYGGVLLTE
FT                   ESVSIVEKNIDAITDNLSETQALYEEGFAEEEDAEQLQITKLQLENQLSNTKRQADIAK
FT                   QMFNLALGIPVSAPVVFKDGLEQLTLENVSLEISEQELAVEENVDYKIADNLTKQRELE
FT                   LKLEKSKALPSVNAFVNYGTQTQDDDFVFFDSDTRWFQSSIFGVSINVPIFSSLKRSAR
FT                   TQRAAIALDQAQTDLEQTIQQIQLDTDTARSDYQFAIESYQTAQKNLELAERIENKNQI
FT                   KFREGISTSFDLRQAQTQLYNAQQELLQSMVNVITTKAELETVLNTPQLRVPYQESK"
FT   gene            complement(488692..489306)
FT                   /locus_tag="CA2559_01975"
FT   CDS_pept        complement(488692..489306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01975"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01975"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87484"
FT                   /db_xref="GOA:A3U5G7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5G7"
FT                   /protein_id="EAP87484.1"
FT                   /translation="MRETILNKATELFLDLGFKSVTMDDIATEMGISKKTIYTHFKNKS
FT                   VLVKASTEILFLRICSGIDGVRKENQNPIVELYSIKQYVMKHMKNQNSSAQFQLQKYYP
FT                   AVYAEMRSKQYDYMQDCVVENLNKGLEMGLYRENLDVEFASRIYFLGMVGIKDNDMFPA
FT                   DQFPMITLMEKYLEYHLRGIVTQKGLKKLTETIENYTPNDL"
FT   gene            489453..490427
FT                   /locus_tag="CA2559_01980"
FT   CDS_pept        489453..490427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01980"
FT                   /product="putative isoprenoid biosynthesis related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01980"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87485"
FT                   /db_xref="GOA:A3U5G8"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5G8"
FT                   /protein_id="EAP87485.1"
FT                   /translation="MQEISSYREAFIAHMNSKVSVKEPENLYEPISYILNLGGKRLRPI
FT                   LVLMATEIFGEDYTKGLDAALAVEVFHNFSLVHDDIMDDAPLRRGKDTVHEKWDLNTGI
FT                   LSGDAMLINAYQLFENYDGSTFKELAKLFTKTAIEVCEGQQYDIDFETRDDVTIPEYLK
FT                   MIEFKTAVLVGAALQMGAIVANAEDSCKDKIYEFGCLLGLAFQLQDDYLDAFGDPKTFG
FT                   KQVGGDIIENKKTFLYLKAIENSTKEDAKQLEHLYSLSPKRPENKIETVKTIFENSGAS
FT                   ELTRQEIEKYTKKAFECLDHISISEDKKKGLIEFGNILMNRTV"
FT   gene            490427..490789
FT                   /locus_tag="CA2559_01985"
FT   CDS_pept        490427..490789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01985"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01985"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87486"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5G9"
FT                   /protein_id="EAP87486.1"
FT                   /translation="MQKPEALSSAVNLFEEATSLNLFKNLVVQVEKDFNLASVDLEIDT
FT                   IESTTPNSLLDGIESKIYYLLQYDTSTYINLLYIIDVPEHSIKYLKAENLEQFSKDISF
FT                   LILKRCWMKVWYKANY"
FT   gene            complement(490786..491160)
FT                   /locus_tag="CA2559_01990"
FT   CDS_pept        complement(490786..491160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01990"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87487"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5H0"
FT                   /protein_id="EAP87487.1"
FT                   /translation="MEGEWKVSDKEVYETWKPSDANILIGEAYTVKENGSKKIAERLAI
FT                   RKVKKDIVYSAMVPNQNAGKAIDFVLNQIDENTYSFENPNHDFPKKIIYKKVSDSELFV
FT                   VVQGKDVTEAFNYTLLKQTN"
FT   gene            complement(491245..491799)
FT                   /locus_tag="CA2559_01995"
FT   CDS_pept        complement(491245..491799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_01995"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_01995"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87488"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5H1"
FT                   /protein_id="EAP87488.1"
FT                   /translation="MNYLIKLNAMKLIINTFFSSKFKLLIVLLVISCATHAQSGSGFTN
FT                   NLRIGGSLGLGFGDGFFTANLAPSVIYDINNYWSVGTGLSGSYTSFDDARAYTIGGSAL
FT                   AFFRPISNLRLSSEFEQLYVNFKRELDGSTFERNYTYPALFLGIGYTTGNLTAGVKYDV
FT                   LFDEDDSIYSSALVPFISVYF"
FT   gene            491883..494645
FT                   /locus_tag="CA2559_02000"
FT   CDS_pept        491883..494645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02000"
FT                   /product="2-oxoglutarate dehydrogenase, E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02000"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87489"
FT                   /db_xref="GOA:A3U5H2"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5H2"
FT                   /protein_id="EAP87489.1"
FT                   /translation="MDQFSFLNAAHTSYFADLYDQYLKYPDSVEPSWRAFFQGFDLGLE
FT                   ERGDIEATQANTSNSKSASQAPDAVLKEFQVIRLIDGYRARGHLFTKTNPVRERRKYVP
FT                   TLDISNFGLSEQDLDLKFNAGNIIGIGEASLRDIITHLERIYCEAIGVEYMYVRKPEEI
FT                   QWIQDKLNINDNHPEFSNDQKKHILKKLNEAVSFESFLHRKYVGQKRFSLEGNESLIPA
FT                   LDALIENAAEQGVEDFVMGMAHRGRLSTLTNIFGKSAKDIFSEFDGKDYEQEVFDGDVK
FT                   YHLGWTACRKTDSGKEINLNIAPNPSHLETVGAVVEGITRAKQDRHHKDDFSKVLPIVV
FT                   HGDAAIAGQGIVYEIVQMSQLDGYKTNGTIHIVVNNQIGFTTNYLDGRSSTYCTDVAKV
FT                   TLSPVLHVNADDAEAVVHAMLFALDFRMRFKRDVFIDLLGYRKYGHNEGDEPRFTQPKL
FT                   YKAISKHKNPLEIYAEKLKSQGVIDDSYVTKLEQDYKNKLEENLEDSRKEDKTEITAIM
FT                   KDEWEGFNYAQEDEMMTPVDTTYDLEKLTEIAEVITELPKDKKFLRKIAKLIEARKTMY
FT                   FEDNKLDWAMGELLAYGTLLKEGYDVRMTGQDVERGTFSHRHAVVKVEESEEEILLLNN
FT                   LKGDQGDFYIYNSLLSEYAVVGFDYGYAMASPKTLTIWEAQFGDFSNGAQIMLDQYISA
FT                   AEDKWKLQNGLVMLLPHGYEGQGAEHSSARMERYLQLCAKDNMYVADCTTPANLYHLFR
FT                   RQMKTDFRKPLIVFTPKSLLRHPKVVSTKEEIANGAFQMTIDDVEADAKKVKTLVFCTG
FT                   KFFYDLTAERDDNKRDDIAFVRVEQLFPLPVEEMRNAMKKYSNAKDVVWAQEEPRNMGA
FT                   YSHILMHLDEAKSFRVCSRRPYGAPAAGSSVRFKKRHAKVIEDVFTRPE"
FT   gene            494707..495999
FT                   /locus_tag="CA2559_02005"
FT   CDS_pept        494707..495999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02005"
FT                   /product="2-oxoglutarate dehydrogenase complex,
FT                   dihydrolipoamide succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02005"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87490"
FT                   /db_xref="GOA:A3U5H3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5H3"
FT                   /protein_id="EAP87490.1"
FT                   /translation="MALEMKVPSPGESITEVEIAQWLVEDGDYVEKDQAIAEVDSDKAT
FT                   LELPAEASGIITLKAEEGDAVEVGAVVCLIDTDAKKPGGDDKAASGDEGSGDDAEKDLK
FT                   EQNKKTEDTNEKGDALKQTPSKPSTQDQKQDNKNYATGSPSPAAKKILDEKGMDSKDVS
FT                   GSGRDGRITKDDAVKAKPSMGSPGNGKRGESRTKLSMLRRKVAERLVSAKNETAMLTTF
FT                   NEVDMSPIFSLRKQYKEEFKAKHGVSLGFMSFFTLACVRALEMYPAVNSMIEGKEMITY
FT                   DYKDISIAVSGPKGLMVPVMRNTENLSFRGVEDEVKRLALKARDGKITVDEMTGGTFTI
FT                   SNGGVFGSMLSTPIINPPQSAILGMHNIVERPVAIDGHVEIRPIMYVALSYDHRIIDGK
FT                   ESVGFLVAVKEALENPEELLMDNDVKRALEL"
FT   gene            496003..496422
FT                   /locus_tag="CA2559_02010"
FT   CDS_pept        496003..496422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02010"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87491"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5H4"
FT                   /protein_id="EAP87491.1"
FT                   /translation="MKHLFKIALACLLIVTTTACSSDDSNDEVAGSGSVSFNVQTTSSR
FT                   NATVISRINEFTTTEENATFPYNLSYDDVPFPANTVIQLTYTDFDDTEVDPNGEENNNP
FT                   FEVALTISVDGNVVKMTSFTVTPDDTTDPSISFSL"
FT   gene            496521..496736
FT                   /locus_tag="CA2559_02015"
FT   CDS_pept        496521..496736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02015"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87492"
FT                   /db_xref="GOA:A3U5H5"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5H5"
FT                   /protein_id="EAP87492.1"
FT                   /translation="MELLKPEFSFILPLIMLIVLGIYIYSLVDILRHEFRGNNKIVWII
FT                   VVLMLPILGVFLYFLLGKKQQSARVL"
FT   gene            complement(496723..497019)
FT                   /locus_tag="CA2559_02020"
FT   CDS_pept        complement(496723..497019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02020"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87493"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5H6"
FT                   /protein_id="EAP87493.1"
FT                   /translation="MSYAVIFTSKQSSNTKGYASMANKIEELAKLQPGFLGIESAKDGI
FT                   GITVSYWESLNHIKEWKLQSEHLLAQQAGKSLWYDWYKVRICKIEREYSFTKP"
FT   gene            complement(497026..497715)
FT                   /locus_tag="CA2559_02025"
FT   CDS_pept        complement(497026..497715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02025"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02025"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87494"
FT                   /db_xref="GOA:A3U5H7"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5H7"
FT                   /protein_id="EAP87494.1"
FT                   /translation="MTNKLNSIELTKSEEDYLKAIFQLMLDSDNEKVGNNKLADYLNIS
FT                   PASVNNMVKKLKLKKLLKSERYAKLQLTDSGRDIAVGLIRKHRLWETFLSKYLNFTWDE
FT                   VHDVAEQLEHVKSPKLINELDRFMDFPKKDPHGEVIPDAEGNYRTFEKVTLASLDSGTI
FT                   CKLISVNDGSVEFLRYVSEIGLALSSEIKVIEKRSFDNSVKIEFNDSIETVSQKFADNV
FT                   FVEILSN"
FT   gene            497681..498562
FT                   /locus_tag="CA2559_02030"
FT   CDS_pept        497681..498562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02030"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87495"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5H8"
FT                   /protein_id="EAP87495.1"
FT                   /translation="MVNSIEFNLLVIPNFYSFANVKYKITQMKHITSIKIIVLLSVILT
FT                   TLNMSAQETQDPGAMVTDRPDQTESPALVTKGYIQVETGAFFTQDEDEGFKTEAIGYNT
FT                   TLVRYGLLDNLELRLGLDFVETRFSNDGNEFDNKLSGFTPMLLGVKVGIAEENGVLPKI
FT                   GLLGHLRLPFTAGSDYKPETTGADFRFSFAHTLSEKSSLSYNLGAQWGDDSPEIAYIYT
FT                   LVYGYSITNKLGAYVELYGDLPENNSANHLWDAGFTYLLKPNFQLDATIGSGLNTNQDL
FT                   LVSAGVSFRLPK"
FT   gene            498574..499485
FT                   /locus_tag="CA2559_02035"
FT   CDS_pept        498574..499485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02035"
FT                   /product="zinc ABC transporter, periplasmic zinc-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02035"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87496"
FT                   /db_xref="GOA:A3U5H9"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5H9"
FT                   /protein_id="EAP87496.1"
FT                   /translation="MKHIIIISLSLLLFASCKHTKEQNTGKLKVVTTTTMLTDLAENIG
FT                   GDQIELQGLMGSGVDPHLYKASEGDVSKLANADLVIYNGLHLEGKLVEVFEKMGNRVTT
FT                   KALADNLDKSGLISSEYFASSYDPHIWFNIKYWKQITNSLTEELKAAVPEQADYFEANR
FT                   NDYIKKLDTLEAAVIKTISTLPEEQRILVTAHDAFNYFGKEYGFEVIGLQGLSTATEAG
FT                   VQDVQNLSKFIIDNKVKAIFVESSVPKRTIEALQQSVKSKGFNVEIGGTLYSDALGNKG
FT                   TVEGTYIGMFSYNVNTIVNALK"
FT   gene            499511..500275
FT                   /locus_tag="CA2559_02040"
FT   CDS_pept        499511..500275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02040"
FT                   /product="zinc ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02040"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87497"
FT                   /db_xref="GOA:A3U5I0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5I0"
FT                   /protein_id="EAP87497.1"
FT                   /translation="MIKDSNKVEVKKKYAIQVDDLTVAYNYKPVLWDIDLAIPEGVLMA
FT                   IVGPNGAGKSTLIKSILGIIKPIAGTVRVFGKDYKKQVNEVAYVPQKGSVDWDFPTTAL
FT                   DVVMMGTYGSLGWLRRPGKKEKKASLEALEKVGMLAFKNRQISQLSGGQQQRIFLARAL
FT                   VQNASIYLMDEPFQGVDATTEKAIINILKELRKAGKTLIVVHHDLQTVPEYFDWVTFLN
FT                   VKGIASGPVRDIFNDDNLTKTYGINYKVSVNA"
FT   gene            500278..501390
FT                   /locus_tag="CA2559_02045"
FT   CDS_pept        500278..501390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02045"
FT                   /product="zinc ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02045"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87498"
FT                   /db_xref="GOA:A3U5I1"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5I1"
FT                   /protein_id="EAP87498.1"
FT                   /translation="MDITDFFTDYTLRTITLGTAILGAICGMLGSFAVLRKESLLGDAI
FT                   SHAALPGIALAFLITGAKDTYTLLLGALVSGLLGTWWIRGITSKTHLKSDTALGLILSL
FT                   FFGFGMLLLTFIQKMPNANQAGLDKYLFGQAATLLESDIWLMAGITGVSLIILLLFWKE
FT                   IKLLLFDADYTKTLGFNTKFLDVLITSFIVLAIVVGLQTVGVVLMSAMLLAPAAAARQW
FT                   TNKLSVMVLLSAIFGLCSGVFGTAISASQNNLSTGPVIVLVAGVFVLISFIFSPNRGIL
FT                   FRQLRLINNRRDLEQHKTLAFMYGIAKNHSDKSHPHTIRILNNFQGFTRKTLGRLEEKE
FT                   YIAIQGKLWSMTEKGYQKAENLYKKDNTDE"
FT   gene            501383..502543
FT                   /locus_tag="CA2559_02050"
FT   CDS_pept        501383..502543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02050"
FT                   /product="zinc ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02050"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87499"
FT                   /db_xref="GOA:A3U5I2"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5I2"
FT                   /protein_id="EAP87499.1"
FT                   /translation="MSSAQIDIQLIAMLVALACAIPGTFLVLRKMAMISDAISHSILPG
FT                   IVLGFFITHDLNSPILILLAAFSGVITVFLVEFIQKTGLVKKDTAIGLVFPALFSIGVI
FT                   LIAKNANDVHLDIDAVLLGELAFAPFDRLLFNDIDLGPKSLWVIGTILLITITLLIMFF
FT                   KELKLSTFDKGLAATLGFSPILIHYGLMTVSSITVVGAFDAVGAILVVALMIAPAASAY
FT                   LLTNDLKKMLLLSCTFGVFAAISGYWLANLLDGSIAGSMTTMLGVIFLMVYFFAPNKGL
FT                   ISVMFRQKRQRKEVSLLTFLLHLQNHSEERERHVNHLQEHINWQKIRSKTVLDLALRNN
FT                   MISIEKNIVTLTDKGQKFTERALEFIITNKTSEIELMKEDFFLFRG"
FT   gene            502615..503064
FT                   /locus_tag="CA2559_02055"
FT   CDS_pept        502615..503064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02055"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87500"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5I3"
FT                   /protein_id="EAP87500.1"
FT                   /translation="MKYVLVLVLAFSFTSCCSQKETTEAAASENQKVIATESFTKIKMG
FT                   QLTPFGNTMLKLKQVTNDSRCPEGAQCIWAGEVSVIVGMYDKGKFVKDINITFSPKDVT
FT                   KNKPYLLFETEDSKYFATGMTPYPKEGSKIEPKEYAMEISIKPNA"
FT   gene            complement(503054..503260)
FT                   /locus_tag="CA2559_02060"
FT   CDS_pept        complement(503054..503260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02060"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87501"
FT                   /db_xref="GOA:A3U5I4"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5I4"
FT                   /protein_id="EAP87501.1"
FT                   /translation="MKVFIYILIVIALGLAGYNITLLDFENLLEGNSKTALIGICACLC
FT                   VIVLMLILLVSKKIEQKSKSIKR"
FT   gene            complement(503266..503847)
FT                   /locus_tag="CA2559_02065"
FT   CDS_pept        complement(503266..503847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02065"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02065"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87502"
FT                   /db_xref="GOA:A3U5I5"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5I5"
FT                   /protein_id="EAP87502.1"
FT                   /translation="MELNFKEIFTATMVLFAVIDIIGNIPIILSLRDKNGHIHSEKAAI
FT                   VAAVVMIVFLFLGESILSLIGINVNEFAVAGAFILFFIALEMVLGVTLFKEDESSSDLA
FT                   AIFPLAFPMLAGPGSLTTLLSLRAEYSLANVIAAIIVNIIIVYIVLKTSSRLQRFLGKN
FT                   GIIVIRKVFGVILLAIAVKLFAENIQELFN"
FT   gene            503965..504537
FT                   /locus_tag="CA2559_02070"
FT   CDS_pept        503965..504537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02070"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87503"
FT                   /db_xref="InterPro:IPR021458"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5I6"
FT                   /protein_id="EAP87503.1"
FT                   /translation="MFQLGKTIVSEEIIEKDFVCNLNSCKGACCIEGEAGAPLEEDEVN
FT                   ILKKIYPKVKPFLREEGIASIKEQGTYIETPLGDLETPLVNGKECAYVTFKDNGMAGCG
FT                   IEDAYNAGEIDYRKPISCHLYPIRIKKYSSFSAINYHRWPICDDACTLGKELKVPVYKF
FT                   TKDALIRKYGEDWYKDLEKVAEEHLKL"
FT   gene            504912..505889
FT                   /locus_tag="CA2559_02075"
FT   CDS_pept        504912..505889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02075"
FT                   /product="probable ribonucleoside-diphosphate reductase
FT                   small chain"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02075"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87504"
FT                   /db_xref="GOA:A3U5I7"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5I7"
FT                   /protein_id="EAP87504.1"
FT                   /translation="MSQVEPILQKNENRFVIFPIQHNDIWEWYKKMEACFWTAEEIDLH
FT                   QDLTDWNSKLNDDERYFIKHILAFFAASDGIVNENLAENFVNEVQYSEAKFFYGFQIMM
FT                   ENIHSETYSLLIDTYVKDEAEKDQLFRAIEVFPAIKKKADWALKWIESDSFAERLIAFA
FT                   AVEGIFFSGAFCSIFWLKKRGLMPGLTFSNELISRDEGMHCDFAVHLHNKHLVNKVSKE
FT                   RIREIIVDALNIEREFITESLPASLIGMNSNLMTQYLEFVTDRLLLELECEKEYNTANP
FT                   FDFMDMISLQGKTNFFEKRVGDYQKAGVMDQDKDNSKISFDADF"
FT   gene            506049..508571
FT                   /locus_tag="CA2559_02080"
FT   CDS_pept        506049..508571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02080"
FT                   /product="probable ribonucleoside-diphosphate reductase
FT                   large chain"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02080"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87505"
FT                   /db_xref="GOA:A3U5I8"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5I8"
FT                   /protein_id="EAP87505.1"
FT                   /translation="MDVLKRDGRREPVMFDKITARVKKLCYGLNELVDPVKVAMRVIEG
FT                   LYDGVTTSDLDNLAAETAASMTVSHPDYAKLAARISVSNLHKDTKKTFSEVMTDLYEYV
FT                   NPRTGKKAPLLSDEVYKVIQDNKDRLDSTIIYNRDYGYDYFGFKTLERSYLLKLNGKIA
FT                   ERPQHMLMRVSVGIHLDDLDAAIETYELMSKKYFTHATPTLFNSGTPKPQMSSCFLLTM
FT                   QDDSIDGIYDTLKQTAKISQSAGGIGLSIHNVRATGSYISGTNGTSNGIVPMLQVYNDT
FT                   ARYVDQGGGKRKGSFAIYIEPWHADIFDFLDLKKNHGKEEMRARDLFYAMWIPDLFMKR
FT                   VEEDGNWTLMCPNECPNLFNVHSEEFDELYLKYESENKGRKTIKARVLWEKILESQIET
FT                   GTPYMLYKDAANRKSNQKNLGTIRSSNLCTEIMEYTSPDEVAVCNLASIALPMFVKNGA
FT                   FDHKELFRITKRVTKNLNKVIDRNYYPVKEAENSNFRHRPVGLGIQGLADAFIMLRMPF
FT                   TSDEAKTLNQEIFETLYFAAVTASMELAIEEGPYSSYEGSPISKGEFQYNLWGIKDEEL
FT                   SGRWDWAGLRQKVLENGVRNSLLVAPMPTASTSQILGNNEAFEPYTSNIYTRRVLSGEF
FT                   IVVNKHLLEDLVNLGLWNNDLKNAIMRANGSIQNIDGIPQDLKELYKTVYELSMKDIID
FT                   MSRHRGYFIDQSQSLNLFMENANYAKLTSMHFYAWKNGLKTGMYYLRTKAAVDAIKFTV
FT                   EKAKKAEPQPQQQEVAAKAAETLQQAKTQLEPQAQTVQAPEVAKTQPVLFDNVSNTENT
FT                   EELSPEELKAIIQQSKDAQGDDCLMCGS"
FT   gene            508699..509058
FT                   /locus_tag="CA2559_02085"
FT   CDS_pept        508699..509058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02085"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87506"
FT                   /db_xref="GOA:A3U5I9"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5I9"
FT                   /protein_id="EAP87506.1"
FT                   /translation="MAQHNELGKEGEKLAVRFLSDKGYTILETNYRYLKAEIDIIARIG
FT                   NVICVVEVKTRSTSEFGNPQEFVKPKQIGLLVSAINNYIEDIEDDVEIRFDIVAIVKNK
FT                   LGTTVEHLEDAFMHF"
FT   gene            complement(509110..510252)
FT                   /locus_tag="CA2559_02090"
FT   CDS_pept        complement(509110..510252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02090"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87507"
FT                   /db_xref="GOA:A3U5J0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5J0"
FT                   /protein_id="EAP87507.1"
FT                   /translation="MLQNQSHLFNLPKDITYLNGAYMSPQLKSVSEVGVDMVHLKEQPF
FT                   NVTSEHFFDARTTLRKRFAELISADNYEHTAIIPSVSYGMANVAQNCNLKRDDEVILIN
FT                   EQFPSNVYVWQHEAKKVGAKIVSIKAPDTFINRGKLWNDSILKSITKKTKVVSLAHSHW
FT                   ADGTLFNLKTIREATHSVGAKLVVDGTQSVGALPFSIKEFNVDALICGGYKWLLGPYGL
FT                   GMAYYADSLCNGNPIEHNWMNRLGSEDFTNLVNYQEHFQPKAGRFSVGESSNFILTPML
FT                   TTALEQLLSWKPQHIQDYCNSISSEAVNTLRSKGCFIEDDAYRSHHLFGIYLPKHMDLN
FT                   VLKKRLEDAKVIVSYRGNAIRVSPHVYNTTEDFERLVAQF"
FT   gene            complement(510275..510631)
FT                   /locus_tag="CA2559_02095"
FT   CDS_pept        complement(510275..510631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02095"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87508"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5J1"
FT                   /protein_id="EAP87508.1"
FT                   /translation="MARDEELKQRWQQVVDKLSAQFADGEVLDLDAIIYLIGVQELGKP
FT                   HDKYKKDHKIDLMHIAICRLLEPYGYYEFEFFDDDGWPHYKVLDQLPNLKAGEQSVLMK
FT                   EAIVTYFLEKAYIS"
FT   gene            510680..511216
FT                   /locus_tag="CA2559_02100"
FT   CDS_pept        510680..511216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02100"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87509"
FT                   /db_xref="GOA:A3U5J2"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5J2"
FT                   /protein_id="EAP87509.1"
FT                   /translation="MNFIDIILGIFLLLGLVRGFMKGFFVELASLVALIAGIFGAIHFS
FT                   YYASSFIAEHVDWEENYINLAAFAVTFIIIIVIISLAGKLLTKLANIIALGILNKLLGG
FT                   AFGVIKMAFLASVIILFFEAVNSNNSLIEQEKLDSSVLYAPVSKITPLVLPSILKEAKN
FT                   RDILDKDKRYIGEEK"
FT   gene            complement(511311..512963)
FT                   /locus_tag="CA2559_02105"
FT   CDS_pept        complement(511311..512963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02105"
FT                   /product="permease protein of sulfate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02105"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87510"
FT                   /db_xref="GOA:A3U5J3"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5J3"
FT                   /protein_id="EAP87510.1"
FT                   /translation="MITFKHFKGDLFGGLTAGVVALPLALAFGVQSGMGAAAGLYGAIA
FT                   VGIFAAAFGGTQTQASGPTGPMTVVTAALVVAAIELTGSLEAGMGIILATFVFAGLIQI
FT                   VFGFLNIAGYVKYFPYPVISGFMSGIGLIIIILQIFPFVGLDSAKSTIKIMKDLPRLFA
FT                   EFNPQALLLGSITIAVYIIWPKINKAIPTALVALIVATLIGYFFNFDVPLIKDIGEIPS
FT                   FLELKIDTILGIDLNAFSIILEYAFILALLGSIDSLLTSVIADSMTKTKHNSNRELIGQ
FT                   GIGNAIGGLIGGIPGAGATKGTVVNINAGGTTRLSGMIHGLFLLAVLLGLGFLASEIPL
FT                   CVLAGILIPIGFKIIDIKGLKHLLKVPKGDAFVMILVLLMTTFGSLIQAVGIGVALACL
FT                   LFMKKSGDMAERGLTTGTLSDIDDNDSKWKTEGNFYETNKEKILIKRLYGPLFFGFTSY
FT                   FKDEVKRNSKDKSVVIFRMDRVPYIDQSGVYALEDIITDLEGKGIEVLLVGLDTQPRKM
FT                   LEAVGIIPKLIQEQDIFDTIYDCLEYLKLQLSD"
FT   gene            complement(513084..514679)
FT                   /locus_tag="CA2559_02110"
FT   CDS_pept        complement(513084..514679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02110"
FT                   /product="Sulfate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02110"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87511"
FT                   /db_xref="GOA:A3U5J4"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5J4"
FT                   /protein_id="EAP87511.1"
FT                   /translation="MFKNLKHDFPASVVVFFVAIPLCLGIALASGAPLFSGLIAGIIGG
FT                   IVVGAISGSSLGVSGPAAGLAAIVLAAIASLGSYENFLVAVVLGGAIQIVFGLLKGGII
FT                   GYYFPSSVIKGMLTGIGIIIVLKQIPHFFGYDADPEGDWAFLQMDGENTFSELGNIIGN
FT                   ISPGATLIAVIAMVILILWEAVLSKKGKIFQLVQGPLVAVFAGIVYFVATQDISGWSIS
FT                   QEHLVSVPIPDDFDSFLGQFTFPNFGVIGNPDVWITAFTIALVASLETLLCVEATDKLD
FT                   PKKRTTPTNRELFAQGTGNMISGLIGGLPITQVIVRSSANIQSGGQTKLSAILHGFLLL
FT                   ISVILIPNILNLIPLSVLAAILFLVGYKLAKPSTFKRMFVLGWKQFVPFIVTVIGIVFG
FT                   DLLIGISLGLAIGIVVIVIKSYQNSHFLHIEEPSNGKNHVKMTLAEEVTFINKGAILKE
FT                   LNNLESNSFLEIDTRKAKYLDHDIIEILDDFKFRAEERNIHIKIISERGITENPESYEQ
FT                   FFNQEKKQPFRRGA"
FT   gene            complement(514791..515072)
FT                   /locus_tag="CA2559_02115"
FT   CDS_pept        complement(514791..515072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02115"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87512"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5J5"
FT                   /protein_id="EAP87512.1"
FT                   /translation="MIKFKAFIFLIGFLAFTIVPTLSLIFDQEVMSVVVIEEENCKNKL
FT                   DFKDYSHSENDVVFKYYDFLDTDKQYFKYNCTFVSVYIDTAYPPPKFS"
FT   gene            complement(515146..515895)
FT                   /locus_tag="CA2559_02120"
FT   CDS_pept        complement(515146..515895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02120"
FT                   /product="BatE, TRP domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02120"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87513"
FT                   /db_xref="GOA:A3U5J6"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5J6"
FT                   /protein_id="EAP87513.1"
FT                   /translation="MKFVTIICALFITTVTIAQSESLFKEANQAYANENYEEAISKYQS
FT                   ILKDGYESTSVYYNLGNSHYKLNNVGPSVYYFEKALKLDPNDADVTNNLAYARQMTIDA
FT                   IDEVPKTGVSKIVNSVIATLSVNGWAWLAVIASISFVVLILLYYFSRASLKKRLFFIGG
FT                   SLAFLIAICAVVFAYQQQSVLEQKSFGIIFPEEVVVRSEPNSRSEQLFLLHEGTKAKIL
FT                   EDFDSWRKIELADGKQGWLLKTELKAL"
FT   gene            complement(515905..516741)
FT                   /locus_tag="CA2559_02125"
FT   CDS_pept        complement(515905..516741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02125"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87514"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5J7"
FT                   /protein_id="EAP87514.1"
FT                   /translation="MNGAQNTYNLSKIVVVLAMFVSSLGFAKTLKYVCTENGLPLKEVP
FT                   SADAKDVDVLDYGTEVEILDEKGEFSKIRFYRFFEHILGYVLTSELSSEKIDKRIKIQF
FT                   NDAVVYIEDVRLLSKNNTFNAEDKVTVKVSYGDSPFNKWVRVQPERNVNVKVYQRVEKS
FT                   LVVFDEQPFCDLSGSYTFKSDWRLMPPLLEDNTFTSLKDEVEDETFKEKISVAEIKDDL
FT                   RRLCSQKVANMINPFKTLTENGIGIKSQNVWYKVVLTDENGKTTEKIIEFNLMVGC"
FT   gene            complement(516746..518515)
FT                   /locus_tag="CA2559_02130"
FT   CDS_pept        complement(516746..518515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02130"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87515"
FT                   /db_xref="GOA:A3U5J8"
FT                   /db_xref="InterPro:IPR025738"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5J8"
FT                   /protein_id="EAP87515.1"
FT                   /translation="MQLKHVLLICLVLIGANTFAQISFEASVSKTKLGVNERLSVEFTM
FT                   NKDGDNFNPPEFTGFRKVGGPYQSVSQSWINGKSTYKKSYKYFLEPTATGNFTIQQAVI
FT                   DIEGTTYKTTPIKITVTNAVENPTDGNNASVVADDNIHLVAEVSKTNPYLNEGVTVTYK
FT                   LYVSPSTSVSNWREIASPKYADFWSQSIDIKQLKVQNGTYQGEQYRYVTLRKTVLYPQK
FT                   SGKLEIEPLSLSIDVDVPSNRRDIFGGRLFETVKKNVSAGKRIIDVKPLPTEGKPSNFT
FT                   NAVGKFNFEVTTNKTELEATESLDAVVKISGNGNLSMFNFPELVVPSSLEVFEPQRKER
FT                   VSTTVNGMRGSVEETYTIIPNYKGKYPISPISFSYFDLETETYKTITSKEIVIDVLSGP
FT                   ENTGNATATGVTSGNNKQAVVTTGTPFRFIKQNANLKPIGDQAFFKSIGFWILLLGPLA
FT                   LIPLAIIFGKKREERANDVRGNRIRKADKLARKYLSDAKKKLGDQKPFYESLERALHNY
FT                   LKAKLNIQTSEMSKDRIQRLLKERGADEAPSIEYISLLENCEFARYTPSSNTAMQQDYD
FT                   KASRVISQIDKQM"
FT   gene            complement(518515..519414)
FT                   /locus_tag="CA2559_02135"
FT   CDS_pept        complement(518515..519414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02135"
FT                   /product="aerotolerance-related exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02135"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87516"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5J9"
FT                   /protein_id="EAP87516.1"
FT                   /translation="MKTKHNVSLILSLLCALVFTITTQAQQKTKEQLKQEQEAQDLLNE
FT                   AQDYLAEDNFPLAEASYRKAIAKNPNNHEAKYNLGNLYYTKDKVSEAGEKYVTAETASE
FT                   EKELKHKSAHNLGNTFMRDKKYAKAVEAYKQALRNNPNDDETRYNLALAKSLLEKEQKD
FT                   GGGGNDDKKNEEQNKDKDKQDDQEKKEGDQGEKDKDDKGEESEDGNEGDDKENKEDQGN
FT                   KDESEEGKPKDDKQGDGKNNDGKEKKEQQQPQQGKGQLSPQQIQNLLETMANQEAKVQE
FT                   KLNAKKAKAAKVKTEKDW"
FT   gene            complement(519475..520080)
FT                   /locus_tag="CA2559_02140"
FT   CDS_pept        complement(519475..520080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02140"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87517"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5K0"
FT                   /protein_id="EAP87517.1"
FT                   /translation="MKHIITYVILLAATLTGYSQNAKKEIETDFNTYLTAIINKEFETA
FT                   IEYTAEGIFELIPREQLLVAMQSAFNSESMNLRFDNTNIKDINEPELINEKYYATLSYS
FT                   NDMYIGFVDNSVEDSEDEELQEKKELQQSMMLVSFYKNFGEENVTYLEDKDQYKISVQK
FT                   RVIAESPNGITNWKFIVVEKNMKPILEMFLPSEIIEKL"
FT   gene            complement(520085..521125)
FT                   /locus_tag="CA2559_02145"
FT   CDS_pept        complement(520085..521125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02145"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87518"
FT                   /db_xref="GOA:A3U5K1"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR024163"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5K1"
FT                   /protein_id="EAP87518.1"
FT                   /translation="MVLEEHIYFWLLAIVPVLLLLLIAALIWKKRKQSQFADKDLLKKL
FT                   SPNQSVFKTILKIVVLCLAIACLTIALVNPKIGTKLETVKREGVDVVFAIDVSKSMLAE
FT                   DVAPNRLEKSQQLVTQIINSLASDRVGIIAYAGSAFPQLPITTDYASAKMFLQNMNTDM
FT                   LSSQGTAINEAIQLAKTYYNDDEQTNRVLFIISDGEDHEGDSVNIAEEASEEGIRIFTI
FT                   GVGTTKGGRIPIKRNGVVLNYKKDQNDQTVITRLQEETLKDIAKEANGEYIYNNITKET
FT                   VEKVTEILQNMDKKEFEAKQFADFKDQFQWFLGFGIFFLVLEVFLLERRTSWLKKLNLF
FT                   NEKQID"
FT   gene            complement(521126..522130)
FT                   /locus_tag="CA2559_02150"
FT   CDS_pept        complement(521126..522130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02150"
FT                   /product="aerotolerance-related membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02150"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87519"
FT                   /db_xref="GOA:A3U5K2"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR024163"
FT                   /db_xref="InterPro:IPR033881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5K2"
FT                   /protein_id="EAP87519.1"
FT                   /translation="MLDNFVFENPQWFWLFLIMPVLIAWYIIKRGKQTAELKISTIKGF
FT                   KVKQSWLVNIRPLLFVLRLLALAFLITAMARPRTVDVSTKTKTTKGIDIVMAIDVSASM
FT                   LARDLRPNRLEALKDVASEFIQGRPNDRVGIVLYAGESYTKTPITSDKSIVLGALNDVK
FT                   FSEVLENGTAIGMGLATSVNRLKDSKALSKVIILLTDGVNNSGTIDPKLASELAVEYGI
FT                   KTYTIGIGSNGMALSPIGIKSNGQFQYGNQKVEIDEDLLKQIATVTGGQYFRATNNQKL
FT                   EAIYEEINKLEKTEVEEFKFYNYKELFRSLVLAALGLIVVEVLLRFTIFRSFV"
FT   gene            complement(522130..523788)
FT                   /locus_tag="CA2559_02155"
FT   CDS_pept        complement(522130..523788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02155"
FT                   /product="putative conserved membrane exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02155"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87520"
FT                   /db_xref="GOA:A3U5K3"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5K3"
FT                   /protein_id="EAP87520.1"
FT                   /translation="MMNENLKMDINKVFSTSVRTLTAIFVSLFAITYSFSQEVNATIDS
FT                   TSIKIGEQITYSIQVETDSTNVVVFPEGQTFAPMEMVESLLADTTRLEKRFRLLKEYRL
FT                   TQFDSGSYTIPQQRVMINDRVILTDSMRVEVADVAVDTTKQKMYPIKPSVEVPSRFQIP
FT                   TWIWWLLLIAMVVASLLFLIFRRQKKKAEAEVKIPPFEKAMLELQALDKSDLLKNQDYK
FT                   NYYSRLTDSARRFIDEKVDDHAMERTTEELIALMEAKKQQGKLDLSQETIKDFKQILMR
FT                   ADLAKFAKMNPDEGVVKADRLRVEVIIKDTKAAIPEPTLEELENTIEFQEAKAKKRKRK
FT                   QIIISVIVGLFVLVVFFVSLIVIKGTDYIKDSFIGHPTKELLQGDWVRSDYGYPSVAIT
FT                   TPKVLVRKDAALPKEVEQVVKDNQLFTYGSLINGFYVYVNTTSFKQEQKEVDKSAIVQA
FT                   NLGMLEQQGANNMFVKEDEFTTANGIKGLKAYGTFTFSKEQGNFTGQKSAFQLLVFNNN
FT                   IGMQQIMVVNGENDEAGEEISNRIINSIELQKSAQ"
FT   gene            complement(523789..524655)
FT                   /locus_tag="CA2559_02160"
FT   CDS_pept        complement(523789..524655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02160"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87521"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5K4"
FT                   /protein_id="EAP87521.1"
FT                   /translation="MNTKDLLKKVRKIEIKTRRLSDHVFGGEYHSTFKGRGMTFSEVRQ
FT                   YQFGDDVRSIDWNVTARYNEPFVKIFEEERELTMVLMVDISGSEFFGTNQAFKKDIIIE
FT                   ISATLAFSATQNNDKIGLLLFSDEIELFIPPKKGRLHVLRIIRELIEFKPQSKKTDITK
FT                   ALKYLSNMLKKKAIVFVLSDFMTDGYEQTMKIVGKKHDVTGIRVYDEKEEAIPNLGMVQ
FT                   MQDEETGELLLVNTGSKTVRVNYAKHYNERVNYFENTFRRSGSGVIHTRTDESYVKKLL
FT                   GYFKRRA"
FT   gene            complement(524781..525782)
FT                   /locus_tag="CA2559_02165"
FT   CDS_pept        complement(524781..525782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02165"
FT                   /product="putative magnesium chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02165"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87522"
FT                   /db_xref="GOA:A3U5K5"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5K5"
FT                   /protein_id="EAP87522.1"
FT                   /translation="MEQNTSIDIASLNEKIEKESAFVDVLSLEMRKVIVGQKHMVERLL
FT                   IGLLGQGHILLEGVPGLAKTLAINTLSKAVHGTFSRIQFTPDLLPADVVGTMIYNMKLN
FT                   DFSIKKGPIFANFVLADEINRAPAKVQSALLEAMQEKQVTIGDETFVLDKPFLVMATQN
FT                   PVEQEGTYPLPEAQVDRFMLKTVIDYPKMDEEQMVMRANLKGSFETVNPVVSIDQILRA
FT                   QQSVKEVYMDEKIEKYILDIIFATRYPEQYNLNDIKPLINFGASPRGSINLANAAKCYA
FT                   FIKRRGYVVPEDVRAVVHDVLRHRIGLTYEAEAENVTSVDLINKIVNEIEVP"
FT   gene            525980..526861
FT                   /locus_tag="CA2559_02170"
FT   CDS_pept        525980..526861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02170"
FT                   /product="oxidoreductase, aldo/keto reductase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02170"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87523"
FT                   /db_xref="GOA:A3U5K6"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5K6"
FT                   /protein_id="EAP87523.1"
FT                   /translation="MLQEKLQFSRIIQGVMNWGAWGAKMSTQQMAEQIEHVLDLGITTF
FT                   DHADIYGGYTTEAEFGKAFKESGVNREDVQLISKLGIQYLSDERPYNRVKHYQYDATYI
FT                   LENTERSLQKLNTNYLDLLLLHRPSPLMDPLEIKGAIERLLTEGKIKSFGVSNFTPSQV
FT                   AMLEKHIKVSGNQIECSITQYEPMLNGVLDDMVTKNILPMAWSPLGSIFKEHTQQTMRV
FT                   QNVLKTLRAKYRTTIDQILIAWLLKHPSGIHPVIGTSKVSHAKAAVKAQEINLDIQDWF
FT                   ELLIASQGHKVP"
FT   gene            complement(526858..527334)
FT                   /locus_tag="CA2559_02175"
FT   CDS_pept        complement(526858..527334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02175"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87524"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5K7"
FT                   /protein_id="EAP87524.1"
FT                   /translation="MFTKEFDIRWSDLDANRHLANSAFINFMSHTRMAYLIENGFGQKE
FT                   MAKYNIGPVIFYEHIFYFREVLQGKPIKVSFEVGGVSEDGSLFKFVHNFYDSNGKNLAT
FT                   CDMLGCWMDLKERKMTTFPKELNHVLENAPKSADFKILTKEDTRAFGKLPKDLD"
FT   gene            complement(527336..528193)
FT                   /locus_tag="CA2559_02180"
FT   CDS_pept        complement(527336..528193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02180"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87525"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5K8"
FT                   /protein_id="EAP87525.1"
FT                   /translation="MKNFILKILGFIINRTAPVFPSWNREFSFKLLCRVKRVGITEKGE
FT                   AFFKKSIKHNFEINNQNVVLHKWGTGKKRLFFVHGWMSNSQRWQPYIDQLDLTEYTAYA
FT                   LDAQGHGLSDGNALNFEIYRKAIAASEKHIGHIHTMVCHSLGSMVTAYAFLVNTNLNVS
FT                   SYVIMGAPSGMDAIFAYFKVMLGLSTKSIQNLLIKVNEVLKLPADRVTMAQFFKLIDKP
FT                   ILVIHETQDKVTPILPIQEGVKQNPDIKTFYTEGLGHNLESDIVVNAVLERIKLINKQP
FT                   QETY"
FT   gene            complement(528232..528822)
FT                   /locus_tag="CA2559_02185"
FT   CDS_pept        complement(528232..528822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02185"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02185"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87526"
FT                   /db_xref="GOA:A3U5K9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5K9"
FT                   /protein_id="EAP87526.1"
FT                   /translation="MRNATATKQKILIESANLFNTQGYKATSISDITKATGLTKGAIYR
FT                   HFESKQDLEQQALRNLSRLLFSNLGSSIKEAKTFKTKFDAIFEFFENYMESPYYEGGCP
FT                   LMNVAVEVDDSNSVLRQQAFNMLAQLRASIKVLFQNGIKNKQVKPDIDIEFYATIVISS
FT                   LEGGIMMSKLERNKKAITHCVKHLEMVIQSVSL"
FT   gene            528925..529335
FT                   /locus_tag="CA2559_02190"
FT   CDS_pept        528925..529335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02190"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87527"
FT                   /db_xref="GOA:A3U5L0"
FT                   /db_xref="InterPro:IPR025962"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5L0"
FT                   /protein_id="EAP87527.1"
FT                   /translation="MDINHQLITGLSCAFILLVLGIIFYKFPPKKINSVYGYRTPRSMT
FT                   NQDTWDSANTFSSIWMIRFAVFTFLVSGASYVLIPEYSALITVIVLVLLVVLILPLTES
FT                   HLKRHYTKSGSPKSVVDEYDLPPTGVTSSEEE"
FT   gene            529411..530256
FT                   /locus_tag="CA2559_02195"
FT   CDS_pept        529411..530256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02195"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87528"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5L1"
FT                   /protein_id="EAP87528.1"
FT                   /translation="MTGFGKSTLQLPTKKISIEIKSLNSKSLDLNARMPNQYREKELDM
FT                   RKLIASSLMRGKVDFSLYIETTSDDTTSAINSEVVKSYMQQLKQVVASDDTELLKMAIK
FT                   MPDALKTVREEIDETEYDSILNTLKEALVEINRFRTDEGKALEDDFNLRISNIKNLLEE
FT                   VIKIDPDRINQVKERLRKGIEELKESVDENRFEQELVYYIEKYDITEEKTRLDNHLSYF
FT                   TETINSADSNGKKLGFISQEIGREINTIGSKSNYAPMQQLVVQMKDELEKIKEQLLNVL
FT                   "
FT   gene            530256..530852
FT                   /locus_tag="CA2559_02200"
FT   CDS_pept        530256..530852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02200"
FT                   /product="guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02200"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87529"
FT                   /db_xref="GOA:A3U5L2"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5L2"
FT                   /protein_id="EAP87529.1"
FT                   /translation="MSKGGKLIVFSAPSGSGKTTIVRHLLKHQSLNLEFSISATSREPR
FT                   FGEQDGVHYYFLDLSEFKRRIKEDEFLEWEEVYRDNFYGTLKSEVERIWDEGKNVIFDI
FT                   DVVGGLDIKEIYPEKTLAVFVKPPSIEELKIRLKKRKTETEDKINMRVAKASIELKTAP
FT                   QFDHIILNDNLDVALTKAYNLVSDFVGADTNTTED"
FT   gene            530852..531442
FT                   /locus_tag="CA2559_02205"
FT   CDS_pept        530852..531442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02205"
FT                   /product="nicotinic acid mononucleotide adenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02205"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87530"
FT                   /db_xref="GOA:A3U5L3"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5L3"
FT                   /protein_id="EAP87530.1"
FT                   /translation="MKTNKNIGLYFGTFNPIHIGHLAIANHMAEFSELDEIWLVVTPHN
FT                   PFKKKSTLLDNHHRLEMVRLATEHYPKLKPSTVEFDLPQPNYTVNTLAVLEEKYPDYMF
FT                   NLIMGEDNLKSLHKWKNYDVILERYGIFVYPRISEGVIEHQFKDHPKITKVKAPIMEIS
FT                   STFIRSSIADKKNIRPLLPEHVWSYADEMNFYR"
FT   gene            complement(531508..532008)
FT                   /locus_tag="CA2559_02210"
FT   CDS_pept        complement(531508..532008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02210"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87531"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5L4"
FT                   /protein_id="EAP87531.1"
FT                   /translation="MGLFSFIKNAGAKVFGIGKTDKEEAAEAAAENAAKIKEANEKAAS
FT                   SMEETVSDLGLEAENLNVTIEGDTATITGKALDQATREKIVLVVGNTAGIAQVDDQMEV
FT                   ENKEPEAQFHTVEKGDSLSKIAKKYYGNAMKYPVIFEANKPMLTDPDKIYPGQVLRIPA
FT                   QED"
FT   gene            complement(532206..533111)
FT                   /locus_tag="CA2559_02215"
FT   CDS_pept        complement(532206..533111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02215"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87532"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5L5"
FT                   /protein_id="EAP87532.1"
FT                   /translation="MLFFVGLVMTSCYVEVVDDQDYEVNNPEPTLTLNQYLQTYELWYL
FT                   DVEQTAGATRVPFLEIAFTLSFQQGDLYANNNLVGIGSRGGGFGIQTGYFDAFQDVLEI
FT                   SHDKDGYHRFQVIEGQANKMILKDLSSGTRYVFYGYQRSTFDYDLVFYNNIHYFLQEYQ
FT                   LWEKTATSANGYVNAFDEENFIQFLPFGQGDNFESSIDAQGTHPNDVVWDYQGHYEVTD
FT                   ISNNGYVKGLYLDYEPMGNEYFEMTIPDDNTIMLFHPASESTYTFRGRGYIEYKLKNNT
FT                   SKKRISKAEFKVLTKDGAST"
FT   gene            533260..534264
FT                   /locus_tag="CA2559_02220"
FT   CDS_pept        533260..534264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02220"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02220"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87533"
FT                   /db_xref="GOA:A3U5L6"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5L6"
FT                   /protein_id="EAP87533.1"
FT                   /translation="MNDEPKFAVIGGGSWATAIVKMLCENLNEVHWYMRSVYAIEHLKK
FT                   MQHNPNYLSSVEFNTEQLKLSNDINEVINAADNLIFAVPSAFIYSELQELTIPLKDKKV
FT                   FSAIKGIVPETGLIVGEHLNETYEIPFDNIGVITGPCHAEEVALERLSYLTVACANEDN
FT                   AKFFAKYLTCDYINVKTSEDVTGTEYAAMLKNIYAIAAGIAHGLGYGDNFQSVLMSNAI
FT                   REMKRFIKKVYKMKRNINDSAYLGDLLVTGYSVFSRNRMFGNMIGKGYTVKSAQMEMSM
FT                   VAEGYYAAKSAYTINQDKKKKRAKTPIIDAVYSILYENKNPKKVFDKLAEKLD"
FT   gene            complement(534266..534730)
FT                   /locus_tag="CA2559_02225"
FT   CDS_pept        complement(534266..534730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02225"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87534"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5L7"
FT                   /protein_id="EAP87534.1"
FT                   /translation="MSKLTREQEELIERFGVIQEQSGFAPASARVNALLTVSDKTSLTF
FT                   DEIRETLQLSKSATSNAINNLLVLGRIGYKTQLGERKRYFYSKLDHWRTMFRKDILGLN
FT                   DHVRVLEDILKARTKDTKSYNHELQDLVKFMEYFITESISLIDSWEPKEK"
FT   gene            534983..537766
FT                   /locus_tag="CA2559_02230"
FT   CDS_pept        534983..537766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02230"
FT                   /product="metalloprotease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02230"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87535"
FT                   /db_xref="GOA:A3U5L8"
FT                   /db_xref="InterPro:IPR001842"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR011096"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5L8"
FT                   /protein_id="EAP87535.1"
FT                   /translation="MKKNYSTQLLTCLLCFVFTLSGIAQDTNSIISTYISAHKKDLKLS
FT                   GAITFHTNSIGNLSNKNYNVAYLQQTFNGIKVSNANATVVLKDNKVISFKHTFINNLET
FT                   KLTGAATAPSLTPNQAGTAALSALGLTDLNHVQLLDFATKEDINALQLSQETLTAPLFY
FT                   EKAANGNYVLTYEIIVKEPTPHWWLSKINVTTGELVSKYDLNISCNFNAPVVTDANPAL
FT                   NTHTTHKHVLNTNAPSVLSKKSTTHSNSYTNIQSDGAIYNAFPLRVETPIHGDRELLIN
FT                   PSLIATQPVDRPIPSPSGWHDLDGVLQTNTNGNNVAAYEDSDNSNSASSAGSLVDGGAT
FT                   LLFDFPLDLTQEPDVYQDATIVNLFVWNNYVHDVFYAYGFDEDNGNFQEEDYDRFTGFD
FT                   IPLVTAHNGDGVAAEAQDGSGLNNANFATPADGGNPRMQMFLWGASPFGEFLNVYFSGD
FT                   FDGLYASTRFPFVDIPRAEDPEVSGSLVVIEDDGAAYTGANGGTAGASPDTDDGCTSIV
FT                   NAAALNGNIAVIRRGVCTFTTKIYNAEDAGAIGVIIVNNVEGEGPANGGGEATEPITIP
FT                   TISISFEDGDPMINALNNGESITGRIIDNGPLADLVMKDGDLDQGIIAHEYGHGISTRL
FT                   VGGRNNSNCLLSLAFEEQMGEGWSDFFALVMTQKLTDTAEQPRGIGTYVLGQDVLGSGI
FT                   RPARYSTDFSVNDYTYEDLGNAEITVPHGIGFIWSTIIWDMYWAFIDEYGFDADMYYGT
FT                   GGNNMALQLVMDGLKLQTCGNVGFVDGRDAILMADEALYDGANECLIRSVFARRGVGAL
FT                   AFQGTAISRMDQVPDFTISDPLGTDCEAVLASQDLNKTLFTVYPNPASHQIHINSNKNS
FT                   GLANVEVYDVNGRKVISKNIDLVNTATLNTAKLETGIYVLQINTDNATYTQKVIIQ"
FT   gene            complement(537831..538226)
FT                   /locus_tag="CA2559_02235"
FT   CDS_pept        complement(537831..538226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02235"
FT                   /product="phenylalanyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02235"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87536"
FT                   /db_xref="GOA:A3U5L9"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5L9"
FT                   /protein_id="EAP87536.1"
FT                   /translation="MKKDITIPESKDIYIAAVLEEHPEYHTKDWNAYIINDGKEPIEMA
FT                   LIVSKGFNDTKITAEFRHQVKLLPAKSYAKIEFLETKVLALNNQFSVTYFKDNKMFEKT
FT                   FLFKANTIKEKYLDKLPVMKLEGILGN"
FT   gene            complement(538239..538406)
FT                   /locus_tag="CA2559_02240"
FT   CDS_pept        complement(538239..538406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02240"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87537"
FT                   /db_xref="GOA:A3U5M0"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5M0"
FT                   /protein_id="EAP87537.1"
FT                   /translation="MKNLVITLLVIAAIVIGILTFISGLIDLILGIVGIAIMTILVFIL
FT                   WGAWKIKSED"
FT   gene            complement(538406..539425)
FT                   /locus_tag="CA2559_02245"
FT   CDS_pept        complement(538406..539425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02245"
FT                   /product="phenylalanyl-tRNA synthetase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02245"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87538"
FT                   /db_xref="GOA:A3U5M1"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5M1"
FT                   /protein_id="EAP87538.1"
FT                   /translation="MLDKIKAYIKEVEAFEAKTEAEIEEFRIKYLGKKGLLNQYFSEFK
FT                   NVANEEKKEFGQAINQWKNAAQDRVNALKDAVESTVDDNGKYGDLSRPGEPIEIGARHP
FT                   ISLVKNRIIEVFSNIGFNVSDGPEIEDDWHNFTALNFTEHHPARDMQDTFFVEKDPDVV
FT                   LRTHTSGVQVRYMENNKPPIRTISPGRVYRNEAISARSHCFFHQVEGLYVDKGVSFADL
FT                   KQTLQYFTTEMFGKSKIRLRPSYFPFTEPSAEVDVYWGLETETDYRMTKGTGWLEIMGC
FT                   GMVDPNVLKNSGIDPEEYSGFAFGMGIDRIALLLHQIPDIRMLSENDVRFLEQFKSVL"
FT   gene            complement(539481..540074)
FT                   /locus_tag="CA2559_02250"
FT   CDS_pept        complement(539481..540074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02250"
FT                   /product="acetyltransferase, GNAT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02250"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87539"
FT                   /db_xref="GOA:A3U5M2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5M2"
FT                   /protein_id="EAP87539.1"
FT                   /translation="MDFNAEIILEDVRVKLSPLSKKATKHLLQYSLNEPETWTYSLQQP
FT                   NSESALETYIQTALQAKKEEKAYPFIVTDKRDNSIAGSTRLYDINRYHKTCSLGYTWYG
FT                   KAYRGTGLNTHCKYLLLKFIFETLHFERVEFRADYNNARSIKAMKNIGATVEGVLRNNC
FT                   TAPNGRRDSIVLSILSNEWFEEVQPMLLNRLNTE"
FT   gene            complement(540074..540772)
FT                   /locus_tag="CA2559_02255"
FT   CDS_pept        complement(540074..540772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02255"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87540"
FT                   /db_xref="GOA:A3U5M3"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5M3"
FT                   /protein_id="EAP87540.1"
FT                   /translation="MAQQLVSRILLQLEFPKDSGPVYTETLPGSFPVEPFNTFSNIIFL
FT                   AIVIYFGVKIYNSNQTHKFLGYWVLPILFIGYVGGTLYHGLRSHEAWLLMDYVPILVLT
FT                   VSAVFYFIFKFSKSWWRRLLLAAFFVGGSFGLRFLPFPVRYTESIGYIITAVSVLLPIC
FT                   LYLFKVNFKHGVWVALSAFTFALAVMFRISDRFEFLSMGTHWLWHLAGGTAVFFMFNFI
FT                   YLDRHQNVNY"
FT   gene            complement(540847..541491)
FT                   /locus_tag="CA2559_02260"
FT   CDS_pept        complement(540847..541491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02260"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87541"
FT                   /db_xref="GOA:A3U5M4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5M4"
FT                   /protein_id="EAP87541.1"
FT                   /translation="MNKPITIQNHNFTLHPSGAMYWHEREMLLISDVHLGKVSHFRKHG
FT                   SAVPKKAIAKNFEKLQDVIQSFAPKIICFLGDLFHSNLNTEWKLFEQWTSTQTAAIVLV
FT                   VGNHDIISPDRYEELGVKLVSEWVLDGFLLTHIPEERDALYNFSGHIHPGIKLRGIGRQ
FT                   FLKLPAFFQRKCQLILPAFGEFTGNYIMTPDKDDVVFAVTPEEVILVNTQE"
FT   gene            complement(541622..544084)
FT                   /locus_tag="CA2559_02265"
FT   CDS_pept        complement(541622..544084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02265"
FT                   /product="Helicase, C-terminal:DEAD/DEAH box helicase,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02265"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87542"
FT                   /db_xref="GOA:A3U5M5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5M5"
FT                   /protein_id="EAP87542.1"
FT                   /translation="MNRKELLLVAEQWFKDQGWSPFPFQKQTWQAFLKGQHGLLNAPTG
FT                   SGKTYALWFPILLNYIKNNSEYKTKHKKGLKAIWITPLRSLSQEIKQASERVINGLDLP
FT                   LTVGIRTGDTSPKDRAKQKRAMPDLLITTPESLQLLLSSKGYDKVFKDCSAIVVDEWHE
FT                   LLGTKRGVQMELALSRLKTVASTLRIWGISATIGNLDQAREVLLGPQTMAFQNSVLIKA
FT                   NINKKIVVKSIIPDKMETFPWRGHLGLHLLDEVIPILKASKSTLLFTNTRSQCEIWFQR
FT                   ILEKHPEFAGEMAMHHGSINKDTRLWVEDAIRNETLKAVVCTSSLDLGVDFAPVETIIQ
FT                   IGGPKGVARFLQRAGRSGHQPGKTSVIHFLPTHAMELVEASALQKAVKTKAVEDRLPYL
FT                   LSYDVLLQHLTTLAVSNGFLPKDIYPEIASTFCFQGLTQEDFQWLCNYLVMGAQSLQAY
FT                   DEYKKVEVEDNGLFKVNNKGVAMRHRLQIGTIVGDANLTVKYQTGGYIGMVEEYFASKL
FT                   TRGDVFTFAGRNLEFIRIKGMQVHVKNSNKRTNRVPAWMGGRLTFSAQMSELLRNELYL
FT                   AATNSNKQSRELKSLAHIFKQQRKESCIPKDNQFLIETFKTREGYHNVFYPFEGRFVHE
FT                   AMGSLLAYRISLLSPITFSLAFNDYGFEILSDKEVDINEVIDNNLFTSEYLLDDLQNSL
FT                   NATEMARRKFRDIAVISGMVFTGYPNRSVKMKHLQSNSQLLFDVFRDYEADNLLFQQAF
FT                   RETFEHSLEEGRLREALERIKLQQIVWKPCSKPTPFSFPIITDRLREKLSSEKLADRIK
FT                   RMIATLSK"
FT   gene            complement(544098..545690)
FT                   /locus_tag="CA2559_02270"
FT   CDS_pept        complement(544098..545690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02270"
FT                   /product="DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02270"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87543"
FT                   /db_xref="GOA:A3U5M6"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR026333"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5M6"
FT                   /protein_id="EAP87543.1"
FT                   /translation="MKQFASLIKTLDSTNKTTKKVEALTQYFKTANAKDKLWTIAILSH
FT                   RRPPRPVNTTLLRQWASELSGIPLWLFEESYHIVGDLAETIALVIPNAEEDSEKPLSQF
FT                   LEEIVALKPRSEEEKKEYVVENWTSLNYYERFVFCKLITGSFRIGVSQKLMTRALSKAT
FT                   EIDEDILAYKLMGDWTPKSTTFQELILEENEEDYLSKPYPFYLAYAIEGEPKDLGNVKD
FT                   WSAEHKWDGIRSQVIIRNDELFVWSRGEELVTDKYPEFKVFTEAIPNGTVIDGELLPFP
FT                   NGEIGSFNDMQKRIGRKTVSKALLKKVPVILKAYDLLEWQGEDLRSKPFIERRKVLETL
FT                   VNYVQTETLPLQLSERMSFSSWEEMAKERETSRDKKSEGLMLKRLDSPYLVGRKKGDWW
FT                   KWKVDPLTIDGVLTYAMRGHGRRSNLFTDYTFGLWNDDKTELVTFAKAYSGLTDAEFRK
FT                   VDAWIKKNTIERFGPVRSVKPHHVFEIAFEGIAESKRHKSGVATRFPRILRWRQDKPLE
FT                   EANTLEDLKRLIP"
FT   gene            complement(545687..546730)
FT                   /locus_tag="CA2559_02275"
FT   CDS_pept        complement(545687..546730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02275"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87544"
FT                   /db_xref="InterPro:IPR026360"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5M7"
FT                   /protein_id="EAP87544.1"
FT                   /translation="MINFSQMPKQPLLQFNSKGIYCAAAKVYLDPWKPVDKAIISHGHA
FT                   DHSRWGHKQYITHTSNVAIIKHRLGQDINVSGVKWGEQFVINNVKFSLFPAGHIIGSSQ
FT                   IRVEHKGEVWVFTGDYKTEDDGIAVPYEPIKCHSFITECTFGLPAFKWLPQKQVFNDIN
FT                   NWWQDNQDNGQTSVLFGYSLGKAQRLLKHLDPSIGKIFTHAAIENMTEVVRPLVHMPET
FT                   IRITRDTKKEDLKGQMVLAPPSAHGSPWIKKMVPYVTGSASGWMTFRGARRRRAIDKGF
FT                   VLSDHCDWQGLLSSIQATGAEKIICTHGYTDIFSRFLQEQGYDARTESTQFEGELAELE
FT                   TQKEEAS"
FT   gene            complement(546821..548350)
FT                   /locus_tag="CA2559_02280"
FT   CDS_pept        complement(546821..548350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02280"
FT                   /product="sensory box sensor histidine kinase/response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02280"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87545"
FT                   /db_xref="GOA:A3U5M8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5M8"
FT                   /protein_id="EAP87545.1"
FT                   /translation="MTNSTSIYSRINTQEVFCDLEGKIIDFNNNIFNFKKGDNIFESHP
FT                   FFESIAAVIMDNPNTIDSFPCVHLDINQQDRICDVSFKKEAHQLTVTLIDYTEPYKELN
FT                   TIAQERNESIIAKQMLVLKNQQLEQQNRFKNKFLANISHEIRTPLTAIVGFSELLKKTN
FT                   LNFEQLGLLDVITNASEQLTATINDMLDIAKIELGELKISNEEINLKEVILDIAKVYKE
FT                   KAKSKGINFSVEYDEEILSNTIGDKLRIQQVLGNLLENAIKFTNVGNVSLVVKKSFQRA
FT                   NKIGVDFYVEDTGQGIPEDHLRSVFESFHQVNASEKQKGTGLGLAITKTLVEALEGKIQ
FT                   VESELGKGSQFRVYLPFKLNLRTSPKTIGKSIETSVFKDNKKYNLLLVDNSEINQLLVV
FT                   KSLLNHGGFYVDVAQDGEKALQYIQVRDYDIILMDLKMPNLDGFETTRAIRSLKDRDLK
FT                   KIPIVALTAFASQDQKKACLKAGMNAYISKPFKQEELISVVEKIFLKANNK"
FT   gene            complement(548347..548832)
FT                   /locus_tag="CA2559_02285"
FT   CDS_pept        complement(548347..548832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02285"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87546"
FT                   /db_xref="GOA:A3U5M9"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5M9"
FT                   /protein_id="EAP87546.1"
FT                   /translation="MSSAKKIVILGQFGVGKTSLTRRFVDQAFSEDYLVTLGVQIKKKT
FT                   LTLKNGDELSLIIWDIEGTRSVKDTRASYLLGSQAIIYVFDVTRIETYENLAEEIEILK
FT                   QHNIPIKVLANKSDLADIKSVLKYVKEHNLDINYFTSAKSGKNVDKAFNELANELGV"
FT   gene            complement(548825..549631)
FT                   /locus_tag="CA2559_02290"
FT   CDS_pept        complement(548825..549631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02290"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87547"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5N0"
FT                   /protein_id="EAP87547.1"
FT                   /translation="MVNESDKLKLLKELLLTDDTTFANRISERINHLENHLNDNDRLSK
FT                   NVKPIIEEELEHFVKEMPKTLGPTITKTLKAEIKNSKDEVVEALFPILGKMIKKYVAHE
FT                   MELLKESINSKTKSIFSFASFKRKAKSKITGISEEDLIVSELANPKIEEVFVIEKGSGI
FT                   VEGHYSINQHIDKDMVSGMITAIKSFVEDAFSGKAENLEAISYELYTIHIQNFHKKYIA
FT                   VVVSGSYTIMYREVLEDKLLDFYEALSKNKADKTCDNILEEFFEDE"
FT   gene            complement(549649..550002)
FT                   /locus_tag="CA2559_02295"
FT   CDS_pept        complement(549649..550002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02295"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02295"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87548"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5N1"
FT                   /protein_id="EAP87548.1"
FT                   /translation="MSKKETTTDQNGIIDSTSKLEAIKNLIFGENIQQYDSEFEALKKD
FT                   IDAKREALQNYVDETRDELMKSIDSLSTDVNIRITELESTLEDKAEDLQAKKVDKDTLG
FT                   DLLISLGEKIQKK"
FT   gene            complement(550085..551104)
FT                   /locus_tag="CA2559_02300"
FT   CDS_pept        complement(550085..551104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02300"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02300"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87549"
FT                   /db_xref="GOA:A3U5N2"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5N2"
FT                   /protein_id="EAP87549.1"
FT                   /translation="MNKTFQTLGEFIIENQSEFAYSSGELSRLINSIRLAAKVVNHEVN
FT                   KAGLVDITGAAGDTNIQGEDQQKLDVYANERFIQTLTNREIVCGIASEENDDFITIEGH
FT                   NEDHQNKYVVLIDPLDGSSNIDVNVSVGTIFSIYRRVTKSGTPVTIDDFLQKGNQQVAA
FT                   GYIVYGTSTMIVYTTGHGVNGFTLNPAIGTYYLSHPNMKFPEDGHIYSINEGNYIQFPQ
FT                   GVKDYIKYCQEETEDGERPYTSRYIGSLVSDIHRNMIKGGIYIYPETSKAPNGKLRLLY
FT                   ECNPMAFLAEQAGGKASNGYQRIMDIQPTELHQRVPFFCGSKNMVTKAEEFMAKSSKP"
FT   gene            551209..551694
FT                   /locus_tag="CA2559_02305"
FT   CDS_pept        551209..551694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02305"
FT                   /product="N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02305"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87550"
FT                   /db_xref="GOA:A3U5N3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5N3"
FT                   /protein_id="EAP87550.1"
FT                   /translation="MNSKNITIELATKDDMPFVLELIQELATFEREPGAVDITVDDLIN
FT                   DGFGKQPLFTCFVARVNNIIEGMALVYFRYSTWKGKTLHLEDLVVRASKRGTGLGNALF
FT                   KQVISYAKQEGVGRAEWVVLDWNTNAIKFYERSGATILKDWHLVQMNKEQLNNYTTN"
FT   gene            551708..552961
FT                   /locus_tag="CA2559_02310"
FT   CDS_pept        551708..552961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02310"
FT                   /product="lysine-sensitive aspartokinase III (aspartate
FT                   kinase III)"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02310"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87551"
FT                   /db_xref="GOA:A3U5N4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5N4"
FT                   /protein_id="EAP87551.1"
FT                   /translation="MNIFKFGGASVKDAEGVKNVVEVLKVTGHKQKVVVVSAMGKTTNA
FT                   LERVISCYFNKESQLSQEINDLEMYHQVILDQLFSNRSHEVYSKVSAFFSDLKRFLKHN
FT                   KSPKYDFVYDQVVGYGELISTTIISNYLQDIGLENQWLDVRSCIQTDSTYRDAKVNWET
FT                   SQEAIQAQVNKSSLTITQGFIGADDNNYTTTLGREGSDYTAGIFAYCLNAESVTIWKDV
FT                   QGVLNGDPREFENTTLLEQISYEEAIELAFYGASVIHPKTLQPLQRKEIPLYVKSFLNP
FT                   TTQGTAVSKGQTLVPHTPCFIVKKNQVLISLSSLDFSFIVEDNISEIFSLFHKYQMKVD
FT                   LIQNSAISFSVCVDNKFRQLNNLINHLKAKFKVSFTEGVSLYTIRHFDDVAVKRIEGQF
FT                   DVLLKQVATETVQLVVKA"
FT   gene            552998..554815
FT                   /locus_tag="CA2559_02315"
FT   CDS_pept        552998..554815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02315"
FT                   /product="putative hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02315"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87552"
FT                   /db_xref="GOA:A3U5N5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5N5"
FT                   /protein_id="EAP87552.1"
FT                   /translation="MPIVSANEIAKVLKLDKLGLLGNTIGSVLLKATKLSKINAIYETR
FT                   KDLNGVQFIDSILKTLEVEFDIPEEDLKRIPKTGAFITVSNHPLGGIDGLILMKLLLAK
FT                   REDYRIIANFLLHRLEPVKPYIMPVNPFEDHKEAKSSVGGLKEALSHLRDGKPLGMFPA
FT                   GEVSTYKEDSVIADKPWEPSAMKLVQKANVPIIPIYFKAKNSALFYRLSKLSPTLRTAK
FT                   LPGEMLSQKHRKIQVRIGHPISAKDQLEYKTLEGFTAYIRKRTYLLDNSFDKKNILDQI
FT                   PKQIKRTKAPKKIVGETPDDLMQKEVEFCRANDKRLLESKNYEVFLAKKEIIPNIVQEI
FT                   GRLREITFRAIGEGTNKSIDTDKYDEYYHHLFLWDNDAQKVAGAYRMGLGKEIFRDYGI
FT                   EGFYMNELFRFEPEITTLISESIEMGRAFIIAEYQLKPMPLFLLWKGIVHTTLRYPEHN
FT                   YLIGGVSISNNFSNFSKSLMIEFMKSHYYDPYFAQFVRPKKEFKVKLKDADKDFVFDAS
FT                   EADLNKFDKIIDEIEPGNNRLPVLLKKYIKQNARLLSFNVDPLFNNSVDGLMYIKIADL
FT                   PESTVKPVMEEFQAEMEKKYAIYKAEENK"
FT   gene            complement(554926..555099)
FT                   /locus_tag="CA2559_02320"
FT   CDS_pept        complement(554926..555099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02320"
FT                   /product="riboflavin synthase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02320"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87553"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5N6"
FT                   /protein_id="EAP87553.1"
FT                   /translation="MPMLVSIGTGKPGKGVKELGGGGPSLGLAAMAEQSSVVKLNNVLI
FT                   VWGLINNTCCKR"
FT   gene            complement(555140..555736)
FT                   /locus_tag="CA2559_02325"
FT   CDS_pept        complement(555140..555736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02325"
FT                   /product="riboflavin synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02325"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87554"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5N7"
FT                   /protein_id="EAP87554.1"
FT                   /translation="MFTGIVEELGRVKDLTKDGDNLHIFIEAHMSSELKIDQSVAHNGV
FT                   CLTVVAVTDNTYSVTAIQETLNKSNLGSLKVNDLVNLERGMKLGARLDGHIVQGHVDQV
FT                   AECILAQEKDGSWEYRFKYDPALNNVTIEKGSITINGVSLTVVDSEINTFSVAIIPYTY
FT                   EHTTFKQLQKGDVVNLEFDVIGKYVKRLLGNTSLS"
FT   gene            555785..556840
FT                   /locus_tag="CA2559_02330"
FT   CDS_pept        555785..556840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02330"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02330"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87555"
FT                   /db_xref="GOA:A3U5N8"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5N8"
FT                   /protein_id="EAP87555.1"
FT                   /translation="MTQKQQLKIGISIGDLNGIGAEVVLKTFEDERILEFCTPVIFANS
FT                   KVLSFIKKHLNIDLQFQGISDLNKIIDGKVNVYNVWKENVNINFGTPDTKVGSYALKSL
FT                   EAATEALKNKQVDILVTAPINKNTIQSEAFNFPGHTDYLAKELQGDSLMFMVSDSLRVG
FT                   LLTDHVAVKNVASTITPQLIEKKVNSIYHSLEEDFRIRQPKIAVLGINPHSGDNGVIGK
FT                   EDEEVLKPTLKNINNNGKLVYGPYSADSFFGSQNYKNFDAVIAAYHDQGLIPFKTLSFG
FT                   NGVNYTAGLSRVRTSPDHGTAFEIAGKGQADETSFKQAVFTGMQIFKNRKEYKELTKNP
FT                   LKKQPRRKERK"
FT   gene            556950..557477
FT                   /locus_tag="CA2559_02335"
FT   CDS_pept        556950..557477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02335"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87556"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5N9"
FT                   /protein_id="EAP87556.1"
FT                   /translation="MKQLKEFTIPFVGLKVGKHQFNYTIGQSFFDVFEYDEFNDANVNV
FT                   TLDFEKKPTMFELLFHISGTVNVNGDLTNEPYDQPIENELKLVVKFGPEFNDENEELLI
FT                   LPHGEYEINVQQYIYEAIVLAVPLKRIHPGIEDGTLKTDVLKKLEELSPKQKENEEVDP
FT                   RWNKLKELLKDK"
FT   gene            557487..557684
FT                   /locus_tag="CA2559_02340"
FT   CDS_pept        557487..557684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02340"
FT                   /product="50S ribosomal protein L32 (Ribosomal protein I)"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02340"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87557"
FT                   /db_xref="GOA:A3U5P0"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5P0"
FT                   /protein_id="EAP87557.1"
FT                   /translation="MAHPKRKISKTRRDKRRTHYKAKAPTLAKDPVTGETHLFHRAHWH
FT                   EGKLYYRGQVLIDNTTEVEA"
FT   gene            557852..558847
FT                   /locus_tag="CA2559_02345"
FT   CDS_pept        557852..558847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02345"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02345"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87558"
FT                   /db_xref="GOA:A3U5P1"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5P1"
FT                   /protein_id="EAP87558.1"
FT                   /translation="MSNITAAITAVGGYVPEYVLSNKVLETMVDTNDEWITTRTGIKER
FT                   RLLKEEGKGTSYLGIKAAEDLIQKIDLDPTTIDLVIFATATPDMPVASSGAYLASQIGA
FT                   KNAFSYDLQAACSSFLYGMSTAASYVQSGRYKKVLLVGADKMSSIIDYTDRATCIIFGD
FT                   GGGAVLFEPNEDGLGLQDEILRSDGIGREFLKIDAGGSILPASEETVANKQHFVQQDGK
FT                   TVFKFAVSNMADVSASIMERNNLTNEDVSWLVAHQANKRIIDATARRMNLDESKVLMNI
FT                   QRYGNTTSATLPLLLHDYEKKLKRGDNLIFASFGGGFTWGSIYLKWAYNS"
FT   gene            558882..559379
FT                   /locus_tag="CA2559_02350"
FT   CDS_pept        558882..559379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02350"
FT                   /product="biotin carboxyl carrier protein of acetyl-CoA
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02350"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87559"
FT                   /db_xref="GOA:A3U5P2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5P2"
FT                   /protein_id="EAP87559.1"
FT                   /translation="MELKDIQNLIKFVAKSGASEVKLEMEDVKITIKTGSDEKETIVQH
FT                   MQMPAQMPQQMAAAPAPAPAQPVAQAAAAAPADSNNGDDSKYITVKSPIIGTFYRKPSP
FT                   DKDLFCEVGDSIKEGDVLCIIEAMKLFNEIESEVSGKIVKVLVDDSSPVEFDQPLFLVD
FT                   PS"
FT   gene            559407..560783
FT                   /locus_tag="CA2559_02355"
FT   CDS_pept        559407..560783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02355"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02355"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87560"
FT                   /db_xref="GOA:A3U5P3"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5P3"
FT                   /protein_id="EAP87560.1"
FT                   /translation="MIISTSNAETVMFKKILIANRGEIALRIIRTCKEMGISTVAVYST
FT                   ADAESLHVKFADEAVCIGPAPSNLSYLKIPNIIAAAEITNADAIHPGYGFLAENSKFSK
FT                   ICEEHDIKFIGASPDMIDKMGDKASARATMQAAGVPCIPGSDGLLKDFAECKKVAKDMG
FT                   YPVMLKATAGGGGKGMRAVWKPEDLEDAWDSARQEAGAAFGNDGMYMEKLIEEPRHIEI
FT                   QVVGDSTGKACHLSERDCSVQRRHQKLTEETPSPFMTTALRKKMGEAAVKAAEYIKYEG
FT                   AGTVEFLVDKHRNFYFMEMNTRIQVEHPITEQVIDFDLIREQILVAAGVPISGKNYTPK
FT                   LHSIECRINAEDPYNGFRPSPGRIEILHAPGGHGVRLDTHVYAGYSIPPNYDSMVAKLI
FT                   TTAQTREEAINKMKRALDEFVIEGVKTTIPFHRQLMDHPDYIAGNYTTKFMEDFKMKEE
FT                   "
FT   gene            560907..562037
FT                   /locus_tag="CA2559_02360"
FT   CDS_pept        560907..562037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02360"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02360"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87561"
FT                   /db_xref="GOA:A3U5P4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5P4"
FT                   /protein_id="EAP87561.1"
FT                   /translation="MEILNSKSYWDRQTWFTTNDFIIIGSGIVGINTALTLREKFPKAT
FT                   ITILERGPWPQGASTKNAGFACLGSISELLKDFKTHSSEDIFKLVEKRVLGLERLRNIV
FT                   GDDHLEYKQLGGYEVFLRKHKALLEKSLDHLNEINDLLYSLYKAPLFSVTENTFGFSGI
FT                   NSKLIVNAFEGQLNTGKMMQALINKTQDANITILNNCNVNEYVEQHTNVLLQTNLGDFK
FT                   TKTLLIATNGFSEQLKISNVKPGRAQVIITKPIKNLNIKGTFHIDEGYFYFRNVGNRLL
FT                   FGGGRNLALKEEETTNFGETELIQSTLDTYLKSHILPKTPYEIDMRWSGILGVGNQKKP
FT                   ILKKVSKNVYCGVRLGGMGVAIGSLVGKDLANLATE"
FT   gene            562034..562732
FT                   /locus_tag="CA2559_02365"
FT   CDS_pept        562034..562732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02365"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02365"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87562"
FT                   /db_xref="GOA:A3U5P5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5P5"
FT                   /protein_id="EAP87562.1"
FT                   /translation="MIKRIFKFFGKILLWFFAMSIIWVALLKFIPVYITPLMVIRYFEN
FT                   NEQNKWTHKWVPLKDISKNLQLAVICSEDQKFVYHNGFDTKAIEKAYEANQKGKKLRGA
FT                   STISQQTAKNVFLWPQRSWTRKGLEVYFTFLIELIWDKERILEVYLNSIEMGDSVYGAS
FT                   AASMYWFGKSAATLSIDEAAAIAAILPNPRRYRANPSSPYVQRQKAWIRQQMYYYGPLI
FT                   LTKTSTETKK"
FT   gene            562775..563266
FT                   /locus_tag="CA2559_02370"
FT   CDS_pept        562775..563266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02370"
FT                   /product="DNA mismatch endonuclease Vsr, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02370"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87563"
FT                   /db_xref="GOA:A3U5P6"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5P6"
FT                   /protein_id="EAP87563.1"
FT                   /translation="MSLHINSKSVNTSMRGNKSKHTKPELLLRKALWASGLRGYRLHFK
FT                   KLAGSPDIVFSTKKIAIFVNGCFWHRCPKCNLNLPKTNTEFWKDKFDTNMKRDQNNYVT
FT                   LIRSNWTVLTIWECDIKKNLKEQVLKIESLIKDVNAYSITTNEPLQLAAEDLLTYGYNI
FT                   "
FT   gene            563250..563717
FT                   /locus_tag="CA2559_02375"
FT   CDS_pept        563250..563717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02375"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87564"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5P7"
FT                   /protein_id="EAP87564.1"
FT                   /translation="MAITSEFKIKLLSHCESLVSTKLEKIKHAIADIVESLESETKSTA
FT                   GDKHETDRAMMDIEREQLGARLDVAEQQYQILKNIRQRDIKPSKNIHIGSLVKTTKAIY
FT                   YIAVSVGAITLDNETVYVISKESPIGMLLMNKTEKDTFEFNGETMTIKSVY"
FT   gene            complement(563714..564628)
FT                   /locus_tag="CA2559_02380"
FT   CDS_pept        complement(563714..564628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02380"
FT                   /product="2-aminoethylphosphonate transport"
FT                   /note="ABC-transporter ATP-binding protein, iron(III)"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02380"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87565"
FT                   /db_xref="GOA:A3U5P8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030287"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5P8"
FT                   /protein_id="EAP87565.1"
FT                   /translation="MLNVNIQAFKYAKTPVLKAINFKLTKGEHISILGESGCGKSTLLE
FT                   LVYGTLQLKAGEIYWNNKKLLGPNFNLVPGEPFIKYVSQDFNLMPYTTVEDNIGKHLSR
FT                   LDMSFRKERIAELLEVVEMTSFKTKKVKTLSGGQQQRVALARALAKEPELLLLDEPFSH
FT                   IDNFRKNKLRRRLYKYLKDKQISCITATHVSEEALSFSDRILVMKDGKFVAQDTPETIY
FT                   KTSQDLYVCSFFDDVFKYKQQVYYPYQITVEELGKHKATVKQSYFKGDFWLIEAVFNND
FT                   NLLLKHNTALPIHTEILINFNDR"
FT   gene            complement(564692..566851)
FT                   /locus_tag="CA2559_02385"
FT   CDS_pept        complement(564692..566851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02385"
FT                   /product="Prolyl endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02385"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87566"
FT                   /db_xref="GOA:A3U5P9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5P9"
FT                   /protein_id="EAP87566.1"
FT                   /translation="MKQLILVTITAATIFSCKTETKTDRTIAVTYPETKKVDTVDVYFG
FT                   NEVKDPYRWLEDDRSKETEDWVKAQNQATFGYLDKIPFREDLKNRLTELWNYEKLGSPF
FT                   KEGEYTYYFKNNGLQNQSVIYRYKSTESPENAKVFLDPNKFSEDGTTSLGGLNFSKDGS
FT                   KAAYSISEGGSDWRKVIVVDAETLERVEDTLQDIKFSGVSWNVNEGFYYSSYDKPKGSE
FT                   LSAKTDQHKLYYHKLGTSQKEDKLIFGGTQEEKRRYVGGSVTEDGKYLIVSGSVSTSGN
FT                   DLRIKDLTKPNSDFKTIISGYETDSYVIENEGSKLYIVTNLNAPNKKIVTVDAENPSPE
FT                   NWVDFIPETEHVLSPSKAGGYFFAEYMVDAVSEVKQYDYAGKLIREVKLPGVGTVGGFG
FT                   AKKEDKELYFSFTNYVTPGSIYKYDIEDGNSELYVKPEIDFNPDHYKSEQVFFNSKDGT
FT                   KIPMIITYKKGTELNGKNPTILYGYGGFNISLTPSFSIANAVWMEQGGIYAVPNLRGGG
FT                   EYGKAWHDAGTKLQKQNVFNDFIAAAEYLIEKNYTSKEYLAIRGGSNGGLLVGATMTQR
FT                   PDLMQVALPAVGVMDMLRYHTFTAGAGWAYDYGTAEDSDEMFQYLKGYSPVHNVKEGVS
FT                   YPATMVTTGDHDDRVVPAHSFKYAAELQDKQAGNAPTLIRIETNAGHGAGTPVSKTIEQ
FT                   YADIFGFTLYNMGYDELPVKKQFKD"
FT   gene            complement(566938..567312)
FT                   /locus_tag="CA2559_02390"
FT   CDS_pept        complement(566938..567312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02390"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87567"
FT                   /db_xref="GOA:A3U5Q0"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Q0"
FT                   /protein_id="EAP87567.1"
FT                   /translation="MNSTFTKIVRYLLALMLLVFGLNKFLKLLPMPELPPSAAEFMTEL
FT                   AATGYVLPVVGAIEIFIGILLLINKWTPFALVLLAPISVNILLFHLFLDLPGIGGALIV
FT                   AILNGILIYKHWSKFRPLFA"
FT   gene            complement(567411..567809)
FT                   /locus_tag="CA2559_02395"
FT   CDS_pept        complement(567411..567809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02395"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87568"
FT                   /db_xref="GOA:A3U5Q1"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Q1"
FT                   /protein_id="EAP87568.1"
FT                   /translation="MKWVNLILRIGLGLMLFMFGLNKFFWFMPDFDFTGYPEADHLFKA
FT                   LRYAGEQATGKGYLMHLVGLSEVVIGVMLVTKKWVPLALAMLVPISINIVLFHAFLNLP
FT                   NIGPAILVAIVNAYLMYKHRDAYKSILT"
FT   gene            complement(567850..568869)
FT                   /locus_tag="CA2559_02400"
FT   CDS_pept        complement(567850..568869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02400"
FT                   /product="Aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02400"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87569"
FT                   /db_xref="GOA:A3U5Q2"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Q2"
FT                   /protein_id="EAP87569.1"
FT                   /translation="MKVAVVGATGMVGRVMIKVLEERKFPISELLPVASKKSIGKKVIY
FT                   NNQPYEVISMEDAIKQRPDIAIFSAGGSTSLEFAPKFADVGTTVIDNSSAWRMHEGVKL
FT                   VVPEINANELTTEDKIIANPNCSTIQLVMVLKPLHDKYGIKRCVVSTYQSITGTGVKAV
FT                   EQLRNELAGEKGEMAYPYPIHKNAIPHCDVFEENGYTKEELKLTREPQKILSDKSIALT
FT                   ATAVRIPVVGGHSESVNLEFNSDFDLNEVRAILSNTEGVKVQDNPDVNTYPMPIYAQGK
FT                   DDVFVGRIRRDHSQSNTLNCWIVSDNLRKGAATNAVQIAEYLLKNNLIKNTSTVSYEV"
FT   gene            complement(569059..569481)
FT                   /locus_tag="CA2559_02405"
FT   CDS_pept        complement(569059..569481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02405"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02405"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87570"
FT                   /db_xref="GOA:A3U5Q3"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Q3"
FT                   /protein_id="EAP87570.1"
FT                   /translation="MGFFSDFKSFLMKGDIVALATAVIVGGAFSKIVGSLVADVIMPVI
FT                   GLLLGGRNVNDLFLVLDGSGTYETIAAAKEAGAAIMTWGNFVQAIIDFVIIGFVIYMLL
FT                   KGYEKTKKKEEAAPAAPKGPSQEELLIEIRDELRKK"
FT   gene            complement(569561..570667)
FT                   /locus_tag="CA2559_02410"
FT   CDS_pept        complement(569561..570667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02410"
FT                   /product="alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02410"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87571"
FT                   /db_xref="GOA:A3U5Q4"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Q4"
FT                   /protein_id="EAP87571.1"
FT                   /translation="MPKAQETVLEINLSALGHNYNYLKSKVNTSVKLMAVVKAFGYGSD
FT                   SVMVAKELQTLGADYFAVAYTSEGVRLRDENITTPILVLHPLANAFKELIERCLEPSIY
FT                   SLKTLREFIATAQTLKQKEYPIHLKFNSGLNRLGFNEKDVPEMYSLLKNTTAVKVTSLM
FT                   SHLVASEDHNLTDFTHNQISSFVSFTEDFKTEFGYMPMRHQSNTSGILNFPEAHFDMVR
FT                   SGIGLYGYGNSSTEDLALKPIATLKSVISQLHNIPKGSSVGYNRGFIADRTTVSATIPL
FT                   GHADGIGRQYGKGKGCFIVNGKKAPILGNVCMDMTMVDVTGIECQEGDEVIIFGAYQNA
FT                   SEFAKGAQTISYEILTSVSQRVKRTFCR"
FT   gene            complement(570676..571320)
FT                   /locus_tag="CA2559_02415"
FT   CDS_pept        complement(570676..571320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02415"
FT                   /product="thymidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02415"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87572"
FT                   /db_xref="GOA:A3U5Q5"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Q5"
FT                   /protein_id="EAP87572.1"
FT                   /translation="MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAKFARQKV
FT                   EIFKPAIDVRYDEDMVVSHDANEIRSTPVPAAANIRLLADGCDVVGIDEAQFFDDEIVA
FT                   VCNDLANKGIRVIVAGLDMDFKGNPFGPMPNLMATAEYVTKVHAVCTRTGNLAQYSFRK
FT                   SENDKLVMLGETEEYEPLSRAAYFKARLREKLKTMPVKEAQELEAKKTPNN"
FT   gene            571396..572205
FT                   /locus_tag="CA2559_02420"
FT   CDS_pept        571396..572205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02420"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87573"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Q6"
FT                   /protein_id="EAP87573.1"
FT                   /translation="MKKALKAELTSLAHQILQLKSTEDIKTLKEMAAKLHDKLTILEFT
FT                   ERHFDGPQPTIGRKDIVQAIENADNDYEITPSEEVIVPLKDNTTSKIEEVREEAQPDLD
FT                   IIKATEKEIKPNTLSQEEVEYQKRQQQLEALEAKNRLMKNDMVDIGGVSYDDLPEFEPI
FT                   GTPEKPSTPKKETAKATQDTKKSKSLNDRLNTGIAIGLNDRLAFIKHLFNGSAGDYNRV
FT                   LSQLNTIESNENAQHFLETVVKPDYKNWEGKELYENRFKEIVEKKFN"
FT   gene            572227..572580
FT                   /locus_tag="CA2559_02425"
FT   CDS_pept        572227..572580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02425"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87574"
FT                   /db_xref="GOA:A3U5Q7"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Q7"
FT                   /protein_id="EAP87574.1"
FT                   /translation="MRIQKIIYWVATALLCALMLYSASFYFLETDTVKGLFESYNYPTY
FT                   IVIPLAIAKVLGVVMILWRRNAWLTSWAYAGFFFDIVLAFFAHQQAGEDTTTTLIALIF
FT                   LLISFFFGKTVRA"
FT   gene            572584..573252
FT                   /locus_tag="CA2559_02430"
FT   CDS_pept        572584..573252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02430"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02430"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87575"
FT                   /db_xref="GOA:A3U5Q8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Q8"
FT                   /protein_id="EAP87575.1"
FT                   /translation="MSKLFLVPTPIGNLEDMTFRAIQTLKDVDFILAEDTRTSGKLLKH
FT                   FEVSTPMHSHHMHNEHKSVVGVVKRIQSGETCALISDAGTPAISDPGFLLTRACIEANL
FT                   DVECLPGATAFVPALVNSGLPNDKFVFEGFLPVKKGRQTRLKLLAEETRTMVFYESPHK
FT                   LVKTLGNFAEYFGADRPVSVSRELSKLYEETIRGTATEVLKHFEEKAPKGEIVIVVAGK
FT                   "
FT   gene            complement(573271..575019)
FT                   /locus_tag="CA2559_02435"
FT   CDS_pept        complement(573271..575019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02435"
FT                   /product="peptidase M1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02435"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87576"
FT                   /db_xref="GOA:A3U5Q9"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Q9"
FT                   /protein_id="EAP87576.1"
FT                   /translation="MRFFIFLITVTAEKHSFIDILSLSIIFVVISKLKARVMTLGFTVN
FT                   RMWVIVFLLVNLTLSAQEFTRQDTLRGSITEERAWWDLKHYDLNVEVFPVSKSISGINT
FT                   LTYTVLSEGNVLQVDLQSPMSLDKVEQNGTPLKVVSEGAAHFITLQEKQEIGEDYNIVL
FT                   TFSGKPQEAKNAPWDGGFSWKKDGNGKPFIATSNQGIGASIWWPNKDHAYDEPDNGMTM
FT                   AFTAPAELTVVGNGRLVKTEDNGNTKTWYWQVVNPINNYGVNINIGDYVNFSEAYDGEK
FT                   GPLDMDYWVLSENLEKAKSQFKQAPKMMEAFEHWFGPYPFYEDSFKLVEVPYLGMEHQS
FT                   SVTYGNNYKNGYLGSDLSGTGWGLKFDFIIIHEAGHEWFANNITHIDVADMWIHESFTA
FT                   YSESLFLDYYYGEEAASEYVIGTRRSIRNDRPLIGTYNVHHEGSGDMYYKGANTLHTLR
FT                   QLVDDDAKWRGILRGLNKEFYHQTISSEQLENYLSEETGINLTQFWDQYLRTTKIPKLE
FT                   YKLDGSKMSFRYTNVVKGFDMPITISVNGNEKWIVPTEEWTTETFPETIKKVVVKKDFY
FT                   IESEKL"
FT   gene            complement(575104..576657)
FT                   /locus_tag="CA2559_02440"
FT   CDS_pept        complement(575104..576657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02440"
FT                   /product="probable piperideine-6-carboxylate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02440"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87577"
FT                   /db_xref="GOA:A3U5R0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5R0"
FT                   /protein_id="EAP87577.1"
FT                   /translation="MSAVATEFGIDEALKQLGINEVNNGTSTGSDWFSSGEEISSYSPV
FT                   DGQLIAKVKTTTKDDYEKVVTTASSAFKTWRKMPAPQRGEVVRQFNEELRRLKEPLGKL
FT                   VSYEMGKSYQEGLGEVQEMIDICDFAVGLSRQLHGLTMHSERPGHRMYEQYHPLGVVGI
FT                   ISAFNFPVAVWAWNTALAWVCGDVCIWKPSEKTPLTGVACQNIAQRVFKENGLPEGISC
FT                   LINGDYKVGEFMTTDKRVPLISATGSTRMGKIVASKVGERLGKSLLELGGNNAIIVTPD
FT                   ADIKMTVIGAVFGAVGTAGQRCTSTRRLIIHDSMYDKVKNAIVDAYGQLKIGNPLDETN
FT                   HVGPLIDKDAVANYNKALERVVEEGGKIIVEGGVLEGEGYESGCYVKPAIAEAQNDFEI
FT                   VQHETFAPVLYLTKYSGDIENAIDLQNSVNQGLSSAIMTNNLREAEHFLSVAGSDCGIA
FT                   NVNIGTSGAEIGGAFGGEKETGGGRESGSDAWKVYMRRQTNTINYTTELPLAQGIKFDL
FT                   "
FT   gene            complement(576727..577266)
FT                   /locus_tag="CA2559_02445"
FT   CDS_pept        complement(576727..577266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02445"
FT                   /product="3-hydroxyanthranilate 3,4-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02445"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87578"
FT                   /db_xref="GOA:A3U5R1"
FT                   /db_xref="InterPro:IPR010329"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5R1"
FT                   /protein_id="EAP87578.1"
FT                   /translation="MAIAKPFNLNKWVEEHREHLKPPVGNKNLYKDAEDYIVMIVAGPN
FT                   ARKDYHYNKTEELFYQLEGHIEVHIQEDGEKKTMKLGPGDMYLHPAGVPHSPVRHENSI
FT                   GLVVERKRKKLNVDDGLLWYCDNCNNKLYEVKFPLNDIEKDFLKHFKEFYGSKEKRTCD
FT                   NCGTVMPVDERFVATE"
FT   gene            577350..578228
FT                   /locus_tag="CA2559_02450"
FT   CDS_pept        577350..578228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02450"
FT                   /product="Glutathione synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02450"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87579"
FT                   /db_xref="GOA:A3U5R2"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5R2"
FT                   /protein_id="EAP87579.1"
FT                   /translation="MNIAILSRSEHLYSTKSLLKAGRSRGHDMEVIDPLACNLTIKSGK
FT                   AVLRYYDDIVNDLDAVIPRIGSSQTATGVSVVRQFEALQVFSTVSSQAILNSRDKWTCF
FT                   QLLVRQQIPTPKTVIGNFYGDAEGLLNQFPDGPIIIKLLEGTHGNGVILAEGRKHALTT
FT                   IETLESLNARFVLQEFIEESKGADLRVIVVDGMVVAAMKRQCAKGDFRSNLHRGGTAKS
FT                   VSLSKAEEQVAIKTAKTLGLGVCGVDILQSKNGPMVLEVNSTPGLEGIEKTTQKSVSKS
FT                   IISYIERHYKL"
FT   gene            578348..578806
FT                   /locus_tag="CA2559_02455"
FT   CDS_pept        578348..578806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02455"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87580"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5R3"
FT                   /protein_id="EAP87580.1"
FT                   /translation="MDKKVIGRVDVVNFPKLNLNEISIKIDTGAYTSSIHCKDIEEVDG
FT                   VLKCKFLDDTHPNYNGKEFSFTNYDVVYVRSSNGQVDVRYSIDSNIKIFNKVYKISLSL
FT                   SSRDDMRYPVLIGRKFLTKKFIVDTEFSNLSFEATSQENTKDVSSEIL"
FT   gene            578859..579731
FT                   /locus_tag="CA2559_02460"
FT   CDS_pept        578859..579731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02460"
FT                   /product="ribosomal protein S6 modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02460"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87581"
FT                   /db_xref="GOA:A3U5R4"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5R4"
FT                   /protein_id="EAP87581.1"
FT                   /translation="MNIKILSRNANLYSTQRLIEACKKRKHDVEVIDPLKCDLIIEKRK
FT                   PTIVYKGRVLEHVDAVIPRVGASITFYGTAVVRQFEMMGAFTTTESQALVRSRDKLRSL
FT                   QLLTKARLGMPKTVFSNYSKDVSQIISHVGGAPVIIKVLEGTQGLGVVLAETEKAAESV
FT                   LEAFNGLQARVIVQEFIKEAKGADIRAFVVDGQVVGAMKRQGKEGEFRSNLHRGGSASI
FT                   IELTDEEEIAAIKAVKVMGLGVAGVDMLQSERGPLILEVNSSPGLEGIETATGKDIAKS
FT                   IVRYIEKNI"
FT   gene            579731..580735
FT                   /locus_tag="CA2559_02465"
FT   CDS_pept        579731..580735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02465"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87582"
FT                   /db_xref="GOA:A3U5R5"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5R5"
FT                   /protein_id="EAP87582.1"
FT                   /translation="MAHIDDQNVLYIFDQTILPGAKATINFNMAKLYTTTNVDVPIIIE
FT                   RSKVPGPTVLITGGIHGDEVNGVEIVRQLISKGINKPKIGTIICVPVLNVFGFLNMNRE
FT                   FPDGRDLNRVFPGFKNGSLASRLAYQFTKNILPVANYCLDFHTGGASRFNAPQIRVKKG
FT                   DAEALDFAKVFNAPFTMYSKTIPKSYRETCGKLNIPILLFEGGKSQDNDKTIAKYGVDG
FT                   SMRILNHLGMLDDKFSVPDVNAPTVIIDSSTWIRAKYSGLLHTKIECGKHVEKGEYIAT
FT                   ITDPYGQFRHKVKTNNEGYIINVNQSPMVYQGDAIFHISTSSQSNEEAEGEDN"
FT   gene            580707..581273
FT                   /locus_tag="CA2559_02470"
FT   CDS_pept        580707..581273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02470"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02470"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87583"
FT                   /db_xref="GOA:A3U5R6"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5R6"
FT                   /protein_id="EAP87583.1"
FT                   /translation="MKKQKARTTNKLRRQNLSVETREELSMRIANKALQLHIWEHSFYH
FT                   IFLAIETQAEINTEYLLHILNGKDKQVVIPKTDFKTRAMKSILLLDNTRLKLNAYNIPE
FT                   PLDGIEITSEQIDVVFIPLLAFDKTGQRAGYGKGFYDAFLALCKPETIKIGLSFFEVEE
FT                   EPFEDVLNTDIPLDYCVTPEKVYSF"
FT   gene            complement(581270..581881)
FT                   /locus_tag="CA2559_02475"
FT   CDS_pept        complement(581270..581881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02475"
FT                   /product="putative signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02475"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87584"
FT                   /db_xref="GOA:A3U5R7"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5R7"
FT                   /protein_id="EAP87584.1"
FT                   /translation="MSLKKASLLILVVLLIDQISKIYIKTNFILGDEVAVLSWFKIRFI
FT                   ENPGMAWGFELPGNYGKLILTLFRIVAIAGIGYWLWDSVKKNGSKVLIASIALIFAGAL
FT                   GNILDSVFYGIVFNDSLHQVATFLPEEGGYSSLFHGKVVDMLYFPLYQGYLPEWVPFWG
FT                   GEYFRFFEPVFNIADSVIFIGVVMLLIFNKKAFPKTEEEA"
FT   gene            complement(581968..582609)
FT                   /locus_tag="CA2559_02480"
FT   CDS_pept        complement(581968..582609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02480"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87585"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5R8"
FT                   /protein_id="EAP87585.1"
FT                   /translation="MIRSIKIYFTVCCFFAILVQQNTFAQKQTEQQIDANEITTILVES
FT                   NEVFKITLKTAKTPFVTIKTTSEGEYYQNISLITELTGEILKVTSKYPQILTSGYDKLS
FT                   AHKVLAMEVILEVPENLSVQIQSNVASVFGEGSFEYLQLELKSGQCVLSNFNGNLLVNT
FT                   YNGNIAVATSPSRVEAESRHGTLINNLDYTGQQLLKLKTIDGNITITKSQ"
FT   gene            complement(582675..583061)
FT                   /locus_tag="CA2559_02485"
FT   CDS_pept        complement(582675..583061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02485"
FT                   /product="DnaK suppressor protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02485"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87586"
FT                   /db_xref="GOA:A3U5R9"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5R9"
FT                   /protein_id="EAP87586.1"
FT                   /translation="MAQTDVKERYSDKHLEEFRAIILEKIESAEHQLKMYEEAYNNLSG
FT                   NGTEDTAPTFKAFDEGSETMSKESNAQLARRQEKFIRDLRNAIVRIENKTYGICRVTGK
FT                   LINPERLKLVPHATLSIEAKNMQQ"
FT   gene            complement(583068..586472)
FT                   /locus_tag="CA2559_02490"
FT   CDS_pept        complement(583068..586472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02490"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02490"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87587"
FT                   /db_xref="GOA:A3U5S0"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5S0"
FT                   /protein_id="EAP87587.1"
FT                   /translation="MSTKFTEYKGLDLPKIASEILDYWKENKIFEKSISSKDDNKPFIF
FT                   FEGPPSANGLPGVHHVLARSIKDIFPRYKSMKGFQVKRKAGWDTHGLPIELGVEKELGI
FT                   TKEDIGTKISVEDYNKACKKAVMRYTDVWNDLTEKMGYWVDMEDPYVTYKSKYMETVWW
FT                   LLSQIYSKGLLYKGYTIQPYSPKAGTGLSSHELNQPGTYQDVSDTTVVAQFKADASTLP
FT                   EELKAYKDNLFFLAWTTTPWTLPSNTALTVGPKIDYVVVKTYNQYTFEPITVIVAKKLV
FT                   AKQFNKRFSAVETEEELSAYKEGDKKIPYLIVSEHKGKDLVGIRYEQLLSYAKPYENPQ
FT                   DAFRVISGDFVTTEDGTGIVHTAPTFGADDALVAKQASPQIPPLLVKDDNDNLVPLVDL
FT                   QGKFTKHMGEFAGKYVKNEYYDEGQAPEKSVDVELAIKLKEENRAFHVEKYVHSYPNCW
FT                   RTDKPILYYPLDSWFIKVTDVKDRMHELNTTINWKPKATGEGRFGNWLANANDWNLSRS
FT                   RYWGIPLPIWRTEDGKEELMIGSVEDLKIEMKKSVEAGIMEKDIFEEFVVGDNSEENYD
FT                   KIDLHKNIVDQIILVSSKGEPMRREADLIDVWFDSGSMPYAQFHYPFENKRLVETTWRK
FT                   ADFIAEGVDQTRGWFYTLHTIATMIFDDVAYKNVVSNGLVLDKNGQKMSKRLGNAVDPF
FT                   ETLSVYGPDATRWYMISNANPWDNLKFDIEGIEEVRRKFFGTLYNTYSFFSLYANLDGF
FT                   TYDENPIPLEQRPEIDRWILSELHSLIKDVDSYYNDYDATRATRAISEFVQENLSNWFV
FT                   RLSRRRYWKGDYETDKISAYQTLFECLLTVSKLGAPVSPFFMDKLYRDLIMASNKEPFE
FT                   SVHLAEFPIADETVIDKSLESKMKKAQIVSSLVLSLRRKEQIRVRQPLQRIMIPVLNDQ
FT                   QRSEILAVADLIKTEVNVKTIELLDDASDILVKQIKPNFKVLGPRFGKDMRFVASAISE
FT                   MNAKEITKIEQEGEISIDVNGNLTKLTLEDVEITSQDIEGWLVANNSGITVALDVTISE
FT                   DLRKEGIAREFVNRIQNLRKDSGYEVSDTIAIKIQKDGKIETAVTDNMEYIKNETLATS
FT                   LDLVEELDNGTVVEFDDVTTKLFIDKN"
FT   gene            complement(586620..588953)
FT                   /locus_tag="CA2559_02495"
FT   CDS_pept        complement(586620..588953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02495"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87588"
FT                   /db_xref="GOA:A3U5S1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5S1"
FT                   /protein_id="EAP87588.1"
FT                   /translation="MSEDTEDPLFNVAVFNLDKSKSSVTDFNGSVSLKSFTLTETIIFK
FT                   HLAHKVFKTTKASVLKEGNTIYLEASENALDEVVMSVSKFSQKEKEVSQKIVSIKAKDI
FT                   IAANPQTSADLLESTGQVFVQKSQLGGGSPIIRGFSTNRLLITVDGVRFNTAIFRGGNV
FT                   QNIISIDPLAVENTEVILGPGSVVYGSDAVGGVMNFYSKKPKFSNDANLKTSGNALVRY
FT                   ATANAEKTGHVDINFGKEKWAFLTSVSYSDFDDLKMGSHGPDEYLRPDYQTTQNGEDLV
FT                   VLNDDPKVQVETGFNQIYLMQKARFSPNTKWDFNLGISYSETSDYPRYDRLIRKNEGEF
FT                   RAAEWYYGPQSWLSTNLDIRQTQSTLFYDEANLTLAYQKFEESRNDRNFGENIRFETDE
FT                   VVNAYSTNLDFTKSLGKHKVFYGLEYVHNKVSSFGKQTNINTNESVEDASRYPDGSTWQ
FT                   SAAAYASAQWSLQDGLTLTTGARYNQVIVNATFNDRFYDFPFDKADINTGALTGSAGLS
FT                   WQPTALFGTKLGFSTAFRAPNIDDVGKVFDSEPGSVVVPNPDLDPEYAYNTEIGFTLNF
FT                   NNNVKFDIGGFYTLLNNALVRRDFTLNGESTIDYQGEPSQVQAIQNAASGKVYGFEAGT
FT                   EVNFNKNLQLTSQINITEGTQELDDGTEAPLRHAAPVFGNTHFKFSKNKITLDAFAEYN
FT                   GEFSFEELAPSEQDKPYLYAIDENGNPYSPSWYTLNFTAQYDVLDNLKATATVENITDQ
FT                   RYRTYSSGIAAAGRNLILALSYDF"
FT   gene            complement(589022..589738)
FT                   /locus_tag="CA2559_02500"
FT   CDS_pept        complement(589022..589738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02500"
FT                   /product="possible DNA repair protein RecO"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02500"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87589"
FT                   /db_xref="GOA:A3U5S2"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5S2"
FT                   /protein_id="EAP87589.1"
FT                   /translation="MLVTTKAIVISALKYGEADLIVKLFTESSGLKSYLLRGILKSKRG
FT                   KFRASQFQPLTLLEVVAKHKDKGTLETLRDAKILATYQTLHTDLLKSTVIMFLAELLRN
FT                   AIQEEEKNPELFGFLETAFLWFDKYNSSNFHLLFLVKLSLFLGFYPEGTNKNASFFNLL
FT                   DGTFQEVSTNSYCISGIHKDTLELLLGINFDGLEELKLNQTNRSGMLSMLLLYYELHLQ
FT                   GFRKPKSLTVLKEIYS"
FT   gene            complement(589738..592023)
FT                   /locus_tag="CA2559_02505"
FT   CDS_pept        complement(589738..592023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02505"
FT                   /product="immunoreactive 84 kDa antigen"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02505"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87590"
FT                   /db_xref="InterPro:IPR011110"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5S3"
FT                   /protein_id="EAP87590.1"
FT                   /translation="MKLVFKLLVLVLPMSLIAQDFSENWTEFYSYYNIKDVSNGNNKIY
FT                   AAAENAILIYDIPTDSVRTVSSVNGLSGELITAIHYSETYESLIIGYENGLIEVINDNS
FT                   TEVTSVGGIIEEVSISPLDKRINHFMEFEDNIYVSTDFGIVLYNLPNLEFGDTYRIGDN
FT                   GEELQVKQTTVRGETIYAATFSGGIRYADVTSEDLIDFEEWQGITTSSFDAVQVVGSQV
FT                   YAVQNNGSLHRIEGTNLVFEESLGLRARDLRVNNENELILTTQSFVRVYDENLTLLNAI
FT                   TTLQDISQNYVATTVVNGEFFIGHDEVGLIATSTTLSPEFVVISPDGPLLNSIFNMEAL
FT                   DNELWVTFGEHNIFYNPYPRSDRGISHLVEDEWRNIPYDSLMGALDIIEVTSNPFNSEQ
FT                   VFFSSFGDGLLEVNDEVPTQFFTGNNSAIFDFIPNGTDGSRVNGTAFNSEGTLYLAQGF
FT                   TDIALYKKEQDSDVIMPIDDLIDNIPTLGDGLLGKIVIDRNDNLYIGSQTQGLVGYQPS
FT                   TGIVTQLKDDVGGAGLPDNDIRALEFDQNGRLWIGSLTGLRVLFNPQSIFTEDNVTVEP
FT                   IIIEENGVPQELLFSQFVTSIEVDGANNKWIGTAQSGVFYLSPNGQETLLRFTKENSPL
FT                   PSNIITDIRIDEASGRVYIGTPNGLLAYNATATSPQDNLENVRAYPNPVRPNFNGVVVI
FT                   DGLTARANVKITDITGNLVYEDTSVGGSIEWDTTAFGRHRVASGVYLILITAEDALETK
FT                   VHKLMIIR"
FT   gene            complement(592020..593342)
FT                   /locus_tag="CA2559_02510"
FT   CDS_pept        complement(592020..593342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02510"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87591"
FT                   /db_xref="GOA:A3U5S4"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5S4"
FT                   /protein_id="EAP87591.1"
FT                   /translation="MNRITKFVFKNPELSIIAFAVVVRLITFIFYPNTTLFNDSENYLD
FT                   LAKRLLEANLIGYEGYRTPGYSMLILLGFQNLCLVVLIQHLLGICTSLFMYWLLRSIAL
FT                   HKGVAIGAAILYSCLLHVVFFEKGILTETFSAFLLTAILYILQLHIIKRKFKPSHFGIL
FT                   SVSILLLVMTKPFFIYILPIIILFLGIALWSQLQFKIIKPILIITIPTLLAVGSWAFLN
FT                   KQNTGYATLSSYFGYNLAQQTVNFIHKAPDDYATVRDIYVKQIEKDKEQLGYTYYSIWD
FT                   AYQPMMKATGYNFYDLSNELANMSKATIIANPKDYIKQVFLSWKLFWGVKLYWDQSHIS
FT                   NPAVVIVYKGIWFLQRPLIVFGKILFVGLFLWSFIKGVLRKRISVHLLSFIFALVILGS
FT                   ILQAAIIYSDNYRFSFPYLPAIIIVLASYSVRLTQLIRKKK"
FT   gene            complement(593422..594765)
FT                   /locus_tag="CA2559_02515"
FT   CDS_pept        complement(593422..594765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02515"
FT                   /product="glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02515"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87592"
FT                   /db_xref="GOA:A3U5S5"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5S5"
FT                   /protein_id="EAP87592.1"
FT                   /translation="MEQEVKEFLDRVSLRNANEPEFMQAVHEVAETVIPFIKENKKYQN
FT                   KRLLERMTEAERIIMFRVTWLDDNGKIQMNRGFRIQMNSAIGPYKGGLRFHPTVNLSVL
FT                   KFLAFEQTFKNSLTTLPMGGGKGGSDFDPKGKSDNEVMRFCQSFMTELQRHIGADTDVP
FT                   AGDIGVGGREIGFMYGQYKRLRNEFTGVLTGKGREYGGSLMRPEATGYGNVYFAQNMLK
FT                   TKGDSFEDKTVVISGSGNVAQYAAEKVIEFGGKVVTLSDSSGYILDNDGIDQEKLEFVM
FT                   ELKNEKRGRIKEYLDKYTNAEYFEGKTPWSVACDVALPCATQNELEESDAKTLVKNGCM
FT                   LVGEGANMPCTPEAVTVFQDAKILFSPGKASNAGGVATSGLEMSQNSMRYSWTAEEVDK
FT                   KLHEIMNNIHDQCVKYGSEEGGYVDYVKGANIAGFVKVADAMLAQGAV"
FT   gene            594971..595774
FT                   /locus_tag="CA2559_02520"
FT   CDS_pept        594971..595774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02520"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87593"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5S6"
FT                   /protein_id="EAP87593.1"
FT                   /translation="MKIKDILLGLALLLVSLQTTNAQLGFSQEIGVAVGPVAFFSDFGQ
FT                   RYDIQTNTHNSGLGIGLLHYINFAYRADCNCYTRDKYFNDHFKLRTEADYHATNLDFFG
FT                   DDAESNTFQGAKLRAQHGKAKVFEIGSSIEYWPLSIRSFQANGYRLAPFISAGVHYVYY
FT                   TPEVYSDLGPLGSPSTTFNSFLPDPTVGREASIVPEDGSTYAIVGGLGARYKLGPLSDL
FT                   IFEGRWHYYGSDWVEGFSPQQPGNPDNKANDWIFWIRFGYIYYLE"
FT   gene            complement(595818..596960)
FT                   /locus_tag="CA2559_02525"
FT   CDS_pept        complement(595818..596960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02525"
FT                   /product="Cystathionine gamma-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02525"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87594"
FT                   /db_xref="GOA:A3U5S7"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5S7"
FT                   /protein_id="EAP87594.1"
FT                   /translation="MKFNTRAIHGGQHDIDPAFGSVMTPIYQTSTYKQTTPGGHKGYEY
FT                   SRSANPTRSSLEQSLASLENGKYGLAFGSGLAAVDAVLKLLEPGDEVVTTNNLYGGSYR
FT                   LFTSIFQKFGIKFHFVDMENAQDIVEHINDHTKMIWIETPTNPMMNIIDIKAVSQISSK
FT                   HKLILAVDNTFATPYLQSPLDLGADIVMHSVTKYIGGHSDLVMGALIVNDKALADKLYF
FT                   IQNSSGAICGPQDAFLALRGVKTLHVRMQRHCENGKVVAHFLKSHPKVEKVYWPGFQEH
FT                   PNHIIAKAQMKDFGGMVSFSTKEGSWESAIQILENLKVFTLAESLGGVESLAGHPASMT
FT                   HASVPKEDRLNMGIVDSLIRLSVGIEDESDLLADLKQALG"
FT   gene            complement(597003..597458)
FT                   /locus_tag="CA2559_02530"
FT   CDS_pept        complement(597003..597458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02530"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87595"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5S8"
FT                   /protein_id="EAP87595.1"
FT                   /translation="MNAILDLTYRNRKAMLKIIEPLSVAQLNHIPEAFNNNIIWNLAHV
FT                   ISVQQGLVYGLSNLNFKIEKDFVKAYTKGTKPMGDVSEKDVSIIKEQLLYTIEQTELDI
FT                   SADRFQTYNEYPVMLGNTLTNVTDALQFNNYHEGLHLGVIMSLKKFV"
FT   gene            597596..597895
FT                   /locus_tag="CA2559_02535"
FT   CDS_pept        597596..597895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02535"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87596"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5S9"
FT                   /protein_id="EAP87596.1"
FT                   /translation="MKELNLPSSFIKQDIKTQGLSEQDVEEMQNLAGSYEALFSKRAQL
FT                   YKQRNLKDEDLIEDDFRDLILEHYTFLKRPVIINNDQIFIGNSKKVIEEAKESL"
FT   gene            597959..598873
FT                   /locus_tag="CA2559_02540"
FT   CDS_pept        597959..598873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02540"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87597"
FT                   /db_xref="GOA:A3U5T0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5T0"
FT                   /protein_id="EAP87597.1"
FT                   /translation="MNNRILALLAAFAASAIYGANHTIAKDLMPTVIQPFGFILLRVSG
FT                   AALLFWVASLFLPREKIDRKDWLRFVACALFGMAINMLSFFKGLSLSTPINSSVVITLS
FT                   PVLLLVLSAIFLKERVTLLKSIGIGLGLAGALLLILFGMKEQPNAPNIPLGNLLFVLNA
FT                   SSYSVYLILVKPIANKYRPVTLMKWFFLFAVIINLPIGLSEFTQVEWTALSLGSIWRML
FT                   FVIIGTTFLTYLFNIYALKILSPSTIGAFMYLQPLLATLIAVLVGSDILTTLRIFAAAL
FT                   IFTGVYISSRKPKKRLQSNNIQH"
FT   gene            598919..599299
FT                   /locus_tag="CA2559_02545"
FT   CDS_pept        598919..599299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02545"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87598"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5T1"
FT                   /protein_id="EAP87598.1"
FT                   /translation="MTTQEVADQLVKWCNEGNEAKCYQELYSPDAVSWEMEADPNDAMA
FT                   KCVGMQEIQKKGEWWYENFEVHSSKASEPTVADGYFTTRFDMDTTHKPSGQRSKMSELG
FT                   VYKVKDGKITEERFFYQNGEQQ"
FT   gene            complement(599336..600367)
FT                   /locus_tag="CA2559_02550"
FT   CDS_pept        complement(599336..600367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02550"
FT                   /product="potassium transporter (Trk family)"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02550"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87599"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5T2"
FT                   /protein_id="EAP87599.1"
FT                   /translation="MLDFIIIGAAQAGLSMAYYLKQQGKSYLVLDKENEVGASWLNRWD
FT                   SLTLFTPTEFNHLAGMPFPAKKGYYPNKYEVASYFKAYVNEFSIPVQLNCLVEKIEKRD
FT                   GKFILTSNNGIYEAKQVVVATGPFHIPYTPPCSKLMSKDIFQIHSNYYKNPKQLQEGPA
FT                   MVVGAGDSGFQILDEISDNGRKTYFSGDTDVKTLPQEILGKTLWWWFTITGFLSFSKNS
FT                   WIGNKINHSKQPVIGTDVKEILARPQVTAVGRTNDAHDYIIETEKKQLTDVRNVIWATG
FT                   YRPNFSWIEGLELDHEGYPKHKRGVSTIEGLYFIGLPWLHTRGSATLGGIKKDAEYLSK
FT                   QIK"
FT   gene            complement(600666..601385)
FT                   /locus_tag="CA2559_02555"
FT   CDS_pept        complement(600666..601385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02555"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87600"
FT                   /db_xref="GOA:A3U5T3"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5T3"
FT                   /protein_id="EAP87600.1"
FT                   /translation="MHHLITRFERAHKKARHNIWIGWFAIFCRIVLAIGFIPAGFTKII
FT                   GERFTALPDMHPMGSYLTALFHTGYYYTAIGVAQVLAGVLLLIPRTATLGALLYFPVIL
FT                   NIALLSFSVRFDGSLLSSPLMLLANIFLLCWDYHKLKFIFPWYHKTSTENLIVANEKTK
FT                   HFPWRFVVGSFMVFVVIVGFIVVINKTLLMPRNSISDCQQDCMNATNPEACLVFCDCVH
FT                   NNGSPLNECLECYEKSL"
FT   gene            complement(601404..604784)
FT                   /locus_tag="CA2559_02560"
FT   CDS_pept        complement(601404..604784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02560"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02560"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87601"
FT                   /db_xref="GOA:A3U5T4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5T4"
FT                   /protein_id="EAP87601.1"
FT                   /translation="MSKTSISQAFSRSPQFRKLQDTIAQSQENYHKTTLTGLVGSAVSF
FT                   AIAEAFKQADKPFLAIFNDKEEAAYYLNDFEQLIKDDEVLFYPGSYRRPYQIEETDNAN
FT                   VLLRAEVLNRLNSRRKPALIVTYPDALFEKVVTKKELEKNTLKLSVGEQVSIDFVNEVL
FT                   FEYKFHRVDFVTEPGEFSLRGGILDVFSFSHDEPFRIEFFGDEVDSIRTFDVETQLSLE
FT                   QTKKISIIPNVENKLLQESRESFLKYIHHKTIIFSKNTELVFGRIDSNFDKAVQAFKTL
FT                   NAETKHSEPEELFATGALLKEQLKGFTHFEILNKSTGAADTIQFHTRPQPSFNKQFNLL
FT                   IENLNENHEDGYHNYIACVSEQQAKRFHDIFDDAELNVKQYETVTVSLYQGFIDDESNS
FT                   VCYTDHQIFERYHKFNLKNGYAKKQAITLKELTNLTVGDYVTHIDHGIGKFGGLQKIDV
FT                   EGKKQEAIKLIYGDRDILYLSIHSLHKITKYNGKDGQAPKVYKLGSQAWKKLKQKTKSK
FT                   VKEIAFNLIKLYAKRRLEKGFAFGPDTTMQLELESSFIYEDTPDQSSATEDVKKDMENE
FT                   RPMDRLVCGDVGFGKTEIAIRAAFKAVDNGKQVAVLVPTTILAFQHHKTFSERLKDFPV
FT                   TVEYLNRFRSAKERRETIADLEAGKVDIIIGTHQLVNKTVKFKDLGLLIVDEEQKFGVA
FT                   VKDKLKTIKENVDTLTLTATPIPRTLQFSLMAARDLSTITTPPPNRYPVETNVIRFSEE
FT                   SIRDAVQYEIQRGGQVYFVHNRIENIKEVAGMIQRVVPDAKIGIGHGQMEGKKLEQLML
FT                   SFMNGDFDVLVSTTIIESGLDVPNANTIFINNANNFGLSDLHQMRGRVGRSNKKAFCYF
FT                   ITPPYSAMTDDARKRITALEQFSDLGSGFNIAMKDLEIRGAGDLLGGEQSGFINEIGFD
FT                   TYQKILNEAIEELKETEFKDLYDTKEEDRVFLKDTTIDTDISLLFPDDYINNISERLNL
FT                   YTELNSISEEKELEAYEKRLLDRFGELPQQAEDLLNSVRVKWIATQVGIEKLILKQGKM
FT                   IGYFINDQQSPFYQSNTFTKVLQYVQTHPRQVVMKEKKTRNGLRLLVTFDKVKTIDKAL
FT                   EVLKPLDFKSQKAQQEQVS"
FT   gene            604912..605337
FT                   /locus_tag="CA2559_02565"
FT   CDS_pept        604912..605337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02565"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87602"
FT                   /db_xref="InterPro:IPR024311"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5T5"
FT                   /protein_id="EAP87602.1"
FT                   /translation="MKNLILAITFLLCLCSCSNDDDSTNQTSNFETLIVGEWQLIESYD
FT                   NEELISLGECELMTTFNFDSNNEFGFVDVFTNTNGNCSVFSILIGTYTISESILTYTLS
FT                   SGDVSQVQITQLNTTTLELTVSTDDGTLTKVYSKISS"
FT   gene            605412..605852
FT                   /locus_tag="CA2559_02570"
FT   CDS_pept        605412..605852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02570"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87603"
FT                   /db_xref="InterPro:IPR024311"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5T6"
FT                   /protein_id="EAP87603.1"
FT                   /translation="MKTFKLILLAAIIACTTASCSSDDDSNNGDVADFNTLIIGQWRLT
FT                   SEVINGEPEPLDDCETSSTITFSEDTVTSVYVYTNDENECETETPDVSTYTISGNTVTI
FT                   SYDGGSDSGSIETLNNSTLTFSFTDSFGDETEVFTTTYTRVN"
FT   gene            606057..607424
FT                   /locus_tag="CA2559_02575"
FT   CDS_pept        606057..607424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02575"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02575"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87604"
FT                   /db_xref="GOA:A3U5T7"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5T7"
FT                   /protein_id="EAP87604.1"
FT                   /translation="MAYKHFDVFIIGSGIAGQTCAKKLAKEGLNVAIADDREFGGTCAN
FT                   RGCDPKKVIYGLTHILQRSNDLLGKGITTMPEYSWKDLMAYKCNFTDAVPAVTEEKLED
FT                   LNITLYHQSPEFIDQSTISVEGKTVTADKFVIATGLHPRNLGFDGCKLMKVSDDFLELE
FT                   TLPETMIFVGAGYIGMEFAHMAARCGVKVTVIDFAKRPLGNFDEDIVEELVKASKKLGI
FT                   KFIFEADVRQVKHLRKNYEVEYLKDGKLQTAKAELIFNVAGRVPATEKLKLQKGNIEFN
FT                   KNGIEVNSYLQNPTNKNVYACGDVSDHAVPLTPFSGREGSTVATNILAELNSKTTSKKK
FT                   ITFPPTPSVCFTIPNVASVGILEADAKNESLEYIVKSGDGKDWYNARRVNTSVYAYKII
FT                   IHKETDKILGAHLIGPQASEVINLFSMAIFKEMTAAELKQMVFAYPTWGTDVAAMV"
FT   gene            607555..608298
FT                   /locus_tag="CA2559_02580"
FT   CDS_pept        607555..608298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02580"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87605"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5T8"
FT                   /protein_id="EAP87605.1"
FT                   /translation="MRTIFTFILSFILFVSNTNAQVGISTTTPQAALDITSTDSGILIP
FT                   RVALNSSADTGTVLNPDGSPLVEGTMVFNNGNGTLTEKGFYFWNGSDWDKLVDNTPHIH
FT                   IGKFRITSTGTVNFTGLPFKPSRIVFTAYANVDDYNQSASNSTGNNNNNTKENTHGSMK
FT                   GYAYEIDGSILQQSIFNGGSGNSINDISRYASSTNCIGLRYTNQNGGNLGLTTATLTAF
FT                   NDDGFTLNITNAVDNVVVIYEAYRY"
FT   gene            complement(608295..609104)
FT                   /locus_tag="CA2559_02585"
FT   CDS_pept        complement(608295..609104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02585"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87606"
FT                   /db_xref="GOA:A3U5T9"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5T9"
FT                   /protein_id="EAP87606.1"
FT                   /translation="MKKTLQIVNIVVFAITIFMNYASSAGLFNGATQAEISAKYSNMFT
FT                   PAGYAFSIWGLIYLLLFGFVIYQSRSLIVKVRDDDFIQKTGWWFTLSCLANSLWCYLFV
FT                   SDYILASVVVIFFLLFCLFKIVYKNSMELWDAPIAVILFIWWPFVFYSGWLTVACIANV
FT                   SVYLTKIEWNAFGLSHQFWTIVMIVIATGINLAITWTRNMREFALVGAWALVAISVANY
FT                   NIEEAVVYCALITGGLLLVSSSVHAIKNKDTSPYQKCLEYLNKEPNS"
FT   gene            complement(609123..611993)
FT                   /locus_tag="CA2559_02590"
FT   CDS_pept        complement(609123..611993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02590"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02590"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87607"
FT                   /db_xref="GOA:A3U5U0"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5U0"
FT                   /protein_id="EAP87607.1"
FT                   /translation="MTNTPENTQKRLFLLDAYALIFRGYYALIKNPRVNSKGMDTSAIM
FT                   GFMNSLFDVIKREKPDHLAVAFDKGGSSDRVEMYEDYKANRDETPDAIKIAVPYIQSIL
FT                   KAMHVPCIEIEGVEADDLIGTLSKQAEKEGYQVFMVTPDKDYAQLVSENIFMYKPARMG
FT                   NGIEIWGIPEVQKKFEVERPEQVIDYLGMMGDASDNIPGLPGVGDKTAKKFIKQYGGLE
FT                   GLLENTDKLKGKMKEKVIANAELGRLSRKLATIMLDCDVTFNAENYELSEPDAEAVAEI
FT                   FDDLEFRRLKDQFVKIFSGEAEASVGAAVSNTETAKKIETASKKAAQAGAGQYNLFDAN
FT                   STIADDVEEASSRQTIKSKEHHYQSVATSGMGLKLFLQNLNKQTSVCFDTETTGLNPLT
FT                   AELVGIAFSWDAGKGFYLPFSDNKEEAQQLIEELRPFFENEDIQKVGQNLKYDIKVLHK
FT                   YDIEVRGPLFDTMLAHYLINPDMRHNMDVLAETYLNYSPVSIETLIGKKGKNQKSMRDV
FT                   PLEDQTEYAVEDADITLQLKEHFEKELGDANTQKLFDDIEIPLLRVLAAMELEGINLDK
FT                   AFLNNLAEDLNNDIATLEASIYKEAGEEFNIGSPKQLGEILFDKLKLVEKPKKTRTGQY
FT                   STAEDVLSYLAADHTIIQNVLDYRGLAKLKSTYVDALPEQVEEDGRVHTDYMQTVAATG
FT                   RLSSNNPNLQNIPIRTERGRQVRKAFVPKNEDYVLLAADYSQIELRIIAALSEEDTMIE
FT                   AFKNGEDIHASTAAKVFNVPINEVTREQRSNAKTVNFGIIYGVSAFGLSNQTDLTRSES
FT                   KDLIDTYYKTYPKLRNYMSNLVDDAREDGYVSTVLGRRRYLKDINSSNGVVRGAAERNA
FT                   VNAPIQGSAADIIKVAMINIHKKLAEGNFKTKMLLQVHDELVFDVPKNELEDIKTLVKT
FT                   EMESAYTLSVPLDVEVGVGNDWLEAH"
FT   gene            612232..613392
FT                   /locus_tag="CA2559_02595"
FT   CDS_pept        612232..613392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02595"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02595"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87608"
FT                   /db_xref="GOA:A3U5U1"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5U1"
FT                   /protein_id="EAP87608.1"
FT                   /translation="MPFYHKLGKIPHKRHTIFKKPDGSLYYEQLFGTIGFDGMSSNLYH
FT                   EHRPTQVKKIDGSYDVTPKVATKNNMHSLRLKGFQVIPEPDYLESRKVVLTNSDVDITL
FT                   ASPQNLTQDYFYKNADSDELLFVHKGSGVLRTHLGNLDFKYGDYLLIPRGVIYKIDFDD
FT                   ENNRLFIVESRRPIYTPKRYRNWFGQLLEHSPFCERDLRQPQDLETHDEVGDFVIKVKK
FT                   NNEIFNMVYATHPFDVVGYDGYNYPYAFSIHDFEPITGRIHQPPPVHQTFETDAFVVCS
FT                   FCPRKYDYHPESIPAPYNHSNIDSDEVLYYVDGDFMSRNDIEPGHISLHPAGIPHGPHP
FT                   GAVERSIGQTETEELAVMVDTFKPLMVTEEGAKIADKSYHQSWLEH"
FT   gene            613377..614549
FT                   /locus_tag="CA2559_02600"
FT   CDS_pept        613377..614549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02600"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02600"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87609"
FT                   /db_xref="GOA:A3U5U2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5U2"
FT                   /protein_id="EAP87609.1"
FT                   /translation="MVRTLKNTKDFIMIDNKTPELEKVIEGAEDFLPLLGTDFVELYVG
FT                   NAKQAAYYYQTAWGFEPIAYSGLETGRKDSVSYVLQQGKIRLVLTSSLQPGGTINDHIS
FT                   DHGDGVKVVALWVDDATKSHEETTKRGAQSYMEPYTVEDEYGKVVLSGIHTYGETVHVF
FT                   VERKNYEGVFLPGYKPYKPNYSTNNVGLKYIDHMVGNVGWNEMNKWCEFYAKVMGFAQM
FT                   VSFDDKDISTDYTALMSKVMSNGNGRIKFPINEPAEGKKKSQIEEYIDFYNGAGVQHIA
FT                   LATDNIIETVTNLRDQGVEFLYVPETYYDTVLDRVGEIDEDLAPLKDLGILIDRDDEGY
FT                   LLQIFTKPVLDRPTMFFEIIQRKGAQSFGKGNFKALFEAIEREQDLRGTL"
FT   gene            614686..615609
FT                   /locus_tag="CA2559_02605"
FT   CDS_pept        614686..615609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02605"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87610"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5U3"
FT                   /protein_id="EAP87610.1"
FT                   /translation="MVTERSEFHNLRFSWLIQLKTPSVTVEFFSFFTFGTVIVNHLKKI
FT                   TKSYNHMKTLIAFTLLLTTTVSIAQQKAFDTNEWLQFRIHYGWFNASEATLEVKEDTYK
FT                   GTPVHHIVGKGKSTGLLHLFFEVDDNYETYVDKTNGQPYKFIRKINEGGHTKDIEINFD
FT                   HSKNTALVHNKKYNTKKTFTTKEKVHDMLSAFYYLRNNLDPTTLTSGEEQTLNLFFDEE
FT                   NFKFKLKFLERETIKTKFGKIKCLKFRPYVQAGRVFKEEESLTFWVSDDPNMLPIKIEA
FT                   DLAVGSLEADLSAFKGLKHPFQIVVN"
FT   gene            615615..616586
FT                   /locus_tag="CA2559_02610"
FT   CDS_pept        615615..616586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02610"
FT                   /product="tryptophan 2,3-dioxygenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02610"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87611"
FT                   /db_xref="GOA:A3U5U4"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5U4"
FT                   /protein_id="EAP87611.1"
FT                   /translation="MSNIDPEIAKKIIQLEKKFKNSGQDMGSYLDGLLHERYLTYWDYI
FT                   HLDTLLSLQIPKTHFPDEEIFIGYHQITELYFKLIIHEQKQIIDDKGQKAEFFIEKITR
FT                   INRYFRILIDSFDVMIRGMEREQFLKFRMSLLPASGFQSAQFRMIEVYATPLNNLVHPS
FT                   LRKDLETSEDIENLYEQLYWKRGATDLKTKEKTLTLKQFEYRYTPRFIRIANEVKGQTI
FT                   FHKYEELPKSEKQNKKLIEALKNLDLNANVNWNLMHMGAAYRYLDKEGSAIQATGGTNW
FT                   KQFLPPSFQKIVFFPSLWTEEELDNWGQEWVEHLFNTEKIKH"
FT   gene            616583..617836
FT                   /locus_tag="CA2559_02615"
FT   CDS_pept        616583..617836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02615"
FT                   /product="peptidase, M23/M37 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02615"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87612"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5U5"
FT                   /protein_id="EAP87612.1"
FT                   /translation="MKHLLSLFALILILSSCGNEPKPETEPMAIAPKPIVKEYGFNTEE
FT                   YEFVRDTVKSGDTFGTILDAHGVPAQTVFNITNSVKETFNPARIGIGRPYAILKSKDTS
FT                   QTAQAFIYENDKVDYTVVNFSDSIGAYKGQKKLTVVEKEATGIINSSLSKTMEDSGLSV
FT                   VLAYKMADVYAWTIDFLRLQEGDRFKVIYEEKYINDTIYAELGSVKAVYFEHRGEPFYA
FT                   FNFKHDSIIGQREYYDEEANNLRRAFLKAPVQFSRISSRFNLKRRIKYYGYKLRPHRGT
FT                   DYAASVGTPILATADGVVTKSEYRGGNGNYVKLRHNSTYETQYLHMKKRKVNVGQYVKQ
FT                   GDVIGWVGMTGNTGGPHVCYRFWKNGVQVDPLKQDLPSAEPLEEALRTEYFMHIDDLKR
FT                   RLDALEFKEENTNIIAKL"
FT   gene            617850..618293
FT                   /locus_tag="CA2559_02620"
FT   CDS_pept        617850..618293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02620"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87613"
FT                   /db_xref="GOA:A3U5U6"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5U6"
FT                   /protein_id="EAP87613.1"
FT                   /translation="MEIIKFIHSYWAYLVVIVVTVATINAVIGYVTKREFVPRDFRLAL
FT                   FALIVTHIQFLIGFVLFFVSDKVRWFDSDTEVSTIMKNSDLRLYNLEHPLVMILTVVFI
FT                   TVGYSKHKKKLTSTPKLKMLAIFYTLALILLLSRIPWSSWLTF"
FT   gene            618278..619678
FT                   /locus_tag="CA2559_02625"
FT   CDS_pept        618278..619678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02625"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87614"
FT                   /db_xref="GOA:A3U5U7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5U7"
FT                   /protein_id="EAP87614.1"
FT                   /translation="MVNILINPFMKYFILSLVAIVIVSCATENKQHTIVSGTLTNNSKD
FT                   IVAVNGHGEAYELKVDKEGNFKDTLNISANGYYYFFAGRERTTIYLEKGKTLNVTVNTD
FT                   EFDETINYSGDLANENNYLAAKYLYNEANRDMQSLYAKEEAQFKNALSSSSKSYDSILS
FT                   ANNVTNTAFLELEKDDIRYAEAGNILNYETYHKYATKNDSFKVSEGFYSSVKDLNYKDT
FT                   LAYKNSEVYRGLVATHLNTIISKKQEEDSTANYSVTFVETVNDEYANGTIKDNVLTNYL
FT                   SGYGLRPDEHLEKIYSTYISTNPTKENLEKVNKRYNVLKDITPGKISPEFSFENIDGST
FT                   TSLKDLSGNYVYIDVWATWCGPCIAEIPSLKQVEKDYHGQPVKFVSISIDNEKDKQKWK
FT                   AMIEEKDLQGIQLFADNNWESKFVQDYGIQGIPRFILIDKKGHIVSADAPRPSNPELRT
FT                   KLDTLLKS"
FT   gene            complement(619754..620833)
FT                   /locus_tag="CA2559_02630"
FT   CDS_pept        complement(619754..620833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02630"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87615"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5U8"
FT                   /protein_id="EAP87615.1"
FT                   /translation="MKTKITIFLIACLAFSCGSSKVATTESKVSTEKKYNVLTVAFYNL
FT                   ENLFDTEDDTEKNDEASPIMEMQNDREQAYQSKLANMAKVISEIGADVAKNSPAIVGLC
FT                   EMENRKVLEDLVNQPGLVEKNYGIAHYDSPDRRGIDVALLYQKDLFKLQSATNHELLIY
FT                   DNNDPEKRVYTRDQLLVTGLLDGDEMNFIVNHWPSRSGGEARSRYKREKAAALNKSIID
FT                   SLQAVNPYAKIITMGDLNDDPTNTSVTKVLGAKDEKENLETKDLYNPMMDLFKQGIGTL
FT                   AYRDGWNLFDQMIMSKPLLDEDFSSYRFYKVGIYNKNYLANPRGRYKGYPFRSWSDGGF
FT                   TNGFSDHFPVYVYLIKEVN"
FT   gene            620996..623860
FT                   /locus_tag="CA2559_02635"
FT   CDS_pept        620996..623860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02635"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87616"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5U9"
FT                   /protein_id="EAP87616.1"
FT                   /translation="MFTLSLTAFAQQTVVQGKAVDGVTNENVPDVTVTIENSNIETQTD
FT                   GLGEFSFDASRVIGEQVIVLYKQGYTTKRFPITINEGETLNLDVLSMDIDINEEQLQIG
FT                   TISLSDNELDQDNENTAFNISGLLQASRDIFLNAAAYDFSATFFRPRGLDNQFGEVLIN
FT                   GLNMNKQFSGRPQWGNWGGLNDVQRNQEFSMGLSANEYSFGGPAGTTNIIMRASKYREG
FT                   GRVSYATANRSYTGRVMGSYSSGLQSNGWAYTVLASRRFGDEGYIDGTFYDANSVFLAV
FT                   EKKINDNHSLNLAAWYTPNRRGRSTAITEEVHNLKGREYNPLWGYQDGEIRNTRVRNIQ
FT                   EPIIMLNHYWDLSENTTLNTNVSYQFGEIANSRVENGGTTLVTTPDGQSTYLGGARNPD
FT                   PSYYQNLPSYQLRFPNPSPADFQNAYLAQQEFINDGQFDFNALYEANRLSAATGGNSIY
FT                   AIQEDVIDDTQIQANTILSSTLTDNITLNAGLNYRNLNSANYARISDLLGGTGYLDIDN
FT                   FTEITANENTNSTDAAQSDLNNPNRIVGEGDRYKYNYEIDANVVGGFAQAQFKYNKVDF
FT                   FVSTKLSQTSYQRNGLYRNGNFADTSFGESEKLDFSNYGAKAGLTYKITGRHLIDANGG
FT                   YITNAPTIRSAFSNARQNNNTVTGLESEKITSADLSYIYRSPMIKARLTGFYTGFEDGT
FT                   DIAFYFTEDVNNGEGAFVQEVLTNIERRNIGAELGIEAQVTPTIKLKAAASFGQYTFNN
FT                   NPDVYYTSDDFNRVNTDDDPSNDNPNINSVGELRFGDGTAKLKDYHVASGPEQAYQIGF
FT                   EYRDPNFWWFGVTTNYFDNAYIDVSTITRSDAFTTDIDGQPFNDYDPTEARALLQQEDF
FT                   GDYILVNAVGGKSWKIDDYFVGFFITINNIFDEEYKTGGFEQSRTSNFRSLQEDVNREN
FT                   GRVFGPRYFYGNGTTYYANVYVRF"
FT   gene            623898..625322
FT                   /locus_tag="CA2559_02640"
FT   CDS_pept        623898..625322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02640"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87617"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5V0"
FT                   /protein_id="EAP87617.1"
FT                   /translation="MKTNFKLLATFLLSIVVLASCVQDDDFDIPNTAPQEVNLDGQVIG
FT                   IGAVQADFVQAQDFFYNEDTFNFFTYDDESDDTATYMEGYVISSDEGGNFFEEIILQDK
FT                   AENPTVGIKLLIDVNPLFTSYEFGRKVFIRLDGLSVGLDSGVLTLGVQDGDRIGKIAPS
FT                   LQSQVIVRSTETAEIVPLVKTISEIKADVDEDDAYANQYLNLYLSVPSVQFTQDDVNNG
FT                   ITYAGETSDEFDGERILQECNEAGTDVTNSIIFSTSTFADFKGLTLPSGSGSIDGILSL
FT                   NFFGEDYIINVNSPETVNLTGERCDPPTPFFTQNFEGASIEDLVANEGWTNQNVSGGSV
FT                   DWFSSSFNDNTYARISAFNSGQAEADVYLVTPAINLDATENETLRFDLEIAFDNGNILS
FT                   VLISTDFTGDASTATWTDLNANIPDGPGSGFGGFQSIPAVDLSGYDGDVYIAFFYEGTD
FT                   SETTRYHVDNISVAGE"
FT   gene            complement(625369..626253)
FT                   /locus_tag="CA2559_02645"
FT   CDS_pept        complement(625369..626253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02645"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02645"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87618"
FT                   /db_xref="GOA:A3U5V1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5V1"
FT                   /protein_id="EAP87618.1"
FT                   /translation="MHQDRIKWVYLIILSLVWGSSFILIKKGLLGLTPLQLGATRILIA
FT                   GMVLIAIGFKHLKSIKKSEWKWVILSGFLGTLIPAFLIAFAETEIDSAVASILNSTTPL
FT                   LALILGVLVFGVAFVKRQAIGVFIGLLGCLVLIFSGANVNPHQNYWFVGFVLVASVCYS
FT                   INVNLIKQYMQNIHPIGITVGNFIGIMIPAFIVLMFSDFPFSEVTSNPKLYNALGYVVL
FT                   LAIIGTCMAKVLFNKLVQMSSAIFATSVTYLIPIVALFWGVLDNEDFGFWQFVGMGIIL
FT                   FGVFLVNSGKKKV"
FT   gene            complement(626324..626479)
FT                   /locus_tag="CA2559_02650"
FT   CDS_pept        complement(626324..626479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02650"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87619"
FT                   /db_xref="GOA:A3U5V2"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5V2"
FT                   /protein_id="EAP87619.1"
FT                   /translation="MSLLTIILSILLPPLAVALKKGLGVDFLINLLLTALGWLPGVIHA
FT                   FYVNSK"
FT   gene            complement(626566..627069)
FT                   /locus_tag="CA2559_02655"
FT   CDS_pept        complement(626566..627069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02655"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87620"
FT                   /db_xref="InterPro:IPR019850"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5V3"
FT                   /protein_id="EAP87620.1"
FT                   /translation="MQPKPKAFLALEYSKAEYKKVDVGCAYTFEINTMAKVKPSRVNNP
FT                   CWVDIEYPELNGTLFITYQEVNGNLDTLLRDGQKLPLQHTKKADVIEGDQYLNPSHNTY
FT                   GMFYEVEGNAASQAQFYVTDSINHFLTGAIYFRATPNFDSIYPAAAYLKNDIKQLMETV
FT                   EWQD"
FT   gene            complement(627123..628379)
FT                   /locus_tag="CA2559_02660"
FT   CDS_pept        complement(627123..628379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02660"
FT                   /product="putative transmembrane CorC/HlyC family
FT                   transporter associatedprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02660"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87621"
FT                   /db_xref="GOA:A3U5V4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR019862"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5V4"
FT                   /protein_id="EAP87621.1"
FT                   /translation="MVLLLCSALISGSEVALFSLAPTDFEPDETKRSAKEQIVINLLDR
FT                   PKKLLATILVANNFINIAIVLLFASLGEYYLGNLNLETQVIGYSIDFRFIIEVVIVTFL
FT                   ILLFGEILPKVYANRNNVKFAFAMAYPLRVLDKVFSPISLPMRGITLGIHRRLGKQKSN
FT                   ISVDQLSQALELTSEEDTTKEEQKILQGIVSFGNTDTKQVMKPRMDIFALNVEQSYKEI
FT                   IPEVIEKGYSRIPVFEESIDNVQGILYVKDLLPYLHRKVFDWTTLLREPYFVPENKKLD
FT                   DLLNEFKDKKNHLAIVVDEYGGTSGLISLEDIIEEIVGDISDEFDDENLIFSQLDEFNY
FT                   IFEGKTPLKDFYKVIKLENNSGFEDFKGEAETLAGFVLEISGGFPQKGEILSFENYTFT
FT                   IEAIDNKRLKQIKFSIHPE"
FT   gene            complement(628484..628969)
FT                   /locus_tag="CA2559_02665"
FT   CDS_pept        complement(628484..628969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02665"
FT                   /product="single-strand DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02665"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87622"
FT                   /db_xref="GOA:A3U5V5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5V5"
FT                   /protein_id="EAP87622.1"
FT                   /translation="MAGTLNKVMLIGHTGDEVKMHYFEGGGSIGRFPLATNEEYTNRTT
FT                   GERVSNTEWHNIVVRNKGAEVCEKYLKKGDKVYIEGRIKTRKWQDDKGMDRYSTEIQCT
FT                   DFTFLTPKDQQGGPVQQPSQSQNQSNNTQQQSQPAQQASQPQVSQSSSVDEDDDLPF"
FT   gene            complement(629042..630097)
FT                   /locus_tag="CA2559_02670"
FT   CDS_pept        complement(629042..630097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02670"
FT                   /product="putative A/G-specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02670"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87623"
FT                   /db_xref="GOA:A3U5V6"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5V6"
FT                   /protein_id="EAP87623.1"
FT                   /translation="MQKDLNFSKILINWYLKYKRDLPWRHTTDPYFIWLSEIMLQQTQV
FT                   AQGLPYYLKFTETYPTVFHLAKASQEEVLKNWQGLGYYSRARNLHETAKYVANERDGKF
FT                   PEDYKGLLRLKGVGDYTASAIASICYNEPVAVVDGNVYRVLSRYFGIETPINSTKGIKE
FT                   FKAMAELLLDENQPALFNQAIMEFGARHCKPKNPFCDTCPFSDSCKALQDDNVLSLPVK
FT                   LKKTTIKKRYLNYIVLLSDNENTQIKQRVGKGIWQGLYEFPCIETKKDISETEFLSLFK
FT                   ASDISNDINENYNVSLFNDASIVHKLSHQHLYTKFWIVRVSTLNDGIPTHQLKDYPVPV
FT                   LIARFLEDFSF"
FT   gene            630222..630515
FT                   /locus_tag="CA2559_02675"
FT   CDS_pept        630222..630515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02675"
FT                   /product="DNA-binding protein HU"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02675"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87624"
FT                   /db_xref="GOA:A3U5V7"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5V7"
FT                   /protein_id="EAP87624.1"
FT                   /translation="MTKADIVAKIADRIGMEKNEVQATVETFMEEVKTSLEGGENVYLR
FT                   GFGSFIIKERAEKTGRNISKNTTIKIPAHNIPAFKPAKVFMEGVKENVSVKK"
FT   gene            630823..632373
FT                   /locus_tag="CA2559_02680"
FT   CDS_pept        630823..632373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02680"
FT                   /product="Ribonuclease G"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02680"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87625"
FT                   /db_xref="GOA:A3U5V8"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5V8"
FT                   /protein_id="EAP87625.1"
FT                   /translation="MNKELIIRTSSSGVDFALLKDGRLIELQQDEDDNKFAVGDIFTAK
FT                   IRKTVPGLNAAFVNVGYEKDGFLHYHDLGPQVGSLLKFVKQVTTGKLKDFSLKNFPLEK
FT                   DIDKNGTVNDALKSNQSILVQVVKEPISTKGPRISSELSLAGRYIVLVPFSNRISVSTK
FT                   IGTKEEKERLKRLVKSIKPNNFGVIIRTVAEGKKVADIHTDLQNLMDRWTAMCKKMYRP
FT                   NYPTKVLGEMNKASSILRDVFNDSFTSICVDDETLHTQIKDYVGEIAPEKESIVKYYDS
FT                   SKVPIFEKFGIERQIKTSFGKTVSMSKGAYLIIEHTEAMHVIDVNSGNRSNKSKSQEGT
FT                   ALEVNMISATEVARQLRLRDMGGIIVVDFIDMGKAENRRKLFDHLRDEMSDDRAKHKIL
FT                   PPSKFGLIQITRQRTRPETNIKTREVNPSNNGGEEIEAPIIIVEKIKTDLQKAIKKGHK
FT                   KMSITAHPFIAAYLTRGFPSPRANWFFDHKRWVKVLPRDAYTYLEYHFHDKDGKLMKL"
FT   gene            632476..632955
FT                   /locus_tag="CA2559_02685"
FT   CDS_pept        632476..632955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02685"
FT                   /product="putative transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02685"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87626"
FT                   /db_xref="GOA:A3U5V9"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5V9"
FT                   /protein_id="EAP87626.1"
FT                   /translation="MNSKSQTSYTVKEAEQALKRYCAYRERCHKEVEEKLKKMNMIPDA
FT                   RDHIIYILLQENYLNEERFARSFARGKFRIKKWGKRRIISELKFRQISKRNIEFALTEI
FT                   PTEEYYTTFNELAFKRLKQIKETQPQKIKKKLADYLLYRGWESSLVFEKVNEIVN"
FT   gene            complement(632952..633836)
FT                   /locus_tag="CA2559_02690"
FT   CDS_pept        complement(632952..633836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02690"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87627"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5W0"
FT                   /protein_id="EAP87627.1"
FT                   /translation="MSNTLHLEDIPRVKSISKEDFIEHYLKPQKPVVIERLIEDWPAFK
FT                   KWDFEYIDSVAGNLKVPLYDDRPISSKLKFNEPHAEMKMKDYIKLLKKQPTNYRIFLYN
FT                   LMKQVPVLQKDFKYPNMGLRWVKSVPFLFFGGENSKVFMHYDIDYANIFHFHFQGKKRC
FT                   ILFPQSETKYLYKVPNALVARQDIDFSKPDFTKWPALKQAEGLVCELNHGETLYMPEGY
FT                   WHYMHYLTPGFSMSLRAFPKSVTNLSKAVYNLGFMRYFDNLMRKIAGERWIQYKNREAI
FT                   RRTHKRNNLSTKH"
FT   gene            complement(633948..635036)
FT                   /locus_tag="CA2559_02695"
FT   CDS_pept        complement(633948..635036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02695"
FT                   /product="Biotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02695"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87628"
FT                   /db_xref="GOA:A3U5W1"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5W1"
FT                   /protein_id="EAP87628.1"
FT                   /translation="MTTKHNWTIEEILDIYNKPFMDLLYEAATVHREFHDPNTVQVSTL
FT                   LSIKTGGCPEDCGYCPQAARYHTDIEGNDLMGVQQVKAQALRAKASGSSRVCMGAAWRN
FT                   VKDGEEFEQVLEMVRTINKLEMEVCCTLGMLTENQAHRLAEAGLYAYNHNLDSSEEYYK
FT                   EVISTRGFEDRLKTIDNVRKTNVTVCSGGIIGMGESTKDRAGMLVALATLNPQPESVPI
FT                   NALVAVDGTPLEDQEPIPIWDMVRMVATTRIVMPQTQVRLSAGRTQMSREGQAMCFFAG
FT                   ANSIFAGDKLLTTPNPDVNEDMEMFKALGLNPQKPFVKKSQPETVESQDSKYQALGEKP
FT                   KWSRPGHKIERNEEAKGKAKAV"
FT   gene            complement(635165..637228)
FT                   /locus_tag="CA2559_02700"
FT   CDS_pept        complement(635165..637228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02700"
FT                   /product="putative metallopeptidase, M16 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02700"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87629"
FT                   /db_xref="GOA:A3U5W2"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5W2"
FT                   /protein_id="EAP87629.1"
FT                   /translation="MKTKLVSMLMICFVTLGVTAQIDRSKQPQPGPAPTINLGQPDSFT
FT                   LKNGLRVLVVENNKLPRVTASLILDNDPHSENEKAGLGSLTGAVLGNGTKTIAKEAYLE
FT                   EVDFLGANVSIGAESAFASSLSKYFPRVLELMADGALNPLITETDFEAEKTKLIEGIKS
FT                   NEKSVGAVASRVSSYLAYGEKHPYGEFATEETINNITFQDVKSYYDRYFVPSKAYLVIV
FT                   GDIEFRDAKKLVKDAFGDWKKSEALSKTTVKPVNAQYTQVNFIDMPNAVQSELRLENTI
FT                   DLQMNDEDYFSALVANQILGGSFGSYLNMNLREANGYTYGARSSIGADPYASRFVASTS
FT                   VRNEVTDSAIVEMVKELRRIRTEPVSAQDLNNTKNKYAGNFVLQLENPATIANFALNIE
FT                   RYNLPKDFYKNYLKNINAVTMEDVQAAANKYVMVDNMRIVVAGKGKDVVEGLENLNLNG
FT                   KKTPVFYFDKEGNKVDKPVYDKEIPEGVTAQTVYNSYLEAIGGKAKVEAVNTLSMTAGA
FT                   TMQGTPLELEIKKSKAGKMAQSLYVMGNVMSKQAFNGTSGYAMAQGQKVPYDEEQIAKG
FT                   KTDALPFPELNLGEAKLVRIEAVDGSDAYVVMPSENVEDYYDVKSGLKVKSTQTRSQGA
FT                   QTMVVTTLYKDYQEKEGIMFPMTISQSFGPQSIDFKVSNIVVNPEFADSDFE"
FT   gene            complement(637249..638571)
FT                   /locus_tag="CA2559_02705"
FT   CDS_pept        complement(637249..638571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02705"
FT                   /product="putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02705"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87630"
FT                   /db_xref="GOA:A3U5W3"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5W3"
FT                   /protein_id="EAP87630.1"
FT                   /translation="MKLLTFWGCAFLAVFTAQAQQVEFTEFDLDNGLHVILHQDNSAPV
FT                   VTTGVMYHVGAKDEAPGRTGFAHFFEHLLFEGTENIARGEWFNIVAANGGSNNANTTQD
FT                   RTYYYETFPSNSLELGLWMESERMLHPVINEIGVETQNEVVKEEKRSRIDNAPYGKIIY
FT                   ATGINKYVFDKHPYANSVIGSMEDLDAAELQEFKDFFKKYYAPNNAVLVVAGDIDVAKT
FT                   KAMVKNYFGAIPSGEEVARVDIKETPISETITATEYDDNIQIPAKLYVYRTPSMKERDA
FT                   YILEMISSILTDGKSSRMYKKMVDQDKSALQVLAFTRPQEDYGTYIMGALPLGDTELST
FT                   LATAMDEEINKLKNELISEREYQKLQNKFENNFVSSNSSIQGVANSLARYYMLYEDINL
FT                   INKEIEIYRSITREEIKEAANKYLNKNQRLELDYLPTPESK"
FT   gene            complement(638696..640612)
FT                   /locus_tag="CA2559_02710"
FT   CDS_pept        complement(638696..640612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02710"
FT                   /product="Peptidase M16-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02710"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87631"
FT                   /db_xref="GOA:A3U5W4"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5W4"
FT                   /protein_id="EAP87631.1"
FT                   /translation="MKRFLVFLLAFFLNVPVFSQVPAEEPVDQNLGESFKTINDSTFVL
FT                   RNGLTVILSKNTSKVISVELSINNLPHSDFQIAGIDAVTDNLLNAKGDNYSAETKEGLV
FT                   EVNLGINKSNFTSLTSKFTDHFEWFANVLVSPKFSENQLQAEKSQLISSISNTTDNPLD
FT                   IVNRVGKTLSYGPEHPYGELSTIKSLNAITLQDVIIHYQRFAVPKNASLHIKGDLSINF
FT                   LKNLLLNTFSNWTASNSLNSTVAETVNPQYTQLNFIQNDSIEYSRIQFLNTTDLSKESV
FT                   DYPESLVALKLLNTLLSNESYETQAFLEILPLASRAIVNVSTASKQTPEVIMDVLDIIK
FT                   TIRTQQIDDSRLKKIISELKEAYPNVDFSEVDANKVRLASVLHFKVNQMRIVIMADGYK
FT                   FYERLKEIKLKGKTVPVKFYNTRAERVEDIKFERKLPEGVTIETVFENYLNAIGGIEKV
FT                   IKINSLTIKAKAVINETRLNLEIKKSVDNNYMSQVLVGGNTLSKLVITEDSSYIWSGGQ
FT                   KKSIGSSELNALRYKSHPFLELLPEYSMLLRIETLNERDVLVVAFSDVSEEYYDFKTGL
FT                   KTQSVVFDKDSGEKIITSYRNYSNVEGILYPSEISQKIGDATLFFEVTEIKVNPTFKPS
FT                   EFE"
FT   gene            640734..641210
FT                   /locus_tag="CA2559_02715"
FT   CDS_pept        640734..641210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02715"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02715"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87632"
FT                   /db_xref="GOA:A3U5W5"
FT                   /db_xref="InterPro:IPR025250"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5W5"
FT                   /protein_id="EAP87632.1"
FT                   /translation="MKNLTIPIKYGLAIGTALIAYFLILSLFGAHTNPIYSLLNGVLAG
FT                   YGIYEGIKHYKLLKGEKFKYQKGFAAGMLSGFNATILFSVFMGIYASHLNPAFLDNIQW
FT                   RLTGETGLGLFLFEVIIMGFATSVVLTLSFMQLFKKSWNTKDGKRHTYNKEEKK"
FT   gene            641307..641981
FT                   /locus_tag="CA2559_02720"
FT   CDS_pept        641307..641981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02720"
FT                   /product="50S ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02720"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87633"
FT                   /db_xref="GOA:A3U5W6"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5W6"
FT                   /protein_id="EAP87633.1"
FT                   /translation="MYAIVEIAGHQFKVEKDQKVYVNRLSAEEGDSVEFDNVLLVGDGD
FT                   NITLGAPAIDGALIGAKVVKHLKGDKVIVFKKKRRKGYRVKNGHRQYLSEIVIESITAS
FT                   GAKKKATSSKAEAKPKAKKETAKAAPKATAKKASGKADDLKKIEGAGPKAAEALVNAGV
FT                   DTFEKLAKETPEHISEILSEASSRLAHLVTDTWPKQAQMAADGKWDELKEYQDKLDGGI
FT                   EK"
FT   gene            642030..642290
FT                   /locus_tag="CA2559_02725"
FT   CDS_pept        642030..642290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02725"
FT                   /product="50S ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02725"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87634"
FT                   /db_xref="GOA:A3U5W7"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5W7"
FT                   /protein_id="EAP87634.1"
FT                   /translation="MAHKKGVGSSKNGRESESKRLGVKIFGGQAAVAGNIIVRQRGTAH
FT                   NPGENVYAGKDHTLHARVDGVVKFTKKANNKSYVSVVPFEA"
FT   gene            642435..643877
FT                   /locus_tag="CA2559_02730"
FT   CDS_pept        642435..643877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02730"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02730"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87635"
FT                   /db_xref="GOA:A3U5W8"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5W8"
FT                   /protein_id="EAP87635.1"
FT                   /translation="MKTLKVADVLKSEQYHQEIAVNGWVKAFRSNRFLALNDGSTINNL
FT                   QCVIDFENLPEDILKEINIGAAVRIKGILEESEGAGQRVEIQVKDIKIEGVANPEDVKL
FT                   TILSPKRHSLEKLREQAHLRVRTNTGAAVMRLRSKLSFAVHKYFQDNGFYYVNTPIITG
FT                   SDAEGAGEMFKVTAMDLKNPAKNEDGSINYKEDFFGKETNLTVSGQLEAETFALGLGQV
FT                   YTFGPTFRAENSNTSRHLAEFWMIEPEVAFCDLAGNMDLAEDFIKYVIGYVLENCDEDL
FT                   EFLENRLVQEDKSKPQAERSDMLLRDKLKFVLENNFKRVSYTEAIDILKSSKPNKKKKF
FT                   KYIIEEWGADLQSEHERYLVEKHFKCPVILFDYPANIKAFYMRLNEDGKTVRAMDILFP
FT                   GIGEIVGGSQREERLDVLKEKMTALDIPEEELWWYLDTRKFGTCVHSGFGLGFERLVQF
FT                   ATGMGNIRDVIPFPRTPLNAEF"
FT   gene            643880..644731
FT                   /locus_tag="CA2559_02735"
FT   CDS_pept        643880..644731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02735"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87636"
FT                   /db_xref="GOA:A3U5W9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5W9"
FT                   /protein_id="EAP87636.1"
FT                   /translation="MQLVEKHTVKEVTAHIRIQEYGPLVFNTLPSRSSVKKAIKKGLIF
FT                   INGKQADSADWIEEGQLLEVFQLKPTTKHFKLNLDVLFEDDYVAVINKPAGYPTSGNFF
FT                   KTIAKALPYNLKISTKNDALLIPQPIHRLDNPTSGVLVVAKTKSSQINLNKQLELKGIQ
FT                   KTYIAVVHNTPDSNMLFNDNIDGKESESKLEIIKTFKVKDDIYSLVELFPKTGRTHQLR
FT                   IHTSKAGYPIVGDQLYGISSEKNKKLLLHAKSIQFKHPVTGNEVFTTSELPKRFEKLLN
FT                   LS"
FT   gene            644797..646251
FT                   /locus_tag="CA2559_02740"
FT   CDS_pept        644797..646251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02740"
FT                   /product="RNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02740"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87637"
FT                   /db_xref="GOA:A3U5X0"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5X0"
FT                   /protein_id="EAP87637.1"
FT                   /translation="MLRQQLKYKLSQKLSPQQIQLMKLIQLPTQAFEQRVKQELEENPA
FT                   LDSGKERDEKHDDDFDNSQDDYEERETIETDINVDEYLSDDDIPSYRLNANNYSADDEE
FT                   KSVPYASGTSFGQFLKTQLQTYRLSDIDRQIAEFLVGSVDESGYIRRSIDDVVDDLAFT
FT                   QNVYTDNETVSKILQIVHQLDPAGVGARSLQECLLIQLKRKTPTKDIDLAIRLIEDAFD
FT                   HFTKKHYSKLLSKFDITEDELREAIDEIEHLNPKPGGAYSGNTRIVEHVVPDFTIKIVD
FT                   GDLELTLNGRNAPQMHVSRDYSNMMKGYKEAKEKTKAQRDAVMFIKQKLDAAKWFIEAI
FT                   KQRQETLFVTMSSIMHYQKEYFLTGDERNLRPMILKDIADEIEMDVSTVSRVANSKYVD
FT                   TPYGTKLIKEFFSESMTNDQGEEVSTREIKKILEITVAEENKRKPLTDEKLAKILKEKG
FT                   YPIARRTIAKYREQLDIPVARLRKEI"
FT   gene            646251..646856
FT                   /locus_tag="CA2559_02745"
FT   CDS_pept        646251..646856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02745"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02745"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87638"
FT                   /db_xref="GOA:A3U5X1"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5X1"
FT                   /protein_id="EAP87638.1"
FT                   /translation="MKWFLKLGSYLFHPLWMPFIGSFFYFYITPRYIDIYVIKAQLLAI
FT                   GIVTILIPIIYFFMLKNMGLAQSIFLKNIKERRLPLLFFVILLLLLMNVIINRIDVPEL
FT                   YYFFGGILIASFTNFLLALLKIKVSLHMVGVSGLAMFTIALSIHYNINLLAIISALVII
FT                   NGWVASSRLYAKAHTVVEVILGIAIGFLPQLFLLKFWL"
FT   gene            complement(646857..647537)
FT                   /locus_tag="CA2559_02750"
FT   CDS_pept        complement(646857..647537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02750"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87639"
FT                   /db_xref="InterPro:IPR025665"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5X2"
FT                   /protein_id="EAP87639.1"
FT                   /translation="MRAQESPERYDSRFDSIQKTTVDSLYLEDQFYVGFGFNLLLDKPG
FT                   GFSQNGFSGGLHLGYIRDIPINKRRNFGFGIGVGWSINTYNQNLFIGEKETEQTIFNVV
FT                   DRGDLDVNTNRFSTYLIEAPLELRWRTSTATDYKFWRIYAGVRLGYIYHFKSKFEQPNN
FT                   AVNQTQLDELNRFRVAGTFTFGYNVFNFSFYYSLNPLFDGTLEDENTPVNLVPLKIGLM
FT                   FYIL"
FT   gene            complement(647678..648160)
FT                   /locus_tag="CA2559_02755"
FT   CDS_pept        complement(647678..648160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02755"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02755"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87640"
FT                   /db_xref="GOA:A3U5X3"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5X3"
FT                   /protein_id="EAP87640.1"
FT                   /translation="MSKFKKKGNGDLPAISTASLPDIVFMLLFFFMVATVMRQNTLKVK
FT                   NELPYADQVEKLDKKDLVMYIYAGKPSERYQSTFGKEARIQLNDKFADVKDIQQFIYTE
FT                   RESKREELVPLLTTALKVDKETNMGLVSDIKQELRRAEALKINYTTRKGESSKNNE"
FT   gene            complement(648181..648795)
FT                   /locus_tag="CA2559_02760"
FT   CDS_pept        complement(648181..648795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02760"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87641"
FT                   /db_xref="GOA:A3U5X4"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5X4"
FT                   /protein_id="EAP87641.1"
FT                   /translation="MAKRSAPEVNAGSMADIAFLLLIFFLVTTTIETDSGISRKLPPIQ
FT                   PEEQDPPPLKEKNIFIVIVNSNNDLLVEDSPMELEDLREAAVTFLDNGGGQGPEACTYC
FT                   RGAKDPASSDNPNKAVISLQNDALTEYGTYIAVQNELVAAYNELRNREAQRLFNVSFIE
FT                   MEDAYKDANYNGDKEKLKERIQQIKDMYPEKLSEAEPKKRG"
FT   gene            complement(648798..649145)
FT                   /locus_tag="CA2559_02765"
FT   CDS_pept        complement(648798..649145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02765"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02765"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87642"
FT                   /db_xref="GOA:A3U5X5"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5X5"
FT                   /protein_id="EAP87642.1"
FT                   /translation="MGIWLFSTGNQSLVQPLMYIAYAVFLLTVLFVVIFVLKGLFSGNI
FT                   KNTLITVGAFLAVVVVAYLISNGVETPMKDGEMLSASGSKWVGTGLYTFYFLAIIAIGT
FT                   MIVTGAKKIFK"
FT   gene            complement(649231..649971)
FT                   /locus_tag="CA2559_02770"
FT   CDS_pept        complement(649231..649971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02770"
FT                   /product="MotA/TolQ/ExbB proton channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02770"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87643"
FT                   /db_xref="GOA:A3U5X6"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5X6"
FT                   /protein_id="EAP87643.1"
FT                   /translation="MVFSTINANATTDATALTTAVVAQEDAADDAVEESASFHQELKKR
FT                   FIEGGPEFMGIVLLCLILGLAIAIERIIFLNLSTTNTKKLAQDVEDALNSGGVEAAKEV
FT                   CRNTKGPVASIYYQGLDRADESIEAAEKAVVAYGGVQMGQLEKNVSWISLFIALAPMLG
FT                   FMGTVIGMIQAFDKIEAAGDMQPSLVAGGIKVALLTTVFGLIVAIILQIFYNYIIAKID
FT                   SIVNDMEDASITLIDMLVAYKKRK"
FT   gene            complement(650153..650240)
FT                   /locus_tag="CA2559_t07713"
FT   tRNA            complement(650153..650240)
FT                   /locus_tag="CA2559_t07713"
FT                   /product="tRNA-Ser"
FT   gene            complement(650326..651354)
FT                   /locus_tag="CA2559_02780"
FT   CDS_pept        complement(650326..651354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02780"
FT                   /product="L-asparaginase I"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02780"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87645"
FT                   /db_xref="GOA:A3U5X8"
FT                   /db_xref="InterPro:IPR006033"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="InterPro:IPR041725"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5X8"
FT                   /protein_id="EAP87645.1"
FT                   /translation="MKKGANILLIYTGGTIGMIKDFETGALKAFNFDELLQNIPELKLL
FT                   EHTIDTVTFEEPIDSSNMNPKYWVDMAEIIENNYDNYDGFVVLHGSDTMSYSASALSFM
FT                   FENLAKPIIFTGSQLPIGDLRTDAKENLITSIQIAGLQKNGKPVIAEVGLYFEYKLYRG
FT                   NRTTKINAEHFEAFASLNYPELVESGVHLKVNHTALKIPNRRKKLILHTDLDDNIIVIK
FT                   LFPGVNQKILEQILNIENLKGIIFETYGSGNATSSNWFIDLVKKTIKRGVVIINVTQCS
FT                   GGSVAMGQYETSVALKKIGVISGEDMTTESAVAKLMFLLGKNLAPNVFKTIFETSLRGE
FT                   IS"
FT   gene            complement(651351..652118)
FT                   /locus_tag="CA2559_02785"
FT   CDS_pept        complement(651351..652118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02785"
FT                   /product="Sec-independent protein translocase protein TatD"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02785"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87646"
FT                   /db_xref="GOA:A3U5X9"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5X9"
FT                   /protein_id="EAP87646.1"
FT                   /translation="MILTDTHTHLYSESFNEDRNAMVQRALDNNITRFFIPAIDSTYTK
FT                   AMYSLEKDFPSHVHLMMGLHPTHVKENFKEELAHVTQQFDERDFIAVGEIGIDLYWDKS
FT                   TLGMQQEAFKSQIQLAKSKNLPIVIHCRDAFDEVFEILESEKDESLYGIFHCFTGTQEQ
FT                   AQQAIGYNMKLGIGGVVTFKNGGLDKYLANIPLKHIVLETDAPYLAPTPYRGKRNESSY
FT                   LINIAEKLADIYNLTVAEIAEVTTENSKDVFGI"
FT   gene            652190..652624
FT                   /locus_tag="CA2559_02790"
FT   CDS_pept        652190..652624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02790"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87647"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Y0"
FT                   /protein_id="EAP87647.1"
FT                   /translation="MTLRQLLLKKGYKRIKLIRTATNHLELKATINSTEGTFILDTGAS
FT                   SSCVGFEAVERFQLLAEDSNVKAAGAGATDMLTQLSSKNKITIGKWAYKKLSLVLFDMT
FT                   HVNSALLAHDAEPVNGIIGADVLKKGKAVIDYKSMCLYLK"
FT   gene            complement(652632..653135)
FT                   /locus_tag="CA2559_02795"
FT   CDS_pept        complement(652632..653135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02795"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02795"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87648"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Y1"
FT                   /protein_id="EAP87648.1"
FT                   /translation="MIKNLLFIAIPMCLLFSCDTNKTKSNTSEIIEDQQIKEQTTGYLV
FT                   DSLTARGFETFPYKDEKTGDTIVMQKYFIAFLNRGEQRDQSKEVADSLQTLHMAHLGKM
FT                   YDLGLADISGPFGDDGDMRGITIYNVPTKDIADSLANSDPMVKAGRLSVIVKPWWAAKG
FT                   FGLR"
FT   gene            complement(653128..653604)
FT                   /locus_tag="CA2559_02800"
FT   CDS_pept        complement(653128..653604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02800"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87649"
FT                   /db_xref="InterPro:IPR012042"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Y2"
FT                   /protein_id="EAP87649.1"
FT                   /translation="MIEIERKFLVTSLDFITEKSNSYTIKQGFLNTHPERTVRVRIKDK
FT                   SAFLTIKGKPNASHRSRFEWEKQITITEAENLLKLCERGVIDKTRYEVQSGSHTFEIDV
FT                   FEGDNKGLTIAEVELSEENETFLKPDWLGEEVTGDTKYYNSQLSKTPFNTWIND"
FT   gene            complement(653604..654251)
FT                   /locus_tag="CA2559_02805"
FT   CDS_pept        complement(653604..654251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02805"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02805"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87650"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Y3"
FT                   /protein_id="EAP87650.1"
FT                   /translation="MSKTAIVLGATGLVGHHLLEEILQDESYEKVTLFSRSPIKKTHPK
FT                   IEEHLIDLFNLENYCNEFKANDVFCCIGTTKSKSPDKKMYKKVDYGIPIDAAKLSGLNN
FT                   IEKLLVVSAMGANRKSKVFYNRVKGQMERDVQFYNSNETYIFKPSLIGGKRNESRVGET
FT                   IAKAFFSVLNPILPKKIRSIHPQDIAKAMMHVAKTGYNSSKIPSDEIRMLAK"
FT   gene            654397..655503
FT                   /locus_tag="CA2559_02810"
FT   CDS_pept        654397..655503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02810"
FT                   /product="DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02810"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87651"
FT                   /db_xref="GOA:A3U5Y4"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Y4"
FT                   /protein_id="EAP87651.1"
FT                   /translation="MSKHFFERKIIHVDMDAFYASVEQLDNPDLRGKPIAVGGGGKRGV
FT                   VSAASYEARVFGVRSAMSGAQAQRLCPELIFVKTNFTRYKECSQQIREIFYEYTDKVEP
FT                   LSLDEAYLDVTENKKGNPSATLIAKEIREKIKAKTGLNASAGISINKFIAKVASDINKP
FT                   NGQKTINPEEVIPFLETLDIRKFYGIGKVTAEKMYLHGIFTGNDLKSKSLEYLEEHFGK
FT                   SGTYYYHIVRGIHNSEVKPHRTRKSLGAERTFSENITSELFMMERLEHIAEEIERRLEK
FT                   SNVAGKTVTLKIKYSDFTLQTRSKTLPYYLRKKEVILETAKELLYQDDMKNSVRLLGIS
FT                   LSNLNTEDRPKAKPSLKKEIAVQLKFEF"
FT   gene            complement(655500..656090)
FT                   /locus_tag="CA2559_02815"
FT   CDS_pept        complement(655500..656090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02815"
FT                   /product="probable fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02815"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87652"
FT                   /db_xref="GOA:A3U5Y5"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Y5"
FT                   /protein_id="EAP87652.1"
FT                   /translation="MPLVTPLDASHDKETAELAEFFNETLGFCPNSVLTMQRRPAISKA
FT                   FINLNKAVMANEGRVTSSLKRMIAWVSSNATGCRYCQAHAIRAAERYGAEQEQLDNIWE
FT                   YRTHSAFSDAERAALDFSLAASQVPNAVDADIQKRLHEHWDEGEIVEMLGVISLFGYLN
FT                   RWNDSMGTTLEGDAIESGNQYLGKHGFEVGKHV"
FT   gene            complement(656130..656432)
FT                   /locus_tag="CA2559_02820"
FT   CDS_pept        complement(656130..656432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02820"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87653"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Y6"
FT                   /protein_id="EAP87653.1"
FT                   /translation="MKYVYVILLVLCCLGCKSTKVAPETSTYEGVLKVQGITTYQYGTH
FT                   TLTNENDVYALTSDTIILDDFDSEYVEITAKRVDGYPVENGPIYLNVKTIKIKNQ"
FT   gene            656499..658205
FT                   /locus_tag="CA2559_02825"
FT   CDS_pept        656499..658205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02825"
FT                   /product="single-stranded-DNA-specific exonuclease recJ"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02825"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87654"
FT                   /db_xref="GOA:A3U5Y7"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Y7"
FT                   /protein_id="EAP87654.1"
FT                   /translation="MRWTLKPKPDYTKVTALSAALSVPENIAALLVQRGITNYDEAKSF
FT                   FRPSLSELHNPFLLKDMDVAVTRIEKAIKESENILVYGDYDVDGTTSVALMSSFLKTKT
FT                   PNVATYIPDRYDEGYGVSYKGIDFAADNDITLIIALDCGIKAIDKVAYAKEKGVDFIIC
FT                   DHHRPGKQIPDAIAVLDPKRDDCNYPYKELCGCGVGFKLIQAINEQSGGTINDLLGYLD
FT                   LVATAIGADIVPMTGENRILAYHGLHIINTAPRMGFYAIIKQVKKETLTITDVVFIIAP
FT                   RINAAGRMKHGNHAVTLLTETDINLAAKYAQEIETFNKDRREADKSITEEALLQINDNS
FT                   EKDCKTTVVYHESWHKGVIGIVASRLTETYYRPTLVFTKSGEKLAASARSVKGFDVYNA
FT                   LEACSKHIEQFGGHKYAAGLTLLEKDYENFKAEFEKVVSETIDERLLTPEINIDSELDL
FT                   ADITPKFFRILKQFAPFGPGNMHPTFMTKNVRDTGYGKCVGQDNAHLKLAVQPNNVPKS
FT                   DKRGIGAIGFNLGNKCELTTDRKTFDIVYSIDENEWNGNVSLQLKLKDLNA"
FT   gene            658205..659200
FT                   /locus_tag="CA2559_02830"
FT   CDS_pept        658205..659200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02830"
FT                   /product="type II DNA modification enzyme
FT                   (methyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02830"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87655"
FT                   /db_xref="GOA:A3U5Y8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Y8"
FT                   /protein_id="EAP87655.1"
FT                   /translation="MNYIGSKQSLLPFLEKTILNVCGNDISEFVFCDLFAGTGTVGHYF
FT                   KLKVKQVISNDLEFYSFVLNRNYIGNSRAIDSFKLLEQLRGVKGVEGFIFQNYAEGGAA
FT                   NRLYFSAENGKKIDAIRQQIEAWKTAEKISDDVYFFLLASLLESADKVANTASVYGAYL
FT                   KKLKTSAQKTLELKPAEFAETNQDNLVFQQDANSLIKEISGDILYLDPPYNARQYGANY
FT                   HLLNTIAHYKPFTPKGKTGLPEYNKSDYSSKPKVAEAFEELIKNAGFKYIFLSYNNEGL
FT                   LPPEQLREILERYGRYDLATTKYNRFKADKTENRNHKASSVVEYLHVLTK"
FT   gene            complement(659230..659988)
FT                   /locus_tag="CA2559_02835"
FT   CDS_pept        complement(659230..659988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02835"
FT                   /product="putative UDP-2,3-diacylglucosamine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02835"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87656"
FT                   /db_xref="GOA:A3U5Y9"
FT                   /db_xref="InterPro:IPR010138"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Y9"
FT                   /protein_id="EAP87656.1"
FT                   /translation="MKLPKDKYIYFSSDNHLGAPTDELSKPRELKFVAWLDEVKKDAEA
FT                   IFLLGDLFDFWFEYKHAVPKGFVRVLGKLAEIRDSGIPIYFFVGNHDLWMRDYFQKELN
FT                   IPVYHKPKEFTFNDKTFLIGHGDGLGPGDKGYKRMKKVFTNKFFQWCYRWLHPDIGVPI
FT                   AKHLSVKNKLISGDEDAKFLGEDNEWLVQYAKRKLEQKHYDYFVFGHRHLPLEIEVGNN
FT                   SKYINLGDWISYYTYGKFDGETMSLNTFKE"
FT   gene            complement(659991..660443)
FT                   /locus_tag="CA2559_02840"
FT   CDS_pept        complement(659991..660443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02840"
FT                   /product="6-pyruvoyl tetrahydrobiopterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02840"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87657"
FT                   /db_xref="GOA:A3U5Z0"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Z0"
FT                   /protein_id="EAP87657.1"
FT                   /translation="MSHIRITKQFSFETGHALYGYDGKCKNVHGHSYKLSVTVIGTPIS
FT                   DTSHVKFGMVIDFGDLKKIVKEEIVDVYDHATVFNKNTPHVDLAKELSNRGHNVLLVDY
FT                   QPTSEMMVTDFAEKIKTRLPEHISLHSLKLQETETSFAEWYASDNM"
FT   gene            660540..661178
FT                   /locus_tag="CA2559_02845"
FT   CDS_pept        660540..661178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02845"
FT                   /product="Oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02845"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87658"
FT                   /db_xref="GOA:A3U5Z1"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Z1"
FT                   /protein_id="EAP87658.1"
FT                   /translation="MSTTQLFEDITFTENESYERIISDLITKKYSIVDDFFTLEEVSTL
FT                   KESLLIKYEEDSFKKSAIGNYTNQEIDKTIRGDFILWIDEKKEEPTEQLFFAKVNSLVS
FT                   YLNKTCFLGILTKEFHYAVYPTGTFYKRHLDTFQNDDRRKLSMVFYLNEDGWLPEFGGE
FT                   LTLYLDGGDKTILPLPGRVVIFESQVIEHEVKRVMANERLSITGWLKTR"
FT   gene            complement(661183..661281)
FT                   /locus_tag="CA2559_02850"
FT   CDS_pept        complement(661183..661281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02850"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87659"
FT                   /db_xref="GOA:A3U5Z2"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Z2"
FT                   /protein_id="EAP87659.1"
FT                   /translation="MEILQFLSGAGLFLILGLVLVGVFIYKKIKNR"
FT   gene            complement(661321..662658)
FT                   /locus_tag="CA2559_02855"
FT   CDS_pept        complement(661321..662658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02855"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02855"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87660"
FT                   /db_xref="GOA:A3U5Z3"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Z3"
FT                   /protein_id="EAP87660.1"
FT                   /translation="MSKLNISFKHINKLAIPALLTGIAEPILSATDAAVVGNIDVNATE
FT                   ALAAVGIVGSFLSALIWILGQTRSALQAIISQYYGANKLDEVSTLPAQAIYFNVLLSIV
FT                   ILGSTVFFIQDIFSLYNADGLILKYCVDYYEIRVWGFPLTLFTFAVFGIFRGLQNTFWP
FT                   MVVAIIGAVLNIGLDFILVYGIDGYIPEFGLKGAAYASLIAQAVMAILALLLLLKKTNI
FT                   SLRLKFPIHTELYTLIGMALNLFVRTIALNVALYLANAFATDYGKNYIAAQTILINIWL
FT                   FSAFFIDGYAAAGNILSGRLLGAKDYEGLLKLAKKVSLYGMAVGLFLVVIGFLLYTPLG
FT                   LLFSKEPMVIQRYKEVFWIVALMQPLNAVAFIFDGIFKGLGKMKYLRNVLLISTFVGFV
FT                   PTLFILDYFDYKLYSIWVAFVVWMLFRAGALIIAFRKQYAPKAAVQ"
FT   gene            complement(662683..663330)
FT                   /locus_tag="CA2559_02860"
FT   CDS_pept        complement(662683..663330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02860"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87661"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Z4"
FT                   /protein_id="EAP87661.1"
FT                   /translation="MDYNNKPDGYYNNVRQEMLAYLPANAKKVLDVGCGNGAFAATIKT
FT                   KNSAEVWGIEYMDEEAKQAEQVLDNVFSGPCESFIKDLPDNFFDVIYFNDVLEHLVDPY
FT                   DVLDQIKHKLAPSGVVISSIPNMRYYNAFIKLLVKKDWQYEGHGIMDKTHLRFFTNKSI
FT                   KTMYKDAGYTITTHEGINKTKSIRPLLFNIPLLFTQMDMLNLQYATVAKFDR"
FT   gene            663476..664282
FT                   /locus_tag="CA2559_02865"
FT   CDS_pept        663476..664282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02865"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02865"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87662"
FT                   /db_xref="GOA:A3U5Z5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Z5"
FT                   /protein_id="EAP87662.1"
FT                   /translation="MVSNLKCSLITPTYNWPEALELLLLSIKNQTHLPNEVIIGDDGST
FT                   QDTKNLIERMQADFPVPLHHIWHEDLKNRKPAIMNKAIASAKYDYIIEIDGDIIMHKDF
FT                   VKDHLSLAEKGQFLYGSRVNIQEDYLQTLFKEKKITFNYFSKGIKKRGRTLRIPFLANS
FT                   YKKEDSRSSKLRGCNMSFWRDDFIKVNGFNEGLTGWGIDDSEMIQRLINIGVKGKRLKF
FT                   KGIVYHIYHKEQDKSHIEINEIIERETTEKNLTYIEKGVDQYLKNE"
FT   gene            664352..665212
FT                   /locus_tag="CA2559_02870"
FT   CDS_pept        664352..665212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02870"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87663"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Z6"
FT                   /protein_id="EAP87663.1"
FT                   /translation="MFEHTSTTLKCQYIIVDNGSTKKSYLHVKNYIDSIANEHPIILVR
FT                   SNINTGFGGGNMLGVQHAKGQYLAFVNNDTVLESDCLVVLKKFMDTRPDVGVCGPQAFT
FT                   DDKKILPTIDHFASPVREIFGRSFLETIQPKKYPKRKRLYSTPQQGQFIAGSFMFFRAS
FT                   DFNTIGGFDTNIFLYYEETDTCRRLAKLNKSAYLVPEASFIHYHGASTEKSVAIKTELK
FT                   ISLLYVVRKHQGLIPFYILLTFLQVRYFISSLVKPKYWSLFYTLFLQAPLTRSLKHKQQ
FT                   ITPIY"
FT   gene            665217..666203
FT                   /locus_tag="CA2559_02875"
FT   CDS_pept        665217..666203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02875"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02875"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87664"
FT                   /db_xref="GOA:A3U5Z7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Z7"
FT                   /protein_id="EAP87664.1"
FT                   /translation="MNILIECRYAIIPTKTYGGIERVIWCLGKELSNLGHQVYFLVDKT
FT                   SVCNFATVIPYDASKSIESHIPEFIDVIHFNRTPTFKVKKPYVVTIHTNPPESENLSKN
FT                   TIFISKNHAKRYGSEAFVYNGIDWSDYPKPNLESTRNGFHFLGKSAWKLKNVFGAAKIA
FT                   LAANEKLHVLGGKRFTFRNFKRGLVYMLSPKVIFHGMVNNQKKIEVAESSKALVFPVIW
FT                   NEPFGLAIIESLYAGCAVFGTKVGALEELISPEVGVTSNSYEDLIFAAKSFNYNPKACY
FT                   DYAVKNFNAKVMALGYIAYYNTVLAGDTVNPEPPKFVSEYNTVPKIV"
FT   gene            666271..667065
FT                   /locus_tag="CA2559_02880"
FT   CDS_pept        666271..667065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02880"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87665"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Z8"
FT                   /protein_id="EAP87665.1"
FT                   /translation="MKNILVPIGSSKNAISNLQYAIDLASFIGDVNVYVISVFKEFSKA
FT                   GTGTRLNRVIEDDTKNNLEDVINAVDKKDISVVAHPLKGNVVEGVERFNKHIPVDLMVI
FT                   GPRSNSVKEEVYLGNTSGKLVKQTNIPILVVPEGYTFKNVDSILMAFKSGTISKKKVLN
FT                   PLMELIEGFDAELNLLRVITPDATEEDAKINDRLTKIKNSIVETENATTFQGVLEHFQS
FT                   HNPDMLCVVRRKRGFFKKLWEKNIILKKEFYCNIPLLVLSGK"
FT   gene            667081..667154
FT                   /locus_tag="CA2559_t07685"
FT   tRNA            667081..667154
FT                   /locus_tag="CA2559_t07685"
FT                   /product="tRNA-Ala"
FT   gene            complement(667211..667405)
FT                   /locus_tag="CA2559_02885"
FT   CDS_pept        complement(667211..667405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02885"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02885"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87666"
FT                   /db_xref="GOA:A3U5Z9"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A3U5Z9"
FT                   /protein_id="EAP87666.1"
FT                   /translation="MTMILASISLAIGAPQIILIVVVVLLLFGGRKIPELMRGLGSGIK
FT                   EFKDASKDDDEDTKKVDNK"
FT   gene            667438..668400
FT                   /locus_tag="CA2559_02890"
FT   CDS_pept        667438..668400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02890"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02890"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87667"
FT                   /db_xref="GOA:A3U600"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A3U600"
FT                   /protein_id="EAP87667.1"
FT                   /translation="MLSLLLIEYNSITKRFLSGNIENSIFVNQQNAMAKKEKKQLKKRL
FT                   LHKYRMVILNEDTFEERVSLKLTRLNVFILVTLTSLLLIAGTTVLIAFTPLKEYIPGYS
FT                   STSLKLKATELTYKTDSLETALAINNQYYESIKKVLSGDVKSTDIDKDSILEAARISID
FT                   SINLSPSEEDLKLREKVALEDKYNVFEETNPSNLNVTLFPPVNGSISEGYNFKEKHYAV
FT                   DVVVAKDAPIKAAADGTVIFAEWTAETGYVIIIEHGNSLITVYKHNSALQKEQGSLVST
FT                   GEVIATAGSTGEYTTGPHLHFEIWSNGYPLNPSDLIDFE"
FT   gene            668404..669897
FT                   /locus_tag="CA2559_02895"
FT   CDS_pept        668404..669897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02895"
FT                   /product="putative auxin-regulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02895"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87668"
FT                   /db_xref="InterPro:IPR004993"
FT                   /db_xref="UniProtKB/TrEMBL:A3U601"
FT                   /protein_id="EAP87668.1"
FT                   /translation="MSLKSFAAKVFAHYHRRKIDRWAANPIKTQERVLRELINGAKDTK
FT                   FGKDHNFVIIKDHTDFAKYVPVRDYEDLKPYVEEAVAGKEDILWKGKPLYFAKTSGTTS
FT                   GSKYIPLTKESMPGHINAARNAILCYIAETNNADFVDGKMIFLQGSPELNEQNGIKLGR
FT                   LSGIVAHFVPNYLQKNRMPSWETNCIEDWETKVDAVVEETINEDMTVISGIPPWVQMYF
FT                   ERLKEKSDKDIKDLFKNFNLFIYGGVNYEPYKPIFEKLIGKKVNSIELYPASEGFFAFQ
FT                   DKQDDNGMLLQLDSGIFYEFIEADKFFDKNPKRLTLKDIKLNVNYVMLISSNAGLWAYN
FT                   VGDTVQFTSLKPFKVIVSGRIKHFISAFGEHVIAKEVEEAMKDACSSYQVSISEFTVAP
FT                   QIEPKQGLPYHEWFVEFETEPKDIAAFSSRIDQALQQQNSYYKDLIDGKILRPLEIFKV
FT                   KKNGFKEYMKTQGKLGGQNKLPRLSNDRKIANSLYELQS"
FT   gene            669921..671582
FT                   /locus_tag="CA2559_02900"
FT   CDS_pept        669921..671582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02900"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87669"
FT                   /db_xref="UniProtKB/TrEMBL:A3U602"
FT                   /protein_id="EAP87669.1"
FT                   /translation="MSKETQNNRSRAQESTNAIERMYITMRHLFNRGFYKPMGVSGETL
FT                   RESLLTLRPEIYGTIAEEKVELQGLLYVIDRLPFGIEECSFINLTSDEGYGDSHFKPII
FT                   PPKRRRNCYRIDDEQMNIEITRGRSEIYDILTHLTFLFMESHKIMRRVIINENGDVTRD
FT                   WKKLEKAVLQKEDLSQAEREIALTHTANIIGRTFKEVSTVYPQFNTSDSNDRFLHVIYW
FT                   LGKLAIEEVIHNNKRLVTFTPVLRERLGHHIHGEIWATKIKETLLELGLLERPLHIISA
FT                   NMHSVMNTLYAPTSLTTELKKKNIDAIYEDLSNSASGKLRTKVMKTALANGMTYLEDKS
FT                   GANINVQIFDIAKLDKSLEAKTAPVIMVMDYAFGEQAYETMDELLKPYTTESGTTLMNV
FT                   KSVSIMGKAGILQGGKGDIMIPNAHLFEGTADNYPFVNELKVEDLENQGLDVYDGSMIT
FT                   VMGTSLQNKDILRFFHHSTWNVIGLEMEGAHYQKAIQAASRIRGSIKDDVKVRYAYYAS
FT                   DNPLETGSTLASGGLGTTGVKPTYLITKKILEQILN"
FT   gene            671589..672656
FT                   /locus_tag="CA2559_02905"
FT   CDS_pept        671589..672656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02905"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02905"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87670"
FT                   /db_xref="GOA:A3U603"
FT                   /db_xref="UniProtKB/TrEMBL:A3U603"
FT                   /protein_id="EAP87670.1"
FT                   /translation="MSEETTQKKDSQEEINIIELFKVIGNGFGNLFRWIGRLIHNVFVL
FT                   FILILSFLKKYLIFIIIAAILGFVAERIASKYKSEVYEATAVVQTNYEIEFQLRARIQE
FT                   FNELIINQDSIKLGRLLEIEPSKAAKLISFEIEPIYSINKLRFDYYDYIYEQDSTLQKN
FT                   FSFNMYEEEMRFEDYDNFEIKAHSSENESFSLLNNKLWDFSDSPNITDRRDREMDVLLN
FT                   KKKLLENSLKSIDSTRSVLRQVLITEANKPQNGAGTNIDLGAKEAYKETPELYSYEKDL
FT                   SLELVSTIQDINKSKNFVNVIKRFPEYGSPFRIIKSYYLSIAFILLAILIILGIKLFKY
FT                   LGSVEQNETWKFKKL"
FT   gene            672700..673818
FT                   /locus_tag="CA2559_02910"
FT   CDS_pept        672700..673818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02910"
FT                   /product="GDP-D-mannose dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02910"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87671"
FT                   /db_xref="GOA:A3U604"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3U604"
FT                   /protein_id="EAP87671.1"
FT                   /translation="MSQKIALITGVTGQDGAYLSEFLLKKGYIVHGIKRRSSLFNTDRI
FT                   DHLYQDPHVENQNFFLHYGDLTDSTNLIRIIQEVKPDEIYNLAAMSHVQVSFEMPEYTA
FT                   NTDGLGALRLLEAIRILGMENNVKLYQASTSELYGKVQEVPQTENTPFYPRSPYAVAKL
FT                   YAYWATVNYREAYNMFACNGILFNHESPIRGETFVTRKITRAASKIALGLQDKMYLGNL
FT                   DAKRDWGHAKDYVKMMWMILQAEEPEDWVIATGKTTSVRDFVTMAFDYLGVTLKFEGKG
FT                   IHEKGIVTAVSKSEYNISLGQEVIGIDEKYFRPTEVELLIGDASKAFKKLGWKPDHKLE
FT                   DLVYDMMKSDLNLMKKESYLKKGGYTIMNYFE"
FT   gene            673821..674909
FT                   /locus_tag="CA2559_02915"
FT   CDS_pept        673821..674909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02915"
FT                   /product="GDP-fucose synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02915"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87672"
FT                   /db_xref="GOA:A3U605"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3U605"
FT                   /protein_id="EAP87672.1"
FT                   /translation="MLKDALIFVAGHRGLVGSAIVNELKSRGYHNIITRTHKELDLTNQ
FT                   VETEQFFSEHKPDYVFLAAAKVGGIVANNTYRGSFIYENLMIQNNVIHHSYLNNVKKLL
FT                   FLGSTCIYPKDSQQPIKENYLLNSPLEYTNEPYAIAKIAGIKLCESYNIQYNTNYISVM
FT                   PTNLYGYNDNFDLEKSHVLPALLRKIHLGKALELDDWEIIKEDLNKLPIGAISGKSPKE
FT                   DILKVLTSFGITKKDDVVSVEIWGSGTPRREFLWSEDMAKACVFIMQQVNFNDLIKDKG
FT                   SFIRNTHINIGTGKDISIKELAFSIKKHLGFRGEFTFNTSKPDGTLKKLTDVSKLNKLG
FT                   WSHDIETEEGIQKLYNWYKASK"
FT   gene            674925..676175
FT                   /locus_tag="CA2559_02920"
FT   CDS_pept        674925..676175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02920"
FT                   /product="O-antigen transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02920"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87673"
FT                   /db_xref="GOA:A3U606"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A3U606"
FT                   /protein_id="EAP87673.1"
FT                   /translation="MFKNYLKAKENRTIASNYVSLLVLQAANYILPLLVLPYLVRVLGT
FT                   DKFGLIMLAQSLTIFFNVFVDYGFNLSGTREVSLARDDKKKLSEIFSAIFVIKAFLLLI
FT                   AFSIFYFIISVFTRFSVDISVYLYSFGLVIGQALFPVWFFQGIEKMKFVTLINILAKSI
FT                   FTALVFILITKEQDYIYVPIYNSLGFIIAGLLGVGLCFKYVYITRPKIDLIKQLLSDST
FT                   SLFVSNFAISLYTSSNVFILGMFTSNTTAGIYSSIEKLILAIKNVYTPLYQAFYPWLSK
FT                   QGDLKKINTIKKLLPYILLVSTIISIIIIVLGKTLLDIIYDDNLISNYAIVFKALSLIS
FT                   IFSGLNMLFNALFLPAIKKYKTRMNIMICAGLFNLTVSLVLVNYYGIYGTTISVVLTEF
FT                   LLLILGYIYFKKYATVS"
FT   gene            676172..677248
FT                   /locus_tag="CA2559_02925"
FT   CDS_pept        676172..677248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02925"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02925"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87674"
FT                   /db_xref="GOA:A3U607"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A3U607"
FT                   /protein_id="EAP87674.1"
FT                   /translation="MSKLIIIQTVIPDYRVKFFTYLKIKLEDNFILFGGERFFKETITT
FT                   DKTISFHRAVKNIFFFNRNFLFQTGPFWKYVLKPNTTFVISLNPRNISNWLILILRKIL
FT                   NRKTIVWGHAWPRSGPNSKSDLLRHFMRLLANEIIVYTKTQEEELSLKMPSKPIYTASN
FT                   ALIFKKEMVASTQDLNDKNNILYVGRLTKGKKPLFLIKAFLTLHSSLPKNSQLIIIGDG
FT                   EEKKALENYIIKNNIAHKVKLLGHISNYSELKTQYDNALFSVSPGYVGLSVTQSFGFGV
FT                   PMLVSENENHSPEIEAVHPNENALYFKTDDIEDFKNKSLLFFENKDFWINKRSVICNFC
FT                   QNKYSIEAMAEPFLMNLD"
FT   gene            677255..678673
FT                   /locus_tag="CA2559_02930"
FT   CDS_pept        677255..678673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02930"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87675"
FT                   /db_xref="GOA:A3U608"
FT                   /db_xref="UniProtKB/TrEMBL:A3U608"
FT                   /protein_id="EAP87675.1"
FT                   /translation="MNLRTFLIFVYLVTSIPLFLFFYTDISVWLSFFVNYLFITAITYY
FT                   HLEVEKTYSPFLSAYIVFNFLFFIVAPIIQINAIDPEVNTFINFFPYSSNVVIYTNAVI
FT                   LFFNIIFFLSYVHFKSKRVYIKALPKSPSPFTPIIAITLVIICAVILITNFGFLINEIE
FT                   RANWMKPDTSVGSLLIRKKVLFLVPLGGVAICFSYLRSKVKLSRNSIIIFGVMLIMLFI
FT                   LLVLKNPLTEKRNALGPIYISLIYLFFPKIINKNAKSFLFLFISMIIAFPLISALTHLR
FT                   ITFQEMIEHPEEIVEYLQKEGILRAFSTLHYDAYANIIATVDYVKLNGLEYGHQLLSSL
FT                   LFFIPRGIWEGKPYSTGQVVGDHLIEEYGFRFNNISNPIVSEGYINFGWVGVFLMAIAL
FT                   SFAIIKLMQWLNSGDALKEIISFYFAIHLLFLLRGDFTNGYAYFIGTLLGVVVIPKIIE
FT                   KCITFSFSKSKTSS"
FT   gene            678670..679896
FT                   /locus_tag="CA2559_02935"
FT   CDS_pept        678670..679896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02935"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02935"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87676"
FT                   /db_xref="GOA:A3U609"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:A3U609"
FT                   /protein_id="EAP87676.1"
FT                   /translation="MMQFSSKNWFYLGCLVMMCSILLPFDKKPLAIGVFALFALITIIK
FT                   NKLKFNLKFFLINACVSILFLISLLYTENLDTGFKKIEQTASLLVFPWYFAFLVNSKYK
FT                   LYGNSKVLYKLLYAFILSAILLNLYYFLYFYFTEFTFADVLYHYSHLIDDKIEGYMIHP
FT                   IYLSMHLCLSLIFLMFIPLKRNILNFTIRGLLVFLIVFFMFLMSKKGPMIAIGLIALFY
FT                   FFKHNKSSLIRGLGVSIICLCVCFLFINDRANRNFKELFSIDTIENNVTSTNIRYSIYK
FT                   NAIVIFKEEPLIGYGIGDSKNTLFEKNKETSDLLFAGQYNTHNQYLSFLLALGIIGTTI
FT                   IIICYIIVFKNQKSKNNYLAIYTIAFYALVMLTENILERQDGVIYFSYFSCFLQTISTQ
FT                   ELPWRKNNV"
FT   gene            679875..680969
FT                   /locus_tag="CA2559_02940"
FT   CDS_pept        679875..680969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02940"
FT                   /product="polysaccharide biosynthesis protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02940"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87677"
FT                   /db_xref="UniProtKB/TrEMBL:A3U610"
FT                   /protein_id="EAP87677.1"
FT                   /translation="MEKKQRIIIIGPFPNPITGLSVANLTLYEGLLNKKYMVSKLDTSY
FT                   SKFEDKTGSFSFDKLFFFITISFNIKCVLNNDVIYITIGQSFFGVLKYSFYILLGKLLS
FT                   KEVIIHLHGNYLGDMHHNLSGLKKQLVKFILSKIDKAIVLSKSLKNNFTPFIDVSNIYV
FT                   LTNFVSKDILLTNTEKEKLETINEPRIVFLGNLMTGKGIQYFFESLESLELEGFKFTAK
FT                   CAGTMDSKKTVEYNKKIDSINSLEYLGVVRGEKKKQLLKWSNILICPSVMVEGLPLSIL
FT                   EAMATGNKIIATKQPALQDMFNNTQITFIKKESSFEISEAIKKVSKHSRAQEDIIKFNM
FT                   NYIEKLTTLKFIEGFISIMNIENE"
FT   gene            680962..681522
FT                   /locus_tag="CA2559_02945"
FT   CDS_pept        680962..681522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02945"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02945"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87678"
FT                   /db_xref="GOA:A3U611"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A3U611"
FT                   /protein_id="EAP87678.1"
FT                   /translation="MNEFQKLDDYSTPNGFRGKSKVYVQFWWIAQSLLFKPSPQLFYGW
FT                   RRFILRCFGAKIGKGVLIRSSVSIVYPWKVKIGDYSWIGDDVVLYSLGKINIGKHAVIS
FT                   QRSYLCTGSHDYLKRDFAIFAKPIHIKDECWLATDVYVAPNVTIGKGTVVGARSSVFKD
FT                   LPKGKVCLGSPAKVIKNRSTATS"
FT   gene            681746..682747
FT                   /locus_tag="CA2559_02950"
FT   CDS_pept        681746..682747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02950"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02950"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87679"
FT                   /db_xref="GOA:A3U612"
FT                   /db_xref="UniProtKB/TrEMBL:A3U612"
FT                   /protein_id="EAP87679.1"
FT                   /translation="MPNSPSFIKRILHILDFSFGSLINSFKIKSTDLVISIIPVTPSAG
FT                   IGWLLKKRLNAKLWVHIQDFEFDAALQSGLTTKKKFSLKTPLFGLLFKVESWLLNKADI
FT                   TSTISNTMLEKLSAKTKSPTYFLPNWVDNEKIDKTYKKPHKYFSSNKFKILYSGNIGDK
FT                   QDWDTFVQYASKLDKQRYELIVIGDGSKKAWLKENTKTLPQVSHYEPVPYEDLGHVLSS
FT                   AQLHILFQKTEIVDTVMPSKILGMMGSSVPSLVTGSSLSEVKKTIQESEGGKYVDEAEF
FT                   SINALLTYTECLFNDESYSQKIGENAKCYIISKFSKNVILKEMESRIATLLK"
FT   gene            682889..683908
FT                   /locus_tag="CA2559_02955"
FT   CDS_pept        682889..683908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02955"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02955"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87680"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3U613"
FT                   /protein_id="EAP87680.1"
FT                   /translation="MLCLNVKQVSMPKRVLITGAAGFVGSHLCDKFINEGCHVIGMDNL
FT                   ITGDLKNIEHLFALENFEFYHHDVSKFVHVAGSLDYIMHFASPASPIDYLKIPIQTLKV
FT                   GSLGTHNLLGLAKEKGARILIASTSEVYGDPKVHPQAETYYGNVNTIGPRGVYDEAKRF
FT                   QESITMAYHRFHGLETRIARIFNTYGPRMRLNDGRVIPAFIGQALRGENLTVFGDGLQT
FT                   RSFCYIDDQVEGLYSLLMSDYTDPVNIGNPEEITILDFAEEIIKLTNSDQKIIFKPLPT
FT                   DDPLQRKPDITVAKRELSWSPKVSREDGMQKTYAYFKGLSEEELYRSEHKDFSKHIVK"
FT   gene            684007..685263
FT                   /locus_tag="CA2559_02960"
FT   CDS_pept        684007..685263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02960"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02960"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87681"
FT                   /db_xref="GOA:A3U614"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:A3U614"
FT                   /protein_id="EAP87681.1"
FT                   /translation="MPLEYLNYIIFVTIGWLILSLKLRFYDVYRFTRATKIAALVLQQA
FT                   FFFTLIVFSFFGFYNELNRSATEIVIYIAEVIGLITLIKFTIFYFLKKYRVILGGNYRQ
FT                   TVIVGVNEKTLKLKEFFTSNPEYGYHLKHMFEVNDTNELALQDCYEFILTNSIDEIYCS
FT                   ISELNDEQMKSLIDFADNNLKVLKFLPDNKEIYTKKMNYDYYGYLPILSLRSIPIDDPI
FT                   NQIIKRVFDIALSIFVLVFILTWLTPILAILIQLESKGPVFFKQKRNGLDYKEFSCYKF
FT                   RSMKPNPTAHIHQVTRGDTRITKVGKFIRKTSIDELPQFINVLFGDMSVVGPRPHMVSH
FT                   TEMYAERIDKFMVRHFVKPGITGLAQVSGFRGEVETDDDIINRVKYDIFYVENWSLLLD
FT                   IKILLLTIKNTAKGEDKAY"
FT   gene            complement(685260..686426)
FT                   /locus_tag="CA2559_02965"
FT   CDS_pept        complement(685260..686426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02965"
FT                   /product="lipopolysaccharide biosynthesis protein, putative
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02965"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87682"
FT                   /db_xref="GOA:A3U615"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A3U615"
FT                   /protein_id="EAP87682.1"
FT                   /translation="MKEICIVTNYFPPETGAASNRISFLATLLAKKGYKVTVLCPLPNY
FT                   PKGQIFKGYRRSFFRKEAQANISVHRLWLYATNSKNKWKRLFSMLSFSVSLLFYRCFKK
FT                   PAEVVIIQSPPLLIAYSAIRLYASKKRKVILNVSDLWPQAGLDLGALKKGKFYNYLKTI
FT                   EAYNYTKADMVMGQSQEILDHVRSIHPQKEMVLYRNFPDIKFNTDSTISINAPVKIIYA
FT                   GLLGVAQGILELCKHIKLPENVELHIYGDGPEKQALLQYLDSANKNNIICHGEVSKSEL
FT                   HTLYENHHIALVPLVRPILGSVPSKIFEIAHFGLPILYMAGGEGEHIVKEHALGYVINT
FT                   QDYKELNETLCTLKVKDLLDNRIEIKAIAKKHFVIEKQLQQLLNAIEA"
FT   gene            complement(686423..687730)
FT                   /locus_tag="CA2559_02970"
FT   CDS_pept        complement(686423..687730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02970"
FT                   /product="possible capK protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02970"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87683"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A3U616"
FT                   /protein_id="EAP87683.1"
FT                   /translation="MNWFNLSLKLNNYPLNSAKRRLSEIVNIPEKDYQSYIDERKLNIV
FT                   EHHFNTTAYYKSLCNGKLPKHWSDVPIVTKGNFQVPLQDRLSAGFTAKNTYVNKTSGSS
FT                   GHPFIFAKDKTCHALTWANIIKNFGGLGLDFNTSYQARFYGIPLDKLGYYKERVKDTFA
FT                   KRYRFPIFNINEETHEFYIKTFTAKQFDYINGYTSVIVLFAKYLKQKNIILKDICPSLK
FT                   VCVVTSEMLFEEDKLLLEQYLGIPIVNEYGASELDIIAFQDVEGNWRINTETLFVEVLN
FT                   EQNKPVSLGEPGKLVITSLYNTAHPFIRYEIGDLGILREDSTAKHTFLKSLIGRSNDIA
FT                   KTPSGKIVPGLTFYYVTKSVIEDQGNVKEFVVKQTKLDSFKIEYVSKEELTQAFKTRVK
FT                   EALSNYLEPGLHLELIRVEQLKRSKSGKLKQFESLL"
FT   gene            687893..689176
FT                   /locus_tag="CA2559_02975"
FT   CDS_pept        687893..689176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02975"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02975"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87684"
FT                   /db_xref="GOA:A3U617"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A3U617"
FT                   /protein_id="EAP87684.1"
FT                   /translation="MNILLLGSGGREHAFAHKLIQSPQCDNLFVAPGNAGTAAIAKNLD
FT                   LSVTNFQAIKDTVLTHQINMVVVGPEDPLVNGIYDYFLKDDLLKDIPVIGPSKEGAQLE
FT                   GSKDYAKQFMFRHNIPTAAYESFTAATVEKGHDFLETLNPPYVLKADGLAAGKGVLIIN
FT                   DLTEAKEELTNMLTNKKFGEASTTVVIEEFLDGIELSVFVLTDGKNYITLPTAKDYKRI
FT                   GEGDTGLNTGGMGAVSPVPFADEAFMLKIENEIVKPTVNGLNKEDIDYKGFIFIGLINV
FT                   DGQPKVIEYNVRMGDPETEVVLPRIESDLLEAFVKLSQGKLNDITLTINPDTAATVMAV
FT                   SGGYPKAYNKGLAISGLADIKDSIVFQAGTAQDSNGIVTSGGRVLAVTSFGKNHKEALK
FT                   KSYQNIENIKFDRMYYRKDLGLDLDKYL"
FT   gene            complement(689171..689398)
FT                   /locus_tag="CA2559_02980"
FT   CDS_pept        complement(689171..689398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02980"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87685"
FT                   /db_xref="GOA:A3U618"
FT                   /db_xref="UniProtKB/TrEMBL:A3U618"
FT                   /protein_id="EAP87685.1"
FT                   /translation="MEDFFTGIQWFFETILLAPYNALANLELESWWLANFMSWIFILIT
FT                   FVAFFYWLKQLRIFKDNNEDRTDVSAHSFL"
FT   gene            689445..690371
FT                   /locus_tag="CA2559_02985"
FT   CDS_pept        689445..690371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02985"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02985"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87686"
FT                   /db_xref="GOA:A3U619"
FT                   /db_xref="UniProtKB/TrEMBL:A3U619"
FT                   /protein_id="EAP87686.1"
FT                   /translation="MLTRFFGQSKPINFLFVAIYMMVFYIVANRLVFFGGSSFITILKE
FT                   VALLLLYVVGMVILNFIAKKNDLNKVNTYKIILYACFTVLFINLLQNNSVISANIFVIL
FT                   ALRRIISLRTNKDIKKKIFDAAFWICIASLFQFWTILFLIIVYFGILFHSNRSWKNFAI
FT                   PITSVSCVAILATTYMLLTQDRFFLFSDWFQFSNFNFTKLNTITILLPISVVLAMVVWV
FT                   SGSYLKAIQNASISQKPSMYLILMTLFASMAIAIFSPFKNGSELLFMFAPLSVMTAKYF
FT                   EREKEFWFKEVLLWLLILMPILIPIIF"
FT   gene            690371..691012
FT                   /locus_tag="CA2559_02990"
FT   CDS_pept        690371..691012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02990"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87687"
FT                   /db_xref="UniProtKB/TrEMBL:A3U620"
FT                   /protein_id="EAP87687.1"
FT                   /translation="MAYNINHIEAELKHRWNYKYQWFRKQEDIWDKRSRFIYNTKSWEA
FT                   LVLKMKHAVETYGFEKRPFFYYTINRWYNFWSAKAIEQLFCNHTAVTPEVNKKHKHIDF
FT                   YINKTPFDHKTTVFPKGFGHTLDYAINHEEELISWLYEHQSSQSRLHYKNRLFVIMYAK
FT                   DNAHWKLKANLNWLKPKITEFLNQISESSLYEFQFEDNYKTKSRILWAIE"
FT   gene            691060..691668
FT                   /locus_tag="CA2559_02995"
FT   CDS_pept        691060..691668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_02995"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_02995"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87688"
FT                   /db_xref="InterPro:IPR025350"
FT                   /db_xref="UniProtKB/TrEMBL:A3U621"
FT                   /protein_id="EAP87688.1"
FT                   /translation="MFSEKANKIFKQVIDKYHVVNTVDQAFENPYSNEDELLEHLLYRK
FT                   CWIDTVQWHYEDIIRDPQIDPVAALKLKRQIDASNQDRTDMVEYIDSYFLEKYKDVTPK
FT                   KDATINTESPAWGVDRLSILALKVYHMNEESVREDATEKHRMQCQQKLNVLLEQRTDLS
FT                   SAIDQLLTDIENGDKYMKVYKQMKMYNDDDLNPVLRNQK"
FT   gene            691723..692718
FT                   /locus_tag="CA2559_03000"
FT   CDS_pept        691723..692718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03000"
FT                   /product="heptosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03000"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87689"
FT                   /db_xref="GOA:A3U622"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A3U622"
FT                   /protein_id="EAP87689.1"
FT                   /translation="MGDVAMTVPVLKQFVNTYPNVKVTVVTKPFFATLFKDIPNTEVFK
FT                   ADVKQKYKGVFGLFKLYKQLRSLQIDAVADLHNVLRSKILRAFFKLGGISTFKIDKGRV
FT                   DKKALTRDKNKVFKPLKSTHERYADVLRAIGFQINLKPIPKNTTTLNPELVHLLQPSLH
FT                   KLIGIAPFAAHQGKQYPLDKMVAVIETLSKKDHTKVLLFGGGLAEIEVLTKIASQYDNV
FT                   ICLAGTLEFKEELQVISNLNLMIGMDSGNGHLAAMFGVPVLTIWGVTHPYAGFVPFGQP
FT                   EANQLIPDLEKFPKIPTSIYGNKVPNGYEDAMLSIPVEKITKMAIQIIEA"
FT   gene            complement(692715..693764)
FT                   /locus_tag="CA2559_03005"
FT   CDS_pept        complement(692715..693764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03005"
FT                   /product="Phenylacetate-CoA oxygenase/reductase, PaaK
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03005"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87690"
FT                   /db_xref="GOA:A3U623"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A3U623"
FT                   /protein_id="EAP87690.1"
FT                   /translation="MDAFQFLRIKDIIRETPQAVSLVFEVPSVLKDNYKFKAGQYLTFK
FT                   MMLNGEEIRRSYSLCSTPKSGELKVTVKEVEDGTFSTYANNKLKVGDSLEVHTPEGKFI
FT                   YEPNNTSQHNYAAFAAGSGITPILSILKTALEEEPTSKFVLVYGNRTPQETIFYKELLE
FT                   LQANYASRLFIEFVYSQSQEDASHFGRIEKSTVNFIVKNRYKDYTFKDVFLCGPEKMIE
FT                   NVTDVLKENNISEENIHFELFTSNTEGSIEADLEGNTEVVVMLDDEETTFTMKKSESIL
FT                   DAVLNQDLDPPYSCQGGICSSCIARLTEGKAEMRKNQILTDDEVAEGLILTCQAHPTTP
FT                   KVVVDFDEV"
FT   gene            693851..695323
FT                   /locus_tag="CA2559_03010"
FT   CDS_pept        693851..695323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03010"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87691"
FT                   /db_xref="GOA:A3U624"
FT                   /db_xref="UniProtKB/TrEMBL:A3U624"
FT                   /protein_id="EAP87691.1"
FT                   /translation="MIKRFISLEWKQFKRSSYFQKGLAIKILLIFGALYFMTAAFFLGI
FT                   SAFFMAEEFVKDVDPFVTINNYVIYWFLFDLVFRFFMHQLPVMNIKPYMIIPIKRETVI
FT                   HYLLGKTTISFFNLLPLFLFVPITGVLLFKGYAALSALTWLISMLGITLCNNFLNFLIN
FT                   KNNVFFYSLLSVLAIFIGLEFYDIYKVSKPLGVAFYSLYTQPYLVIIPLIAAFGLYKAN
FT                   YSLVRSGFYLDGAISKKTKAVTTENLSWLDRFGSIAVFLKNDIKLIKRNARPKQVLMMS
FT                   FIFLFYGLIFYTQETYREMPVFLAFASIFVTGGFLLSFGQLVPSWDSEYYKLLMSQNIP
FT                   YRKYLESKWYLMVVAVAISFILSTPYIYFGWDIYGMIAAGALFNIGLNSFITLFGGALN
FT                   RVPVELNVKAKAFSNTQGFNPTQLLIALPKMIGPMLIFYVPYKLIDFNAGIIALAISGI
FT                   LGIALKGVFLNKIEAVYQKGKYKTIAAFNEKK"
FT   gene            695344..696039
FT                   /locus_tag="CA2559_03015"
FT   CDS_pept        695344..696039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03015"
FT                   /product="putative ATP-binding component of ABC transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03015"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87692"
FT                   /db_xref="GOA:A3U625"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3U625"
FT                   /protein_id="EAP87692.1"
FT                   /translation="MITTTNLSKSYNGATVLNVEHLEIPKGESFGLVGNNGAGKTTYFS
FT                   LLLDLIRPTTGHIENNAIIVNESEDWKPFTSSFIDESFLIGYLTAEEYFYFIGDLRGQN
FT                   KATVDAFLADFEDFFNGEILGQKKYLRDLSKGNQKKAGIIAALIGNPQVIILDEPFANL
FT                   DPTTQIRLKRLMKELTENREVTLLVSSHDLLHVTEVCERIVVLEKGEVVKDLAKSPETL
FT                   KELEEHFNR"
FT   gene            696296..698755
FT                   /locus_tag="CA2559_03020"
FT   CDS_pept        696296..698755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03020"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03020"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87693"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A3U626"
FT                   /protein_id="EAP87693.1"
FT                   /translation="MTAYYNTMFNGKQAIIQGEAELEASFRDNYWAILPVERLQIEEQA
FT                   LLQGETKNANFERAEEKATKAIQKHSMYIDGEENNPQMDEAFIMLGKARYFDGRFIPAQ
FT                   EAFNYVLRRYPTSNTITEARVWKEKVNIRLDNNELAIENLKEILEEAEEEDLNKQAVAE
FT                   AAAMLSQAYINLQQLDSAIMPIKLASETIDDKEKQARYTFIKGQLYNNIGKVDSANIAF
FT                   DEVIKLNRSIPRRYLINAYVEKAKNFDLDKGDKAEFEELLTRLETYYENRPYLDRIYLV
FT                   MADYYQKLDSTDLAVTYYNKSLRTQSADNYLVSRNYLRLAEINFDNAEYKEAGNYFDST
FT                   LTNLDNTTREFRTITKRRVNLDDVILYEGIARANDSILNVANLSAEDQYSYYQTYADGL
FT                   KATAIAQARAEELPVTGATNSFYNKQTNSRELKGIGGPKVKGDFYFYNPTTVAYGKQEF
FT                   EKVWGSRKLEDNWRTGGSVFSNTETEEEDIDPIAALEEDPRFDPQTYVDLIPKNQKVLD
FT                   SLSTERNFAYYQLGLIYKEKFKEYSLASEKLEGLLNNNPEERLILPSKYNLYKVYETTG
FT                   DTANADRVKNDILNNHPESRYASILRNPESLKNDENSPEAIYATLYKQFQEQNYALVLE
FT                   KSEEYIQQFTGDDIVPKFELLKAYAEGRYLGFEAYKEGLNFVALNYPQSDEGKQAAKIY
FT                   KQSIPSLEFKEFEKDGKEGEFKLIYPIDKNDTTVDAKALREKVDKAIEDLGYTNLYTSY
FT                   DVYNPFQNFLVIHGLNSSLGAEGFGELLKDNKNYKITNEFFGISSENYTIVQIHKNIDA
FT                   YREFSTQ"
FT   gene            698785..699204
FT                   /locus_tag="CA2559_03025"
FT   CDS_pept        698785..699204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03025"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87694"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:A3U627"
FT                   /protein_id="EAP87694.1"
FT                   /translation="MFSDNNSGKKSRNNEQVSREQNKISQGTKIVGDIVAKGAFRIEGT
FT                   VEGTVTTPGKVVVGKSGFISGTLTCENADFEGKFSGKLDIADTLTLRSSSHIEGEVLVG
FT                   KLAVEPGATFNASCAMKGNVKSLKNDDDKRKEKSA"
FT   gene            699176..699412
FT                   /locus_tag="CA2559_03030"
FT   CDS_pept        699176..699412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03030"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87695"
FT                   /db_xref="GOA:A3U628"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:A3U628"
FT                   /protein_id="EAP87695.1"
FT                   /translation="MTNEKKSPLNSSYAKYSGIAFQMFAIIAIGAFGGVKLDEYLNNQN
FT                   NLYTIIFSLVAVLAAIFFVIRQILKMSKDDNAS"
FT   gene            699439..699855
FT                   /locus_tag="CA2559_03035"
FT   CDS_pept        699439..699855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03035"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87696"
FT                   /db_xref="GOA:A3U629"
FT                   /db_xref="UniProtKB/TrEMBL:A3U629"
FT                   /protein_id="EAP87696.1"
FT                   /translation="MNSIQEKEFRRRQISFVGLLSAITVILLGLHYYIYYYFAASIDLK
FT                   IPLWTVYAFHFIVVLLIYSFINYRHTSGKTDVFNVFMILTFLKMILAVVFLLPVLLSSL
FT                   ENKVPDVLNFFFPYFIYLGLEVWTVTNFLKEKTN"
FT   gene            699946..701031
FT                   /locus_tag="CA2559_03040"
FT   CDS_pept        699946..701031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03040"
FT                   /product="putative ATP synthase A chain"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03040"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87697"
FT                   /db_xref="GOA:A3U630"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:A3U630"
FT                   /protein_id="EAP87697.1"
FT                   /translation="MNITLRQFILGLALVTTVLSGFAKDANTEEPEEGFNVKEMIMHHV
FT                   KDAYGMHIIDYNGHAISIPLPVILWTDNGLTTFMSSEFHHDYHGEVVVEKNGGKFINLH
FT                   EKVYQLDAGADSVQLDEEGHATNAQIPIDISITRNVFMMFISVIVLLLIFITAARKYRK
FT                   SDTNVPSGIASFVEPLIIFVRDEIGIPMIGEHKYKKYMPFLLTVFFFIWINNIFGLIPI
FT                   ANGANLSGNIAFTAVLAGFTFIITTFSGNKNYWQHIFWMPGVPVPIKIFLIPIELIGMI
FT                   VKPVSLAIRLFANITAGHIIILSLISLIFIFNSLAVAPVSVAFALFISIIEIIVTAIQA
FT                   YIFTVLSALYFGMAVEDHDHH"
FT   gene            701068..701271
FT                   /locus_tag="CA2559_03045"
FT   CDS_pept        701068..701271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03045"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87698"
FT                   /db_xref="GOA:A3U631"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:A3U631"
FT                   /protein_id="EAP87698.1"
FT                   /translation="MTITGIAAIGAGLAAIAAGIGIGKIGSSAMEAMARQPEMHGKIQS
FT                   SALILAAFVEAVALFGVVASLI"
FT   gene            701355..701849
FT                   /locus_tag="CA2559_03050"
FT   CDS_pept        701355..701849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03050"
FT                   /product="ATP synthase F0, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03050"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87699"
FT                   /db_xref="GOA:A3U632"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:A3U632"
FT                   /protein_id="EAP87699.1"
FT                   /translation="MELLTPGFGLVVWTVITFLILFFLLKKFAWKPILGAVHDRETSIK
FT                   SALDSAEAARREMENLQADNERILQEARTERDSIIKEARSMKDKMIADASDEAQAKADQ
FT                   IIKQAQAAILSEKQAAIADIKNQVANLSIDIAEKVVREELSNKEKQAKLVEDMLGDVTL
FT                   N"
FT   gene            701856..702410
FT                   /locus_tag="CA2559_03055"
FT   CDS_pept        701856..702410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03055"
FT                   /product="ATP synthase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03055"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87700"
FT                   /db_xref="GOA:A3U633"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:A3U633"
FT                   /protein_id="EAP87700.1"
FT                   /translation="MAASRAAQRYAKAILDLAIDQNNAKETNENMKLVSNTIAASDDLQ
FT                   LMLTSPVVKSADKKAVLRQVFKDGNAITIGLFDILIENKRVDILQDVAKKYTFLFDQMN
FT                   KTEVATVTTAVPLTKELEAKVLAKVKELTGNDVSLENKIDENIIGGFILRVGDLQYNAS
FT                   IANKLNTLKREFTNNTYVSKL"
FT   gene            702432..704006
FT                   /locus_tag="CA2559_03060"
FT   CDS_pept        702432..704006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03060"
FT                   /product="ATP synthase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03060"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87701"
FT                   /db_xref="GOA:A3U634"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:A3U634"
FT                   /protein_id="EAP87701.1"
FT                   /translation="MAEVNPAEVSAILKQQLSGFENKASLDEVGTVLTVGDGIARVYGL
FT                   SNAQYGELVEFETGLEAIVLNLEEDNVGVVLLGPSVGISEGSTVKRTQRIASIKVGEGI
FT                   VGRVVDTLGNPIDGKGPIEGETFEMPLERKAPGVIYREPVTEPLQTGIKSIDAMVPIGR
FT                   GQRELVIGDRQTGKTTVCIDTILNQKEFYDAGEPVYCIYVAIGQKASTVAGIAKTLEDK
FT                   GAMAYTTIVAANASDPAPMQVYAPFAGAAIGEYFRDTGRPGLIIYDDLSKQAVAYREVS
FT                   LLLRRPPGREAYPGDVFFLHSRLLERAAKVINDDGIARDMNDLPDSLKDKVKGGGSLTA
FT                   LPVIETQAGDVSAYIPTNVISITDGQIFLTSDLFNSGVRPAINVGISVSRVGGSAQIKS
FT                   MKKVAGTLKLDQAQFRELEAFAKFGSDLDAATLNVIEKGKRNVEILKQGQNDPYTVENQ
FT                   IAIVYAGSKNLLRKVPVNKVKEFEVDYLEYLNAKHRDVLDTLKAGKLTEEVTNTLEKVA
FT                   AELSSKY"
FT   gene            704094..704963
FT                   /locus_tag="CA2559_03065"
FT   CDS_pept        704094..704963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03065"
FT                   /product="H+-transporting two-sector ATPase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03065"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87702"
FT                   /db_xref="GOA:A3U635"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:A3U635"
FT                   /protein_id="EAP87702.1"
FT                   /translation="MANLKELRNRITSVSSTMQITSAMKMVSAAKLNKAQDAITKMRPY
FT                   SNKLTELLQSLSATLDADSGSDFAEERQINKVLIVAISSNRGLAGAFNTNIIKKVKSLT
FT                   ETTYKGISTEVITIGKKANDILKKTHTVTTNNNSLFDDLSFENVAEVAEDLMAKFKNRE
FT                   YDKIVIVYNSFKNAATQIVMNEQFLPLVAKQNDDVDTSSVSDYIFEPSKEEIVNDLIPK
FT                   SLKMQLYKAMRDSFASEHGARMTAMHKATDNATELRDSLKLSYNKARQASITNEILEIV
FT                   GGAEALNN"
FT   gene            complement(705013..705843)
FT                   /locus_tag="CA2559_03070"
FT   CDS_pept        complement(705013..705843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03070"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87703"
FT                   /db_xref="UniProtKB/TrEMBL:A3U636"
FT                   /protein_id="EAP87703.1"
FT                   /translation="MFNTSHILKVLLLFILVTTLSSAQVGINTTSPQETLHIAGDDTTN
FT                   IKVEGLSAANNVNNLGIGNSTRVYANENGDLTLATSPPSVEIVLDFSNYLDDNGVTVNQ
FT                   TGGGSAFTRTNRPLNTTFTLVRDAIIQINYSVSWSIRKNNNFKISDQRARIIQTGIYLV
FT                   DDSDNSFVTQDLDGNTINPATVNCNLFGDLLNCLGTEALLGLSGQFYNNSSRTVGEANG
FT                   FHNTGSDYVRLPAGTYKALFAVQVSVGNASGSGNIQFKLGTANDDIQIIAYYYN"
FT   gene            complement(705843..706589)
FT                   /locus_tag="CA2559_03075"
FT   CDS_pept        complement(705843..706589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03075"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87704"
FT                   /db_xref="UniProtKB/TrEMBL:A3U637"
FT                   /protein_id="EAP87704.1"
FT                   /translation="MNVYLLPFLFLPMLSFAQVGIGTTQPQQDLHIAGDTSTIRIESLN
FT                   ATNNPFNNGIDLAPVSIDGFGNFTLVPQYNTPLVFLLEENNFIPDNPSNLDFNTGTVIN
FT                   SDLASTSNEAIIITKAITIPQPSIIEVNYAVTMLFAGDDLKSNTLSPITDAKSRTGEIF
FT                   FRIDLNSDGLNTTEISKKYGIKGIYYTSSSGGVAGYAYVNSQGYVTLPTGNHTIYFYGV
FT                   VKDGNSSYTSIGFGGSKDYLKIRLYN"
FT   gene            complement(706591..707280)
FT                   /locus_tag="CA2559_03080"
FT   CDS_pept        complement(706591..707280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03080"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87705"
FT                   /db_xref="UniProtKB/TrEMBL:A3U638"
FT                   /protein_id="EAP87705.1"
FT                   /translation="MFFAQQGVGINTNDPQQALHIAGTTSTIRLDGLNAVNNASNSGDF
FT                   DGNGNLSDNTFPLYINEDGDFLLDFNTLYISEDEDAIQTTTTITLNPFTNSDGNGAEEV
FT                   FSFNVTTTRPTILEIKYNISFEVNSNAAGDEIEDYLSRRITNYFTVGGATYGIASKNFT
FT                   NRTPSFSFGNTGSNETYYNVGRGYVSLPAAQTYTIRFFGEVSSGDSYLATSVVFGSGID
FT                   SLLFRMY"
FT   gene            complement(707590..710364)
FT                   /locus_tag="CA2559_03085"
FT   CDS_pept        complement(707590..710364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03085"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87706"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR041700"
FT                   /db_xref="UniProtKB/TrEMBL:A3U639"
FT                   /protein_id="EAP87706.1"
FT                   /translation="MKNVYLFLAVFFISITSIAQSVTIKGTIVDETSKTPLEAATVFAE
FT                   KVSDSTLITYSISDRAGLFLLETESSLPEMRVNISFTGYAGYSKVVKINSSEIDLGTIP
FT                   LGLQAESLSDVVITATRAPITIKKDTLEFNVKSFKTKKDANVEDLLKQLPGVEVDPDGT
FT                   IKVNGKPVNKILVNGKPFFGNDPTIATRNLTKDIIKKIQVTDTKTDSEAFTGEDGEQTN
FT                   KTINLTIDEDKNKGIFGRVAAGAGTDERFEYAGLLNYFDNDLRVSVLGGGNNINSPGFS
FT                   FGEIQRLFSNTRSVSFNGNGSFNVGGRSFGGGQGITNSRTAGVNFANELWKKTDITTDY
FT                   FYSASNSYNDEVTQRENILPDNRFITNSISSSDSNIDSHTVNARFRSEVDSTFVILFRP
FT                   EFSYNTGLSNFDSNEESRTIDGELTNQSEASTQSDRTGTNFQGELDFTKKYGKKGGFVR
FT                   LGVENNINKDVNERFLFSNTEVFGDTPETITRNQFTDGENTDNGFQVSADWRIPLIEKK
FT                   LFLNAEYTYEQNTREDNQSVFDFNETNQNYSDFNLEQSTDFENKNSSSEPELGLQYQTD
FT                   KLRAGFSAGYIHRTLESDDALRDINFENNFDALTLSSNFRYNFTKQSRAYISYRLRNDA
FT                   PSVNQLSPFVDVSNPLNTIQGNPNLSPSNNHNIYLGYNSYDFKTQSGVYSYGNATFTND
FT                   RVVAQTTVDENFVRNTTYTNVNGNYNLNFSIGVNKQKKVDSLQSIRYGLRGSINANRNV
FT                   NFNNAVQYASRTVTYSPSVNIAYILKDKFEFRPSYTLNYTENSFNLDLFEGREYVRHTI
FT                   NLFTTATFFKKLEWVNDIDYNYNADVAEGFEKSILFWNSSLLYSFYNDAFTASIKAYDI
FT                   LKQNNNTRRTATQDYIQDTQSTVLQRYVMFGLSYKFNTLGKKGETREFNWRRH"
FT   gene            710553..711050
FT                   /locus_tag="CA2559_03090"
FT   CDS_pept        710553..711050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03090"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87707"
FT                   /db_xref="UniProtKB/TrEMBL:A3U640"
FT                   /protein_id="EAP87707.1"
FT                   /translation="MKLATLLYGIIPLVFFSSCSSSQQLQNFVLQEQVPFEIVEYYYQD
FT                   WPQHTRTSPAGIHVTIVLKENLNSIELKEVFFRDKQVALKPELRAPTVYVGKFPKQTDR
FT                   ILNADPVKEYGNKPPQFSKNGSFKLSSNDAIISYTERGKLLYYKLTDIEERGTRQAPRN
FT                   PR"
FT   gene            complement(711051..712190)
FT                   /locus_tag="CA2559_03095"
FT   CDS_pept        complement(711051..712190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03095"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87708"
FT                   /db_xref="GOA:A3U641"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A3U641"
FT                   /protein_id="EAP87708.1"
FT                   /translation="MTQEEKIKQLEAENKKLRDTFASQKESKRKRRKLGWSFLKRSSGM
FT                   VLGVKLKTSIEDFLNELGDDRRVSRETLSNLLSAVVLRLTRVGFLLVLTAILPSILLIF
FT                   QTYYLAKQTTLIDDQKTLFQNQNIRLDQQTYLQEAERRGNVIILLDNMIKDVNDEIDRT
FT                   PSNRISKPTTGRLIALSKMLKPYRYLKNDSLTERVLSPERGYLLLSLIESDLSLKLSSN
FT                   TSLNGSLLERLDFSYAEMVGVSIINEDLLNINLSYADLSNSNFSGNDFENADFKYADLT
FT                   NTVLDLANLESTNFKGAILKNTSFKRADLTKADLSLTDLRGAEFSVKSLKGATLTNARV
FT                   SENFSVTMSKQLNKTDYAWFAETYEVVEVDDDNYQILKK"
FT   gene            complement(712225..712878)
FT                   /locus_tag="CA2559_03100"
FT   CDS_pept        complement(712225..712878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03100"
FT                   /product="3-oxoadipate CoA-succinyl transferase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03100"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87709"
FT                   /db_xref="GOA:A3U642"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A3U642"
FT                   /protein_id="EAP87709.1"
FT                   /translation="MLDKNGIAQRIAKEVKDGYYVNLGIGIPTLVANFVRDDIDVEFQS
FT                   ENGVLGMGPFPFDGEEDADVINAGKQTITALPGASFFDSATSFSMIRGQHVDLTILGAM
FT                   EVAENGDIANWKIPGKMVKGMGGAMDLVASADNIIVAMMHTNRAGESKLLKRCSLPLTG
FT                   VGCVTKVVTNLAVLEVTKEGFKLLERAPGVSVDEIQKATEGTLIIDGDVPEMKL"
FT   gene            complement(712908..713609)
FT                   /locus_tag="CA2559_03105"
FT   CDS_pept        complement(712908..713609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03105"
FT                   /product="3-oxoacid CoA-transferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03105"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87710"
FT                   /db_xref="GOA:A3U643"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A3U643"
FT                   /protein_id="EAP87710.1"
FT                   /translation="MIKKTVKDVEAALQGVQDGMTFMLGGFGLSGIPENAIAHLVKLNV
FT                   KDITCISNNAGVDDFGLGLLLQKKQIRKMVSSYVGENDEFERQMLSGELEVELIPQGTL
FT                   AERCRAAQGGFPAFFTPAGYGTEVAEGKEVREFNGKMYVLEEAFKADFAFIKAWKGDEA
FT                   GNLIFKGTARNFNPNMCGAAKVTVVEVEELVKPGELDPNQIHIPGIFVQRIFQGERYEK
FT                   RIEQRTVRQRD"
FT   gene            complement(713687..715309)
FT                   /locus_tag="CA2559_03110"
FT   CDS_pept        complement(713687..715309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03110"
FT                   /product="carboxy-terminal processing protease precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03110"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87711"
FT                   /db_xref="GOA:A3U644"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A3U644"
FT                   /protein_id="EAP87711.1"
FT                   /translation="MKKRIILSVVAVGIFFTTVSFKNDFFEIAKQIEIFTTLFKELNMN
FT                   YVDETNPAELMDTAIKSMLTELDPYTKFYNEQDVETARIRNSGEYTGIGASVKTRDDKI
FT                   TIIEPHKGYPADNAGLKAGDEIIKIGDIVLSDFDSDAGELLKGSPGSEVQVTYLRQGKQ
FT                   ETTTLKRGKIDVEAVPYYKLLEDKTGYIVLSKFNAKASTQVIDALKTLKADGADKIILD
FT                   LRGNPGGLLSEAINVTNIFIPKGELVTTTKSVIKKYNRTYVTKNEPVDTEIPLVVLIDG
FT                   RSASASEIVSGGLQDYDRAVIVGARSFGKGLVQRPKQLTYGTQLKVTISRYYTPSGRCI
FT                   QALDYWNRDEDGNAVRTKSAEYNEFKTKAGRSVFDGGGVLPDVQLETSKFSGVTSALVQ
FT                   DEAIFNFATNYYYTHKLESPEDFKFTSSDFSDFKEFLKTTNFKYTTQTEKELKETLEIA
FT                   VKEEFDDDVQNNYNNFLASIQQAKTKAIDDKKPEIERLITDEIIKRYFYKEGLYDYYVI
FT                   NNPEIEEAKNILNSTNRYSKILK"
FT   gene            complement(715309..716100)
FT                   /locus_tag="CA2559_03115"
FT   CDS_pept        complement(715309..716100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03115"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87712"
FT                   /db_xref="GOA:A3U645"
FT                   /db_xref="InterPro:IPR025645"
FT                   /db_xref="UniProtKB/TrEMBL:A3U645"
FT                   /protein_id="EAP87712.1"
FT                   /translation="MVLACGENSTESFSKEFTIENSEDYLEETIIETTTTPNLNTSQEQ
FT                   KIIKTGVLEFQTQNLSKTYSQIKALLNTYEGYIQTDNSGKNYNRQYQNLQVRIPSKNFQ
FT                   VIIDSISQSVNYFDTKSISRQDVTEEFIDLTARLKAKRELESRYIQLLSKANTVKEILE
FT                   IERELSTIREDIEAKQGRLEYLQSQVSYSTLNINFYKEISNTGITVSYGTKIVNALKSG
FT                   WFGISSVFLGILTLWPLLIIGLVVAIVIRHWLKSSNKNTSK"
FT   gene            complement(716114..716485)
FT                   /locus_tag="CA2559_03125"
FT   CDS_pept        complement(716114..716485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03125"
FT                   /product="possible ribonuclease P component"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03125"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87714"
FT                   /db_xref="GOA:A3U647"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A3U647"
FT                   /protein_id="EAP87714.1"
FT                   /translation="MDQSFPNTEHLKGKTLINELFLNGKSVTAYPLRMYYIPLKDNDVK
FT                   GFKVGVSVPKRNFKLAVHRNRIKRLLRESFRKNKYLVYNGTTQHFALLIVYIGKETPEY
FT                   EFVETKFKKLVGAFLKAVS"
FT   gene            complement(716599..718029)
FT                   /locus_tag="CA2559_03130"
FT   CDS_pept        complement(716599..718029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03130"
FT                   /product="pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03130"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87715"
FT                   /db_xref="GOA:A3U648"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A3U648"
FT                   /protein_id="EAP87715.1"
FT                   /translation="MPNRKKTKIVATLGPSTSTKTVLKQMLEAGANVFRINFSHANYDD
FT                   VKKRISMIRELNEKYGFNASILGDLQGPKLRVGVMKGEVIVSKGDKLSFCTGEEFEGTA
FT                   DRVYMNYDTFPRDVKAGERILLDDGKLIFEVLETNKKDEVKAKVIQGGPLRSRKGVNLP
FT                   NTNISLPALTEKDVKDAIFACEQGVDWMALSFVRHAEDLQELQELIKKHSEHKIPIIAK
FT                   IEKPEGVENIDKIVAYCDGLMVARGDLGVEIPAQEVPLIQKQLVLKAKQARIPVIIATQ
FT                   MMETMITSLTPTRAEVNDVANSVMDGADAVMLSGETSVGQYPVQVIQKMCQILKTVEDS
FT                   PLIHVPEEPPHIRTKRYITKSICYHAAHMANEIKAKAICTLTNSGYTAFQISAWRPSAH
FT                   ILAFTSNKRILTQLSLLWGVHAYYYDKFTSTDDTVEDVNGIAKQMKYVKKSEFVINLAA
FT                   MPISDKGMVNTLRVSEIK"
FT   gene            complement(718057..718542)
FT                   /locus_tag="CA2559_03135"
FT   CDS_pept        complement(718057..718542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03135"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87716"
FT                   /db_xref="UniProtKB/TrEMBL:A3U649"
FT                   /protein_id="EAP87716.1"
FT                   /translation="MKGNKLILDTVFEDEFKLIAIHCSLEPYRIAYFVNKQLKLKLERV
FT                   SDIEIYQGDTVINAPLFQFEDAIRETDYYLTANKFKTSNKNITEDDLFGSKQNRYSIIS
FT                   LLKEYKNADYFLKIEDEVVNAIPIKRILFELNQIKHIVTAYLINTEDLKQKERLVFK"
FT   gene            complement(718650..719393)
FT                   /locus_tag="CA2559_03140"
FT   CDS_pept        complement(718650..719393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03140"
FT                   /product="putative ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03140"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87717"
FT                   /db_xref="GOA:A3U650"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A3U650"
FT                   /protein_id="EAP87717.1"
FT                   /translation="MSIIRNILNSRSKKDGNFFSAIQNLVGFKPTNLKPYKKAFTHRSL
FT                   NEVDELGNAQNYERLEFLGDAMLSAIIAAHLFSAVPGGNEGYLTKMRAKVVSRKHLNEL
FT                   GKDLDLVSLVKTNIPKTQFGANIHGNLFEALIGAIYLDKGYKSCKRFIHERVIEPYVDI
FT                   EQLENKVISYKSLLIEYCQKTKKEFHYDVYEDTGVGEMKHFAVKLRIDKKVVAKARATS
FT                   KKKAEEKASKRAFFAFQSKIKKVFD"
FT   gene            complement(719399..720652)
FT                   /locus_tag="CA2559_03145"
FT   CDS_pept        complement(719399..720652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03145"
FT                   /product="putative 3-oxoacyl-[acyl-carrier-protein]
FT                   synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03145"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87718"
FT                   /db_xref="GOA:A3U651"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A3U651"
FT                   /protein_id="EAP87718.1"
FT                   /translation="MELKRVVVTGLGALTPIGNNINEYWNGLVEGKSGCAGITSFDPAN
FT                   FKTQFACEIKDFDPLKHFDRKEARKLDKFAQYALVSSDEAIADAGIDLDAVDKFRVGVI
FT                   WGAGIGGIQTFQDEVVNFAQGNGTPRFNPFFIPKMIADIAPGNISIKHGFMGPNYTTVS
FT                   ACASSANAMIDALNYIRLGHCDVIITGGSEAAVTEAGMGGFNAMHALSTRNDNPQSASR
FT                   PFDANRDGFVLGEGAGALVLEELEHAKARGARIYAEVIGGGMSSDAYHMTAPHPDGIGV
FT                   KRVMENCLRDAGIDASEVDAINTHGTSTPLGDVAELKAISQVFGQHAGKININSTKSMT
FT                   GHLLGAAGAIEAIASILSMEHSVVPPTINHETVDENIDPNLNLTLNKAQEREVNVAMSN
FT                   TFGFGGHNACVLFRKLNE"
FT   gene            complement(720663..720896)
FT                   /locus_tag="CA2559_03150"
FT   CDS_pept        complement(720663..720896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03150"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03150"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87719"
FT                   /db_xref="GOA:A3U652"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A3U652"
FT                   /protein_id="EAP87719.1"
FT                   /translation="MSDIASRVKAIIVDKLGVDENEVVNDASFTNDLGADSLDTVELIM
FT                   EFEKEFDIQIPDDQAENIATVGQAISYIEEAK"
FT   gene            721263..721655
FT                   /locus_tag="CA2559_03155"
FT   CDS_pept        721263..721655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03155"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03155"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87720"
FT                   /db_xref="GOA:A3U653"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A3U653"
FT                   /protein_id="EAP87720.1"
FT                   /translation="MLNLLKDIQPDLIVLAGFLWLFPEKIVEAFPDKVINLHPALLPKF
FT                   GGKGMYGANVHKAVVEQKEEKTGITIHFVNEVYDDGKIIAQFETELKPTDTVEDVASKI
FT                   NELEMEHFPKVINELLFPERYDTNGN"
FT   gene            721645..722283
FT                   /locus_tag="CA2559_03160"
FT   CDS_pept        721645..722283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03160"
FT                   /product="ribonuclease H-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03160"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87721"
FT                   /db_xref="GOA:A3U654"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017290"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR037056"
FT                   /db_xref="UniProtKB/TrEMBL:A3U654"
FT                   /protein_id="EAP87721.1"
FT                   /translation="MATKSPKFYVVWKGKKPGIYKTWASCKASIDGYKGALYKSFPTFA
FT                   AAQKAYNGNYEDFKGKSAKLRVLSEADKLKYGTPNFNSIAVDAASSGNPGKMEYRGVDT
FT                   KTKKQLFHQGPFLQGTNNIGEFLALVHGLAFLKKHNSDRIIYTDSRIAMGWVRKKKCNT
FT                   KLSLNAKNKNVFELVKRAEHWLKTNSYNTPVVKWETKAWGEIPADFGRK"
FT   gene            722370..723293
FT                   /locus_tag="CA2559_03165"
FT   CDS_pept        722370..723293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03165"
FT                   /product="carbohydrate kinase, PfkB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03165"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87722"
FT                   /db_xref="GOA:A3U655"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A3U655"
FT                   /protein_id="EAP87722.1"
FT                   /translation="MGKLLIVGTVAFDAIETPFGKTDKILGGAATYIGLSASNFGIDSG
FT                   VVSVVGEDFPQEHLDLLTEHNVNIDGIEIVKGGKTFFWSGKYHNDMNSRDTLVTELNVL
FT                   ADFDPVVPAAYQNADVVMLGNLHPFVQMRVIEQVKNPKLIVLDTMNFWMDSALEELKQV
FT                   IAKVDVITINDEEARQLSGEYSLVKAAREIEKMGPKYVVIKKGEHGALLFHDDKMFFAP
FT                   ALPLEEVFDPTGAGDTFAGGFSGYLAKTEDYSFKNMKNAIIYGSNLASFCVEKFGTERM
FT                   ESLDKKEVEERLEQFKKLTQFKIELS"
FT   gene            723348..725246
FT                   /locus_tag="CA2559_03170"
FT   CDS_pept        723348..725246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03170"
FT                   /product="putative phosphoribosylpyrophosphate
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03170"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87723"
FT                   /db_xref="GOA:A3U656"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A3U656"
FT                   /protein_id="EAP87723.1"
FT                   /translation="MSDVLKHECGIALIRLLKPLEYYKEKYGTAFYGVNKMYLMMEKQH
FT                   NRGQDGAGFASIKLDVKPGERYISRVRSNQAQPIQDIFAQINERVNQELTDNPEYANNV
FT                   ELQKQHIPYIGELLLGHVRYGTFGKNSIESVHPFLRQNNWMHRNLIMAGNFNMTNVFKL
FT                   FDNLVKLGQHPKDKADTVTVMEKIGHFVDSEVRKLYKKLKKEGFSKIEASPEIAKRLNI
FT                   EKILKKSSKDWDGGYAMVGLLGHGDSFVLRDPAGIRPAYYYKDDEIVVVASERPVIQTV
FT                   FDVKFDDVKELAPGHAIITKKDGSVSIPEILKPLERKACSFERIYFSRGSDAEIYKERK
FT                   ELGALLYPEVLKAIDNDTTNSVFSFIPNTAEVSFYGLVEAAQEDLNKRKNETILNEKET
FT                   LTDKRLEQILSHRLRTEKIAIKDAKLRTFITEDSSRDDLVAHVYDVTYGVVKPEDNLVI
FT                   IDDSIVRGTTLKKSIIKMMDRLKPKRIVVVSSAPQIRFPDCYGIDMARIEDFVAFKAAL
FT                   ELLKETNQYHVIDDVYKKCKSQEHLEDKDVKNFVKEVYAPFSYEAVSQKIAELLSDETV
FT                   NAEVKVIYQPIDNLHKACPKNLGDWYFTGDYPTVGGNRVVNRAFINFVEGNKERAY"
FT   gene            complement(725475..726083)
FT                   /locus_tag="CA2559_03175"
FT   CDS_pept        complement(725475..726083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03175"
FT                   /product="superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03175"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87724"
FT                   /db_xref="GOA:A3U657"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A3U657"
FT                   /protein_id="EAP87724.1"
FT                   /translation="MSFELPKLKYAHDALEPHIDEKTMTIHHGKHHQGYTNKLNAAIEG
FT                   TDLEGKTIENILTNLEMSNTAVRNNGGGFFNHRLFWEVMSPDGGGKPTGELAEAIDAKF
FT                   GSFEAFKDEFSSQAGGQFGSGWAWLCVQEGGKVEVCSTANQDNPLMPGIGCGGYPILGL
FT                   DVWEHAYYLNYQNRRPDYVNAFFNVIDWTEVSKRYAENK"
FT   gene            726195..729359
FT                   /locus_tag="CA2559_03180"
FT   CDS_pept        726195..729359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03180"
FT                   /product="putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03180"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87725"
FT                   /db_xref="GOA:A3U658"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A3U658"
FT                   /protein_id="EAP87725.1"
FT                   /translation="MQDAPFKIYNASAGSGKTFSLVRDYLSLLFSAKKTDAFRSILAIT
FT                   FTNKAVAEMKSRIVENLIAFSKDNTQDDYLAMLNAVANSTNISQDLIKTRSVILLKKLI
FT                   HNYAAFEISTIDGFTHRVLRTFAKDLGLPSNFEVTMQVDDILHEAVDKLIAKAGEDKEL
FT                   TKVLIDFALSKADDDKSWDISRELYSIAKLLTKENNLDHLKAFENKDLKDFKTYTKTLN
FT                   DKKQDITSAIKQIAENVFNLLNENGILPEYAFTGKYAYKYFNNLKEGNLGKLTFTAGWQ
FT                   NDLINGTKPIYSKSSKDLSKEQKSILDGLKQPIGSYFEDSKNKVLLLNFIEHISKNIIP
FT                   LSLLNSIKKEVEAIKKERGLLLISEFNNTIANAIKGQPAPFIYERLGERYRHFFIDEFQ
FT                   DTSELQWQNIIPLAENPLISLDEDENQGSLLLVGDAKQSIYRWRGGKAEQFINLCNKIS
FT                   PFSINPEVTNLPNNFRSLPQVVNFNNALFKHIAQYFKVEDYESLYEKSPQEIIKKDKGY
FT                   VNLKFFDLKNKEEENEVFPEEVLKIIKECEALGYKKSDICILNRNRKEGVVIADYLSEK
FT                   GISLISSETLLVKNSKEVLFIIDVLKLIKNPKDALTKVNLLHYLIASEKIQKDETQFIL
FT                   ESLQKDHEDFYSSLEQYNINFDHNLLTSLALYDALEYIISSFNLLQSSNAYLQYFLDFA
FT                   FDYGNQNVGGIHGFLEHWSQHEDKLSIVVPKGEDAVQLLTIHRAKGLEFPVVIYPYASE
FT                   NILDTKMDDIWVNLKDPYNDIPKAYISASSKLETLDESMAVPYEYLLNEKQMDGVNVLY
FT                   VALTRAKEQLYVLSKKDINSKGVVNTKTVSGLLIDFLINENIWDNTQTSFHFGEPHFKV
FT                   STESSSSQATQTQSKVETLPFKERSITLSTNSGRLWGTTQQEAIDEGILIHDIMANINS
FT                   VSDLESAINLFVDKGILPNDDVLRVRKKVKTIIMHPELNTYFKEANKNYNERDLVSRDG
FT                   KILRPDRINVVENNTAVIIDYKTGVFNEQNERQVKEYKKALEDIGYTVTKTILVYTNES
FT                   LTIKNV"
FT   gene            729387..730580
FT                   /locus_tag="CA2559_03185"
FT   CDS_pept        729387..730580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03185"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03185"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87726"
FT                   /db_xref="GOA:A3U659"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3U659"
FT                   /protein_id="EAP87726.1"
FT                   /translation="MYGKIKEHLQNEIQEIKDNGLFKKERIITSPQGAEIKISTGETVI
FT                   NFCANNYLGLSSHPDVIQAAKDTMDTHGFGMSSVRFICGTQDIHKELEQKISDFFETED
FT                   TILYAAAFDANGGVFEPLLTKEDAIISDSLNHASIIDGVRLCKAARYRYANGDMQDLEK
FT                   QLQDANANGARFKIIVTDGVFSMDGLVAPLDKICDLADKYDAMVMIDECHASGFIGETG
FT                   IGTLEAKGVLGRIDIITGTLGKALGGAMGGFTTGKKEIIELLRQRSRPYLFSNSLAPAI
FT                   VGASIKVFDMLKNDTTLRDKLEKNAAYFKKEMQDAGFDIVDGDSAIVPVMLYDAKLSQE
FT                   MADRLLEEGIYVIGFFYPVVPKDKARIRVQLSAAHETHHIDKAVKAFIKVGKDLNVI"
FT   gene            complement(730573..730713)
FT                   /locus_tag="CA2559_03190"
FT   CDS_pept        complement(730573..730713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03190"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87727"
FT                   /db_xref="UniProtKB/TrEMBL:A3U660"
FT                   /protein_id="EAP87727.1"
FT                   /translation="MFHILINLIFKVLIANKSKRLQLIIKDICNKIFLMPLTSEALIYL
FT                   K"
FT   gene            730705..732141
FT                   /locus_tag="CA2559_03195"
FT   CDS_pept        730705..732141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03195"
FT                   /product="Thrombospondin type 3 repeat:OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03195"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87728"
FT                   /db_xref="GOA:A3U661"
FT                   /db_xref="InterPro:IPR003367"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A3U661"
FT                   /protein_id="EAP87728.1"
FT                   /translation="MKHLSKVLFATLFVLGFSVAQAQDENNPWAIGVGVNAVDYFSAGE
FT                   DQGPLGSYFQEFFNVEDHWNILPSISRISVGRYIGNGFSATAVGTINQIDRIGDVEVGD
FT                   LAYYGIDGMLSYSLRNVLNGPGGWADPYVGIGGGYTWLEESNNAALPDNFSNDDGDLGT
FT                   VGVGTGNVTAGLNFWISENLAINAASTYKHVFEDAYGAQHFQHSLGVVFTFGGKDTDGD
FT                   GIYDDQDECPETPGLAEFNGCPDTDSDGIEDRKDDCPNVAGTAEFNGCPDTDGDGIPDP
FT                   KDDCPTVAGIQALNGCPDADGDGIKDSEDNCPNEAGPASNNGCPFEDKDGDGVLDKDDQ
FT                   CPDVAGTVANNGCPEVTVEVMNELNEYSRTILFDLNKSTIRSESFETLQNIADIMSEYP
FT                   TAKFHIEGHTDSQGSEAYNEKLSRERAASVRTYLTTKGVAANKLTSEGYGELRPIATNK
FT                   TAAGRQQNRRVEIKLEKDRK"
FT   gene            732206..734941
FT                   /locus_tag="CA2559_03200"
FT   CDS_pept        732206..734941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03200"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87729"
FT                   /db_xref="GOA:A3U662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A3U662"
FT                   /protein_id="EAP87729.1"
FT                   /translation="MISFLEQTLNSIENTYQDLSKPIFILPSQRAVSFLKQLMAKRTNK
FT                   ATFLPEIYSIESFIEKVAGLQQIDNTTTLFKLYEVYISLINKEDQETFETFSGWAQTII
FT                   GDFNEIDRYLIPSDEFFNYLSEIKDKDHWYLADEKTTLIENYLKFWKQLPQLYNALYSS
FT                   LISSKKGYQGLIYREAANNIDTYLSTNNKTHIFIGFNALNNAEQHIIQQSIKKDCAEVF
FT                   WDLDEVFYNDTFHDASHFIRSYYKNWKVFENKQFNGGHNFSNKKEISIIGTPKKIGQAK
FT                   AVGQILNDIPANKLSSTAVILGDETLLLPLLNAIPKHIKDVNITMGLPLQKVPLASFFE
FT                   LLFTLQLNNTSELYYKHVLELFNHPSLQYVLEVSKLNVVSYINTGNIVSIKFDSLIAQS
FT                   SAEESEIVKLLFSSSENNPEHFISRILKIIQYLKQNLSVEQSVLREYLYRFNVLFNKLE
FT                   HLLSTFSHISNISVLHTIYKDMLSNETLDFIGKKHDGLQIMGVLETRVLDFENIIITSV
FT                   NEGILPSGKSANSYLPYDLKKEYGLPTYKEKDAIYTYHFYHMLQRCNQAHIIFNTEAGD
FT                   LNSGEKSRFITQLQVEAQNYPKHSYNNLITLPKVPKITSQLRTVQKTAQVMDQIKYRAK
FT                   SGFSPSALTLYMRNPIDFYTRYVLGVGDTEEVEETVAYNTLGTVVHDTLEQLYTPYIGE
FT                   LLNADIIKVMTTKADKQVALEFNNTYSKSSLDKGMNLLIFEVAKRYVHNFLKLEKKRLD
FT                   NGEDIQILKIEEDNNVPITINGIDFPVNLRGKVDRVEKTNGITRIIDYKTGNVDLAKVT
FT                   VKSWDDLNTDYDKYSKSFQILQYAYMMHLKTPFLNPIEAGIISFKNLKSGFLPFNYNKN
FT                   TEITTETFKAFSEQLEQLIKDICNPNIPFVEKELKDPFKG"
FT   gene            734938..735783
FT                   /locus_tag="CA2559_03205"
FT   CDS_pept        734938..735783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03205"
FT                   /product="Alpha/beta superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03205"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87730"
FT                   /db_xref="GOA:A3U663"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3U663"
FT                   /protein_id="EAP87730.1"
FT                   /translation="MTITQNIAVKGQHNKPIVTDLFFKQNTDKKPVVIFCHGYKGFKDW
FT                   GAWNIMAEAFANAGLFFVKFNFSHNGGTLEQPIDFPDLEAFGNNTYTKELDDLESVLNW
FT                   LTAEDFEHAPQIDTTDITLVGHSRGGGIVLIKAEEDSRVTKVITLASVSDYKARFPRGK
FT                   DFEAWKKDGVMHVVNGRTKQKMPHYFSFFEDFKANYERLNIQKVAKRLEKPLLILHGTN
FT                   DTSVKNYNAENLKNWNENATLRWIANADHVFNTKHPWESDTLSKQLNLVVLKSISFIKD
FT                   "
FT   gene            complement(735780..736208)
FT                   /locus_tag="CA2559_03210"
FT   CDS_pept        complement(735780..736208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03210"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03210"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87731"
FT                   /db_xref="InterPro:IPR007298"
FT                   /db_xref="UniProtKB/TrEMBL:A3U664"
FT                   /protein_id="EAP87731.1"
FT                   /translation="MRVFIGIVLVALGLSSCKNTDSSKQSSHEKVVSKGFYNDSIKGLY
FT                   IGTLPCADCLGIKTELHLKEDYNFTLNQVYLETSGSAFTVVGNYTIKQDTIKLYGNTIT
FT                   PDAHQYLYLKDTLIKLNLKGERIKGMLSQKYKLPKKNF"
FT   gene            complement(736218..737210)
FT                   /locus_tag="CA2559_03215"
FT   CDS_pept        complement(736218..737210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03215"
FT                   /product="putative TIM-barrel enzyme, possible
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03215"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87732"
FT                   /db_xref="GOA:A3U665"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A3U665"
FT                   /protein_id="EAP87732.1"
FT                   /translation="MAKIGDIDVGNFPLLLAPMEDVSDPPFRALCKEQGADVVYTEFIS
FT                   SEGLIRDAAKSVMKLDIYEKERPVGIQIFGANLESMLKSVEIVEASGPDIIDINFGCPV
FT                   KKVVSKGAGAGILKDIDLMVSLTEAMVKHTKLPVTVKTRLGWDEESIKIVEVAERLQDV
FT                   GCAAIAIHGRTRKQMYKGDAKWEQIADVKNNPRMHIPVFGNGDVNTPERAVEMRDKYGL
FT                   DGAMIGRASIGYPWFFREVKHFFETGKHLPPPNMIERLDAARRHLQMSIDWKGEKLGVF
FT                   ETRRHYTNYFKGIPHFKEYRMKMVTSDDSKDVFAVFDEVEKEFGDYQFV"
FT   gene            737409..739148
FT                   /locus_tag="CA2559_03220"
FT   CDS_pept        737409..739148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03220"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03220"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87733"
FT                   /db_xref="GOA:A3U666"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/TrEMBL:A3U666"
FT                   /protein_id="EAP87733.1"
FT                   /translation="MADRLLDFTGSVTAREAQAQLLDSMDLERERGITIKSHAIQMNYT
FT                   HKGEEYTLNLIDTPGHVDFSYEVSRSIAACEGALLVVDAAQSIQAQTISNLYLALENDL
FT                   EIIPVLNKVDLPSASPEEVTDDIVDLLGCDPSEVIPASAKTGIGIEEILTAIIERVPAP
FT                   KGNPDESLQALIFDSVYNPFRGVETYFRVINGSIKKNQEIMFMATKKTYGADEVGTLRL
FT                   KQFPRQEIKTGDVGYLITGIKDAREVKVGDTITDAKNPTKNMIGGFEDVKPMVFAGIYP
FT                   VDTEDFEELRSSMEKLQLNDASLVFQPESSAALGFGFRCGFLGMLHLEIIQERLEREFD
FT                   MTVITTVPNVSYHAFTNKNPDEILLVNNPSDLPEPSKLNRVEEPFIKATIITKSDFVGN
FT                   VMSLCIEKRGIITNQTYLTTERVELTFDMPLAEIVFDFYDRLKTVSKGYASFDYSPIGM
FT                   KESKLVKVDVLLNGNTVDALSALLHQDNAYDIGKKMCEKLKELIPRQQFDIPIQAAIGA
FT                   KIIARETVKALRKDVTAKCYGGDISRKRKLLEKQKKGKKRMRQVGNVEIPQEAFMAVLK
FT                   LND"
FT   gene            complement(739271..741148)
FT                   /locus_tag="CA2559_03225"
FT   CDS_pept        complement(739271..741148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03225"
FT                   /product="Na(+):H(+) antiporter, CPA1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03225"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87734"
FT                   /db_xref="GOA:A3U667"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A3U667"
FT                   /protein_id="EAP87734.1"
FT                   /translation="MLELAGIIILGILAQWVAWKFKIPAILPLILIGLLVGPLATLYTD
FT                   GGVKLIQPIWNGEKGLFPGKSLFYFVSLAIGIILFEGGLTLKLSEIKTTGSVITKLISI
FT                   GVIVTFFGAALAAHFIFFLSWPISFLFSALIIVTGPTVISPILRNVPLKKDVSAILKWE
FT                   GILIDPIGALFAVLVFEFISVGAGSEFTITALEEFGKIVLFGFTFGFTFAHALAFAIKK
FT                   NVIPHYLLNVFTLAMVLAVFVLSDLFAHESGLLSVVVMGMVMGNINLPNIKELLYFKES
FT                   LSVLLISILFILLAANINIDDLLLVFNWNAVVLFAIVVLLIRPLGVFLSSINSGLQLNE
FT                   KLFISWVGPRGIVAAGIASLFGLQLTQEGIEGAEYITPLVFMIVLGTVLLNATTARMFA
FT                   KLVGVFLKNSEGILIIGASKVSRLIASYLHKNGRHVVLVDSNNLNIKKAKELGLEAMEA
FT                   SVYADDLISNIELNDVGYLMALTGNAEINNYALDKFEAQFGENGSFRLISPEEMNNPQK
FT                   NPRQGLFSHTDDYIKLTDVARKYPAIQEIDIDTKEQFEGLIEMTKSEKDMVPLFIKKAD
FT                   GQIDILSSFSKDVNVENFEGHKLVYLGKPIDVEQLADSTTAMEDEDNSM"
FT   gene            741293..742156
FT                   /locus_tag="CA2559_03230"
FT   CDS_pept        741293..742156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03230"
FT                   /product="putative metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03230"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87735"
FT                   /db_xref="GOA:A3U668"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A3U668"
FT                   /protein_id="EAP87735.1"
FT                   /translation="MTLHPIESGNFKLDGGAMFGVVPKSLWTRTNPADANNMIDMAARC
FT                   LLIEDGDRLILIDTGMGDKQSEKFFGYYYMWGDHSLDASLAKAGFHRDDITDVFLTHLH
FT                   FDHCGGCIINNPNGNGYLPAFKNAKFWTNENHWNWAVNPNAREKASFLKENILPMQDSG
FT                   QLNFIKKTTKDSFQTSSELDFGIFFADGHTEKQMIPRIDYKGKTLVFAADLLPTAGHIP
FT                   LPYVMGYDTRPLLTLDEKAQFLNEAADHNHYIFLEHDAHNEIITVQHTDKGVRLKDTYT
FT                   FNQLFK"
FT   gene            742166..743848
FT                   /locus_tag="CA2559_03235"
FT   CDS_pept        742166..743848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03235"
FT                   /product="Serine protease/subtilase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03235"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87736"
FT                   /db_xref="GOA:A3U669"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR017308"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034080"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A3U669"
FT                   /protein_id="EAP87736.1"
FT                   /translation="MTIKFPAVATAAITASIILSGCGSAVPTIVSTPLENIDKQPLKTT
FT                   SLNEVQLKGWGGADIVSDTIPGMSVEKAYTEIIKDKQGQSVIVAVIDSGVDIEHEDLKN
FT                   VIWTNTDEIPNNGIDDDKNGYIDDIHGWNFLGDIVEENMEYVRILRDGYSKFENASASD
FT                   FSGEDLEAYNQYVEAKAEYDKEYGEAIQNKQQYEGIYQQLKAAHSAVSKEIGKEDYTKK
FT                   ELSEMTTTSEQLGQYKGFLTQMYTYAEGQTIPEFMEGIKEGVDYFAGRLNSHFNQKLNA
FT                   RATILKDNPDDWSTRYYGNNDVDGPDPKKADAKHGTHVAGIIAASRNNGVGMNGVAQNV
FT                   EIMVIRAVPDGDEYDKDIANAIRYAVDNGAKVINTSFGKYFSTHPEWVNDAIEYAAKKD
FT                   VLIVNAAGNEGLNLDEKRVYPNDQTPTEPKEISDTFLTVGSLTYTYGAEMVSSFSNYGK
FT                   SNVDVFAPGSKIWSTTPLNEYEYLQGTSMAAPAAAGVAAMVRSYFPNLKASEVKQVLME
FT                   SGLSTTQTVVVGGESSNTKPFTSLSTSGKMVNLYNALILASKK"
FT   gene            743905..745716
FT                   /locus_tag="CA2559_03240"
FT   CDS_pept        743905..745716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03240"
FT                   /product="Zn-dependent aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03240"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87737"
FT                   /db_xref="GOA:A3U670"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:A3U670"
FT                   /protein_id="EAP87737.1"
FT                   /translation="MTKYLSVLICFLSLSAIAQNNTSYWQQHVDYNMDIDMDVETFQYK
FT                   GTQKLEYTNNSPDDLNRVFYHLYFNAFQPGSEMDVRLQNIQDPDGRMTTEDKKSRIMSL
FT                   SESEMGYIKVKSLTQDGKEVTYKTVGTVLEVELATPIKSGDKATFEMEFDGQVPQQIRR
FT                   SGRNNAEGVSLSMTQWYPKMAEYDFEGWHADPYIGREFHGVWGDFNVNITIDKDYIIGG
FT                   TGYLQNPEDIGYNYGDEGPKGKKGKKGKLTWKFKAPMVHDFTWAADPDYIHDKVTANDG
FT                   TVLHFLYQDNDSIKENWKNLQPKTEQILEFFNENIGPYPYEQYSVIQGGDGGMEYGMST
FT                   LITGERKFGSLVGVTAHEMAHSWFQFILATNEAQHEWMDEGFTSFISSEAMNVVMGENK
FT                   ENPHSGSYRGYTYLANSGVEQPMTTHADRYNVNQAYSITAYAKGAVFLAQLEYLLGNDL
FT                   QDEIIKEYYNQWKFKHPTPNDFIRVAEKVSGAELGWYLIDFGQTTNTIDYTVKSIEGNT
FT                   ATLERIGLMPMPIDAKVTFADGTTKMVHIPLRMMRWVKPNAENVQEDWPWAMPTYELKM
FT                   DKEISKVEIDPSQLMADVKRDNNTMQK"
FT   gene            complement(745811..747031)
FT                   /locus_tag="CA2559_03245"
FT   CDS_pept        complement(745811..747031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03245"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87738"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:A3U671"
FT                   /protein_id="EAP87738.1"
FT                   /translation="MRTLLLCFILLTITSLSQAQAVANPASDLTACSDTDFSQFDLSVN
FT                   DAQIIGDQNNVTVSYHTSQTDADNKINPLISPFTNTTNPQTIYARAEDTTDSTYDTTTL
FT                   IISVGLNPATAEPIDLILEDVNEDGTESFDLSENTPIVLNGLSPSNYDVVYFETESDAL
FT                   ADNNAIVTPNAYNNLFSPQTIYIRVTNFEFGCFTIENFDLVLTLPDSDNDGISDSDEDL
FT                   NTNGDLNDDDTDEDDIPNYLDDDDDGDGVDTLTEITGIGAGLQSFAFIDTDEDLIENYL
FT                   DDDDDGDGVLTIDEDYNNNGSPLDDDTDNSGVPDFLESNISLSIEDNKLSEVSVFPNPS
FT                   SGIFNLNGITVDTINVKVITIYGKTLKSYTFNKHSTSINLSNLPSALYFLHLEVNGYKR
FT                   VQKIVIK"
FT   gene            complement(747072..747638)
FT                   /locus_tag="CA2559_03250"
FT   CDS_pept        complement(747072..747638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03250"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87739"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A3U672"
FT                   /protein_id="EAP87739.1"
FT                   /translation="MKNLLSTIRDCSLCADKLPLGPRPIIEAAKHSKIVLISQAPGRKV
FT                   HESGVAWKDQSGKKLREWLGVTEETFYNTDNFAILPMGFCYPGKAKTGDLPPMKICAPT
FT                   WHDQVWNELKHVKLKLLIGAYAQNYYLPDDKRNLTEKVKNYNDYLPEYFVIPHPSPVNR
FT                   FWRMKNPWFENTVVTKLQEHVNSIL"
FT   gene            747718..749625
FT                   /locus_tag="CA2559_03255"
FT   CDS_pept        747718..749625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03255"
FT                   /product="acetyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03255"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87740"
FT                   /db_xref="GOA:A3U673"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A3U673"
FT                   /protein_id="EAP87740.1"
FT                   /translation="MSHYSIKHIEEYYQVYRKSVRDPELFWGEIAEEHFLWRKKWDRVL
FT                   SYDFSKPEFKWFEGAQLNITENCLDRHLTTRANKTALLFEPNNPEEKAQHITYKELYER
FT                   VCKLANVLKQKGVKKGDRVCIYLPMIPELTVSVLACARIGAIHSVVFAGFSSKALATRI
FT                   NDCDCEMVITSDGSYRGHKTIDLKAIVDEALEQCSGVKNVLVVKRINSEVSMTPNRDFW
FT                   IEPLLKEASANCPAEIMDAEDPLFVLYTSGSTGTPKGMVHTCGGYMVYSAYTFKNVFRY
FT                   EENDVYWCTADIGWITGHSYIIYGPLANGATSLMFEGVPSYPDFGRFWEIVEKHRVNQF
FT                   YTAPTAIRALAKENLKFIESHDLSSLKVLGTVGEPINEEAWHWYNVNVGKKRSPVADSW
FT                   FQTETGGIMISPIPYVTATKPTYATLPLPGVQLALMDENGDEIKGNQVDGRLCIKYPWP
FT                   GIARTIYGNHKRYKDTYFSAFKGMYFTGDGALRDETGYYRITGRVDDVVIVSGHNMGTA
FT                   PIEDAINEHPAVAESAIVGFPHDIKGNALYGFITLKETGEGRDHNNLRSEINQLITEYI
FT                   GPIAKLDKIQFTKGLPKTRSGKIMRRILRKIASKDSENLGDISTLLNPEVVQDIIDTSL
FT                   "
FT   gene            749639..751069
FT                   /locus_tag="CA2559_03260"
FT   CDS_pept        749639..751069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03260"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03260"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87741"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3U674"
FT                   /protein_id="EAP87741.1"
FT                   /translation="MSAYDAVIIGSGPNGLAAGIALSQEGKRVLILEAHKEVGGGTRTA
FT                   ELTLPGFHHDVCSAVHPSGFISPFFKTLPLEKFGLEWIHPEVSVAHPLDNAPAILLKKS
FT                   IKDTSTQLGQDSNRWVSLFEEFVGASDALFKDTMAPLQIPNNPILLSKFGLKGARSAVS
FT                   FVNSYFKDEQAKALFAGCAGHSILPFDKMLTSAFAMMFVIQGHVTNWPIVKGGSQNLAK
FT                   ALSGYFVSLGGTITTNTRITNFEQLPIAKAYLFDTDPKQLAAICKAELPKSYLNRLHNY
FT                   KYGPGIFKVDWALSESIPWKDPNCLKASTVHVGGTFNEIAKSEKDMWEGRHSEKPFLIL
FT                   CQQSEFDATRAPKGQHTGYAYCHVPNGSTKDMTAAIESQIERFAPGFKNIILSRHKTST
FT                   KGFQDYNPNYLGGAITGGVSDISQLFTRPVARLNPYSTPNHSIYICSASSPPGGGVHGM
FT                   CGYYAAKSVLNKKATIKR"
FT   gene            complement(751105..752691)
FT                   /locus_tag="CA2559_03265"
FT   CDS_pept        complement(751105..752691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03265"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87742"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:A3U675"
FT                   /protein_id="EAP87742.1"
FT                   /translation="MTRYILLIASLVLACNLSAQSDEANGAVATELSATYECENSEISN
FT                   FQGFTKSAEFNCVDYDFWVDSWYTFTPTETKMYAIEIESLNSNNQNVRIGIFTGTPGNL
FT                   TSQTGCATRYYSAVLNSGQTYYINARGASETTQYRMCVYPFPDSPDNNDTANAEEILES
FT                   TIDMCENSVVGYTANASTSGESYCTNSNPDVWYTFTPTESAEYTFSASLVNGAAPLSIS
FT                   LYNGTPGFLNPLSEEFPSQTNQCEDIVLGDLEANETYYINVTSALSSQAIYFDLCVYKS
FT                   PAPPSNDDCTNPIALNVGQSFEDSFIVATNTSATINPGNSNFPSCGTLDFSTRGRDIWF
FT                   TVVVPESGSFTIETRVEPDETNLYDTAIETYTGSCGTDTLEPYYYNLPPPNTTTAYCND
FT                   QFVIGGNQFAGILFTDKTPGETVIVRVWGWSQQFGKFRIAAYDSSTLSTDEVESNELEV
FT                   YPNPIKNEVNISYSNIIDEVVIYDIRGKEVLKNKVNNNYINLNTNSLESGLYIIKVKSE
FT                   DNVHTYKIVKN"
FT   gene            752857..756069
FT                   /locus_tag="CA2559_03270"
FT   CDS_pept        752857..756069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03270"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87743"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A3U676"
FT                   /protein_id="EAP87743.1"
FT                   /translation="MKNIYIILILVAATLKINAQVVSINDITLGGISTSTFQETPIDAD
FT                   DNYSYSQSIYLQSEINVAGTISKITYYTDGVLENSNDITVYMAEKTEDVFSSNDDWLPF
FT                   SSLTEVFSGTYEVYGNEVSIILDTPFNYSNTSNLVIIVDENQDDSDSNDFITHNLGFSE
FT                   ANGRVLHYGNNFTNPDPISPPSGTRDYYRPNIEIDFNEITCFPPSNIAIGTIEPTAVTI
FT                   SWESPVTNWDYVIQFAGLGNPDAATPVEASSSTINPQGLTSNTAYEFFVRSSCDTDDTS
FT                   DWIGPINFRTGCETVNDFSESFESLPDELAIPYCWSVISTSTGTEASYKVNSSASQSYS
FT                   PDNYYEIQINEDDELFVISPQSLTIADGTKRIEFAAKVNSTTSGETTLNVGLMTDPNSE
FT                   TTFEALSSFTLNSSSNNNNNYTLYYVNIPENINADYLAFNIETTSTFNKIVSLDDIVIT
FT                   SQPSCFEVLNLEASEITDTSFNLTLEADIQPQTQWELVVVQTDLNFNPDLETPIVVNTL
FT                   TTPITTDSDGGSILPNSPYRVFIRANCDAAGSDGSGYSSWFGPYDLRTDCAPLNNGFTE
FT                   TFESYSNADFPFCWSKNMTSTGSPLVQVSSFASYANSGSNSLIMNTGNDPNANILLILP
FT                   QSTIANDGNHRLEYYARKTNVNTDINLIVGTMSDPLDANTFEEITAVPVLTGGTSGENV
FT                   QYFVNLPFNDNDYVVLKHEAGDAASVALYLDDVTITEQPDCTEVFNVTANNVTASSVSV
FT                   SWEFIGDQTQWEYIVQPLNTGIPVSGQSTMSNTSNSDFSMLDANTSYEIYVRANCDTDG
FT                   YSDWSAPITFTTLCVGESDNFTHSFEGFESNTPIEPCWSSLITPFSTSPTITYSSTQAQ
FT                   DGSLSARLYSGNSTDTDLLLISPQLLGLDATKQISFYVYDNDMGALEVGTMTNKNDATT
FT                   FTPYQIFTDADLTDDAWEQKIVTFEDYTGTDQYIAFRYVAASTFDNLFIDNFSYDTNPV
FT                   LSTSENSLSDVSIYPNPVKNALHITGEHISSITIYTINGKKVFSKRESLETINITNLNA
FT                   GIYFVELKDQDGKRIMKKVIKQ"
FT   gene            complement(756124..756828)
FT                   /locus_tag="CA2559_03275"
FT   CDS_pept        complement(756124..756828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03275"
FT                   /product="two-component system, transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03275"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87744"
FT                   /db_xref="GOA:A3U677"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A3U677"
FT                   /protein_id="EAP87744.1"
FT                   /translation="MEKRILLADDDIDFGTTLKQYLELNKFEVFWAKDGVEAFDLLKMH
FT                   SFDICIVDVMMPKLDGFSLSKKISKKFPATPFLFLTARKNKPDRIKGLSIGADDYISKP
FT                   FEVEELILRINNIIKRTKQQQTINIEEEVFETLQIGKYLLDVKNLSLTIENHTFKITEK
FT                   EAQLIVYLYKNKNSLIPRDDILDNVWGQSNFFSGRSMDVFISRVRKHFKDDKNISINSV
FT                   RGVGLEFVIKDQ"
FT   gene            complement(756800..758203)
FT                   /locus_tag="CA2559_03280"
FT   CDS_pept        complement(756800..758203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03280"
FT                   /product="two-component system sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03280"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87745"
FT                   /db_xref="GOA:A3U678"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3U678"
FT                   /protein_id="EAP87745.1"
FT                   /translation="MKIKSKLLIVGAILALIALTTMQGYLIFNTYDLRKKSYAVESRTK
FT                   IGSIVKTPYVDSLSWNYRMEFVEKIPEYKNGIITKDSLLNSLEKFSSLKNDTFLDYFKK
FT                   GAEYYNLDDNIQFKKIATSIQLSENGETEDLLIDGKDEPIFLLGTNFPTDEGLIINAWN
FT                   WTFDKDYTNTLNQESTVDIKYRATIYMKILNWDTIIFKRLLLLFFVAFLLFLFIILLVT
FT                   YSIRNLLKLKRISDIKTDFINNITHELKTPLATLSIATKTLTNKFAKDNKDIAKDSIDT
FT                   INRQNKRLQNLIDQVVDNSVGYNDINLNKEQVNLSSFLKDLSEDYALTLPKHIQFIKSI
FT                   SDVSEEVSVDQFYFSTAIVNILNNAVKFEGSVIKITYQIENFEHIISISDNGIGISKKN
FT                   KTLIFGKFFRVSEKNTHNFKGLGLGLYYCKQIINAHKGTLDVKSRKNEGSTFFIKLPLS
FT                   NGKKNLISR"
FT   gene            complement(758333..758406)
FT                   /locus_tag="CA2559_t07711"
FT   tRNA            complement(758333..758406)
FT                   /locus_tag="CA2559_t07711"
FT                   /product="tRNA-Met"
FT   gene            complement(758477..758884)
FT                   /locus_tag="CA2559_03285"
FT   CDS_pept        complement(758477..758884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03285"
FT                   /product="Lactoylglutathione lyase and related lyase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03285"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87746"
FT                   /db_xref="GOA:A3U679"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A3U679"
FT                   /protein_id="EAP87746.1"
FT                   /translation="MLTKIEHIGIAVSNLEEANKTYETLLGVAPYKAEDVESEGVTTSF
FT                   FKVGDSKIELLGATHEDSAIAKFIAKRGEGIHHIAYAVEDIEKEMKRLKNEGFKLLNET
FT                   PKKGADNKLIAFLHPKSSNGVLVELCQDIKK"
FT   gene            758959..759357
FT                   /locus_tag="CA2559_03290"
FT   CDS_pept        758959..759357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03290"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03290"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87747"
FT                   /db_xref="GOA:A3U680"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:A3U680"
FT                   /protein_id="EAP87747.1"
FT                   /translation="METNRQKKIAGVLQRDLADVLQSALREAGTQGIIISVTQAKVTTD
FT                   LSQAKAYLSIFPSDKAETVIAEINKLKYQIKHQIALKTKNQLRRMPNLEFFNDDSLDYI
FT                   AGIEDAVKGKENPIENRDLLDKRKKAGN"
FT   gene            759354..760550
FT                   /locus_tag="CA2559_03295"
FT   CDS_pept        759354..760550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03295"
FT                   /product="putative lipoprotein releasing system
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03295"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87748"
FT                   /db_xref="GOA:A3U681"
FT                   /db_xref="UniProtKB/TrEMBL:A3U681"
FT                   /protein_id="EAP87748.1"
FT                   /translation="MNFSYYIAKRYLFTKSKNNAINIISLIATIGVFAGALALFIVLSG
FT                   FSGLKDFSLSFTNEFDPDLKLLPEQGKTIVVDSLLQEKISEVEGIVAYSKVIEERVFLD
FT                   FREKNQMAFIKGVDERFKSVNAIDSSLFYGTWLSDKPSHVVLGNGISQSLSLGTYDYGS
FT                   TLRLMVPKPGKGQITNPTDAFNAKQSVVSDIYSINEELDNKYVFSSLAFAQELLELDAN
FT                   EFSALEIKLSPTAKEDDVRASLNNLFDKPINIKNRIQLNDKLYKMLNTENLAVYLIFTL
FT                   VLIIALFNVIGSIIMVILDKQDNIKTLYNVGASVSQIKKVFLLQGTLMTLLGGVLGLFV
FT                   GVLIIYAQLQFNMIMITPSLPYPVSLTIKNILIVFVTIMSLGIMASYIASSRIHRALA"
FT   gene            complement(760547..760921)
FT                   /locus_tag="CA2559_03300"
FT   CDS_pept        complement(760547..760921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03300"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03300"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87749"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:A3U682"
FT                   /protein_id="EAP87749.1"
FT                   /translation="MKHILLVVSICFFSLTYSQNQAELEKVAYSEYLQSDKELKSLFNS
FT                   ILKGHNENPEFSKRLKQSQELWLGFRNFELESRFPNSEVNRSSNNNYGICESMFLTEFT
FT                   LDRIKYFNTWFNDTTTEPCN"
FT   gene            complement(760937..761908)
FT                   /locus_tag="CA2559_03305"
FT   CDS_pept        complement(760937..761908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03305"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87750"
FT                   /db_xref="InterPro:IPR032286"
FT                   /db_xref="UniProtKB/TrEMBL:A3U683"
FT                   /protein_id="EAP87750.1"
FT                   /translation="MKKFVLLLSVLATVFTSCEDEKVILTTSSGNINNLSVIVENDLWK
FT                   GEVGDAIRTNLAATVEGLPQEEPLFNMNQIPPKAFSGFVTKNRTYLKVEKSDSIALKIV
FT                   RNQFARPQTGVIAKGPDAASIAKLINERGADIVAVFKQTEIKEKQRRINKSLKADDVIK
FT                   KKLGVSLKFPTAYRYAKEDDKFFWLRKDLKNGGMNIMIYEIPMQKINADTNVISSIIKM
FT                   RDSIGQAHIPGPVDGSYMITEAAYAPYLFESEIDGRFAYETKGTWEVKNAFMAGPFLNY
FT                   TIEDKANNRYIVLEGFTFAPSAPKRDHMFELEAILKSAKIGF"
FT   gene            complement(761931..763502)
FT                   /locus_tag="CA2559_03310"
FT   CDS_pept        complement(761931..763502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03310"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03310"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87751"
FT                   /db_xref="GOA:A3U684"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A3U684"
FT                   /protein_id="EAP87751.1"
FT                   /translation="MFRYIFITLLIGATSVSAQDSIKKPRKIIQDSTGITMYKSIDTTV
FT                   VDTKNPEFKRTIPAALVRLENKEPLQDIKEAIRVDSLWMAELSNEDIFEELHAKLDSLP
FT                   YNETVIFDLPTDTLKARLAKLNAKTPFNIEYNPSLENVIKSYLKRNKESYERLMAISEY
FT                   YFPMFEQMLDKYDIPLEMKYLAIVESALNPRAKSRVGATGLWQFMFSTGKMYDLDVSSY
FT                   VDERMDPIMATEAACKYLSKLYDIFEDWDLALAAYNSGPGNVNKAVRRSGGYKNYWNLR
FT                   PFLPRETAGYVPAFLASMYIFEYAEEHGFQPKRPEIPYFKTDTIHIKDMITFDQISEVT
FT                   QLDSGMLEFLNPSYKLGIIPKIEDEAYYLRLPTEQAGIFVTHENAVYAYAKTELEKREK
FT                   PLPNLVEANDKVRYRVRSGDVLGKIAERYGVSVSSIKRWNRLRSNNIRIGQRLTIYPRK
FT                   PVAATRNSASSSKPITGKVYTVKSGDSLWSIANKIPGVSVSNLKNWNDISSNSLKPGMR
FT                   LKLSKG"
FT   gene            complement(763546..764808)
FT                   /locus_tag="CA2559_03315"
FT   CDS_pept        complement(763546..764808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03315"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03315"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87752"
FT                   /db_xref="GOA:A3U685"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:A3U685"
FT                   /protein_id="EAP87752.1"
FT                   /translation="MSNVNLFYLTMVKRDISLLLPLNFVTMKTLNDYNFKNKKALIRVD
FT                   FNVPLNDDFEVTDTTRIEAAKDTIIKVLEDGGSAVLMSHLGRPKGEQEEYSLKHICSKV
FT                   SEILGVQTKFASNCVGPVAEDAVSRLENGEVLLLENLRYHEEEKKGDQKFAKQLSKLGD
FT                   VYINDAFGTAHRAHASTTVVANYFEDKCVGYLLQKEIESLNKVLNNSTKPVTAILGGAK
FT                   VSTKITVIENILDKIDHLIIGGGMTFTFIKAKGGKIGSSLVEEDKLDLALEIIEKAEEK
FT                   NVQIHLPSDAIVADSFSEFANTNIEAVDNISDGWMGLDVGPKTLEEFKGVVLQSKTILW
FT                   NGPLGVFEMEPFAKGTIELGNYIEEATEKGAFSLVGGGDSVAAVKQFGFENKVSYVSTG
FT                   GGAMLEMLEGKKLPGIAALED"
FT   gene            764842..766014
FT                   /locus_tag="CA2559_03320"
FT   CDS_pept        764842..766014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03320"
FT                   /product="putative DNA polymerase III, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03320"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87753"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3U686"
FT                   /protein_id="EAP87753.1"
FT                   /translation="MGMLYLRMLFKDIIGLPHIKNHLTTTADRRRIPHAQLFVGKSGSG
FT                   TLPMAIAYAQYILCNNSNGDNLEDNSCNMRFNNLSHPDLHFAFPVANTKEVSKHAVSNH
FT                   FMAQWRDFVKDSPYADVFDWYKRLEIENKQGRIGVDEAQDVVKKLSLKAYEGGFKCMII
FT                   WGADKMNTEASNKLLKLIEEPPEKTVFLLITDDEDSIIQTILSRCQVLHFPPLGEGDIA
FT                   KHLIDYEGLDIVNAQKIAHQSDGDYNIAMHLLHKNEDDALFEEWFITWVRTAFRAKGNK
FT                   KAINPLLTWSETIAKSGRETQKRFLEYCQNFFRQALLINYNTPELVYLQPQTSGFDINK
FT                   FAPFVHENNILQINEALQDAMYHIERNGNPKIILSDLSIKLTRFLHTKSA"
FT   gene            766031..766897
FT                   /locus_tag="CA2559_03325"
FT   CDS_pept        766031..766897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03325"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87754"
FT                   /db_xref="GOA:A3U687"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A3U687"
FT                   /protein_id="EAP87754.1"
FT                   /translation="MIKQIFSLLRIKDWIKNLFVFLPAFFSGLILEPNVFKASLIAFLL
FT                   FSLSASLIYIINDYVDRAQDKLHPLKKDRPIASGKITPKGALIIAGVLALVITILGLYS
FT                   FSLLLLLPLLLYIILNLGYSFGLKHIPILDVSIIAIGFILRVVFGGLATEIFVSKWAFL
FT                   LTFFLALVLALGKRRGELISISSTSRKVLDGYNKEFLNTALIICVTITLVCYVMYTISD
FT                   DVIVAFGSDYIYFTTLFVIIALLRYLQLTFVYNKTESPTKVVYSDHFMQVMIALWLISF
FT                   ALIIYFK"
FT   gene            766898..768208
FT                   /locus_tag="CA2559_03330"
FT   CDS_pept        766898..768208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03330"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87755"
FT                   /db_xref="GOA:A3U688"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A3U688"
FT                   /protein_id="EAP87755.1"
FT                   /translation="MPKLKHITNWGNFPKIKAQEFKLRNTDNSQEFFNCKTIIPRGNAR
FT                   CYGDASLNSSVVSTLPLKHFINFNSKKGYITCECGVLFSDILEFIVPKGFFLPVTPGTK
FT                   FITVGGAIAADIHGKNHHNEGCFSEFVIEFKLLTAQHIIITCSRTENEKLFWETIGGMG
FT                   LTGIILSATFQLKPIKTSYIKQESIKAKNLDEVFQLFETHEDSTYTVAWIDCLKKGKGL
FT                   GRSILIKGDHAAPSDLSKKQLEKPLKIHSSGKLKIPFFFPSFALNTFTVKVFNLLYYFK
FT                   QFHKTTASVVHYDSFFYPLDAIHQWNNVYGKNGFIQYQFVVDKARSKAAMKEVLEAISK
FT                   SGQGSFLAVLKLFGKQNIKAFNSFPIEGYTLALDFKLNKKVLQLIPILDAIILKYEGRI
FT                   YRAKDSCSNPKLTNYVTAHNPKFDSIQNKRIKSHKTI"
FT   gene            768205..768927
FT                   /locus_tag="CA2559_03335"
FT   CDS_pept        768205..768927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03335"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03335"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87756"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3U689"
FT                   /protein_id="EAP87756.1"
FT                   /translation="MIVLGANSDVAKAFVEKILKEQHLKRVYLCSSNPKELAPFKAHLE
FT                   VKYSVDIEVLEFNLLANTVNIDYSALDYKLVFCASGYLGKPAEKGILDEHDSLKIVTIN
FT                   YAKLVVELNKIATDLVSKGSGTIIGLSSVAGERGRQSNFLYGSAKAGFTAYLSGLRNYL
FT                   VSKNCHVLTVKPGFMDTKMIEDIDTPKPLTITAEKAAHLIYKGYKSKKNTIYIAGIWRY
FT                   IMAIIKMIPEFIFKKLSL"
FT   gene            768924..769514
FT                   /locus_tag="CA2559_03340"
FT   CDS_pept        768924..769514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03340"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87757"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A3U690"
FT                   /protein_id="EAP87757.1"
FT                   /translation="MKTLYLYDFDGTITTRDSLFDVLKLSTSTFIYYLKILQFAPKLIL
FT                   TKLGILKKGQTKESLVSLFLKGYSKKELEELAKRYLKLANKESLFRKKALKQLETDLKG
FT                   GDVYIVSASLEFWLKPIAAALDVQLICTEVAYNDSVFTGKFSTPNCNYAEKARRVKAEI
FT                   DLSNYDSIVYYGDSKGDLNMKPIVTKFHLNYFK"
FT   gene            complement(769574..770083)
FT                   /locus_tag="CA2559_03345"
FT   CDS_pept        complement(769574..770083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03345"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87758"
FT                   /db_xref="GOA:A3U691"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:A3U691"
FT                   /protein_id="EAP87758.1"
FT                   /translation="MKTIVIALGALLVLASCNQDKTAYVDNTVLLKEYKEMKDTEAKYN
FT                   TMAEAMKKEMDSVAKQFQAEVQEYQSNANSMSNSQRQEAEGKLMQKQQQLQQQQQMRSQ
FT                   QLRAESDKEIDSIITKVKTYVKDYGKDNGYTYIFGSNETANIMYAKEGKDITQDVLEEI
FT                   NAEVKE"
FT   gene            complement(770305..771162)
FT                   /locus_tag="CA2559_03350"
FT   CDS_pept        complement(770305..771162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03350"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87759"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3U692"
FT                   /protein_id="EAP87759.1"
FT                   /translation="MNYPDFSSLNTKLTCKDYTVSEEFFQLKYWDEYDMLVTYPQPKLD
FT                   ELDSYYESEDYISHTDSKATLVDKIYQSVKRIMLNKKLEIVSSFNQNKGSLLDVGAGTG
FT                   DFLNAAKNDGWSISGVEPNSKARSLANQKKILLVEDINQLPTQKYDVITLWHVLEHVPN
FT                   LFEYIETLKSLLKENGILIIAVPNYKSYDATYYKEFWAAYDVPRHLWHFSPKGIKKLFA
FT                   QFNFKLENTFPMTYDAYYVSLLSEKYKNSSFQKLKALKTGFLSNLKAKHSGEYSSLIYC
FT                   FKTI"
FT   gene            complement(771202..773073)
FT                   /locus_tag="CA2559_03355"
FT   CDS_pept        complement(771202..773073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03355"
FT                   /product="glucose-inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03355"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87760"
FT                   /db_xref="GOA:A3U693"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3U693"
FT                   /protein_id="EAP87760.1"
FT                   /translation="MFESEYDVIVVGAGHAGSEAAAAAANMGCSTLLITMNLQNIAQMS
FT                   CNPAMGGIAKGQIVREIDALGGYSGIVSDTSAIQFKMLNKSKGPAMWSPRVQSDRMRFA
FT                   EDWRLKLEQTPNLDFYQEMVAGLIVEKDKLVGVRTSLGLEVRGKTVVLTNGTFLNGLIH
FT                   IGEKQFGGGRAGERAATGITADLLNLGFESGRMKTGTPPRVDGRSLDYSKMTEQPGDDI
FT                   PWKFSYSDITKPLEKQRSCYMTYTSPEVHDLLREGFDRSPMFNGRIQSIGPRYCPSIED
FT                   KINRFADKDRHQMFIEPEGWNTVEVYVNGFSTSLPEDVQFKALRSVVGFEKVKFFRPGY
FT                   AIEYDYFPPTQLKHTLETKLVDGLFFAGQINGTTGYEEAASQGLIAGVNAALKVKEQDE
FT                   FILKRDEAYIGVLIDDLITKGTEEPYRMFTSRAEYRTLLRQDNADFRLTGKSFEIGLAS
FT                   EERYNKMLDKKDKSESFVDFFKNTSYDWKEANEILKENNSATVKQNDKLFKLFSRPQIT
FT                   MDDVRQFNDVENYIQEHNLDTEVLEQTEVQVKYAGYIEKEKNNADKLQRLEYVKIPSDF
FT                   DYSQLKSMSYEAREKLQEIQPRTVSQASRVSGVNPADISVLLVYLGR"
FT   gene            complement(773076..773492)
FT                   /locus_tag="CA2559_03360"
FT   CDS_pept        complement(773076..773492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03360"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87761"
FT                   /db_xref="GOA:A3U694"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:A3U694"
FT                   /protein_id="EAP87761.1"
FT                   /translation="MINFFTETEFIINEDEFNSWLLSVIASEGKNLGEINYIFCDDAYL
FT                   LSINQQYLDHDTYTDIISFDTSEGNDLSGDIFISVERIQENAQQFNVSVDDELKRVLVH
FT                   GILHFCGYKDKTDDEAKLMREKEDEKLKMFHVEQ"
FT   gene            complement(773485..776925)
FT                   /locus_tag="CA2559_03365"
FT   CDS_pept        complement(773485..776925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CA2559_03365"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CA2559_03365"
FT                   /db_xref="EnsemblGenomes-Tr:EAP87762"
FT                   /db_xref="GOA:A3U695"
FT                   /db_xref="UniProtKB/TrEMBL:A3U695"
FT                   /protein_id="EAP87762.1"
FT                   /translation="MNHYNQIIDKLERFIRKYYTNELLKGIILFFAIGLLYFLLTVFLE
FT                   WVLWLSPLARTILFWTFIAVEIALFGRFIIYPLSKLFKLSKGISYEQASAIIGQHFTEV
FT                   NDKLLNVLQLKQNTESSELLLASIDQKAEELQPIQFNFAVNFKDNTKYLKYLAIPVLIL
FT                   LAIWISGKSNLFTESYDRVVNYQQAYEPPAPFQFFVVNDNLDAKENQDFTIEVRTTGNF
FT                   IPQEATINYNGETYFMKSVSAGVFQYTFNQLKEPLSFYLSANEVKSIPYTISLTKVPTL
FT                   LSFNMALNYPAYTGRRDEVLQGTGSATIPEGTTITWDLATQSTSQVSMILRYTTQEFTV
FT                   NDNTFSLQKRIFNNFNYEISTSNEQLKNYENLAYGLRVIKDQYPELVLKSETDSLNKQA
FT                   MYFFGSASDDYGLSKLELVYYPSEDEASSKKLPIAINSTTYDDFVYAFPDTLSLPKGVP
FT                   YNFYFQVFDNDRVNGSKRVKSEVFSFRKLTDNEVEEQQFEEQKETISGMNKSLEKMKDR
FT                   EKELEELNQLQKEKEALNFNDKKKLEEFLKRQKQQEQIMQQFSKKMKENLQQFQQDNPE
FT                   NDPVKQKLEERFQRNEEQLKKNEELLEELQKVQDKINKEELSEKLEKLAKQNQNEEKNL
FT                   EQLLELTKRYYVEKKALKVAEDLEKLAQKQEELSKNDGDENTKEAQEELNKEFKKLQED
FT                   LKDLEEENKDLKEPMDISRDEEKEESIKEDQEDASEKLDSESKENQEEESSEQKNSDKQ
FT                   DAQKKQKSAADKMKEMGQKMASQMQESGESGESEDAEMLRQILDNLVTFSFEQEGLMDD
FT                   FKAMERNNPAFAKKLKRQSVLRENFTHIDDSLYALSLRNAELGEIVNEKLTDIEFNIDK
FT                   SLERLSDNYLPQGISNQQYTVTAANELAFLLANSLDNMNASMGSSGKGKSGKGKGKGKG
FT                   EGQGKGFQLPDIIKKQEELGEQLKNGMKPGQKPGEGSQGKNGKSGEGGEGGSSGENGKS
FT                   GTDGKNGNKEGEGKDGNQLDEQMSGELFEIYQKQQQLRNQLEDKIREEGLGADAERLAK
FT                   QMEQVEQSLLDKGFDNKVLQQMTNLKHQLLKLDSATLEQGQDDKRESKSNLKSFSNPTN
FT                   SHILKAKEYFNTTEILNRQTLPLRQDYKQKVQDYFKEND"
FT   gene            777086..778621
FT                   /locus_tag="CA2559_03370"
FT