(data stored in ACNUC1104 zone)

EMBL: CP002047

ID   CP002047; SV 1; linear; genomic DNA; STD; PRO; 11936683 BP.
AC   CP002047;
PR   Project:PRJNA46847;
DT   01-JUN-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
DE   Streptomyces bingchenggensis BCW-1, complete genome.
KW   .
OS   Streptomyces bingchenggensis BCW-1
OC   Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae;
OC   Streptomyces.
RN   [1]
RP   1-11936683
RX   DOI; 10.1128/JB.00596-10.
RX   PUBMED; 20581206.
RA   Wang X.J., Yan Y.J., Zhang B., An J., Wang J.J., Tian J., Jiang L.,
RA   Chen Y.H., Huang S.X., Yin M., Zhang J., Gao A.L., Liu C.X., Zhu Z.X.,
RA   Xiang W.S.;
RT   "Genome sequence of the milbemycin-producing bacterium Streptomyces
RT   bingchenggensis";
RL   J. Bacteriol. 192(17):4526-4527(2010).
RN   [2]
RP   1-11936683
RA   Wang X., Yan Y., Zhang B., Xiang W., Wang J., An J., Tian J., Jiang L.,
RA   Wang C., Sun X., Zhang J., Liu C., Du J., Zhu Z., Xiang Z.;
RT   ;
RL   Submitted (20-MAY-2010) to the INSDC.
RL   College of Life Science, Northeast Agricultural University, No.59 Mucai
RL   Street Xiangfang District, Harbin, Heilongjiang 150030, China
DR   MD5; 5224bc056fb4075d20a2a0f83a6342dc.
DR   BioSample; SAMN02603683.
DR   EnsemblGenomes-Gn; EBG00001441992.
DR   EnsemblGenomes-Gn; EBG00001441993.
DR   EnsemblGenomes-Gn; EBG00001441994.
DR   EnsemblGenomes-Gn; EBG00001441995.
DR   EnsemblGenomes-Gn; EBG00001441996.
DR   EnsemblGenomes-Gn; EBG00001441997.
DR   EnsemblGenomes-Gn; EBG00001441998.
DR   EnsemblGenomes-Gn; EBG00001441999.
DR   EnsemblGenomes-Gn; EBG00001442000.
DR   EnsemblGenomes-Gn; EBG00001442001.
DR   EnsemblGenomes-Gn; EBG00001442002.
DR   EnsemblGenomes-Gn; EBG00001442003.
DR   EnsemblGenomes-Gn; EBG00001442004.
DR   EnsemblGenomes-Gn; EBG00001442005.
DR   EnsemblGenomes-Gn; EBG00001442006.
DR   EnsemblGenomes-Gn; EBG00001442007.
DR   EnsemblGenomes-Gn; EBG00001442008.
DR   EnsemblGenomes-Gn; EBG00001442009.
DR   EnsemblGenomes-Gn; EBG00001442010.
DR   EnsemblGenomes-Gn; EBG00001442011.
DR   EnsemblGenomes-Gn; EBG00001442012.
DR   EnsemblGenomes-Gn; EBG00001442013.
DR   EnsemblGenomes-Gn; EBG00001442014.
DR   EnsemblGenomes-Gn; EBG00001442015.
DR   EnsemblGenomes-Gn; EBG00001442016.
DR   EnsemblGenomes-Gn; EBG00001442017.
DR   EnsemblGenomes-Gn; EBG00001442018.
DR   EnsemblGenomes-Gn; EBG00001442019.
DR   EnsemblGenomes-Gn; EBG00001442020.
DR   EnsemblGenomes-Gn; EBG00001442021.
DR   EnsemblGenomes-Gn; EBG00001442022.
DR   EnsemblGenomes-Gn; EBG00001442023.
DR   EnsemblGenomes-Gn; EBG00001442024.
DR   EnsemblGenomes-Gn; EBG00001442025.
DR   EnsemblGenomes-Gn; EBG00001442026.
DR   EnsemblGenomes-Gn; EBG00001442027.
DR   EnsemblGenomes-Gn; EBG00001442028.
DR   EnsemblGenomes-Gn; EBG00001442029.
DR   EnsemblGenomes-Gn; EBG00001442030.
DR   EnsemblGenomes-Gn; EBG00001442031.
DR   EnsemblGenomes-Gn; EBG00001442032.
DR   EnsemblGenomes-Gn; EBG00001442033.
DR   EnsemblGenomes-Gn; EBG00001442034.
DR   EnsemblGenomes-Gn; EBG00001442035.
DR   EnsemblGenomes-Gn; EBG00001442036.
DR   EnsemblGenomes-Gn; EBG00001442037.
DR   EnsemblGenomes-Gn; EBG00001442038.
DR   EnsemblGenomes-Gn; EBG00001442039.
DR   EnsemblGenomes-Gn; EBG00001442040.
DR   EnsemblGenomes-Gn; EBG00001442041.
DR   EnsemblGenomes-Gn; EBG00001442042.
DR   EnsemblGenomes-Gn; EBG00001442043.
DR   EnsemblGenomes-Gn; EBG00001442044.
DR   EnsemblGenomes-Gn; EBG00001442045.
DR   EnsemblGenomes-Gn; EBG00001442046.
DR   EnsemblGenomes-Gn; EBG00001442047.
DR   EnsemblGenomes-Gn; EBG00001442048.
DR   EnsemblGenomes-Gn; EBG00001442049.
DR   EnsemblGenomes-Gn; EBG00001442050.
DR   EnsemblGenomes-Gn; EBG00001442051.
DR   EnsemblGenomes-Gn; EBG00001442052.
DR   EnsemblGenomes-Gn; EBG00001442053.
DR   EnsemblGenomes-Gn; EBG00001442054.
DR   EnsemblGenomes-Gn; EBG00001442055.
DR   EnsemblGenomes-Gn; EBG00001442056.
DR   EnsemblGenomes-Gn; EBG00001442057.
DR   EnsemblGenomes-Gn; EBG00001442058.
DR   EnsemblGenomes-Gn; EBG00001442059.
DR   EnsemblGenomes-Gn; EBG00001442060.
DR   EnsemblGenomes-Gn; EBG00001442061.
DR   EnsemblGenomes-Gn; EBG00001442062.
DR   EnsemblGenomes-Gn; EBG00001442063.
DR   EnsemblGenomes-Gn; EBG00001442064.
DR   EnsemblGenomes-Gn; EBG00001442065.
DR   EnsemblGenomes-Gn; EBG00001442066.
DR   EnsemblGenomes-Gn; EBG00001442067.
DR   EnsemblGenomes-Gn; EBG00001442068.
DR   EnsemblGenomes-Gn; EBG00001442069.
DR   EnsemblGenomes-Gn; EBG00001442070.
DR   EnsemblGenomes-Gn; EBG00001442071.
DR   EnsemblGenomes-Gn; EBG00001442072.
DR   EnsemblGenomes-Gn; EBG00001442073.
DR   EnsemblGenomes-Gn; EBG00001442074.
DR   EnsemblGenomes-Gn; EBG00001442075.
DR   EnsemblGenomes-Gn; EBG00001442076.
DR   EnsemblGenomes-Gn; EBG00001442077.
DR   EnsemblGenomes-Gn; EBG00001442078.
DR   EnsemblGenomes-Gn; EBG00001442079.
DR   EnsemblGenomes-Gn; EBG00001442080.
DR   EnsemblGenomes-Gn; EBG00001442081.
DR   EnsemblGenomes-Gn; EBG00001442082.
DR   EnsemblGenomes-Gn; EBG00001442083.
DR   EnsemblGenomes-Gn; EBG00001442084.
DR   EnsemblGenomes-Gn; EBG00001442085.
DR   EnsemblGenomes-Gn; EBG00001442086.
DR   EnsemblGenomes-Gn; EBG00001442087.
DR   EnsemblGenomes-Gn; EBG00001442088.
DR   EnsemblGenomes-Gn; EBG00001442089.
DR   EnsemblGenomes-Gn; EBG00001442090.
DR   EnsemblGenomes-Gn; EBG00001442091.
DR   EnsemblGenomes-Gn; EBG00001442092.
DR   EnsemblGenomes-Gn; EBG00001442093.
DR   EnsemblGenomes-Gn; EBG00001442094.
DR   EnsemblGenomes-Gn; EBG00001442095.
DR   EnsemblGenomes-Gn; EBG00001442096.
DR   EnsemblGenomes-Gn; EBG00001442097.
DR   EnsemblGenomes-Gn; EBG00001442098.
DR   EnsemblGenomes-Gn; EBG00001442099.
DR   EnsemblGenomes-Gn; EBG00001442100.
DR   EnsemblGenomes-Gn; EBG00001442101.
DR   EnsemblGenomes-Gn; EBG00001442102.
DR   EnsemblGenomes-Gn; EBG00001442103.
DR   EnsemblGenomes-Gn; EBG00001442104.
DR   EnsemblGenomes-Gn; EBG00001442105.
DR   EnsemblGenomes-Gn; EBG00001442106.
DR   EnsemblGenomes-Gn; EBG00001442107.
DR   EnsemblGenomes-Gn; EBG00001442108.
DR   EnsemblGenomes-Gn; EBG00001442109.
DR   EnsemblGenomes-Gn; EBG00001442110.
DR   EnsemblGenomes-Gn; EBG00001442111.
DR   EnsemblGenomes-Gn; EBG00001442112.
DR   EnsemblGenomes-Gn; EBG00001442113.
DR   EnsemblGenomes-Gn; EBG00001442114.
DR   EnsemblGenomes-Gn; EBG00001442115.
DR   EnsemblGenomes-Gn; EBG00001442116.
DR   EnsemblGenomes-Gn; EBG00001442117.
DR   EnsemblGenomes-Gn; EBG00001442118.
DR   EnsemblGenomes-Gn; EBG00001442119.
DR   EnsemblGenomes-Gn; EBG00001442120.
DR   EnsemblGenomes-Gn; EBG00001442121.
DR   EnsemblGenomes-Gn; EBG00001442122.
DR   EnsemblGenomes-Gn; EBG00001442123.
DR   EnsemblGenomes-Gn; EBG00001442124.
DR   EnsemblGenomes-Gn; EBG00001442125.
DR   EnsemblGenomes-Gn; EBG00001442126.
DR   EnsemblGenomes-Gn; EBG00001442127.
DR   EnsemblGenomes-Gn; EBG00001442128.
DR   EnsemblGenomes-Gn; EBG00001442129.
DR   EnsemblGenomes-Gn; EBG00001442130.
DR   EnsemblGenomes-Gn; EBG00001442131.
DR   EnsemblGenomes-Gn; EBG00001442132.
DR   EnsemblGenomes-Gn; EBG00001442133.
DR   EnsemblGenomes-Gn; EBG00001442134.
DR   EnsemblGenomes-Gn; EBG00001442135.
DR   EnsemblGenomes-Gn; EBG00001442136.
DR   EnsemblGenomes-Gn; EBG00001442137.
DR   EnsemblGenomes-Gn; EBG00001442138.
DR   EnsemblGenomes-Gn; EBG00001442139.
DR   EnsemblGenomes-Gn; EBG00001442140.
DR   EnsemblGenomes-Gn; EBG00001442141.
DR   EnsemblGenomes-Gn; EBG00001442142.
DR   EnsemblGenomes-Gn; EBG00001442143.
DR   EnsemblGenomes-Gn; EBG00001442144.
DR   EnsemblGenomes-Gn; EBG00001442145.
DR   EnsemblGenomes-Gn; EBG00001442146.
DR   EnsemblGenomes-Gn; EBG00001442147.
DR   EnsemblGenomes-Gn; EBG00001442148.
DR   EnsemblGenomes-Gn; EBG00001442149.
DR   EnsemblGenomes-Gn; EBG00001442150.
DR   EnsemblGenomes-Gn; EBG00001442151.
DR   EnsemblGenomes-Gn; EBG00001442152.
DR   EnsemblGenomes-Gn; EBG00001442153.
DR   EnsemblGenomes-Gn; SBI_r1.
DR   EnsemblGenomes-Gn; SBI_r10.
DR   EnsemblGenomes-Gn; SBI_r11.
DR   EnsemblGenomes-Gn; SBI_r12.
DR   EnsemblGenomes-Gn; SBI_r13.
DR   EnsemblGenomes-Gn; SBI_r14.
DR   EnsemblGenomes-Gn; SBI_r15.
DR   EnsemblGenomes-Gn; SBI_r16.
DR   EnsemblGenomes-Gn; SBI_r17.
DR   EnsemblGenomes-Gn; SBI_r18.
DR   EnsemblGenomes-Gn; SBI_r2.
DR   EnsemblGenomes-Gn; SBI_r3.
DR   EnsemblGenomes-Gn; SBI_r4.
DR   EnsemblGenomes-Gn; SBI_r5.
DR   EnsemblGenomes-Gn; SBI_r6.
DR   EnsemblGenomes-Gn; SBI_r7.
DR   EnsemblGenomes-Gn; SBI_r8.
DR   EnsemblGenomes-Gn; SBI_r9.
DR   EnsemblGenomes-Gn; SBI_t1.
DR   EnsemblGenomes-Gn; SBI_t10.
DR   EnsemblGenomes-Gn; SBI_t11.
DR   EnsemblGenomes-Gn; SBI_t12.
DR   EnsemblGenomes-Gn; SBI_t13.
DR   EnsemblGenomes-Gn; SBI_t14.
DR   EnsemblGenomes-Gn; SBI_t15.
DR   EnsemblGenomes-Gn; SBI_t16.
DR   EnsemblGenomes-Gn; SBI_t17.
DR   EnsemblGenomes-Gn; SBI_t18.
DR   EnsemblGenomes-Gn; SBI_t19.
DR   EnsemblGenomes-Gn; SBI_t2.
DR   EnsemblGenomes-Gn; SBI_t20.
DR   EnsemblGenomes-Gn; SBI_t21.
DR   EnsemblGenomes-Gn; SBI_t22.
DR   EnsemblGenomes-Gn; SBI_t23.
DR   EnsemblGenomes-Gn; SBI_t24.
DR   EnsemblGenomes-Gn; SBI_t25.
DR   EnsemblGenomes-Gn; SBI_t26.
DR   EnsemblGenomes-Gn; SBI_t27.
DR   EnsemblGenomes-Gn; SBI_t28.
DR   EnsemblGenomes-Gn; SBI_t29.
DR   EnsemblGenomes-Gn; SBI_t3.
DR   EnsemblGenomes-Gn; SBI_t30.
DR   EnsemblGenomes-Gn; SBI_t31.
DR   EnsemblGenomes-Gn; SBI_t32.
DR   EnsemblGenomes-Gn; SBI_t33.
DR   EnsemblGenomes-Gn; SBI_t34.
DR   EnsemblGenomes-Gn; SBI_t35.
DR   EnsemblGenomes-Gn; SBI_t36.
DR   EnsemblGenomes-Gn; SBI_t37.
DR   EnsemblGenomes-Gn; SBI_t38.
DR   EnsemblGenomes-Gn; SBI_t39.
DR   EnsemblGenomes-Gn; SBI_t4.
DR   EnsemblGenomes-Gn; SBI_t40.
DR   EnsemblGenomes-Gn; SBI_t41.
DR   EnsemblGenomes-Gn; SBI_t42.
DR   EnsemblGenomes-Gn; SBI_t43.
DR   EnsemblGenomes-Gn; SBI_t44.
DR   EnsemblGenomes-Gn; SBI_t45.
DR   EnsemblGenomes-Gn; SBI_t46.
DR   EnsemblGenomes-Gn; SBI_t47.
DR   EnsemblGenomes-Gn; SBI_t48.
DR   EnsemblGenomes-Gn; SBI_t49.
DR   EnsemblGenomes-Gn; SBI_t5.
DR   EnsemblGenomes-Gn; SBI_t50.
DR   EnsemblGenomes-Gn; SBI_t51.
DR   EnsemblGenomes-Gn; SBI_t52.
DR   EnsemblGenomes-Gn; SBI_t53.
DR   EnsemblGenomes-Gn; SBI_t54.
DR   EnsemblGenomes-Gn; SBI_t55.
DR   EnsemblGenomes-Gn; SBI_t56.
DR   EnsemblGenomes-Gn; SBI_t57.
DR   EnsemblGenomes-Gn; SBI_t58.
DR   EnsemblGenomes-Gn; SBI_t59.
DR   EnsemblGenomes-Gn; SBI_t6.
DR   EnsemblGenomes-Gn; SBI_t60.
DR   EnsemblGenomes-Gn; SBI_t61.
DR   EnsemblGenomes-Gn; SBI_t62.
DR   EnsemblGenomes-Gn; SBI_t63.
DR   EnsemblGenomes-Gn; SBI_t64.
DR   EnsemblGenomes-Gn; SBI_t65.
DR   EnsemblGenomes-Gn; SBI_t66.
DR   EnsemblGenomes-Gn; SBI_t7.
DR   EnsemblGenomes-Gn; SBI_t8.
DR   EnsemblGenomes-Gn; SBI_t9.
DR   EnsemblGenomes-Tr; EBT00001819781.
DR   EnsemblGenomes-Tr; EBT00001819782.
DR   EnsemblGenomes-Tr; EBT00001819783.
DR   EnsemblGenomes-Tr; EBT00001819784.
DR   EnsemblGenomes-Tr; EBT00001819785.
DR   EnsemblGenomes-Tr; EBT00001819786.
DR   EnsemblGenomes-Tr; EBT00001819787.
DR   EnsemblGenomes-Tr; EBT00001819788.
DR   EnsemblGenomes-Tr; EBT00001819789.
DR   EnsemblGenomes-Tr; EBT00001819790.
DR   EnsemblGenomes-Tr; EBT00001819791.
DR   EnsemblGenomes-Tr; EBT00001819792.
DR   EnsemblGenomes-Tr; EBT00001819793.
DR   EnsemblGenomes-Tr; EBT00001819794.
DR   EnsemblGenomes-Tr; EBT00001819795.
DR   EnsemblGenomes-Tr; EBT00001819796.
DR   EnsemblGenomes-Tr; EBT00001819797.
DR   EnsemblGenomes-Tr; EBT00001819798.
DR   EnsemblGenomes-Tr; EBT00001819799.
DR   EnsemblGenomes-Tr; EBT00001819800.
DR   EnsemblGenomes-Tr; EBT00001819801.
DR   EnsemblGenomes-Tr; EBT00001819802.
DR   EnsemblGenomes-Tr; EBT00001819803.
DR   EnsemblGenomes-Tr; EBT00001819804.
DR   EnsemblGenomes-Tr; EBT00001819805.
DR   EnsemblGenomes-Tr; EBT00001819806.
DR   EnsemblGenomes-Tr; EBT00001819807.
DR   EnsemblGenomes-Tr; EBT00001819808.
DR   EnsemblGenomes-Tr; EBT00001819809.
DR   EnsemblGenomes-Tr; EBT00001819810.
DR   EnsemblGenomes-Tr; EBT00001819811.
DR   EnsemblGenomes-Tr; EBT00001819812.
DR   EnsemblGenomes-Tr; EBT00001819813.
DR   EnsemblGenomes-Tr; EBT00001819814.
DR   EnsemblGenomes-Tr; EBT00001819815.
DR   EnsemblGenomes-Tr; EBT00001819816.
DR   EnsemblGenomes-Tr; EBT00001819817.
DR   EnsemblGenomes-Tr; EBT00001819818.
DR   EnsemblGenomes-Tr; EBT00001819819.
DR   EnsemblGenomes-Tr; EBT00001819820.
DR   EnsemblGenomes-Tr; EBT00001819821.
DR   EnsemblGenomes-Tr; EBT00001819822.
DR   EnsemblGenomes-Tr; EBT00001819823.
DR   EnsemblGenomes-Tr; EBT00001819824.
DR   EnsemblGenomes-Tr; EBT00001819825.
DR   EnsemblGenomes-Tr; EBT00001819826.
DR   EnsemblGenomes-Tr; EBT00001819827.
DR   EnsemblGenomes-Tr; EBT00001819828.
DR   EnsemblGenomes-Tr; EBT00001819829.
DR   EnsemblGenomes-Tr; EBT00001819830.
DR   EnsemblGenomes-Tr; EBT00001819831.
DR   EnsemblGenomes-Tr; EBT00001819832.
DR   EnsemblGenomes-Tr; EBT00001819833.
DR   EnsemblGenomes-Tr; EBT00001819834.
DR   EnsemblGenomes-Tr; EBT00001819835.
DR   EnsemblGenomes-Tr; EBT00001819836.
DR   EnsemblGenomes-Tr; EBT00001819837.
DR   EnsemblGenomes-Tr; EBT00001819838.
DR   EnsemblGenomes-Tr; EBT00001819839.
DR   EnsemblGenomes-Tr; EBT00001819840.
DR   EnsemblGenomes-Tr; EBT00001819841.
DR   EnsemblGenomes-Tr; EBT00001819842.
DR   EnsemblGenomes-Tr; EBT00001819843.
DR   EnsemblGenomes-Tr; EBT00001819844.
DR   EnsemblGenomes-Tr; EBT00001819845.
DR   EnsemblGenomes-Tr; EBT00001819846.
DR   EnsemblGenomes-Tr; EBT00001819847.
DR   EnsemblGenomes-Tr; EBT00001819848.
DR   EnsemblGenomes-Tr; EBT00001819849.
DR   EnsemblGenomes-Tr; EBT00001819850.
DR   EnsemblGenomes-Tr; EBT00001819851.
DR   EnsemblGenomes-Tr; EBT00001819852.
DR   EnsemblGenomes-Tr; EBT00001819853.
DR   EnsemblGenomes-Tr; EBT00001819854.
DR   EnsemblGenomes-Tr; EBT00001819855.
DR   EnsemblGenomes-Tr; EBT00001819856.
DR   EnsemblGenomes-Tr; EBT00001819857.
DR   EnsemblGenomes-Tr; EBT00001819858.
DR   EnsemblGenomes-Tr; EBT00001819859.
DR   EnsemblGenomes-Tr; EBT00001819860.
DR   EnsemblGenomes-Tr; EBT00001819861.
DR   EnsemblGenomes-Tr; EBT00001819862.
DR   EnsemblGenomes-Tr; EBT00001819863.
DR   EnsemblGenomes-Tr; EBT00001819864.
DR   EnsemblGenomes-Tr; EBT00001819865.
DR   EnsemblGenomes-Tr; EBT00001819866.
DR   EnsemblGenomes-Tr; EBT00001819867.
DR   EnsemblGenomes-Tr; EBT00001819868.
DR   EnsemblGenomes-Tr; EBT00001819869.
DR   EnsemblGenomes-Tr; EBT00001819870.
DR   EnsemblGenomes-Tr; EBT00001819871.
DR   EnsemblGenomes-Tr; EBT00001819872.
DR   EnsemblGenomes-Tr; EBT00001819873.
DR   EnsemblGenomes-Tr; EBT00001819874.
DR   EnsemblGenomes-Tr; EBT00001819875.
DR   EnsemblGenomes-Tr; EBT00001819876.
DR   EnsemblGenomes-Tr; EBT00001819877.
DR   EnsemblGenomes-Tr; EBT00001819878.
DR   EnsemblGenomes-Tr; EBT00001819879.
DR   EnsemblGenomes-Tr; EBT00001819880.
DR   EnsemblGenomes-Tr; EBT00001819881.
DR   EnsemblGenomes-Tr; EBT00001819882.
DR   EnsemblGenomes-Tr; EBT00001819883.
DR   EnsemblGenomes-Tr; EBT00001819884.
DR   EnsemblGenomes-Tr; EBT00001819885.
DR   EnsemblGenomes-Tr; EBT00001819886.
DR   EnsemblGenomes-Tr; EBT00001819887.
DR   EnsemblGenomes-Tr; EBT00001819888.
DR   EnsemblGenomes-Tr; EBT00001819889.
DR   EnsemblGenomes-Tr; EBT00001819890.
DR   EnsemblGenomes-Tr; EBT00001819891.
DR   EnsemblGenomes-Tr; EBT00001819892.
DR   EnsemblGenomes-Tr; EBT00001819893.
DR   EnsemblGenomes-Tr; EBT00001819894.
DR   EnsemblGenomes-Tr; EBT00001819895.
DR   EnsemblGenomes-Tr; EBT00001819896.
DR   EnsemblGenomes-Tr; EBT00001819897.
DR   EnsemblGenomes-Tr; EBT00001819898.
DR   EnsemblGenomes-Tr; EBT00001819899.
DR   EnsemblGenomes-Tr; EBT00001819900.
DR   EnsemblGenomes-Tr; EBT00001819901.
DR   EnsemblGenomes-Tr; EBT00001819902.
DR   EnsemblGenomes-Tr; EBT00001819903.
DR   EnsemblGenomes-Tr; EBT00001819904.
DR   EnsemblGenomes-Tr; EBT00001819905.
DR   EnsemblGenomes-Tr; EBT00001819906.
DR   EnsemblGenomes-Tr; EBT00001819907.
DR   EnsemblGenomes-Tr; EBT00001819908.
DR   EnsemblGenomes-Tr; EBT00001819909.
DR   EnsemblGenomes-Tr; EBT00001819910.
DR   EnsemblGenomes-Tr; EBT00001819911.
DR   EnsemblGenomes-Tr; EBT00001819912.
DR   EnsemblGenomes-Tr; EBT00001819913.
DR   EnsemblGenomes-Tr; EBT00001819914.
DR   EnsemblGenomes-Tr; EBT00001819915.
DR   EnsemblGenomes-Tr; EBT00001819916.
DR   EnsemblGenomes-Tr; EBT00001819917.
DR   EnsemblGenomes-Tr; EBT00001819918.
DR   EnsemblGenomes-Tr; EBT00001819919.
DR   EnsemblGenomes-Tr; EBT00001819920.
DR   EnsemblGenomes-Tr; EBT00001819921.
DR   EnsemblGenomes-Tr; EBT00001819922.
DR   EnsemblGenomes-Tr; EBT00001819923.
DR   EnsemblGenomes-Tr; EBT00001819924.
DR   EnsemblGenomes-Tr; EBT00001819925.
DR   EnsemblGenomes-Tr; EBT00001819926.
DR   EnsemblGenomes-Tr; EBT00001819927.
DR   EnsemblGenomes-Tr; EBT00001819928.
DR   EnsemblGenomes-Tr; EBT00001819929.
DR   EnsemblGenomes-Tr; EBT00001819930.
DR   EnsemblGenomes-Tr; EBT00001819931.
DR   EnsemblGenomes-Tr; EBT00001819932.
DR   EnsemblGenomes-Tr; EBT00001819933.
DR   EnsemblGenomes-Tr; EBT00001819934.
DR   EnsemblGenomes-Tr; EBT00001819935.
DR   EnsemblGenomes-Tr; EBT00001819936.
DR   EnsemblGenomes-Tr; EBT00001819937.
DR   EnsemblGenomes-Tr; EBT00001819938.
DR   EnsemblGenomes-Tr; EBT00001819939.
DR   EnsemblGenomes-Tr; EBT00001819940.
DR   EnsemblGenomes-Tr; EBT00001819941.
DR   EnsemblGenomes-Tr; EBT00001819942.
DR   EnsemblGenomes-Tr; SBI_r1-1.
DR   EnsemblGenomes-Tr; SBI_r10-1.
DR   EnsemblGenomes-Tr; SBI_r11-1.
DR   EnsemblGenomes-Tr; SBI_r12-1.
DR   EnsemblGenomes-Tr; SBI_r13-1.
DR   EnsemblGenomes-Tr; SBI_r14-1.
DR   EnsemblGenomes-Tr; SBI_r15-1.
DR   EnsemblGenomes-Tr; SBI_r16-1.
DR   EnsemblGenomes-Tr; SBI_r17-1.
DR   EnsemblGenomes-Tr; SBI_r18-1.
DR   EnsemblGenomes-Tr; SBI_r2-1.
DR   EnsemblGenomes-Tr; SBI_r3-1.
DR   EnsemblGenomes-Tr; SBI_r4-1.
DR   EnsemblGenomes-Tr; SBI_r5-1.
DR   EnsemblGenomes-Tr; SBI_r6-1.
DR   EnsemblGenomes-Tr; SBI_r7-1.
DR   EnsemblGenomes-Tr; SBI_r8-1.
DR   EnsemblGenomes-Tr; SBI_r9-1.
DR   EnsemblGenomes-Tr; SBI_t1-1.
DR   EnsemblGenomes-Tr; SBI_t10-1.
DR   EnsemblGenomes-Tr; SBI_t11-1.
DR   EnsemblGenomes-Tr; SBI_t12-1.
DR   EnsemblGenomes-Tr; SBI_t13-1.
DR   EnsemblGenomes-Tr; SBI_t14-1.
DR   EnsemblGenomes-Tr; SBI_t15-1.
DR   EnsemblGenomes-Tr; SBI_t16-1.
DR   EnsemblGenomes-Tr; SBI_t17-1.
DR   EnsemblGenomes-Tr; SBI_t18-1.
DR   EnsemblGenomes-Tr; SBI_t19-1.
DR   EnsemblGenomes-Tr; SBI_t2-1.
DR   EnsemblGenomes-Tr; SBI_t20-1.
DR   EnsemblGenomes-Tr; SBI_t21-1.
DR   EnsemblGenomes-Tr; SBI_t22-1.
DR   EnsemblGenomes-Tr; SBI_t23-1.
DR   EnsemblGenomes-Tr; SBI_t24-1.
DR   EnsemblGenomes-Tr; SBI_t25-1.
DR   EnsemblGenomes-Tr; SBI_t26-1.
DR   EnsemblGenomes-Tr; SBI_t27-1.
DR   EnsemblGenomes-Tr; SBI_t28-1.
DR   EnsemblGenomes-Tr; SBI_t29-1.
DR   EnsemblGenomes-Tr; SBI_t3-1.
DR   EnsemblGenomes-Tr; SBI_t30-1.
DR   EnsemblGenomes-Tr; SBI_t31-1.
DR   EnsemblGenomes-Tr; SBI_t32-1.
DR   EnsemblGenomes-Tr; SBI_t33-1.
DR   EnsemblGenomes-Tr; SBI_t34-1.
DR   EnsemblGenomes-Tr; SBI_t35-1.
DR   EnsemblGenomes-Tr; SBI_t36-1.
DR   EnsemblGenomes-Tr; SBI_t37-1.
DR   EnsemblGenomes-Tr; SBI_t38-1.
DR   EnsemblGenomes-Tr; SBI_t39-1.
DR   EnsemblGenomes-Tr; SBI_t4-1.
DR   EnsemblGenomes-Tr; SBI_t40-1.
DR   EnsemblGenomes-Tr; SBI_t41-1.
DR   EnsemblGenomes-Tr; SBI_t42-1.
DR   EnsemblGenomes-Tr; SBI_t43-1.
DR   EnsemblGenomes-Tr; SBI_t44-1.
DR   EnsemblGenomes-Tr; SBI_t45-1.
DR   EnsemblGenomes-Tr; SBI_t46-1.
DR   EnsemblGenomes-Tr; SBI_t47-1.
DR   EnsemblGenomes-Tr; SBI_t48-1.
DR   EnsemblGenomes-Tr; SBI_t49-1.
DR   EnsemblGenomes-Tr; SBI_t5-1.
DR   EnsemblGenomes-Tr; SBI_t50-1.
DR   EnsemblGenomes-Tr; SBI_t51-1.
DR   EnsemblGenomes-Tr; SBI_t52-1.
DR   EnsemblGenomes-Tr; SBI_t53-1.
DR   EnsemblGenomes-Tr; SBI_t54-1.
DR   EnsemblGenomes-Tr; SBI_t55-1.
DR   EnsemblGenomes-Tr; SBI_t56-1.
DR   EnsemblGenomes-Tr; SBI_t57-1.
DR   EnsemblGenomes-Tr; SBI_t58-1.
DR   EnsemblGenomes-Tr; SBI_t59-1.
DR   EnsemblGenomes-Tr; SBI_t6-1.
DR   EnsemblGenomes-Tr; SBI_t60-1.
DR   EnsemblGenomes-Tr; SBI_t61-1.
DR   EnsemblGenomes-Tr; SBI_t62-1.
DR   EnsemblGenomes-Tr; SBI_t63-1.
DR   EnsemblGenomes-Tr; SBI_t64-1.
DR   EnsemblGenomes-Tr; SBI_t65-1.
DR   EnsemblGenomes-Tr; SBI_t66-1.
DR   EnsemblGenomes-Tr; SBI_t7-1.
DR   EnsemblGenomes-Tr; SBI_t8-1.
DR   EnsemblGenomes-Tr; SBI_t9-1.
DR   EuropePMC; PMC2937363; 20581206.
DR   EuropePMC; PMC3072421; 21490938.
DR   EuropePMC; PMC3388780; 22759432.
DR   EuropePMC; PMC3424136; 22827618.
DR   EuropePMC; PMC4102860; 25035323.
DR   EuropePMC; PMC4807529; 26826232.
DR   EuropePMC; PMC5015266; 27604457.
DR   EuropePMC; PMC5240415; 28095865.
DR   EuropePMC; PMC6430987; 30799497.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01782; ASpks.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002047.
DR   SILVA-SSU; CP002047.
CC   Source DNA is available from Yijun Yan, quasar110@126.com.
CC   Bacteria available from China General Microbiology Culture
CC   Collection Center (Accession No:CGMCC1734), Institute of
CC   Microbiology, Chinese Academy of Sciences.
CC   Genome was manually curated based on annotation generated by the
CC   NCBI Prokaryotic Genomes Automatic Annotation Pipeline Group.
CC   Information about the Pipeline can be found here:
CC   http://www.ncbi.nlm.nih.gov/genomes/static/Pipeline.html.
FH   Key             Location/Qualifiers
FT   source          1..11936683
FT                   /organism="Streptomyces bingchenggensis BCW-1"
FT                   /strain="BCW-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:749414"
FT                   /culture_collection="CGMCC:1734"
FT   gene            691..801
FT                   /locus_tag="SBI_00001"
FT   CDS_pept        691..801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00001"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03122"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSU5"
FT                   /protein_id="ADI03122.1"
FT   gene            1302..1655
FT                   /locus_tag="SBI_00002"
FT   CDS_pept        1302..1655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00002"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03123"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSU6"
FT                   /protein_id="ADI03123.1"
FT                   GDLFGRPGPQGRP"
FT   gene            complement(1672..2526)
FT                   /locus_tag="SBI_00003"
FT   CDS_pept        complement(1672..2526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00003"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03124"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSU7"
FT                   /protein_id="ADI03124.1"
FT                   SRA"
FT   gene            2812..2964
FT                   /locus_tag="SBI_00004"
FT   CDS_pept        2812..2964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00004"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03125"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSU8"
FT                   /protein_id="ADI03125.1"
FT                   DVQSI"
FT   gene            complement(3050..4615)
FT                   /locus_tag="SBI_00005"
FT   CDS_pept        complement(3050..4615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03126"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSU9"
FT                   /protein_id="ADI03126.1"
FT                   ADTP"
FT   gene            complement(7227..7409)
FT                   /locus_tag="SBI_00006"
FT   CDS_pept        complement(7227..7409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00006"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03127"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSV0"
FT                   /protein_id="ADI03127.1"
FT                   AAGDRSAVELQRIDE"
FT   gene            complement(7419..8045)
FT                   /locus_tag="SBI_00007"
FT   CDS_pept        complement(7419..8045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00007"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03128"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSV1"
FT                   /protein_id="ADI03128.1"
FT   gene            complement(8057..8422)
FT                   /locus_tag="SBI_00008"
FT   CDS_pept        complement(8057..8422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00008"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03129"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSV2"
FT                   /protein_id="ADI03129.1"
FT                   PPPTPTPCPSYPPPTCS"
FT   gene            8527..8673
FT                   /locus_tag="SBI_00009"
FT   CDS_pept        8527..8673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00009"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03130"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSV3"
FT                   /protein_id="ADI03130.1"
FT                   SQQ"
FT   gene            complement(8657..8944)
FT                   /locus_tag="SBI_00010"
FT   CDS_pept        complement(8657..8944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00010"
FT                   /product="hypothetical protein"
FT                   /note="COG0804 Urea amidohydrolase (urease) alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03131"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSV4"
FT                   /protein_id="ADI03131.1"
FT   gene            9020..9520
FT                   /locus_tag="SBI_00011"
FT   CDS_pept        9020..9520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00011"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03132"
FT                   /db_xref="GOA:D7BSV5"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSV5"
FT                   /protein_id="ADI03132.1"
FT                   HSS"
FT   gene            9784..9888
FT                   /locus_tag="SBI_00012"
FT   CDS_pept        9784..9888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00012"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03133"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSV6"
FT                   /protein_id="ADI03133.1"
FT   gene            12126..12479
FT                   /locus_tag="SBI_00013"
FT   CDS_pept        12126..12479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00013"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03134"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSV7"
FT                   /protein_id="ADI03134.1"
FT                   LLPVPGRVLLGAG"
FT   gene            12665..13492
FT                   /locus_tag="SBI_00014"
FT   CDS_pept        12665..13492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00014"
FT                   /product="D-aminopeptidase"
FT                   /note="COG2362 D-aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00014"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03135"
FT                   /db_xref="GOA:D7BSV8"
FT                   /db_xref="InterPro:IPR007035"
FT                   /db_xref="InterPro:IPR027476"
FT                   /db_xref="InterPro:IPR036177"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSV8"
FT                   /protein_id="ADI03135.1"
FT   gene            14035..14238
FT                   /locus_tag="SBI_00015"
FT   CDS_pept        14035..14238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03136"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSV9"
FT                   /protein_id="ADI03136.1"
FT   gene            complement(14332..14853)
FT                   /locus_tag="SBI_00016"
FT   CDS_pept        complement(14332..14853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00016"
FT                   /product="transposase"
FT                   /note="COG5659 FOG: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00016"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03137"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSW0"
FT                   /protein_id="ADI03137.1"
FT                   PSPGRPATAT"
FT   gene            complement(14850..15002)
FT                   /locus_tag="SBI_00017"
FT   CDS_pept        complement(14850..15002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00017"
FT                   /product="hypothetical protein"
FT                   /note="COG5659 FOG: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00017"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03138"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSW1"
FT                   /protein_id="ADI03138.1"
FT                   PAGSW"
FT   gene            complement(14972..15466)
FT                   /locus_tag="SBI_00018"
FT   CDS_pept        complement(14972..15466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00018"
FT                   /product="hypothetical protein"
FT                   /note="COG5659 FOG: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00018"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03139"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSW2"
FT                   /protein_id="ADI03139.1"
FT                   G"
FT   gene            complement(15555..18362)
FT                   /locus_tag="SBI_00019"
FT   CDS_pept        complement(15555..18362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00019"
FT                   /product="DEAD/DEAH box helicase domain-containing protein"
FT                   /note="COG1204 Superfamily II helicase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00019"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03140"
FT                   /db_xref="GOA:D7BSW3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSW3"
FT                   /protein_id="ADI03140.1"
FT                   IAPRA"
FT   gene            18660..18824
FT                   /locus_tag="SBI_00020"
FT   CDS_pept        18660..18824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03141"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSW4"
FT                   /protein_id="ADI03141.1"
FT                   TNFASNCHG"
FT   gene            complement(18929..19402)
FT                   /locus_tag="SBI_00021"
FT   CDS_pept        complement(18929..19402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00021"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03142"
FT                   /db_xref="InterPro:IPR025459"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSW5"
FT                   /protein_id="ADI03142.1"
FT   gene            20147..20485
FT                   /locus_tag="SBI_00022"
FT   CDS_pept        20147..20485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00022"
FT                   /product="hypothetical protein"
FT                   /note="COG3795 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00022"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03143"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSW6"
FT                   /protein_id="ADI03143.1"
FT                   EIMADPTV"
FT   gene            20561..20842
FT                   /locus_tag="SBI_00023"
FT   CDS_pept        20561..20842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00023"
FT                   /product="putative transposase"
FT                   /note="COG3293 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00023"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03144"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSW7"
FT                   /protein_id="ADI03144.1"
FT   gene            complement(21098..21397)
FT                   /locus_tag="SBI_00024"
FT   CDS_pept        complement(21098..21397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00024"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03145"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSW8"
FT                   /protein_id="ADI03145.1"
FT   gene            complement(21535..22590)
FT                   /locus_tag="SBI_00025"
FT   CDS_pept        complement(21535..22590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00025"
FT                   /product="putative transposase"
FT                   /note="COG3335 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03146"
FT                   /db_xref="GOA:D7BSW9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSW9"
FT                   /protein_id="ADI03146.1"
FT                   HHEESSAEPAT"
FT   gene            22707..22832
FT                   /locus_tag="SBI_00026"
FT   CDS_pept        22707..22832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00026"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03147"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSX0"
FT                   /protein_id="ADI03147.1"
FT   gene            23042..23524
FT                   /locus_tag="SBI_00027"
FT   CDS_pept        23042..23524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00027"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03148"
FT                   /db_xref="GOA:D7BSX1"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSX1"
FT                   /protein_id="ADI03148.1"
FT   gene            complement(24142..24480)
FT                   /locus_tag="SBI_00028"
FT   CDS_pept        complement(24142..24480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00028"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03149"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSX2"
FT                   /protein_id="ADI03149.1"
FT                   VHLAYVAW"
FT   gene            complement(24979..27909)
FT                   /locus_tag="SBI_00029"
FT   CDS_pept        complement(24979..27909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00029"
FT                   /product="TPR repeat-containing protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00029"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03150"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSX3"
FT                   /protein_id="ADI03150.1"
FT   gene            complement(28199..29119)
FT                   /locus_tag="SBI_00030"
FT   CDS_pept        complement(28199..29119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00030"
FT                   /product="monooxygenase"
FT                   /note="COG0654 2-polyprenyl-6-methoxyphenol hydroxylase and
FT                   related FAD-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03151"
FT                   /db_xref="GOA:D7BSX4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSX4"
FT                   /protein_id="ADI03151.1"
FT   gene            29668..30321
FT                   /locus_tag="SBI_00031"
FT   CDS_pept        29668..30321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00031"
FT                   /product="putative transposase"
FT                   /note="COG3293 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00031"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03152"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSX5"
FT                   /protein_id="ADI03152.1"
FT   gene            30668..31636
FT                   /locus_tag="SBI_00032"
FT   CDS_pept        30668..31636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00032"
FT                   /product="IS110 family transposase"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00032"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03153"
FT                   /db_xref="GOA:D7BSX6"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSX6"
FT                   /protein_id="ADI03153.1"
FT   gene            complement(31591..32175)
FT                   /locus_tag="SBI_00033"
FT   CDS_pept        complement(31591..32175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00033"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COG3981 Predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00033"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03154"
FT                   /db_xref="GOA:D7BSX7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSX7"
FT                   /protein_id="ADI03154.1"
FT   gene            complement(32875..33417)
FT                   /locus_tag="SBI_00034"
FT   CDS_pept        complement(32875..33417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00034"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03155"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSX8"
FT                   /protein_id="ADI03155.1"
FT                   TGVLLVPASSPLEITRA"
FT   gene            complement(34040..34285)
FT                   /locus_tag="SBI_00035"
FT   CDS_pept        complement(34040..34285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03156"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSX9"
FT                   /protein_id="ADI03156.1"
FT   gene            complement(34488..35120)
FT                   /locus_tag="SBI_00036"
FT   CDS_pept        complement(34488..35120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00036"
FT                   /product="isochorismatase hydrolase"
FT                   /note="COG1335 Amidases related to nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00036"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03157"
FT                   /db_xref="GOA:D7BSY0"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSY0"
FT                   /protein_id="ADI03157.1"
FT   gene            complement(35444..35611)
FT                   /locus_tag="SBI_00037"
FT   CDS_pept        complement(35444..35611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00037"
FT                   /product="putative IstB-like ATPase"
FT                   /note="COG1484 DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00037"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03158"
FT                   /db_xref="GOA:D7BSY1"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSY1"
FT                   /protein_id="ADI03158.1"
FT                   KSSCVVPPAR"
FT   gene            complement(35836..36033)
FT                   /locus_tag="SBI_00038"
FT   CDS_pept        complement(35836..36033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00038"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03159"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSY2"
FT                   /protein_id="ADI03159.1"
FT   gene            complement(36191..36592)
FT                   /locus_tag="SBI_00039"
FT   CDS_pept        complement(36191..36592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00039"
FT                   /product="hypothetical protein"
FT                   /note="COG0251 Putative translation initiation inhibitor,
FT                   yjgF family"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00039"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03160"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSY3"
FT                   /protein_id="ADI03160.1"
FT   gene            36696..37079
FT                   /locus_tag="SBI_00040"
FT   CDS_pept        36696..37079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00040"
FT                   /product="hypothetical protein"
FT                   /note="COG1733 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03161"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSY4"
FT                   /protein_id="ADI03161.1"
FT   gene            37318..38274
FT                   /locus_tag="SBI_00041"
FT   CDS_pept        37318..38274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00041"
FT                   /product="putative AraC family transcriptional regulator"
FT                   /note="COG4977 Transcriptional regulator containing an
FT                   amidase domain and an AraC-type DNA-binding HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00041"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03162"
FT                   /db_xref="GOA:D7BSY5"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSY5"
FT                   /protein_id="ADI03162.1"
FT   gene            38385..39383
FT                   /gene="gap1"
FT                   /locus_tag="SBI_00042"
FT   CDS_pept        38385..39383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap1"
FT                   /locus_tag="SBI_00042"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /note="COG0057 Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00042"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03163"
FT                   /db_xref="GOA:D7BSY6"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSY6"
FT                   /protein_id="ADI03163.1"
FT   gene            complement(40109..41536)
FT                   /locus_tag="SBI_00043"
FT   CDS_pept        complement(40109..41536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00043"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03164"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSY7"
FT                   /protein_id="ADI03164.1"
FT                   GSTPNNGPLPKPDEPWR"
FT   gene            complement(41586..42080)
FT                   /locus_tag="SBI_00044"
FT   CDS_pept        complement(41586..42080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00044"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03165"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSY8"
FT                   /protein_id="ADI03165.1"
FT                   K"
FT   gene            complement(42319..42618)
FT                   /locus_tag="SBI_00045"
FT   CDS_pept        complement(42319..42618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00045"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase family
FT                   protein"
FT                   /note="COG1062 Zn-dependent alcohol dehydrogenases, class
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03166"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSY9"
FT                   /protein_id="ADI03166.1"
FT   gene            complement(42657..43139)
FT                   /locus_tag="SBI_00046"
FT   CDS_pept        complement(42657..43139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00046"
FT                   /product="alcohol dehydrogenase"
FT                   /note="COG1062 Zn-dependent alcohol dehydrogenases, class
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00046"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03167"
FT                   /db_xref="GOA:D7BUH6"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUH6"
FT                   /protein_id="ADI03167.1"
FT   gene            complement(43263..43355)
FT                   /locus_tag="SBI_00047"
FT   CDS_pept        complement(43263..43355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00047"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03168"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUH7"
FT                   /protein_id="ADI03168.1"
FT                   /translation="MGVVQETGPGVARVRPGDHVALFYVPSSGF"
FT   gene            43413..43763
FT                   /locus_tag="SBI_00048"
FT   CDS_pept        43413..43763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00048"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00048"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03169"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUH8"
FT                   /protein_id="ADI03169.1"
FT                   STSTDMPHYADG"
FT   gene            44207..45625
FT                   /locus_tag="SBI_00049"
FT   CDS_pept        44207..45625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00049"
FT                   /product="putative serine/threonine protein kinase"
FT                   /note="COG0515 Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00049"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03170"
FT                   /db_xref="GOA:D7BUH9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUH9"
FT                   /protein_id="ADI03170.1"
FT                   RWSRRRSPFWMPHR"
FT   gene            45989..47506
FT                   /locus_tag="SBI_00050"
FT   CDS_pept        45989..47506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03171"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUI0"
FT                   /protein_id="ADI03171.1"
FT   gene            48068..49318
FT                   /locus_tag="SBI_00051"
FT   CDS_pept        48068..49318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00051"
FT                   /product="major facilitator superfamily permease"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00051"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03172"
FT                   /db_xref="GOA:D7BUI1"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUI1"
FT                   /protein_id="ADI03172.1"
FT                   RLGRTLPAPPETPVPSA"
FT   gene            complement(49604..49783)
FT                   /locus_tag="SBI_00052"
FT   CDS_pept        complement(49604..49783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00052"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03173"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUI2"
FT                   /protein_id="ADI03173.1"
FT                   ADPEGHEFCLLAPS"
FT   gene            complement(50099..50713)
FT                   /locus_tag="SBI_00053"
FT   CDS_pept        complement(50099..50713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00053"
FT                   /product="putative transcriptional regulator, XRE family
FT                   protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00053"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03174"
FT                   /db_xref="GOA:D7BUI3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUI3"
FT                   /protein_id="ADI03174.1"
FT   gene            50793..51419
FT                   /locus_tag="SBI_00054"
FT   CDS_pept        50793..51419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00054"
FT                   /product="methyltransferase type 12"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00054"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03175"
FT                   /db_xref="GOA:D7BUI4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUI4"
FT                   /protein_id="ADI03175.1"
FT   gene            51462..51962
FT                   /locus_tag="SBI_00055"
FT   CDS_pept        51462..51962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03176"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUI5"
FT                   /protein_id="ADI03176.1"
FT                   TGR"
FT   gene            52326..53927
FT                   /locus_tag="SBI_00056"
FT   CDS_pept        52326..53927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00056"
FT                   /product="Rab family protein"
FT                   /note="COG4886 Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00056"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03177"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUI6"
FT                   /protein_id="ADI03177.1"
FT                   AELPDTALLGLRREAR"
FT   gene            54210..54635
FT                   /locus_tag="SBI_00057"
FT   CDS_pept        54210..54635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00057"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03178"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUI7"
FT                   /protein_id="ADI03178.1"
FT   gene            54632..55003
FT                   /locus_tag="SBI_00058"
FT   CDS_pept        54632..55003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00058"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03179"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUI8"
FT                   /protein_id="ADI03179.1"
FT   gene            55000..55296
FT                   /locus_tag="SBI_00059"
FT   CDS_pept        55000..55296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00059"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03180"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUI9"
FT                   /protein_id="ADI03180.1"
FT   gene            complement(55878..57026)
FT                   /locus_tag="SBI_00060"
FT   CDS_pept        complement(55878..57026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00060"
FT                   /product="Beta-lactamase class C and other penicillin
FT                   binding protein-like protein"
FT                   /note="COG1680 Beta-lactamase class C and other penicillin
FT                   binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03181"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUJ0"
FT                   /protein_id="ADI03181.1"
FT   gene            complement(57338..57862)
FT                   /locus_tag="SBI_00061"
FT   CDS_pept        complement(57338..57862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00061"
FT                   /product="transcription regulator"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00061"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03182"
FT                   /db_xref="GOA:D7BUJ1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUJ1"
FT                   /protein_id="ADI03182.1"
FT                   DGLRFGAQNAG"
FT   gene            57967..58491
FT                   /locus_tag="SBI_00062"
FT   CDS_pept        57967..58491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00062"
FT                   /product="short chain dehydrogenase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00062"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03183"
FT                   /db_xref="GOA:D7BUJ2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUJ2"
FT                   /protein_id="ADI03183.1"
FT                   GVGVEEYSSRS"
FT   gene            58509..58631
FT                   /locus_tag="SBI_00063"
FT   CDS_pept        58509..58631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00063"
FT                   /product="short chain dehydrogenase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00063"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03184"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUJ3"
FT                   /protein_id="ADI03184.1"
FT   gene            58674..59042
FT                   /locus_tag="SBI_00064"
FT   CDS_pept        58674..59042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00064"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03185"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUJ4"
FT                   /protein_id="ADI03185.1"
FT                   GGRVYASPAGHPFCLRSG"
FT   gene            complement(59464..60087)
FT                   /locus_tag="SBI_00065"
FT   CDS_pept        complement(59464..60087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00065"
FT                   /product="putative short chain dehydrogenase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00065"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03186"
FT                   /db_xref="GOA:D7BUJ5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUJ5"
FT                   /protein_id="ADI03186.1"
FT   gene            60368..60529
FT                   /locus_tag="SBI_00066"
FT   CDS_pept        60368..60529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00066"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00066"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03187"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUJ6"
FT                   /protein_id="ADI03187.1"
FT                   KLGQSFTR"
FT   gene            complement(61081..61947)
FT                   /locus_tag="SBI_00067"
FT   CDS_pept        complement(61081..61947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00067"
FT                   /product="DNA-binding protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00067"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03188"
FT                   /db_xref="GOA:D7BUJ7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUJ7"
FT                   /protein_id="ADI03188.1"
FT                   DREGRRS"
FT   gene            62123..63088
FT                   /locus_tag="SBI_00068"
FT   CDS_pept        62123..63088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00068"
FT                   /product="hypothetical protein"
FT                   /note="COG1073 Hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00068"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03189"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUJ8"
FT                   /protein_id="ADI03189.1"
FT   gene            complement(63342..63842)
FT                   /locus_tag="SBI_00069"
FT   CDS_pept        complement(63342..63842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00069"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03190"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUJ9"
FT                   /protein_id="ADI03190.1"
FT                   QLP"
FT   gene            64296..64931
FT                   /locus_tag="SBI_00070"
FT   CDS_pept        64296..64931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03191"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK0"
FT                   /protein_id="ADI03191.1"
FT   gene            65648..66004
FT                   /locus_tag="SBI_00071"
FT   CDS_pept        65648..66004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00071"
FT                   /product="YCII-related protein"
FT                   /note="COG3795 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00071"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03192"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK1"
FT                   /protein_id="ADI03192.1"
FT                   LGGAVEVRPSAKYW"
FT   gene            complement(66045..66149)
FT                   /locus_tag="SBI_00072"
FT   CDS_pept        complement(66045..66149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00072"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03193"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK2"
FT                   /protein_id="ADI03193.1"
FT   gene            66175..67035
FT                   /locus_tag="SBI_00073"
FT   CDS_pept        66175..67035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00073"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03194"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK3"
FT                   /protein_id="ADI03194.1"
FT                   PPCGR"
FT   gene            complement(67602..68735)
FT                   /locus_tag="SBI_00074"
FT   CDS_pept        complement(67602..68735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00074"
FT                   /product="putative transcriptional regulator, TetR family
FT                   protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00074"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03195"
FT                   /db_xref="GOA:D7BUK4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK4"
FT                   /protein_id="ADI03195.1"
FT   gene            68822..68932
FT                   /locus_tag="SBI_00075"
FT   CDS_pept        68822..68932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00075"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03196"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK5"
FT                   /protein_id="ADI03196.1"
FT   gene            69110..69736
FT                   /locus_tag="SBI_00076"
FT   CDS_pept        69110..69736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00076"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03197"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK6"
FT                   /protein_id="ADI03197.1"
FT   gene            69733..71418
FT                   /locus_tag="SBI_00077"
FT   CDS_pept        69733..71418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00077"
FT                   /product="pyruvate phosphate dikinase"
FT                   /EC_number=""
FT                   /note="COG0574 Phosphoenolpyruvate synthase/pyruvate
FT                   phosphate dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00077"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03198"
FT                   /db_xref="GOA:D7BUK7"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK7"
FT                   /protein_id="ADI03198.1"
FT   gene            71483..72055
FT                   /locus_tag="SBI_00078"
FT   CDS_pept        71483..72055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00078"
FT                   /product="pgam5; phosphoglycerate mutase family member 5"
FT                   /note="COG0406 Fructose-2,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00078"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03199"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK8"
FT                   /protein_id="ADI03199.1"
FT   gene            72156..73145
FT                   /locus_tag="SBI_00079"
FT   CDS_pept        72156..73145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00079"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03200"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK9"
FT                   /protein_id="ADI03200.1"
FT   gene            complement(73188..73970)
FT                   /locus_tag="SBI_00080"
FT   CDS_pept        complement(73188..73970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00080"
FT                   /product="hypothetical protein"
FT                   /note="COG4312 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03201"
FT                   /db_xref="InterPro:IPR010296"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUL0"
FT                   /protein_id="ADI03201.1"
FT   gene            complement(74197..75351)
FT                   /locus_tag="SBI_00081"
FT   CDS_pept        complement(74197..75351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00081"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00081"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03202"
FT                   /db_xref="GOA:D7BUL1"
FT                   /db_xref="InterPro:IPR014543"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUL1"
FT                   /protein_id="ADI03202.1"
FT   gene            75620..76201
FT                   /locus_tag="SBI_00082"
FT   CDS_pept        75620..76201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00082"
FT                   /product="transcriptional regulator"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00082"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03203"
FT                   /db_xref="GOA:D7BUL2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUL2"
FT                   /protein_id="ADI03203.1"
FT   gene            complement(76275..76859)
FT                   /locus_tag="SBI_00083"
FT   CDS_pept        complement(76275..76859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00083"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03204"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUL3"
FT                   /protein_id="ADI03204.1"
FT   gene            77188..77718
FT                   /locus_tag="SBI_00084"
FT   CDS_pept        77188..77718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00084"
FT                   /product="hypothetical protein"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00084"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03205"
FT                   /db_xref="GOA:D7BUL4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUL4"
FT                   /protein_id="ADI03205.1"
FT                   GNWPGQVLARRVD"
FT   gene            78057..79619
FT                   /locus_tag="SBI_00085"
FT   CDS_pept        78057..79619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00085"
FT                   /product="secreted protein"
FT                   /note="COG0330 Membrane protease subunits,
FT                   stomatin/prohibitin homologs"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00085"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03206"
FT                   /db_xref="GOA:D7BUL5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUL5"
FT                   /protein_id="ADI03206.1"
FT                   PGR"
FT   gene            complement(79551..80450)
FT                   /locus_tag="SBI_00086"
FT   CDS_pept        complement(79551..80450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00086"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00086"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03207"
FT                   /db_xref="GOA:D7BUL6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUL6"
FT                   /protein_id="ADI03207.1"
FT                   LRGGWGVVQVDHRAYGRR"
FT   gene            80543..81259
FT                   /locus_tag="SBI_00087"
FT   CDS_pept        80543..81259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00087"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00087"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03208"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUL7"
FT                   /protein_id="ADI03208.1"
FT                   DGPRGGFFDDEGVIPW"
FT   gene            81393..81776
FT                   /locus_tag="SBI_00088"
FT   CDS_pept        81393..81776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00088"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03209"
FT                   /db_xref="GOA:D7BUL8"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUL8"
FT                   /protein_id="ADI03209.1"
FT   gene            82081..82317
FT                   /locus_tag="SBI_00089"
FT   CDS_pept        82081..82317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00089"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00089"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03210"
FT                   /db_xref="GOA:D7BUL9"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUL9"
FT                   /protein_id="ADI03210.1"
FT   gene            complement(82398..83000)
FT                   /locus_tag="SBI_00090"
FT   CDS_pept        complement(82398..83000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00090"
FT                   /product="ATP-dependent Clp protease proteolytic subunit 2"
FT                   /note="COG0740 Protease subunit of ATP-dependent Clp
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03211"
FT                   /db_xref="GOA:D7BUM0"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM0"
FT                   /protein_id="ADI03211.1"
FT   gene            complement(83002..83640)
FT                   /locus_tag="SBI_00091"
FT   CDS_pept        complement(83002..83640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00091"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /note="COG0740 Protease subunit of ATP-dependent Clp
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00091"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03212"
FT                   /db_xref="GOA:D7BUM1"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM1"
FT                   /protein_id="ADI03212.1"
FT   gene            complement(84060..84326)
FT                   /locus_tag="SBI_00092"
FT   CDS_pept        complement(84060..84326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00092"
FT                   /product="hypothetical protein"
FT                   /note="COG0640 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00092"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03213"
FT                   /db_xref="GOA:D7BUM2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM2"
FT                   /protein_id="ADI03213.1"
FT   gene            complement(84367..85107)
FT                   /locus_tag="SBI_00093"
FT   CDS_pept        complement(84367..85107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00093"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COG4221 Short-chain alcohol dehydrogenase of unknown
FT                   specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00093"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03214"
FT                   /db_xref="GOA:D7BUM3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM3"
FT                   /protein_id="ADI03214.1"
FT   gene            85202..85762
FT                   /locus_tag="SBI_00094"
FT   CDS_pept        85202..85762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00094"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00094"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03215"
FT                   /db_xref="GOA:D7BUM4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM4"
FT                   /protein_id="ADI03215.1"
FT   gene            complement(86012..86857)
FT                   /locus_tag="SBI_00095"
FT   CDS_pept        complement(86012..86857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00095"
FT                   /product="putative binding-protein-dependent transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03216"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM5"
FT                   /protein_id="ADI03216.1"
FT                   "
FT   gene            86843..87079
FT                   /locus_tag="SBI_00096"
FT   CDS_pept        86843..87079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00096"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03217"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM6"
FT                   /protein_id="ADI03217.1"
FT   gene            complement(87450..88403)
FT                   /locus_tag="SBI_00097"
FT   CDS_pept        complement(87450..88403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00097"
FT                   /product="hypothetical protein"
FT                   /note="COG0376 Catalase (peroxidase I)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00097"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03218"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM7"
FT                   /protein_id="ADI03218.1"
FT   gene            complement(88617..89963)
FT                   /locus_tag="SBI_00098"
FT   CDS_pept        complement(88617..89963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00098"
FT                   /product="glutamate dehydrogenase"
FT                   /EC_number=""
FT                   /note="COG0334 Glutamate dehydrogenase/leucine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00098"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03219"
FT                   /db_xref="GOA:D7BUM8"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM8"
FT                   /protein_id="ADI03219.1"
FT   gene            complement(90075..90650)
FT                   /locus_tag="SBI_00099"
FT   CDS_pept        complement(90075..90650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00099"
FT                   /product="hypothetical protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00099"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03220"
FT                   /db_xref="GOA:D7BUM9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM9"
FT                   /protein_id="ADI03220.1"
FT   gene            complement(90683..91852)
FT                   /locus_tag="SBI_00100"
FT   CDS_pept        complement(90683..91852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00100"
FT                   /product="aminotransferase"
FT                   /note="COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03221"
FT                   /db_xref="GOA:D7BUN0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUN0"
FT                   /protein_id="ADI03221.1"
FT   gene            complement(91902..92648)
FT                   /locus_tag="SBI_00101"
FT   CDS_pept        complement(91902..92648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00101"
FT                   /product="putative 3-oxoacyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00101"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03222"
FT                   /db_xref="GOA:D7BUN1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUN1"
FT                   /protein_id="ADI03222.1"
FT   gene            complement(92753..93757)
FT                   /locus_tag="SBI_00102"
FT   CDS_pept        complement(92753..93757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00102"
FT                   /product="allophanate hydrolase subunit 2"
FT                   /note="COG1984 Allophanate hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00102"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03223"
FT                   /db_xref="GOA:D7BUN2"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUN2"
FT                   /protein_id="ADI03223.1"
FT   gene            complement(93754..94491)
FT                   /locus_tag="SBI_00103"
FT   CDS_pept        complement(93754..94491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00103"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="COG2049 Allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00103"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03224"
FT                   /db_xref="GOA:D7BUN3"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUN3"
FT                   /protein_id="ADI03224.1"
FT   gene            complement(94511..95320)
FT                   /locus_tag="SBI_00104"
FT   CDS_pept        complement(94511..95320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00104"
FT                   /product="lactam utilization protein"
FT                   /note="COG1540 Uncharacterized proteins, homologs of lactam
FT                   utilization protein B"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00104"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03225"
FT                   /db_xref="GOA:D7BUN4"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUN4"
FT                   /protein_id="ADI03225.1"
FT   gene            complement(95351..96727)
FT                   /locus_tag="SBI_00105"
FT   CDS_pept        complement(95351..96727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00105"
FT                   /product="major facilitator transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03226"
FT                   /db_xref="GOA:D7BUN5"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUN5"
FT                   /protein_id="ADI03226.1"
FT                   "
FT   gene            97479..98117
FT                   /locus_tag="SBI_00106"
FT   CDS_pept        97479..98117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00106"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /note="COG0684 Demethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00106"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03227"
FT                   /db_xref="GOA:D7BUN6"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUN6"
FT                   /protein_id="ADI03227.1"
FT   gene            98114..99190
FT                   /locus_tag="SBI_00107"
FT   CDS_pept        98114..99190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00107"
FT                   /product="phosphoglycerate dehydrogenase"
FT                   /note="COG0111 Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00107"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03228"
FT                   /db_xref="GOA:D7BUN7"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUN7"
FT                   /protein_id="ADI03228.1"
FT                   RLLDGRDLINRVNTVEFY"
FT   gene            complement(99257..100210)
FT                   /locus_tag="SBI_00108"
FT   CDS_pept        complement(99257..100210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00108"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00108"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03229"
FT                   /db_xref="GOA:D7BUN8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUN8"
FT                   /protein_id="ADI03229.1"
FT   gene            100397..102694
FT                   /locus_tag="SBI_00109"
FT   CDS_pept        100397..102694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00109"
FT                   /product="oxidoreductase alpha subunit"
FT                   /note="COG0243 Anaerobic dehydrogenases, typically
FT                   selenocysteine-containing"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00109"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03230"
FT                   /db_xref="GOA:D7BUN9"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUN9"
FT                   /protein_id="ADI03230.1"
FT                   IVRLERAAGATR"
FT   gene            complement(102711..103661)
FT                   /locus_tag="SBI_00110"
FT   CDS_pept        complement(102711..103661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00110"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03231"
FT                   /db_xref="GOA:D7BUP0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUP0"
FT                   /protein_id="ADI03231.1"
FT   gene            103811..107512
FT                   /gene="dnaE1"
FT                   /locus_tag="SBI_00111"
FT   CDS_pept        103811..107512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE1"
FT                   /locus_tag="SBI_00111"
FT                   /product="DNA polymerase III subunit alpha"
FT                   /EC_number=""
FT                   /note="COG0587 DNA polymerase III, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00111"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03232"
FT                   /db_xref="GOA:D7BUP1"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUP1"
FT                   /protein_id="ADI03232.1"
FT                   ADAWQGIA"
FT   gene            complement(107554..107991)
FT                   /locus_tag="SBI_00112"
FT   CDS_pept        complement(107554..107991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00112"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03233"
FT                   /db_xref="GOA:D7BUP2"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUP2"
FT                   /protein_id="ADI03233.1"
FT   gene            complement(108317..108802)
FT                   /locus_tag="SBI_00113"
FT   CDS_pept        complement(108317..108802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00113"
FT                   /product="hypothetical protein"
FT                   /note="COG0346 Lactoylglutathione lyase and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00113"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03234"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUP3"
FT                   /protein_id="ADI03234.1"
FT   gene            109071..110588
FT                   /locus_tag="SBI_00114"
FT   CDS_pept        109071..110588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00114"
FT                   /product="putative oxygenase"
FT                   /note="COG0654 2-polyprenyl-6-methoxyphenol hydroxylase and
FT                   related FAD-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00114"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03235"
FT                   /db_xref="GOA:D7BUP4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUP4"
FT                   /protein_id="ADI03235.1"
FT   gene            110670..111338
FT                   /locus_tag="SBI_00115"
FT   CDS_pept        110670..111338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00115"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="COG2755 Lysophospholipase L1 and related esterases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03236"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUP5"
FT                   /protein_id="ADI03236.1"
FT                   "
FT   gene            111497..111592
FT                   /locus_tag="SBI_00116"
FT   CDS_pept        111497..111592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00116"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03237"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUP6"
FT                   /protein_id="ADI03237.1"
FT                   /translation="MRSEDELDGAVRVARELGIDVRTDATEAGEG"
FT   gene            111589..111936
FT                   /locus_tag="SBI_00117"
FT   CDS_pept        111589..111936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00117"
FT                   /product="ArsR family transcriptional regulator"
FT                   /note="COG0640 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00117"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03238"
FT                   /db_xref="GOA:D7BUP7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUP7"
FT                   /protein_id="ADI03238.1"
FT                   LDELRAAETAR"
FT   gene            complement(112145..112474)
FT                   /locus_tag="SBI_00118"
FT   CDS_pept        complement(112145..112474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00118"
FT                   /product="putative transcriptional regulator"
FT                   /note="COG0640 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00118"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03239"
FT                   /db_xref="GOA:D7BUP8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUP8"
FT                   /protein_id="ADI03239.1"
FT                   GNPPS"
FT   gene            complement(112761..113186)
FT                   /locus_tag="SBI_00119"
FT   CDS_pept        complement(112761..113186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00119"
FT                   /product="hypothetical protein"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00119"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03240"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUP9"
FT                   /protein_id="ADI03240.1"
FT   gene            complement(113238..114971)
FT                   /locus_tag="SBI_00120"
FT   CDS_pept        complement(113238..114971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00120"
FT                   /product="putative sulfate transporter"
FT                   /note="COG0659 Sulfate permease and related transporters
FT                   (MFS superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03241"
FT                   /db_xref="GOA:D7BUQ0"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUQ0"
FT                   /protein_id="ADI03241.1"
FT                   R"
FT   gene            complement(114971..115090)
FT                   /locus_tag="SBI_00121"
FT   CDS_pept        complement(114971..115090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00121"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03242"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUQ1"
FT                   /protein_id="ADI03242.1"
FT   gene            complement(115309..115866)
FT                   /locus_tag="SBI_00122"
FT   CDS_pept        complement(115309..115866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00122"
FT                   /product="hypothetical protein"
FT                   /note="COG2353 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00122"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03243"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUQ2"
FT                   /protein_id="ADI03243.1"
FT   gene            complement(116132..116689)
FT                   /locus_tag="SBI_00123"
FT   CDS_pept        complement(116132..116689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00123"
FT                   /product="hypothetical protein"
FT                   /note="COG2350 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00123"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03244"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUQ3"
FT                   /protein_id="ADI03244.1"
FT   gene            116925..118352
FT                   /locus_tag="SBI_00124"
FT   CDS_pept        116925..118352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00124"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03245"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUQ4"
FT                   /protein_id="ADI03245.1"
FT                   HGAMVIAAPDGWSASVS"
FT   gene            complement(118341..118880)
FT                   /locus_tag="SBI_00125"
FT   CDS_pept        complement(118341..118880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00125"
FT                   /product="transcriptional regulator"
FT                   /note="COG1733 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00125"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03246"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUQ5"
FT                   /protein_id="ADI03246.1"
FT                   QRSPRDRACIAQPSAD"
FT   gene            119026..119874
FT                   /locus_tag="SBI_00126"
FT   CDS_pept        119026..119874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00126"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00126"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03247"
FT                   /db_xref="GOA:D7BUQ6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUQ6"
FT                   /protein_id="ADI03247.1"
FT                   P"
FT   gene            120072..121196
FT                   /locus_tag="SBI_00127"
FT   CDS_pept        120072..121196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00127"
FT                   /product="putative DNA alkylation repair protein"
FT                   /note="COG4335 DNA alkylation repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00127"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03248"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUQ7"
FT                   /protein_id="ADI03248.1"
FT   gene            121493..123142
FT                   /locus_tag="SBI_00128"
FT   CDS_pept        121493..123142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00128"
FT                   /product="putative integral membrane protein"
FT                   /note="COG1457 Purine-cytosine permease and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00128"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03249"
FT                   /db_xref="GOA:D7BUQ8"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUQ8"
FT                   /protein_id="ADI03249.1"
FT   gene            complement(123215..123625)
FT                   /locus_tag="SBI_00129"
FT   CDS_pept        complement(123215..123625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00129"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="COG1917 Uncharacterized conserved protein, contains
FT                   double-stranded beta-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00129"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUQ9"
FT                   /protein_id="ADI03250.1"
FT   gene            complement(123767..125125)
FT                   /locus_tag="SBI_00130"
FT   CDS_pept        complement(123767..125125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00130"
FT                   /product="putative streptomycin-6-phosphate phosphatase"
FT                   /note="COG1785 Alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03251"
FT                   /db_xref="GOA:D7BUR0"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUR0"
FT                   /protein_id="ADI03251.1"
FT   gene            complement(125305..126561)
FT                   /locus_tag="SBI_00131"
FT   CDS_pept        complement(125305..126561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00131"
FT                   /product="putative MFS transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00131"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03252"
FT                   /db_xref="GOA:D7BUR1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUR1"
FT                   /protein_id="ADI03252.1"
FT   gene            complement(126558..127697)
FT                   /locus_tag="SBI_00132"
FT   CDS_pept        complement(126558..127697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00132"
FT                   /product="cysteine synthase A"
FT                   /note="COG0031 Cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00132"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03253"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUR2"
FT                   /protein_id="ADI03253.1"
FT   gene            128496..129716
FT                   /locus_tag="SBI_00133"
FT   CDS_pept        128496..129716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00133"
FT                   /product="hypothetical protein"
FT                   /note="COG0531 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00133"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03254"
FT                   /db_xref="GOA:D7BUR3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUR3"
FT                   /protein_id="ADI03254.1"
FT                   SFRSPPA"
FT   gene            129779..130633
FT                   /locus_tag="SBI_00134"
FT   CDS_pept        129779..130633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00134"
FT                   /product="hypothetical protein"
FT                   /note="COG2513 PEP phosphonomutase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00134"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03255"
FT                   /db_xref="GOA:D7BUR4"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUR4"
FT                   /protein_id="ADI03255.1"
FT                   SGR"
FT   gene            complement(130850..132256)
FT                   /locus_tag="SBI_00135"
FT   CDS_pept        complement(130850..132256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03256"
FT                   /db_xref="GOA:D7BUR5"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUR5"
FT                   /protein_id="ADI03256.1"
FT                   IRRRVSASQR"
FT   gene            132914..135370
FT                   /locus_tag="SBI_00136"
FT   CDS_pept        132914..135370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00136"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03257"
FT                   /db_xref="InterPro:IPR007817"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUR6"
FT                   /protein_id="ADI03257.1"
FT                   TRLRRR"
FT   gene            complement(135407..136891)
FT                   /locus_tag="SBI_00137"
FT   CDS_pept        complement(135407..136891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00137"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COG0318 Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00137"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03258"
FT                   /db_xref="GOA:D7BUR7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUR7"
FT                   /protein_id="ADI03258.1"
FT   gene            136953..138158
FT                   /locus_tag="SBI_00138"
FT   CDS_pept        136953..138158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00138"
FT                   /product="transporter, major facilitator superfamily"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00138"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03259"
FT                   /db_xref="GOA:D7BUR8"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUR8"
FT                   /protein_id="ADI03259.1"
FT                   RE"
FT   gene            138202..142206
FT                   /locus_tag="SBI_00139"
FT   CDS_pept        138202..142206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00139"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COG0318 Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00139"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03260"
FT                   /db_xref="GOA:D7BUR9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUR9"
FT                   /protein_id="ADI03260.1"
FT   gene            complement(142265..148906)
FT                   /locus_tag="SBI_00140"
FT   CDS_pept        complement(142265..148906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00140"
FT                   /product="amino acid adenylation domain-containing protein"
FT                   /note="COG1020 Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03261"
FT                   /db_xref="GOA:D7BUS0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS0"
FT                   /protein_id="ADI03261.1"
FT   gene            149111..149926
FT                   /locus_tag="SBI_00141"
FT   CDS_pept        149111..149926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00141"
FT                   /product="Oleoyl-(acyl-carrier-protein) hydrolase"
FT                   /note="COG3208 Predicted thioesterase involved in
FT                   non-ribosomal peptide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00141"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03262"
FT                   /db_xref="GOA:D7BUS1"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS1"
FT                   /protein_id="ADI03262.1"
FT   gene            150477..152234
FT                   /locus_tag="SBI_00142"
FT   CDS_pept        150477..152234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00142"
FT                   /product="hypothetical protein"
FT                   /note="COG1357 Uncharacterized low-complexity proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00142"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03263"
FT                   /db_xref="GOA:D7BUS2"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS2"
FT                   /protein_id="ADI03263.1"
FT                   LAIRGRIKR"
FT   gene            complement(152363..152773)
FT                   /locus_tag="SBI_00143"
FT   CDS_pept        complement(152363..152773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00143"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00143"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03264"
FT                   /db_xref="GOA:D7BUS3"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS3"
FT                   /protein_id="ADI03264.1"
FT   gene            complement(152995..153594)
FT                   /locus_tag="SBI_00144"
FT   CDS_pept        complement(152995..153594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00144"
FT                   /product="hypothetical protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00144"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03265"
FT                   /db_xref="GOA:D7BUS4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS4"
FT                   /protein_id="ADI03265.1"
FT   gene            153847..154830
FT                   /locus_tag="SBI_00145"
FT   CDS_pept        153847..154830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00145"
FT                   /product="Esterase/lipase-like protein"
FT                   /note="COG0657 Esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00145"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03266"
FT                   /db_xref="GOA:D7BUS5"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS5"
FT                   /protein_id="ADI03266.1"
FT   gene            154830..155279
FT                   /locus_tag="SBI_00146"
FT   CDS_pept        154830..155279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00146"
FT                   /product="hypothetical protein"
FT                   /note="COG0469 Pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00146"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03267"
FT                   /db_xref="GOA:D7BUS6"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS6"
FT                   /protein_id="ADI03267.1"
FT   gene            complement(155338..155745)
FT                   /locus_tag="SBI_00147"
FT   CDS_pept        complement(155338..155745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00147"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03268"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS7"
FT                   /protein_id="ADI03268.1"
FT   gene            155962..157260
FT                   /locus_tag="SBI_00148"
FT   CDS_pept        155962..157260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00148"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COG1252 NADH dehydrogenase, FAD-containing subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00148"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03269"
FT                   /db_xref="GOA:D7BUS8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS8"
FT                   /protein_id="ADI03269.1"
FT   gene            complement(157339..158799)
FT                   /gene="cyp1"
FT                   /locus_tag="SBI_00149"
FT   CDS_pept        complement(157339..158799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp1"
FT                   /locus_tag="SBI_00149"
FT                   /product="cytochrome P450"
FT                   /note="COG2124 Cytochrome P450, CYP183C1"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00149"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03270"
FT                   /db_xref="GOA:D7BUS9"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS9"
FT                   /protein_id="ADI03270.1"
FT   gene            complement(158804..160147)
FT                   /gene="cyp2"
FT                   /locus_tag="SBI_00150"
FT   CDS_pept        complement(158804..160147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp2"
FT                   /locus_tag="SBI_00150"
FT                   /product="cytochrome P450"
FT                   /note="COG2124 Cytochrome P450, CYP183D1"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03271"
FT                   /db_xref="GOA:D7BUT0"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUT0"
FT                   /protein_id="ADI03271.1"
FT   gene            complement(160217..170530)
FT                   /locus_tag="SBI_00151"
FT   CDS_pept        complement(160217..170530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00151"
FT                   /product="putative type-I PKS"
FT                   /note="COG3321 Polyketide synthase modules and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00151"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03272"
FT                   /db_xref="GOA:D7BUT1"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUT1"
FT                   /protein_id="ADI03272.1"
FT   gene            170837..171055
FT                   /locus_tag="SBI_00152"
FT   CDS_pept        170837..171055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00152"
FT                   /product="hypothetical protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00152"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03273"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUT2"
FT                   /protein_id="ADI03273.1"
FT   gene            complement(171167..172066)
FT                   /locus_tag="SBI_00153"
FT   CDS_pept        complement(171167..172066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00153"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="COG3173 Predicted aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00153"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03274"
FT                   /db_xref="GOA:D7BUT3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUT3"
FT                   /protein_id="ADI03274.1"
FT                   NPRVAAQTTRQITAALIG"
FT   gene            complement(172228..173871)
FT                   /locus_tag="SBI_00154"
FT   CDS_pept        complement(172228..173871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00154"
FT                   /product="hypothetical protein"
FT                   /note="COG2425 Uncharacterized protein containing a von
FT                   Willebrand factor type A (vWA) domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00154"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03275"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUT4"
FT                   /protein_id="ADI03275.1"
FT   gene            complement(173891..174325)
FT                   /locus_tag="SBI_00155"
FT   CDS_pept        complement(173891..174325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00155"
FT                   /product="AAA ATPase"
FT                   /note="COG0714 MoxR-like ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00155"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03276"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUT5"
FT                   /protein_id="ADI03276.1"
FT   gene            complement(175589..176128)
FT                   /locus_tag="SBI_00156"
FT   CDS_pept        complement(175589..176128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00156"
FT                   /product="hypothetical protein"
FT                   /note="COG2847 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00156"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03277"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUT6"
FT                   /protein_id="ADI03277.1"
FT                   ASPPVTTRALAVRPGR"
FT   gene            complement(176110..178440)
FT                   /locus_tag="SBI_00157"
FT   CDS_pept        complement(176110..178440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00157"
FT                   /product="cation-transporting P-type ATPase"
FT                   /note="COG2217 Cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00157"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03278"
FT                   /db_xref="GOA:D7BUT7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUT7"
FT                   /protein_id="ADI03278.1"
FT   gene            complement(178536..178832)
FT                   /locus_tag="SBI_00158"
FT   CDS_pept        complement(178536..178832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00158"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03279"
FT                   /db_xref="GOA:D7BUT8"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUT8"
FT                   /protein_id="ADI03279.1"
FT   gene            complement(179233..181191)
FT                   /locus_tag="SBI_00159"
FT   CDS_pept        complement(179233..181191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00159"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03280"
FT                   /db_xref="InterPro:IPR011496"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUT9"
FT                   /protein_id="ADI03280.1"
FT                   TFLAAAPGLGGAGAHAP"
FT   gene            complement(181470..181589)
FT                   /locus_tag="SBI_00160"
FT   CDS_pept        complement(181470..181589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03281"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUU0"
FT                   /protein_id="ADI03281.1"
FT   gene            complement(181586..181723)
FT                   /locus_tag="SBI_00161"
FT   CDS_pept        complement(181586..181723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00161"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03282"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUU1"
FT                   /protein_id="ADI03282.1"
FT                   "
FT   gene            complement(181764..181910)
FT                   /locus_tag="SBI_00162"
FT   CDS_pept        complement(181764..181910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00162"
FT                   /product="luciferase-like protein"
FT                   /note="COG2141 Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00162"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03283"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUU2"
FT                   /protein_id="ADI03283.1"
FT                   RDR"
FT   gene            182039..182191
FT                   /locus_tag="SBI_00163"
FT   CDS_pept        182039..182191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00163"
FT                   /product="hypothetical protein"
FT                   /note="COG0596 Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00163"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03284"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUU3"
FT                   /protein_id="ADI03284.1"
FT                   ADRDG"
FT   gene            182314..182457
FT                   /locus_tag="SBI_00164"
FT   CDS_pept        182314..182457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00164"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03285"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUU4"
FT                   /protein_id="ADI03285.1"
FT                   VV"
FT   gene            complement(182633..182749)
FT                   /locus_tag="SBI_00165"
FT   CDS_pept        complement(182633..182749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00165"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03286"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUU5"
FT                   /protein_id="ADI03286.1"
FT   gene            183795..184073
FT                   /locus_tag="SBI_00166"
FT   CDS_pept        183795..184073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00166"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03287"
FT                   /db_xref="GOA:D7BUU6"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUU6"
FT                   /protein_id="ADI03287.1"
FT   gene            184294..184932
FT                   /locus_tag="SBI_00167"
FT   CDS_pept        184294..184932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00167"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03288"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUU7"
FT                   /protein_id="ADI03288.1"
FT   gene            complement(184997..185902)
FT                   /locus_tag="SBI_00168"
FT   CDS_pept        complement(184997..185902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00168"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00168"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03289"
FT                   /db_xref="GOA:D7BUU8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUU8"
FT                   /protein_id="ADI03289.1"
FT   gene            186000..186173
FT                   /locus_tag="SBI_00169"
FT   CDS_pept        186000..186173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00169"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03290"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUU9"
FT                   /protein_id="ADI03290.1"
FT                   GGHHIQCPHRGR"
FT   gene            complement(186322..186394)
FT                   /locus_tag="SBI_t1"
FT   tRNA            complement(186322..186394)
FT                   /locus_tag="SBI_t1"
FT                   /product="tRNA-Trp"
FT   gene            complement(186525..187712)
FT                   /locus_tag="SBI_00170"
FT   CDS_pept        complement(186525..187712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00170"
FT                   /product="WD-40 repeat protein"
FT                   /note="COG2319 FOG: WD40 repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03291"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUV0"
FT                   /protein_id="ADI03291.1"
FT   gene            188352..188912
FT                   /locus_tag="SBI_00171"
FT   CDS_pept        188352..188912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00171"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03292"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUV1"
FT                   /protein_id="ADI03292.1"
FT   gene            189374..192223
FT                   /locus_tag="SBI_00172"
FT   CDS_pept        189374..192223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00172"
FT                   /product="Alpha-glucuronidase"
FT                   /note="COG3661 Alpha-glucuronidase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00172"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03293"
FT                   /db_xref="GOA:D7BUV2"
FT                   /db_xref="InterPro:IPR005154"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011099"
FT                   /db_xref="InterPro:IPR011100"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="InterPro:IPR037054"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUV2"
FT                   /protein_id="ADI03293.1"
FT   gene            192471..193553
FT                   /locus_tag="SBI_00173"
FT   CDS_pept        192471..193553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00173"
FT                   /product="hypothetical protein"
FT                   /note="COG2837 Predicted iron-dependent peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00173"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03294"
FT                   /db_xref="GOA:D7BUV3"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUV3"
FT                   /protein_id="ADI03294.1"
FT   gene            193534..194376
FT                   /locus_tag="SBI_00174"
FT   CDS_pept        193534..194376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00174"
FT                   /product="antigen cfp29"
FT                   /note="COG1659 Uncharacterized protein, linocin/CFP29
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00174"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03295"
FT                   /db_xref="GOA:D7BUV4"
FT                   /db_xref="InterPro:IPR007544"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUV4"
FT                   /protein_id="ADI03295.1"
FT   gene            complement(194439..195059)
FT                   /locus_tag="SBI_00175"
FT   CDS_pept        complement(194439..195059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00175"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00175"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03296"
FT                   /db_xref="GOA:D7BUV5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUV5"
FT                   /protein_id="ADI03296.1"
FT   gene            complement(196056..196148)
FT                   /locus_tag="SBI_00176"
FT   CDS_pept        complement(196056..196148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00176"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03297"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUV6"
FT                   /protein_id="ADI03297.1"
FT                   /translation="MMTGTAVVADFHAAITGAISAHCSSDRPVL"
FT   gene            complement(196145..196615)
FT                   /locus_tag="SBI_00177"
FT   CDS_pept        complement(196145..196615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00177"
FT                   /product="putative DNA-binding protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00177"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03298"
FT                   /db_xref="GOA:D7BUV7"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUV7"
FT                   /protein_id="ADI03298.1"
FT   gene            196668..197195
FT                   /gene="fadE1"
FT                   /locus_tag="SBI_00178"
FT   CDS_pept        196668..197195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE1"
FT                   /locus_tag="SBI_00178"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="COG1960 Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00178"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03299"
FT                   /db_xref="GOA:D7BUV8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUV8"
FT                   /protein_id="ADI03299.1"
FT                   VMKVIIAKSLGL"
FT   gene            197199..198008
FT                   /locus_tag="SBI_00179"
FT   CDS_pept        197199..198008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00179"
FT                   /product="dehydrogenase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00179"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03300"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUV9"
FT                   /protein_id="ADI03300.1"
FT   gene            complement(198883..199392)
FT                   /locus_tag="SBI_00180"
FT   CDS_pept        complement(198883..199392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00180"
FT                   /product="putative transcriptional regulator, TetR family
FT                   protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03301"
FT                   /db_xref="GOA:D7BUW0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUW0"
FT                   /protein_id="ADI03301.1"
FT                   PSADDT"
FT   gene            199693..201312
FT                   /locus_tag="SBI_00181"
FT   CDS_pept        199693..201312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00181"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="COG0488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00181"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03302"
FT                   /db_xref="GOA:D7BUW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUW1"
FT                   /protein_id="ADI03302.1"
FT   gene            201359..202030
FT                   /locus_tag="SBI_00182"
FT   CDS_pept        201359..202030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00182"
FT                   /product="streptogramin A acetyl transferase"
FT                   /note="COG0110 Acetyltransferase (isoleucine patch
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00182"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03303"
FT                   /db_xref="GOA:D7BWE7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWE7"
FT                   /protein_id="ADI03303.1"
FT                   R"
FT   gene            202122..203420
FT                   /locus_tag="SBI_00183"
FT   CDS_pept        202122..203420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00183"
FT                   /product="erythromycin esterase-like protein"
FT                   /note="COG2312 Erythromycin esterase homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00183"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03304"
FT                   /db_xref="GOA:D7BWE8"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="InterPro:IPR016273"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWE8"
FT                   /protein_id="ADI03304.1"
FT   misc_feature    203428..204569
FT                   /note="potential frameshift: common BLAST hit:
FT                   gi|162453249|ref|YP_001615616.1| putative monooxygenase"
FT   gene            204810..205736
FT                   /locus_tag="SBI_00184"
FT   CDS_pept        204810..205736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00184"
FT                   /product="hypothetical protein"
FT                   /note="COG0405 Gamma-glutamyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00184"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03305"
FT                   /db_xref="InterPro:IPR026935"
FT                   /db_xref="InterPro:IPR032369"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWE9"
FT                   /protein_id="ADI03305.1"
FT   gene            206352..206864
FT                   /locus_tag="SBI_00185"
FT   CDS_pept        206352..206864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00185"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03306"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWF0"
FT                   /protein_id="ADI03306.1"
FT                   ARLREEL"
FT   gene            complement(206941..207465)
FT                   /locus_tag="SBI_00186"
FT   CDS_pept        complement(206941..207465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00186"
FT                   /product="hypothetical protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00186"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03307"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWF1"
FT                   /protein_id="ADI03307.1"
FT                   VRRHRARAAVT"
FT   gene            207483..208739
FT                   /locus_tag="SBI_00187"
FT   CDS_pept        207483..208739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00187"
FT                   /product="putative major facilitator superfamily (MFS)
FT                   transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00187"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03308"
FT                   /db_xref="GOA:D7BWF2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWF2"
FT                   /protein_id="ADI03308.1"
FT   gene            209016..209996
FT                   /locus_tag="SBI_00188"
FT   CDS_pept        209016..209996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00188"
FT                   /product="proline dehydrogenase"
FT                   /note="COG0506 Proline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00188"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03309"
FT                   /db_xref="GOA:D7BWF3"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWF3"
FT                   /protein_id="ADI03309.1"
FT   gene            complement(210017..210754)
FT                   /locus_tag="SBI_00189"
FT   CDS_pept        complement(210017..210754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00189"
FT                   /product="NIPSNAP family containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00189"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03310"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWF4"
FT                   /protein_id="ADI03310.1"
FT   gene            210902..211867
FT                   /locus_tag="SBI_00190"
FT   CDS_pept        210902..211867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00190"
FT                   /product="helix-turn-helix type 11 domain protein"
FT                   /note="COG2378 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03311"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWF5"
FT                   /protein_id="ADI03311.1"
FT   gene            complement(212135..213187)
FT                   /locus_tag="SBI_00191"
FT   CDS_pept        complement(212135..213187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00191"
FT                   /product="Phenylserine aldolase"
FT                   /note="COG2008 Threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00191"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03312"
FT                   /db_xref="GOA:D7BWF6"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR026273"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWF6"
FT                   /protein_id="ADI03312.1"
FT                   LVNAVRRLTA"
FT   gene            complement(213217..213702)
FT                   /locus_tag="SBI_00192"
FT   CDS_pept        complement(213217..213702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00192"
FT                   /product="transcriptional regulator, XRE family protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00192"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03313"
FT                   /db_xref="GOA:D7BWF7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWF7"
FT                   /protein_id="ADI03313.1"
FT   gene            complement(213786..214478)
FT                   /locus_tag="SBI_00193"
FT   CDS_pept        complement(213786..214478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00193"
FT                   /product="predicted metal-dependent hydrolase"
FT                   /note="COG2872 Predicted metal-dependent hydrolases related
FT                   to alanyl-tRNA synthetase HxxxH domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00193"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03314"
FT                   /db_xref="GOA:D7BWF8"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWF8"
FT                   /protein_id="ADI03314.1"
FT                   YSAAHGER"
FT   gene            complement(214614..214970)
FT                   /locus_tag="SBI_00194"
FT   CDS_pept        complement(214614..214970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00194"
FT                   /product="hypothetical protein"
FT                   /note="COG4332 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00194"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03315"
FT                   /db_xref="InterPro:IPR009412"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWF9"
FT                   /protein_id="ADI03315.1"
FT                   SGKLCGDFTFTLKR"
FT   gene            complement(215455..216504)
FT                   /locus_tag="SBI_00195"
FT   CDS_pept        complement(215455..216504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00195"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="COG2207 AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03316"
FT                   /db_xref="GOA:D7BWG0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWG0"
FT                   /protein_id="ADI03316.1"
FT                   MRLSLGSRD"
FT   gene            216687..216845
FT                   /locus_tag="SBI_00196"
FT   CDS_pept        216687..216845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00196"
FT                   /product="ArsR family transcriptional regulator"
FT                   /note="COG0640 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00196"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03317"
FT                   /db_xref="GOA:D7BWG1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWG1"
FT                   /protein_id="ADI03317.1"
FT                   LERIVTR"
FT   gene            complement(217049..217633)
FT                   /locus_tag="SBI_00197"
FT   CDS_pept        complement(217049..217633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00197"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03318"
FT                   /db_xref="InterPro:IPR040999"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWG2"
FT                   /protein_id="ADI03318.1"
FT   gene            complement(217736..218227)
FT                   /locus_tag="SBI_00198"
FT   CDS_pept        complement(217736..218227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00198"
FT                   /product="hypothetical protein"
FT                   /note="COG2606 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00198"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03319"
FT                   /db_xref="GOA:D7BWG3"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWG3"
FT                   /protein_id="ADI03319.1"
FT                   "
FT   gene            218349..218867
FT                   /locus_tag="SBI_00199"
FT   CDS_pept        218349..218867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00199"
FT                   /product="putative transcriptional regulator, XRE family
FT                   protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00199"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03320"
FT                   /db_xref="GOA:D7BWG4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWG4"
FT                   /protein_id="ADI03320.1"
FT                   ALLVVRHPQ"
FT   gene            219078..220316
FT                   /gene="cyp3"
FT                   /locus_tag="SBI_00200"
FT   CDS_pept        219078..220316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp3"
FT                   /locus_tag="SBI_00200"
FT                   /product="cytochrome P450"
FT                   /note="COG2124 Cytochrome P450, CYP1038A1"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03321"
FT                   /db_xref="GOA:D7BWG5"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWG5"
FT                   /protein_id="ADI03321.1"
FT                   PTPATITPTPNGS"
FT   gene            220745..222022
FT                   /locus_tag="SBI_00201"
FT   CDS_pept        220745..222022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00201"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00201"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03322"
FT                   /db_xref="GOA:D7BWG6"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWG6"
FT                   /protein_id="ADI03322.1"
FT   gene            complement(222167..222520)
FT                   /locus_tag="SBI_00202"
FT   CDS_pept        complement(222167..222520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00202"
FT                   /product="secreted oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00202"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03323"
FT                   /db_xref="InterPro:IPR011024"
FT                   /db_xref="InterPro:IPR015161"
FT                   /db_xref="InterPro:IPR015791"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWG7"
FT                   /protein_id="ADI03323.1"
FT                   PNRPPKVVAIQIL"
FT   gene            complement(222780..223643)
FT                   /locus_tag="SBI_00203"
FT   CDS_pept        complement(222780..223643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00203"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="COG3231 Aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00203"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03324"
FT                   /db_xref="GOA:D7BWG8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR024165"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWG8"
FT                   /protein_id="ADI03324.1"
FT                   DPLTWG"
FT   gene            complement(223701..225917)
FT                   /locus_tag="SBI_00204"
FT   CDS_pept        complement(223701..225917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00204"
FT                   /product="TPR repeat-containing protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00204"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03325"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWG9"
FT                   /protein_id="ADI03325.1"
FT   gene            complement(226213..226455)
FT                   /locus_tag="SBI_00205"
FT   CDS_pept        complement(226213..226455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00205"
FT                   /product="hypothetical protein"
FT                   /note="COG0402 Cytosine deaminase and related
FT                   metal-dependent hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00205"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03326"
FT                   /db_xref="GOA:D7BWH0"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWH0"
FT                   /protein_id="ADI03326.1"
FT   gene            226901..227770
FT                   /locus_tag="SBI_00206"
FT   CDS_pept        226901..227770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00206"
FT                   /product="putative oxidoreductase"
FT                   /note="COG0667 Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00206"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03327"
FT                   /db_xref="GOA:D7BWH1"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWH1"
FT                   /protein_id="ADI03327.1"
FT                   FQALSQAV"
FT   gene            227950..228267
FT                   /locus_tag="SBI_00207"
FT   CDS_pept        227950..228267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00207"
FT                   /product="transcriptional regulator, HxlR family protein"
FT                   /note="COG1733 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00207"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03328"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWH2"
FT                   /protein_id="ADI03328.1"
FT                   R"
FT   gene            complement(228380..228997)
FT                   /locus_tag="SBI_00208"
FT   CDS_pept        complement(228380..228997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00208"
FT                   /product="hypothetical protein"
FT                   /note="COG0655 Multimeric flavodoxin WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00208"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03329"
FT                   /db_xref="GOA:D7BWH3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWH3"
FT                   /protein_id="ADI03329.1"
FT   gene            complement(229452..229688)
FT                   /locus_tag="SBI_00209"
FT   CDS_pept        complement(229452..229688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00209"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03330"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWH4"
FT                   /protein_id="ADI03330.1"
FT   gene            229695..231095
FT                   /locus_tag="SBI_00210"
FT   CDS_pept        229695..231095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00210"
FT                   /product="hypothetical protein"
FT                   /note="COG0142 Geranylgeranyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03331"
FT                   /db_xref="GOA:D7BWH5"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWH5"
FT                   /protein_id="ADI03331.1"
FT                   CTEHGVGA"
FT   gene            231092..231946
FT                   /locus_tag="SBI_00211"
FT   CDS_pept        231092..231946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00211"
FT                   /product="hypothetical protein"
FT                   /note="COG0657 Esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00211"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03332"
FT                   /db_xref="GOA:D7BWH6"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWH6"
FT                   /protein_id="ADI03332.1"
FT                   EEG"
FT   gene            231948..232766
FT                   /locus_tag="SBI_00212"
FT   CDS_pept        231948..232766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00212"
FT                   /product="tryptophan 23-dioxygenase"
FT                   /note="COG3483 Tryptophan 2,3-dioxygenase (vermilion)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00212"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03333"
FT                   /db_xref="GOA:D7BWH7"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWH7"
FT                   /protein_id="ADI03333.1"
FT   gene            232786..234054
FT                   /locus_tag="SBI_00213"
FT   CDS_pept        232786..234054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00213"
FT                   /product="kynureninase"
FT                   /note="COG3844 Kynureninase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00213"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03334"
FT                   /db_xref="GOA:D7BWH8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010111"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWH8"
FT                   /protein_id="ADI03334.1"
FT   gene            234067..235137
FT                   /locus_tag="SBI_00214"
FT   CDS_pept        234067..235137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00214"
FT                   /product="O-methyltransferase family protein"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00214"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03335"
FT                   /db_xref="GOA:D7BWH9"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWH9"
FT                   /protein_id="ADI03335.1"
FT                   LIAARKRMPSAPGGVK"
FT   gene            235134..236195
FT                   /locus_tag="SBI_00215"
FT   CDS_pept        235134..236195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00215"
FT                   /product="putative alkanal monooxygenase"
FT                   /note="COG2141 Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00215"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03336"
FT                   /db_xref="GOA:D7BWI0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWI0"
FT                   /protein_id="ADI03336.1"
FT                   LFAEHVMPRLQQA"
FT   gene            236364..236930
FT                   /locus_tag="SBI_00216"
FT   CDS_pept        236364..236930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00216"
FT                   /product="2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,
FT                   4-benzoquinol methylase"
FT                   /note="COG2227
FT                   2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00216"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03337"
FT                   /db_xref="GOA:D7BWI1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWI1"
FT                   /protein_id="ADI03337.1"
FT   gene            236927..237817
FT                   /locus_tag="SBI_00217"
FT   CDS_pept        236927..237817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00217"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /note="COG1575 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00217"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03338"
FT                   /db_xref="GOA:D7BWI2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWI2"
FT                   /protein_id="ADI03338.1"
FT                   LLLVFGALLAIGLAR"
FT   gene            237838..239328
FT                   /locus_tag="SBI_00218"
FT   CDS_pept        237838..239328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00218"
FT                   /product="monooxygenase"
FT                   /note="COG2072 Predicted flavoprotein involved in K+
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00218"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03339"
FT                   /db_xref="GOA:D7BWI3"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWI3"
FT                   /protein_id="ADI03339.1"
FT   gene            239330..239755
FT                   /locus_tag="SBI_00219"
FT   CDS_pept        239330..239755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00219"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03340"
FT                   /db_xref="GOA:D7BWI4"
FT                   /db_xref="InterPro:IPR021362"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWI4"
FT                   /protein_id="ADI03340.1"
FT   gene            239745..241688
FT                   /locus_tag="SBI_00220"
FT   CDS_pept        239745..241688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00220"
FT                   /product="putative squalene-hopene cyclase"
FT                   /note="COG1657 Squalene cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03341"
FT                   /db_xref="GOA:D7BWI5"
FT                   /db_xref="InterPro:IPR006400"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR018333"
FT                   /db_xref="InterPro:IPR032696"
FT                   /db_xref="InterPro:IPR032697"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWI5"
FT                   /protein_id="ADI03341.1"
FT                   DGSARADGTEWR"
FT   gene            241685..243181
FT                   /locus_tag="SBI_00221"
FT   CDS_pept        241685..243181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00221"
FT                   /product="hypothetical protein"
FT                   /note="COG3349 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00221"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03342"
FT                   /db_xref="GOA:D7BWI6"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWI6"
FT                   /protein_id="ADI03342.1"
FT   gene            243217..244602
FT                   /gene="cyp4"
FT                   /locus_tag="SBI_00222"
FT   CDS_pept        243217..244602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp4"
FT                   /locus_tag="SBI_00222"
FT                   /product="cytochrome P450"
FT                   /note="COG2124 Cytochrome P450, CYP183E1"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00222"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03343"
FT                   /db_xref="GOA:D7BWI7"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWI7"
FT                   /protein_id="ADI03343.1"
FT                   RVP"
FT   gene            complement(244588..244785)
FT                   /locus_tag="SBI_00223"
FT   CDS_pept        complement(244588..244785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00223"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03344"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWI8"
FT                   /protein_id="ADI03344.1"
FT   gene            complement(244785..245873)
FT                   /locus_tag="SBI_00224"
FT   CDS_pept        complement(244785..245873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00224"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03345"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWI9"
FT                   /protein_id="ADI03345.1"
FT   gene            complement(245879..246922)
FT                   /locus_tag="SBI_00225"
FT   CDS_pept        complement(245879..246922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03346"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ0"
FT                   /protein_id="ADI03346.1"
FT                   IRVDPVA"
FT   gene            complement(247020..247943)
FT                   /locus_tag="SBI_00226"
FT   CDS_pept        complement(247020..247943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00226"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03347"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ1"
FT                   /protein_id="ADI03347.1"
FT   gene            complement(247945..249102)
FT                   /locus_tag="SBI_00227"
FT   CDS_pept        complement(247945..249102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00227"
FT                   /product="hypothetical protein"
FT                   /note="COG5412 Phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00227"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03348"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ2"
FT                   /protein_id="ADI03348.1"
FT   gene            complement(249126..249707)
FT                   /locus_tag="SBI_00228"
FT   CDS_pept        complement(249126..249707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00228"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03349"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ3"
FT                   /protein_id="ADI03349.1"
FT   gene            complement(249739..250128)
FT                   /locus_tag="SBI_00229"
FT   CDS_pept        complement(249739..250128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00229"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03350"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ4"
FT                   /protein_id="ADI03350.1"
FT   gene            complement(250143..250433)
FT                   /locus_tag="SBI_00230"
FT   CDS_pept        complement(250143..250433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03351"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ5"
FT                   /protein_id="ADI03351.1"
FT   gene            complement(250504..251079)
FT                   /locus_tag="SBI_00231"
FT   CDS_pept        complement(250504..251079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00231"
FT                   /product="hypothetical protein"
FT                   /note="COG4147 Predicted symporter"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00231"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03352"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ6"
FT                   /protein_id="ADI03352.1"
FT   gene            complement(251127..251534)
FT                   /locus_tag="SBI_00232"
FT   CDS_pept        complement(251127..251534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00232"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03353"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ7"
FT                   /protein_id="ADI03353.1"
FT   gene            complement(251701..251898)
FT                   /locus_tag="SBI_00233"
FT   CDS_pept        complement(251701..251898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00233"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03354"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ8"
FT                   /protein_id="ADI03354.1"
FT   gene            complement(251895..252389)
FT                   /locus_tag="SBI_00234"
FT   CDS_pept        complement(251895..252389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00234"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03355"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ9"
FT                   /protein_id="ADI03355.1"
FT                   R"
FT   gene            252750..252968
FT                   /locus_tag="SBI_00235"
FT   CDS_pept        252750..252968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03356"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWK0"
FT                   /protein_id="ADI03356.1"
FT   gene            253201..257670
FT                   /locus_tag="SBI_00236"
FT   CDS_pept        253201..257670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00236"
FT                   /product="Calcium-transporting ATPase"
FT                   /note="COG2217 Cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00236"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03357"
FT                   /db_xref="GOA:D7BWK1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWK1"
FT                   /protein_id="ADI03357.1"
FT   gene            257696..257827
FT                   /locus_tag="SBI_00237"
FT   CDS_pept        257696..257827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00237"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03358"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWK2"
FT                   /protein_id="ADI03358.1"
FT   gene            complement(257856..258875)
FT                   /locus_tag="SBI_00238"
FT   CDS_pept        complement(257856..258875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00238"
FT                   /product="sugar kinase, ribokinase"
FT                   /note="COG0524 Sugar kinases, ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00238"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03359"
FT                   /db_xref="GOA:D7BWK3"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWK3"
FT                   /protein_id="ADI03359.1"
FT   gene            complement(258872..260365)
FT                   /locus_tag="SBI_00239"
FT   CDS_pept        complement(258872..260365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00239"
FT                   /product="putative transmembrane protein"
FT                   /note="COG1457 Purine-cytosine permease and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00239"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03360"
FT                   /db_xref="GOA:D7BWK4"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWK4"
FT                   /protein_id="ADI03360.1"
FT   gene            complement(260468..261475)
FT                   /locus_tag="SBI_00240"
FT   CDS_pept        complement(260468..261475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00240"
FT                   /product="ADP-ribosylglycohydrolase"
FT                   /note="COG1397 ADP-ribosylglycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03361"
FT                   /db_xref="GOA:D7BWK5"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWK5"
FT                   /protein_id="ADI03361.1"
FT   gene            complement(261535..262251)
FT                   /locus_tag="SBI_00241"
FT   CDS_pept        complement(261535..262251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00241"
FT                   /product="transcription regulator"
FT                   /note="COG2188 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00241"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03362"
FT                   /db_xref="GOA:D7BWK6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWK6"
FT                   /protein_id="ADI03362.1"
FT                   DPGRFQLHLGFGEQPQ"
FT   gene            262436..263917
FT                   /locus_tag="SBI_00242"
FT   CDS_pept        262436..263917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00242"
FT                   /product="short chain fatty acid transporter"
FT                   /note="COG2031 Short chain fatty acids transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00242"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03363"
FT                   /db_xref="GOA:D7BWK7"
FT                   /db_xref="InterPro:IPR006160"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWK7"
FT                   /protein_id="ADI03363.1"
FT   gene            264103..265104
FT                   /locus_tag="SBI_00243"
FT   CDS_pept        264103..265104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00243"
FT                   /product="hypothetical protein"
FT                   /note="COG4326 Sporulation control protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00243"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03364"
FT                   /db_xref="InterPro:IPR009776"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWK8"
FT                   /protein_id="ADI03364.1"
FT   gene            265450..266337
FT                   /gene="terD1"
FT                   /locus_tag="SBI_00244"
FT   CDS_pept        265450..266337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terD1"
FT                   /locus_tag="SBI_00244"
FT                   /product="putative tellurium resistance protein"
FT                   /note="COG3793 Tellurite resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00244"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03365"
FT                   /db_xref="GOA:D7BWK9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWK9"
FT                   /protein_id="ADI03365.1"
FT                   LSPSAPQDTRTPQS"
FT   gene            complement(266344..268743)
FT                   /gene="bga1"
FT                   /locus_tag="SBI_00245"
FT   CDS_pept        complement(266344..268743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bga1"
FT                   /locus_tag="SBI_00245"
FT                   /product="beta-galactosidase"
FT                   /note="COG1874 Beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00245"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03366"
FT                   /db_xref="GOA:D7BWL0"
FT                   /db_xref="InterPro:IPR001944"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031330"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWL0"
FT                   /protein_id="ADI03366.1"
FT   gene            269076..272450
FT                   /locus_tag="SBI_00246"
FT   CDS_pept        269076..272450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00246"
FT                   /product="pyruvate carboxylase"
FT                   /EC_number=""
FT                   /note="COG1038 Pyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00246"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03367"
FT                   /db_xref="GOA:D7BWL1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWL1"
FT                   /protein_id="ADI03367.1"
FT                   ISPVQQVEGGDLLVELG"
FT   gene            complement(272492..272875)
FT                   /locus_tag="SBI_00247"
FT   CDS_pept        complement(272492..272875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00247"
FT                   /product="hypothetical protein"
FT                   /note="COG1733 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00247"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03368"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWL2"
FT                   /protein_id="ADI03368.1"
FT   gene            272976..273383
FT                   /locus_tag="SBI_00248"
FT   CDS_pept        272976..273383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00248"
FT                   /product="hypothetical protein"
FT                   /note="COG0251 Putative translation initiation inhibitor,
FT                   yjgF family"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00248"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03369"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWL3"
FT                   /protein_id="ADI03369.1"
FT   gene            complement(273482..274630)
FT                   /gene="cyp5"
FT                   /locus_tag="SBI_00249"
FT   CDS_pept        complement(273482..274630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp5"
FT                   /locus_tag="SBI_00249"
FT                   /product="putative cytochrome P450"
FT                   /note="COG2124 Cytochrome P450, CYP143C1"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00249"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03370"
FT                   /db_xref="GOA:D7BWL4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWL4"
FT                   /protein_id="ADI03370.1"
FT   gene            complement(274786..276009)
FT                   /gene="cyp6"
FT                   /locus_tag="SBI_00250"
FT   CDS_pept        complement(274786..276009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp6"
FT                   /locus_tag="SBI_00250"
FT                   /product="cytochrome P450"
FT                   /note="COG2124 Cytochrome P450, CYP1031A2"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03371"
FT                   /db_xref="GOA:D7BWL5"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWL5"
FT                   /protein_id="ADI03371.1"
FT                   AARLPVRV"
FT   gene            276752..277918
FT                   /locus_tag="SBI_00251"
FT   CDS_pept        276752..277918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00251"
FT                   /product="hypothetical protein"
FT                   /note="COG1835 Predicted acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00251"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03372"
FT                   /db_xref="GOA:D7BWL6"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWL6"
FT                   /protein_id="ADI03372.1"
FT   gene            278223..279422
FT                   /locus_tag="SBI_00252"
FT   CDS_pept        278223..279422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00252"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00252"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03373"
FT                   /db_xref="GOA:D7BWL7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWL7"
FT                   /protein_id="ADI03373.1"
FT                   "
FT   gene            complement(279515..280708)
FT                   /locus_tag="SBI_00253"
FT   CDS_pept        complement(279515..280708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00253"
FT                   /product="putative acetylornithine deacetylase"
FT                   /note="COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00253"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03374"
FT                   /db_xref="GOA:D7BWL8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWL8"
FT                   /protein_id="ADI03374.1"
FT   gene            complement(280824..282089)
FT                   /locus_tag="SBI_00254"
FT   CDS_pept        complement(280824..282089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00254"
FT                   /product="allantoate amidohydrolase"
FT                   /note="COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00254"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03375"
FT                   /db_xref="GOA:D7BWL9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWL9"
FT                   /protein_id="ADI03375.1"
FT   gene            complement(282199..283320)
FT                   /locus_tag="SBI_00255"
FT   CDS_pept        complement(282199..283320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00255"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="COG1171 Threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03376"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWM0"
FT                   /protein_id="ADI03376.1"
FT   gene            283419..284363
FT                   /locus_tag="SBI_00256"
FT   CDS_pept        283419..284363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00256"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00256"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03377"
FT                   /db_xref="GOA:D7BWM1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWM1"
FT                   /protein_id="ADI03377.1"
FT   gene            284471..284977
FT                   /locus_tag="SBI_00257"
FT   CDS_pept        284471..284977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00257"
FT                   /product="hypothetical protein"
FT                   /note="COG2128 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00257"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03378"
FT                   /db_xref="GOA:D7BWM2"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWM2"
FT                   /protein_id="ADI03378.1"
FT                   TDPWK"
FT   gene            285099..285266
FT                   /locus_tag="SBI_00258"
FT   CDS_pept        285099..285266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00258"
FT                   /product="hypothetical protein"
FT                   /note="COG5515 Uncharacterized conserved small protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00258"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03379"
FT                   /db_xref="InterPro:IPR013619"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWM3"
FT                   /protein_id="ADI03379.1"
FT                   QALIWPTRVR"
FT   gene            complement(285295..285417)
FT                   /locus_tag="SBI_00259"
FT   CDS_pept        complement(285295..285417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00259"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03380"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWM4"
FT                   /protein_id="ADI03380.1"
FT   gene            complement(285555..286811)
FT                   /locus_tag="SBI_00260"
FT   CDS_pept        complement(285555..286811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00260"
FT                   /product="hypothetical protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03381"
FT                   /db_xref="GOA:D7BWM5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWM5"
FT                   /protein_id="ADI03381.1"
FT   gene            complement(286993..287766)
FT                   /locus_tag="SBI_00261"
FT   CDS_pept        complement(286993..287766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00261"
FT                   /product="Zn-dependent hydrolase of the beta-lactamase
FT                   fold-like protein"
FT                   /note="COG2220 Predicted Zn-dependent hydrolases of the
FT                   beta-lactamase fold"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00261"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03382"
FT                   /db_xref="GOA:D7BWM6"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWM6"
FT                   /protein_id="ADI03382.1"
FT   gene            287867..288463
FT                   /locus_tag="SBI_00262"
FT   CDS_pept        287867..288463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00262"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03383"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWM7"
FT                   /protein_id="ADI03383.1"
FT   gene            complement(288664..289593)
FT                   /locus_tag="SBI_00263"
FT   CDS_pept        complement(288664..289593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00263"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00263"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03384"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWM8"
FT                   /protein_id="ADI03384.1"
FT   gene            complement(289641..290447)
FT                   /locus_tag="SBI_00264"
FT   CDS_pept        complement(289641..290447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00264"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00264"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03385"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWM9"
FT                   /protein_id="ADI03385.1"
FT   gene            290600..291535
FT                   /locus_tag="SBI_00265"
FT   CDS_pept        290600..291535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00265"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03386"
FT                   /db_xref="GOA:D7BWN0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWN0"
FT                   /protein_id="ADI03386.1"
FT   gene            complement(291783..293237)
FT                   /locus_tag="SBI_00266"
FT   CDS_pept        complement(291783..293237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00266"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily
FT                   protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00266"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03387"
FT                   /db_xref="GOA:D7BWN1"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWN1"
FT                   /protein_id="ADI03387.1"
FT   gene            293452..293739
FT                   /locus_tag="SBI_00267"
FT   CDS_pept        293452..293739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00267"
FT                   /product="ArsR family transcriptional regulator"
FT                   /note="COG0640 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00267"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03388"
FT                   /db_xref="GOA:D7BWN2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWN2"
FT                   /protein_id="ADI03388.1"
FT   gene            complement(293900..294763)
FT                   /locus_tag="SBI_00268"
FT   CDS_pept        complement(293900..294763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00268"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03389"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWN3"
FT                   /protein_id="ADI03389.1"
FT                   DAHDDA"
FT   gene            complement(294837..295247)
FT                   /locus_tag="SBI_00269"
FT   CDS_pept        complement(294837..295247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00269"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWN4"
FT                   /protein_id="ADI03390.1"
FT   gene            complement(295419..296336)
FT                   /gene="sig1"
FT                   /locus_tag="SBI_00270"
FT   CDS_pept        complement(295419..296336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sig1"
FT                   /locus_tag="SBI_00270"
FT                   /product="ECF subfamily RNA polymerase sigma factor"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03391"
FT                   /db_xref="GOA:D7BWN5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWN5"
FT                   /protein_id="ADI03391.1"
FT   gene            complement(296449..297666)
FT                   /locus_tag="SBI_00271"
FT   CDS_pept        complement(296449..297666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00271"
FT                   /product="flavohemoprotein"
FT                   /note="COG1017 Hemoglobin-like flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00271"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03392"
FT                   /db_xref="GOA:D7BWN6"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWN6"
FT                   /protein_id="ADI03392.1"
FT                   DLWLSK"
FT   gene            complement(297775..298221)
FT                   /locus_tag="SBI_00272"
FT   CDS_pept        complement(297775..298221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00272"
FT                   /product="hypothetical protein"
FT                   /note="COG1959 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00272"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03393"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWN7"
FT                   /protein_id="ADI03393.1"
FT   gene            298406..299695
FT                   /locus_tag="SBI_00273"
FT   CDS_pept        298406..299695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00273"
FT                   /product="secreted solute-binding lipoprotein"
FT                   /note="COG1653 ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00273"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03394"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWN8"
FT                   /protein_id="ADI03394.1"
FT   gene            299745..300683
FT                   /locus_tag="SBI_00274"
FT   CDS_pept        299745..300683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00274"
FT                   /product="binding-protein dependent transport protein"
FT                   /note="COG1175 ABC-type sugar transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00274"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03395"
FT                   /db_xref="GOA:D7BWN9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWN9"
FT                   /protein_id="ADI03395.1"
FT   gene            300698..301525
FT                   /locus_tag="SBI_00275"
FT   CDS_pept        300698..301525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00275"
FT                   /product="binding-protein dependent transport protein"
FT                   /note="COG0395 ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03396"
FT                   /db_xref="GOA:D7BWP0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWP0"
FT                   /protein_id="ADI03396.1"
FT   gene            301522..302601
FT                   /locus_tag="SBI_00276"
FT   CDS_pept        301522..302601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00276"
FT                   /product="LacI family transcriptional regulator"
FT                   /note="COG1609 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00276"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03397"
FT                   /db_xref="GOA:D7BWP1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWP1"
FT                   /protein_id="ADI03397.1"
FT   gene            302676..304619
FT                   /locus_tag="SBI_00277"
FT   CDS_pept        302676..304619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00277"
FT                   /product="hypothetical protein"
FT                   /note="COG3934 Endo-beta-mannanase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00277"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03398"
FT                   /db_xref="GOA:D7BWP2"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWP2"
FT                   /protein_id="ADI03398.1"
FT                   YGVCVLELKCWS"
FT   gene            304607..306901
FT                   /locus_tag="SBI_00278"
FT   CDS_pept        304607..306901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00278"
FT                   /product="Beta-glucosidase"
FT                   /note="COG1472 Beta-glucosidase-related glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00278"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03399"
FT                   /db_xref="GOA:D7BWP3"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWP3"
FT                   /protein_id="ADI03399.1"
FT                   QGARLVIASSG"
FT   gene            complement(306966..307424)
FT                   /locus_tag="SBI_00279"
FT   CDS_pept        complement(306966..307424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00279"
FT                   /product="ROK family protein"
FT                   /note="COG1940 Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00279"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03400"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWP4"
FT                   /protein_id="ADI03400.1"
FT   gene            307755..307997
FT                   /locus_tag="SBI_00280"
FT   CDS_pept        307755..307997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00280"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="COG0235 Ribulose-5-phosphate 4-epimerase and related
FT                   epimerases and aldolases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03401"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWP5"
FT                   /protein_id="ADI03401.1"
FT   gene            complement(307989..308582)
FT                   /locus_tag="SBI_00281"
FT   CDS_pept        complement(307989..308582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00281"
FT                   /product="putative TetR family regulator"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00281"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03402"
FT                   /db_xref="GOA:D7BWP6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWP6"
FT                   /protein_id="ADI03402.1"
FT   gene            308872..310002
FT                   /locus_tag="SBI_00282"
FT   CDS_pept        308872..310002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00282"
FT                   /product="putative oxidoreductase transmembrane protein"
FT                   /note="COG0654 2-polyprenyl-6-methoxyphenol hydroxylase and
FT                   related FAD-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00282"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03403"
FT                   /db_xref="GOA:D7BWP7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWP7"
FT                   /protein_id="ADI03403.1"
FT   gene            310170..311573
FT                   /locus_tag="SBI_00283"
FT   CDS_pept        310170..311573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00283"
FT                   /product="putative transport integral membrane protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00283"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03404"
FT                   /db_xref="GOA:D7BWP8"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWP8"
FT                   /protein_id="ADI03404.1"
FT                   AAAAPVVHM"
FT   gene            complement(311503..314082)
FT                   /locus_tag="SBI_00284"
FT   CDS_pept        complement(311503..314082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00284"
FT                   /product="ATPase P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="COG0474 Cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00284"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03405"
FT                   /db_xref="GOA:D7BWP9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWP9"
FT                   /protein_id="ADI03405.1"
FT   gene            314273..316723
FT                   /locus_tag="SBI_00285"
FT   CDS_pept        314273..316723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00285"
FT                   /product="hypothetical protein"
FT                   /note="COG1554 Trehalose and maltose hydrolases (possible
FT                   phosphorylases)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03406"
FT                   /db_xref="GOA:D7BWQ0"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ0"
FT                   /protein_id="ADI03406.1"
FT                   TAYP"
FT   gene            complement(316779..317654)
FT                   /locus_tag="SBI_00286"
FT   CDS_pept        complement(316779..317654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00286"
FT                   /product="hypothetical protein"
FT                   /note="COG0589 Universal stress protein UspA and related
FT                   nucleotide-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00286"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03407"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ1"
FT                   /protein_id="ADI03407.1"
FT                   RCPVAVVPHE"
FT   gene            317783..318970
FT                   /locus_tag="SBI_00287"
FT   CDS_pept        317783..318970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00287"
FT                   /product="hypothetical protein"
FT                   /note="COG0778 Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00287"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03408"
FT                   /db_xref="GOA:D7BWQ2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR015035"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ2"
FT                   /protein_id="ADI03408.1"
FT   gene            319173..320906
FT                   /locus_tag="SBI_00288"
FT   CDS_pept        319173..320906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00288"
FT                   /product="amino acid permease"
FT                   /note="COG0531 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00288"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03409"
FT                   /db_xref="GOA:D7BWQ3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ3"
FT                   /protein_id="ADI03409.1"
FT                   M"
FT   gene            321399..321635
FT                   /locus_tag="SBI_00289"
FT   CDS_pept        321399..321635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00289"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03410"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ4"
FT                   /protein_id="ADI03410.1"
FT   gene            322119..322640
FT                   /locus_tag="SBI_00290"
FT   CDS_pept        322119..322640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03411"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ5"
FT                   /protein_id="ADI03411.1"
FT                   DAAKTVPPDA"
FT   gene            complement(322661..325210)
FT                   /locus_tag="SBI_00291"
FT   CDS_pept        complement(322661..325210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00291"
FT                   /product="two-component system sensor kinase for
FT                   high-affinity potassium transport system"
FT                   /note="COG2205 Osmosensitive K+ channel histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00291"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03412"
FT                   /db_xref="GOA:D7BWQ6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ6"
FT                   /protein_id="ADI03412.1"
FT   gene            complement(325271..325954)
FT                   /locus_tag="SBI_00292"
FT   CDS_pept        complement(325271..325954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00292"
FT                   /product="putative two-component system response regulator"
FT                   /note="COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00292"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03413"
FT                   /db_xref="GOA:D7BWQ7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ7"
FT                   /protein_id="ADI03413.1"
FT                   YRFEE"
FT   gene            complement(326079..326747)
FT                   /locus_tag="SBI_00293"
FT   CDS_pept        complement(326079..326747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00293"
FT                   /product="potassium-transporting ATPase subunit C"
FT                   /EC_number=""
FT                   /note="COG2156 K+-transporting ATPase, c chain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00293"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03414"
FT                   /db_xref="GOA:D7BWQ8"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ8"
FT                   /protein_id="ADI03414.1"
FT                   "
FT   gene            complement(326753..328885)
FT                   /locus_tag="SBI_00294"
FT   CDS_pept        complement(326753..328885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00294"
FT                   /product="potassium-transporting ATPase subunit B"
FT                   /EC_number=""
FT                   /note="COG2216 High-affinity K+ transport system, ATPase
FT                   chain B"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00294"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03415"
FT                   /db_xref="GOA:D7BWQ9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ9"
FT                   /protein_id="ADI03415.1"
FT                   GIKIIDLLISLIPGIG"
FT   gene            complement(328882..330546)
FT                   /locus_tag="SBI_00295"
FT   CDS_pept        complement(328882..330546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00295"
FT                   /product="potassium-transporting ATPase subunit A"
FT                   /EC_number=""
FT                   /note="COG2060 K+-transporting ATPase, A chain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03416"
FT                   /db_xref="GOA:D7BWR0"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR0"
FT                   /protein_id="ADI03416.1"
FT   gene            complement(330868..332709)
FT                   /locus_tag="SBI_00296"
FT   CDS_pept        complement(330868..332709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00296"
FT                   /product="putative aminoacid/polyamine transporter,
FT                   permease protein"
FT                   /note="COG0531 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00296"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03417"
FT                   /db_xref="GOA:D7BWR1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR1"
FT                   /protein_id="ADI03417.1"
FT   gene            complement(332977..335448)
FT                   /locus_tag="SBI_00297"
FT   CDS_pept        complement(332977..335448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00297"
FT                   /product="Osmosensitive K channel His kinase sensor"
FT                   /note="COG2205 Osmosensitive K+ channel histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00297"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03418"
FT                   /db_xref="GOA:D7BWR2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR2"
FT                   /protein_id="ADI03418.1"
FT                   LPFAERTVYSR"
FT   gene            complement(335841..336281)
FT                   /locus_tag="SBI_00298"
FT   CDS_pept        complement(335841..336281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00298"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03419"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR3"
FT                   /protein_id="ADI03419.1"
FT   gene            complement(336542..337480)
FT                   /locus_tag="SBI_00299"
FT   CDS_pept        complement(336542..337480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00299"
FT                   /product="band 7 family protein"
FT                   /note="COG0330 Membrane protease subunits,
FT                   stomatin/prohibitin homologs"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00299"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03420"
FT                   /db_xref="GOA:D7BWR4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR4"
FT                   /protein_id="ADI03420.1"
FT   gene            337726..338181
FT                   /locus_tag="SBI_00300"
FT   CDS_pept        337726..338181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03421"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR5"
FT                   /protein_id="ADI03421.1"
FT   gene            338226..340292
FT                   /locus_tag="SBI_00301"
FT   CDS_pept        338226..340292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00301"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03422"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR6"
FT                   /protein_id="ADI03422.1"
FT   gene            340467..341627
FT                   /locus_tag="SBI_00302"
FT   CDS_pept        340467..341627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00302"
FT                   /product="hypothetical protein"
FT                   /note="COG3211 Predicted phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00302"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03423"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR7"
FT                   /protein_id="ADI03423.1"
FT   gene            complement(341701..343002)
FT                   /locus_tag="SBI_00303"
FT   CDS_pept        complement(341701..343002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00303"
FT                   /product="membrane transport protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00303"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03424"
FT                   /db_xref="GOA:D7BWR8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR8"
FT                   /protein_id="ADI03424.1"
FT   gene            complement(342999..344099)
FT                   /locus_tag="SBI_00304"
FT   CDS_pept        complement(342999..344099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00304"
FT                   /product="cysteine synthase A"
FT                   /note="COG0031 Cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00304"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03425"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR9"
FT                   /protein_id="ADI03425.1"
FT   gene            complement(344233..344577)
FT                   /locus_tag="SBI_00305"
FT   CDS_pept        complement(344233..344577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03426"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWS0"
FT                   /protein_id="ADI03426.1"
FT                   RLTVVCRWRI"
FT   gene            complement(344873..345334)
FT                   /locus_tag="SBI_00306"
FT   CDS_pept        complement(344873..345334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00306"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03427"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWS1"
FT                   /protein_id="ADI03427.1"
FT   gene            complement(345476..347098)
FT                   /locus_tag="SBI_00307"
FT   CDS_pept        complement(345476..347098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00307"
FT                   /product="putative multicopper oxidase"
FT                   /note="COG2132 Putative multicopper oxidases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00307"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03428"
FT                   /db_xref="GOA:D7BWS2"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWS2"
FT                   /protein_id="ADI03428.1"
FT   gene            347405..347539
FT                   /locus_tag="SBI_00308"
FT   CDS_pept        347405..347539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00308"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03429"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWS3"
FT                   /protein_id="ADI03429.1"
FT   gene            complement(347711..349147)
FT                   /locus_tag="SBI_00309"
FT   CDS_pept        complement(347711..349147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00309"
FT                   /product="permease of the major facilitator superfamily
FT                   protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00309"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03430"
FT                   /db_xref="GOA:D7BWS4"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWS4"
FT                   /protein_id="ADI03430.1"
FT   gene            349302..349967
FT                   /locus_tag="SBI_00310"
FT   CDS_pept        349302..349967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00310"
FT                   /product="transcriptional regulator"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03431"
FT                   /db_xref="GOA:D7BWS5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWS5"
FT                   /protein_id="ADI03431.1"
FT   gene            complement(350056..353535)
FT                   /locus_tag="SBI_00311"
FT   CDS_pept        complement(350056..353535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00311"
FT                   /product="putative NRPS"
FT                   /note="COG1020 Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00311"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03432"
FT                   /db_xref="GOA:D7BWS6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWS6"
FT                   /protein_id="ADI03432.1"
FT   gene            complement(353749..356748)
FT                   /locus_tag="SBI_00312"
FT   CDS_pept        complement(353749..356748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00312"
FT                   /product="putative NRPS"
FT                   /note="COG1020 Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00312"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03433"
FT                   /db_xref="GOA:D7BWS7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWS7"
FT                   /protein_id="ADI03433.1"
FT                   PKGVLVETGM"
FT   gene            complement(356732..367279)
FT                   /gene="pks1-1"
FT                   /locus_tag="SBI_00313"
FT   CDS_pept        complement(356732..367279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pks1-1"
FT                   /locus_tag="SBI_00313"
FT                   /product="modular polyketide synthase"
FT                   /note="COG3321 Polyketide synthase modules and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00313"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03434"
FT                   /db_xref="GOA:D7BWS8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWS8"
FT                   /protein_id="ADI03434.1"
FT   gene            complement(367641..368693)
FT                   /locus_tag="SBI_00314"
FT   CDS_pept        complement(367641..368693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00314"
FT                   /product="putative 3-oxoacyl-ACP synthase III"
FT                   /note="COG0332 3-oxoacyl-[acyl-carrier-protein] synthase
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00314"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03435"
FT                   /db_xref="GOA:D7BWS9"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWS9"
FT                   /protein_id="ADI03435.1"
FT                   AEPEWPEESG"
FT   gene            complement(368889..369665)
FT                   /locus_tag="SBI_00315"
FT   CDS_pept        complement(368889..369665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00315"
FT                   /product="putative oxidoreductase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03436"
FT                   /db_xref="GOA:D7BWT0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWT0"
FT                   /protein_id="ADI03436.1"
FT   gene            369886..370617
FT                   /locus_tag="SBI_00316"
FT   CDS_pept        369886..370617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00316"
FT                   /product="hypothetical protein"
FT                   /note="COG1073 Hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00316"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03437"
FT                   /db_xref="GOA:D7BWT1"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWT1"
FT                   /protein_id="ADI03437.1"
FT   gene            370768..372984
FT                   /locus_tag="SBI_00317"
FT   CDS_pept        370768..372984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00317"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COG0515 Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00317"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03438"
FT                   /db_xref="GOA:D7BWT2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWT2"
FT                   /protein_id="ADI03438.1"
FT   gene            complement(373001..374830)
FT                   /locus_tag="SBI_00318"
FT   CDS_pept        complement(373001..374830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00318"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="COG3573 Predicted oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00318"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03439"
FT                   /db_xref="GOA:D7BYB1"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014614"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYB1"
FT                   /protein_id="ADI03439.1"
FT   gene            375188..381421
FT                   /gene="pks1-2"
FT                   /locus_tag="SBI_00319"
FT   CDS_pept        375188..381421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pks1-2"
FT                   /locus_tag="SBI_00319"
FT                   /product="modular polyketide synthase"
FT                   /note="COG3321 Polyketide synthase modules and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00319"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03440"
FT                   /db_xref="GOA:D7BYB2"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYB2"
FT                   /protein_id="ADI03440.1"
FT   gene            381414..383888
FT                   /locus_tag="SBI_00320"
FT   CDS_pept        381414..383888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00320"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="COG0764 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03441"
FT                   /db_xref="GOA:D7BYB3"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYB3"
FT                   /protein_id="ADI03441.1"
FT                   PTGGAAEGQVPR"
FT   gene            383885..385453
FT                   /locus_tag="SBI_00321"
FT   CDS_pept        383885..385453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00321"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /note="COG2070 Dioxygenases related to 2-nitropropane
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00321"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03442"
FT                   /db_xref="GOA:D7BYB4"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014179"
FT                   /db_xref="InterPro:IPR040981"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYB4"
FT                   /protein_id="ADI03442.1"
FT                   VPATP"
FT   gene            complement(385564..386403)
FT                   /locus_tag="SBI_00322"
FT   CDS_pept        complement(385564..386403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00322"
FT                   /product="hypothetical protein"
FT                   /note="COG0702 Predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00322"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03443"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYB5"
FT                   /protein_id="ADI03443.1"
FT   gene            386496..386861
FT                   /locus_tag="SBI_00323"
FT   CDS_pept        386496..386861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00323"
FT                   /product="hypothetical protein"
FT                   /note="COG1733 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00323"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03444"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYB6"
FT                   /protein_id="ADI03444.1"
FT                   PLTELFDRITRRLPPRP"
FT   gene            387147..387581
FT                   /locus_tag="SBI_00324"
FT   CDS_pept        387147..387581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00324"
FT                   /product="hypothetical protein"
FT                   /note="COG1917 Uncharacterized conserved protein, contains
FT                   double-stranded beta-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00324"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03445"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYB7"
FT                   /protein_id="ADI03445.1"
FT   gene            complement(387694..388167)
FT                   /locus_tag="SBI_00325"
FT   CDS_pept        complement(387694..388167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00325"
FT                   /product="hypothetical protein"
FT                   /note="COG2128 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00325"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03446"
FT                   /db_xref="GOA:D7BYB8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYB8"
FT                   /protein_id="ADI03446.1"
FT   gene            388713..389039
FT                   /locus_tag="SBI_00326"
FT   CDS_pept        388713..389039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00326"
FT                   /product="hydroperoxide resistance protein"
FT                   /note="COG1764 Predicted redox protein, regulator of
FT                   disulfide bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00326"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03447"
FT                   /db_xref="GOA:D7BYB9"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYB9"
FT                   /protein_id="ADI03447.1"
FT                   TLAS"
FT   gene            complement(389123..389506)
FT                   /locus_tag="SBI_00327"
FT   CDS_pept        complement(389123..389506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00327"
FT                   /product="ferredoxin"
FT                   /note="COG1146 Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00327"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03448"
FT                   /db_xref="GOA:D7BYC0"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYC0"
FT                   /protein_id="ADI03448.1"
FT   gene            389729..390961
FT                   /locus_tag="SBI_00328"
FT   CDS_pept        389729..390961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00328"
FT                   /product="ferredoxin reductase"
FT                   /note="COG0446 Uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00328"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03449"
FT                   /db_xref="GOA:D7BYC1"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYC1"
FT                   /protein_id="ADI03449.1"
FT                   DPDVPLDRIRP"
FT   gene            391044..392768
FT                   /locus_tag="SBI_00329"
FT   CDS_pept        391044..392768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00329"
FT                   /product="succinate dehydrogenase flavoprotein subunit"
FT                   /note="COG1053 Succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00329"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03450"
FT                   /db_xref="GOA:D7BYC2"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYC2"
FT                   /protein_id="ADI03450.1"
FT   gene            392942..393676
FT                   /locus_tag="SBI_00330"
FT   CDS_pept        392942..393676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00330"
FT                   /product="hypothetical protein"
FT                   /note="COG0702 Predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03451"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYC3"
FT                   /protein_id="ADI03451.1"
FT   gene            393585..394850
FT                   /locus_tag="SBI_00331"
FT   CDS_pept        393585..394850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00331"
FT                   /product="putative transmembrane efflux protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00331"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03452"
FT                   /db_xref="GOA:D7BYC4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYC4"
FT                   /protein_id="ADI03452.1"
FT   gene            394892..395635
FT                   /locus_tag="SBI_00332"
FT   CDS_pept        394892..395635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00332"
FT                   /product="hypothetical protein"
FT                   /note="COG2120 Uncharacterized proteins, LmbE homologs"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00332"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03453"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYC5"
FT                   /protein_id="ADI03453.1"
FT   gene            complement(395669..396634)
FT                   /locus_tag="SBI_00333"
FT   CDS_pept        complement(395669..396634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00333"
FT                   /product="dioxygenase"
FT                   /note="COG2070 Dioxygenases related to 2-nitropropane
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00333"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03454"
FT                   /db_xref="GOA:D7BYC6"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYC6"
FT                   /protein_id="ADI03454.1"
FT   gene            complement(396785..397258)
FT                   /locus_tag="SBI_00334"
FT   CDS_pept        complement(396785..397258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00334"
FT                   /product="hypothetical protein"
FT                   /note="COG2128 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00334"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03455"
FT                   /db_xref="GOA:D7BYC7"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYC7"
FT                   /protein_id="ADI03455.1"
FT   gene            complement(397383..399056)
FT                   /locus_tag="SBI_00335"
FT   CDS_pept        complement(397383..399056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00335"
FT                   /product="cytochrome B subunit"
FT                   /note="COG1290 Cytochrome b subunit of the bc complex"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03456"
FT                   /db_xref="GOA:D7BYC8"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYC8"
FT                   /protein_id="ADI03456.1"
FT   gene            complement(399175..399405)
FT                   /locus_tag="SBI_00336"
FT   CDS_pept        complement(399175..399405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00336"
FT                   /product="transcription factor WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00336"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03457"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYC9"
FT                   /protein_id="ADI03457.1"
FT   gene            399584..400495
FT                   /gene="sig2"
FT                   /locus_tag="SBI_00337"
FT   CDS_pept        399584..400495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sig2"
FT                   /locus_tag="SBI_00337"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00337"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03458"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD0"
FT                   /protein_id="ADI03458.1"
FT   gene            complement(400537..401454)
FT                   /gene="sig3"
FT                   /locus_tag="SBI_00338"
FT   CDS_pept        complement(400537..401454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sig3"
FT                   /locus_tag="SBI_00338"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00338"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03459"
FT                   /db_xref="GOA:D7BYD1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD1"
FT                   /protein_id="ADI03459.1"
FT   gene            401838..402176
FT                   /locus_tag="SBI_00339"
FT   CDS_pept        401838..402176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00339"
FT                   /product="hypothetical protein"
FT                   /note="COG1917 Uncharacterized conserved protein, contains
FT                   double-stranded beta-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00339"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03460"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD2"
FT                   /protein_id="ADI03460.1"
FT                   PNPGCDFQ"
FT   gene            402315..402503
FT                   /locus_tag="SBI_00340"
FT   CDS_pept        402315..402503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03461"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD3"
FT                   /protein_id="ADI03461.1"
FT                   SVSDALRHTRPAGAAGC"
FT   gene            402794..404026
FT                   /locus_tag="SBI_00341"
FT   CDS_pept        402794..404026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00341"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00341"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03462"
FT                   /db_xref="GOA:D7BYD4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD4"
FT                   /protein_id="ADI03462.1"
FT                   VSHTHGVFGPS"
FT   gene            404107..404571
FT                   /locus_tag="SBI_00342"
FT   CDS_pept        404107..404571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00342"
FT                   /product="hypothetical protein"
FT                   /note="COG1917 Uncharacterized conserved protein, contains
FT                   double-stranded beta-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00342"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03463"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD5"
FT                   /protein_id="ADI03463.1"
FT   gene            complement(404681..406030)
FT                   /locus_tag="SBI_00343"
FT   CDS_pept        complement(404681..406030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00343"
FT                   /product="dehydrogenase"
FT                   /note="COG1252 NADH dehydrogenase, FAD-containing subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00343"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03464"
FT                   /db_xref="GOA:D7BYD6"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD6"
FT                   /protein_id="ADI03464.1"
FT   gene            complement(406114..406767)
FT                   /locus_tag="SBI_00344"
FT   CDS_pept        complement(406114..406767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00344"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03465"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD7"
FT                   /protein_id="ADI03465.1"
FT   gene            complement(406923..407381)
FT                   /locus_tag="SBI_00345"
FT   CDS_pept        complement(406923..407381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00345"
FT                   /product="secreted protein"
FT                   /note="COG0702 Predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00345"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03466"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD8"
FT                   /protein_id="ADI03466.1"
FT   gene            complement(407535..408038)
FT                   /locus_tag="SBI_00346"
FT   CDS_pept        complement(407535..408038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00346"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03467"
FT                   /db_xref="GOA:D7BYD9"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD9"
FT                   /protein_id="ADI03467.1"
FT                   DGRC"
FT   gene            408355..409278
FT                   /gene="sig4"
FT                   /locus_tag="SBI_00347"
FT   CDS_pept        408355..409278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sig4"
FT                   /locus_tag="SBI_00347"
FT                   /product="ECF subfamily RNA polymerase sigma factor"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00347"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03468"
FT                   /db_xref="GOA:D7BYE0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYE0"
FT                   /protein_id="ADI03468.1"
FT   gene            complement(409626..410126)
FT                   /locus_tag="SBI_00348"
FT   CDS_pept        complement(409626..410126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00348"
FT                   /product="putative phosphatase"
FT                   /note="COG0546 Predicted phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00348"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03469"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYE1"
FT                   /protein_id="ADI03469.1"
FT                   PQI"
FT   gene            410539..411936
FT                   /locus_tag="SBI_00349"
FT   CDS_pept        410539..411936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00349"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase"
FT                   /note="COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide dehydrogenase (E3) component, and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00349"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03470"
FT                   /db_xref="GOA:D7BYE2"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYE2"
FT                   /protein_id="ADI03470.1"
FT                   TVVRSDV"
FT   gene            412220..414268
FT                   /locus_tag="SBI_00350"
FT   CDS_pept        412220..414268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00350"
FT                   /product="transketolase"
FT                   /note="COG0021 Transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03471"
FT                   /db_xref="GOA:D7BYE3"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYE3"
FT                   /protein_id="ADI03471.1"
FT   gene            414282..415910
FT                   /gene="pgi"
FT                   /locus_tag="SBI_00351"
FT   CDS_pept        414282..415910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="SBI_00351"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number=""
FT                   /note="COG0166 Glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00351"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03472"
FT                   /db_xref="GOA:D7BYE4"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYE4"
FT                   /protein_id="ADI03472.1"
FT   gene            415944..416978
FT                   /gene="gnd1"
FT                   /locus_tag="SBI_00352"
FT   CDS_pept        415944..416978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd1"
FT                   /locus_tag="SBI_00352"
FT                   /product="6-phosphogluconate dehydrogenase-like protein"
FT                   /note="COG1023 Predicted 6-phosphogluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00352"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03473"
FT                   /db_xref="GOA:D7BYE5"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYE5"
FT                   /protein_id="ADI03473.1"
FT                   RSRP"
FT   gene            416975..418417
FT                   /locus_tag="SBI_00353"
FT   CDS_pept        416975..418417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00353"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /note="COG0364 Glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00353"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03474"
FT                   /db_xref="GOA:D7BYE6"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYE6"
FT                   /protein_id="ADI03474.1"
FT   gene            418429..419166
FT                   /locus_tag="SBI_00354"
FT   CDS_pept        418429..419166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00354"
FT                   /product="dehydrogenase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00354"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03475"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYE7"
FT                   /protein_id="ADI03475.1"
FT   gene            complement(419443..420447)
FT                   /locus_tag="SBI_00355"
FT   CDS_pept        complement(419443..420447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00355"
FT                   /product="dehydrogenase"
FT                   /note="COG0604 NADPH:quinone reductase and related
FT                   Zn-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00355"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03476"
FT                   /db_xref="GOA:D7BYE8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYE8"
FT                   /protein_id="ADI03476.1"
FT   gene            420695..422023
FT                   /locus_tag="SBI_00356"
FT   CDS_pept        420695..422023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00356"
FT                   /product="hypothetical protein"
FT                   /note="COG2755 Lysophospholipase L1 and related esterases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00356"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03477"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYE9"
FT                   /protein_id="ADI03477.1"
FT   gene            complement(422115..422630)
FT                   /locus_tag="SBI_00357"
FT   CDS_pept        complement(422115..422630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00357"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00357"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03478"
FT                   /db_xref="GOA:D7BYF0"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYF0"
FT                   /protein_id="ADI03478.1"
FT                   FHRHRKER"
FT   gene            complement(422654..422818)
FT                   /locus_tag="SBI_00358"
FT   CDS_pept        complement(422654..422818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00358"
FT                   /product="hypothetical protein"
FT                   /note="COG3387 Glucoamylase and related glycosyl
FT                   hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00358"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03479"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYF1"
FT                   /protein_id="ADI03479.1"
FT                   TAARLGIRR"
FT   gene            complement(422920..423888)
FT                   /locus_tag="SBI_00359"
FT   CDS_pept        complement(422920..423888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00359"
FT                   /product="putative endoglucanase"
FT                   /note="COG2730 Endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00359"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03480"
FT                   /db_xref="GOA:D7BYF2"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR005102"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR040946"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYF2"
FT                   /protein_id="ADI03480.1"
FT   gene            complement(424013..425662)
FT                   /locus_tag="SBI_00360"
FT   CDS_pept        complement(424013..425662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00360"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COG0515 Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03481"
FT                   /db_xref="GOA:D7BYF3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYF3"
FT                   /protein_id="ADI03481.1"
FT   gene            complement(425726..426595)
FT                   /locus_tag="SBI_00361"
FT   CDS_pept        complement(425726..426595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00361"
FT                   /product="putative ABC transporter permease protein"
FT                   /note="COG0842 ABC-type multidrug transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00361"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03482"
FT                   /db_xref="GOA:D7BYF4"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYF4"
FT                   /protein_id="ADI03482.1"
FT                   SLLGRLAR"
FT   gene            complement(426555..427409)
FT                   /locus_tag="SBI_00362"
FT   CDS_pept        complement(426555..427409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00362"
FT                   /product="ABC-type drug export system, ATP-binding protein"
FT                   /note="COG1131 ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00362"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03483"
FT                   /db_xref="GOA:D7BYF5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYF5"
FT                   /protein_id="ADI03483.1"
FT                   RVG"
FT   gene            complement(427406..427861)
FT                   /locus_tag="SBI_00363"
FT   CDS_pept        complement(427406..427861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00363"
FT                   /product="transcriptional regulator, MarR family protein"
FT                   /note="COG1846 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00363"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03484"
FT                   /db_xref="GOA:D7BYF6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYF6"
FT                   /protein_id="ADI03484.1"
FT   gene            427892..428041
FT                   /locus_tag="SBI_00364"
FT   CDS_pept        427892..428041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00364"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03485"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYF7"
FT                   /protein_id="ADI03485.1"
FT                   SRWS"
FT   gene            428041..428403
FT                   /locus_tag="SBI_00365"
FT   CDS_pept        428041..428403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00365"
FT                   /product="putative 2Fe-2S rieske nitrite reductase small
FT                   subunit"
FT                   /note="COG2146 Ferredoxin subunits of nitrite reductase and
FT                   ring-hydroxylating dioxygenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00365"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03486"
FT                   /db_xref="GOA:D7BYF8"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYF8"
FT                   /protein_id="ADI03486.1"
FT                   NLPPCVAHRLAGEGAA"
FT   gene            428409..429581
FT                   /locus_tag="SBI_00366"
FT   CDS_pept        428409..429581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00366"
FT                   /product="ferredoxin reductase"
FT                   /note="COG0446 Uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00366"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03487"
FT                   /db_xref="GOA:D7BYF9"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYF9"
FT                   /protein_id="ADI03487.1"
FT   gene            429638..430759
FT                   /locus_tag="SBI_00367"
FT   CDS_pept        429638..430759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00367"
FT                   /product="putative ring hydroxylating dioxygenase subunit"
FT                   /note="COG4638 Phenylpropionate dioxygenase and related
FT                   ring-hydroxylating dioxygenases, large terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00367"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03488"
FT                   /db_xref="GOA:D7BYG0"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYG0"
FT                   /protein_id="ADI03488.1"
FT   gene            complement(430841..431587)
FT                   /locus_tag="SBI_00368"
FT   CDS_pept        complement(430841..431587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00368"
FT                   /product="oxidoreductase"
FT                   /note="COG1414 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00368"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03489"
FT                   /db_xref="GOA:D7BYG1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYG1"
FT                   /protein_id="ADI03489.1"
FT   gene            431772..434210
FT                   /locus_tag="SBI_00369"
FT   CDS_pept        431772..434210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00369"
FT                   /product="putative dehydrogenase"
FT                   /note="COG0665 Glycine/D-amino acid oxidases (deaminating)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00369"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03490"
FT                   /db_xref="GOA:D7BYG2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYG2"
FT                   /protein_id="ADI03490.1"
FT                   "
FT   gene            434352..435368
FT                   /locus_tag="SBI_00370"
FT   CDS_pept        434352..435368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00370"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COG0596 Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03491"
FT                   /db_xref="GOA:D7BYG3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYG3"
FT                   /protein_id="ADI03491.1"
FT   gene            435474..437144
FT                   /locus_tag="SBI_00371"
FT   CDS_pept        435474..437144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00371"
FT                   /product="malate dehydrogenase"
FT                   /EC_number=""
FT                   /note="COG0281 Malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00371"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03492"
FT                   /db_xref="GOA:D7BYG4"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYG4"
FT                   /protein_id="ADI03492.1"
FT   gene            437111..437974
FT                   /gene="fumC"
FT                   /locus_tag="SBI_00372"
FT   CDS_pept        437111..437974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumC"
FT                   /locus_tag="SBI_00372"
FT                   /product="fumarate hydratase"
FT                   /EC_number=""
FT                   /note="COG0114 Fumarase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00372"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03493"
FT                   /db_xref="GOA:D7BYG5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYG5"
FT                   /protein_id="ADI03493.1"
FT                   EKSRSA"
FT   gene            438061..439014
FT                   /locus_tag="SBI_00373"
FT   CDS_pept        438061..439014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00373"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03494"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYG6"
FT                   /protein_id="ADI03494.1"
FT   gene            complement(439031..440659)
FT                   /locus_tag="SBI_00374"
FT   CDS_pept        complement(439031..440659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00374"
FT                   /product="hypothetical protein"
FT                   /note="COG2152 Predicted glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00374"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03495"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYG7"
FT                   /protein_id="ADI03495.1"
FT   gene            440910..443465
FT                   /gene="bga2"
FT                   /locus_tag="SBI_00375"
FT   CDS_pept        440910..443465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bga2"
FT                   /locus_tag="SBI_00375"
FT                   /product="hydrolase"
FT                   /note="COG3250 Beta-galactosidase/beta-glucuronidase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00375"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03496"
FT                   /db_xref="GOA:D7BYG8"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011658"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYG8"
FT                   /protein_id="ADI03496.1"
FT   gene            443608..444504
FT                   /locus_tag="SBI_00376"
FT   CDS_pept        443608..444504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00376"
FT                   /product="hydroxyquinol 1,2-dioxygenase"
FT                   /note="COG3485 Protocatechuate 3,4-dioxygenase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00376"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03497"
FT                   /db_xref="GOA:D7BYG9"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYG9"
FT                   /protein_id="ADI03497.1"
FT                   KSWSRVRFDIVLPPQSA"
FT   gene            444681..444908
FT                   /locus_tag="SBI_00377"
FT   CDS_pept        444681..444908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00377"
FT                   /product="hypothetical protein"
FT                   /note="COG1141 Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00377"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03498"
FT                   /db_xref="GOA:D7BYH0"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYH0"
FT                   /protein_id="ADI03498.1"
FT   gene            444898..446292
FT                   /locus_tag="SBI_00378"
FT   CDS_pept        444898..446292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00378"
FT                   /product="ferredoxin reductase"
FT                   /note="COG0446 Uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00378"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03499"
FT                   /db_xref="GOA:D7BYH1"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYH1"
FT                   /protein_id="ADI03499.1"
FT                   FVPSRA"
FT   gene            446332..447555
FT                   /gene="cyp7"
FT                   /locus_tag="SBI_00379"
FT   CDS_pept        446332..447555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp7"
FT                   /locus_tag="SBI_00379"
FT                   /product="cytochrome P450 family protein"
FT                   /note="COG2124 Cytochrome P450, CYP147F2"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00379"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03500"
FT                   /db_xref="GOA:D7BYH2"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYH2"
FT                   /protein_id="ADI03500.1"
FT                   VAIEGVTA"
FT   gene            447694..449703
FT                   /locus_tag="SBI_00380"
FT   CDS_pept        447694..449703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00380"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COG0515 Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03501"
FT                   /db_xref="GOA:D7BYH3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYH3"
FT                   /protein_id="ADI03501.1"
FT   gene            449956..450534
FT                   /gene="sig5"
FT                   /locus_tag="SBI_00381"
FT   CDS_pept        449956..450534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sig5"
FT                   /locus_tag="SBI_00381"
FT                   /product="ECF subfamily RNA polymerase sigma factor"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00381"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03502"
FT                   /db_xref="GOA:D7BYH4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYH4"
FT                   /protein_id="ADI03502.1"
FT   gene            450531..450839
FT                   /locus_tag="SBI_00382"
FT   CDS_pept        450531..450839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00382"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03503"
FT                   /db_xref="GOA:D7BYH5"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYH5"
FT                   /protein_id="ADI03503.1"
FT   gene            450892..451863
FT                   /locus_tag="SBI_00383"
FT   CDS_pept        450892..451863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00383"
FT                   /product="WD-40 repeat protein"
FT                   /note="COG2319 FOG: WD40 repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00383"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03504"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYH6"
FT                   /protein_id="ADI03504.1"
FT   gene            complement(451923..452063)
FT                   /locus_tag="SBI_00384"
FT   CDS_pept        complement(451923..452063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00384"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03505"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYH7"
FT                   /protein_id="ADI03505.1"
FT                   G"
FT   gene            complement(452089..452592)
FT                   /locus_tag="SBI_00385"
FT   CDS_pept        complement(452089..452592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00385"
FT                   /product="transcriptional regulator, MarR family protein"
FT                   /note="COG1846 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00385"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03506"
FT                   /db_xref="GOA:D7BYH8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYH8"
FT                   /protein_id="ADI03506.1"
FT                   SGRS"
FT   gene            452642..453565
FT                   /locus_tag="SBI_00386"
FT   CDS_pept        452642..453565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00386"
FT                   /product="hypothetical protein"
FT                   /note="COG2141 Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00386"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03507"
FT                   /db_xref="GOA:D7BYH9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYH9"
FT                   /protein_id="ADI03507.1"
FT   gene            complement(453606..454787)
FT                   /locus_tag="SBI_00387"
FT   CDS_pept        complement(453606..454787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00387"
FT                   /product="hypothetical protein"
FT                   /note="COG2508 Regulator of polyketide synthase expression"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00387"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03508"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYI0"
FT                   /protein_id="ADI03508.1"
FT   gene            455008..455391
FT                   /locus_tag="SBI_00388"
FT   CDS_pept        455008..455391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00388"
FT                   /product="L-asparagine permease AnsP1"
FT                   /note="COG1113 Gamma-aminobutyrate permease and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00388"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03509"
FT                   /db_xref="GOA:D7BYI1"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYI1"
FT                   /protein_id="ADI03509.1"
FT   gene            455418..456677
FT                   /locus_tag="SBI_00389"
FT   CDS_pept        455418..456677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00389"
FT                   /product="putative N-carbamoyl-L-amino acid amidohydrolase"
FT                   /note="COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00389"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03510"
FT                   /db_xref="GOA:D7BYI2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYI2"
FT                   /protein_id="ADI03510.1"
FT   gene            456670..457461
FT                   /locus_tag="SBI_00390"
FT   CDS_pept        456670..457461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00390"
FT                   /product="carbon-nitrogen family hydrolase"
FT                   /note="COG0388 Predicted amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03511"
FT                   /db_xref="GOA:D7BYI3"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYI3"
FT                   /protein_id="ADI03511.1"
FT   gene            457586..459262
FT                   /locus_tag="SBI_00391"
FT   CDS_pept        457586..459262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00391"
FT                   /product="amine oxidase"
FT                   /note="COG1231 Monoamine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00391"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03512"
FT                   /db_xref="GOA:D7BYI4"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYI4"
FT                   /protein_id="ADI03512.1"
FT   gene            complement(459323..460534)
FT                   /locus_tag="SBI_00392"
FT   CDS_pept        complement(459323..460534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00392"
FT                   /product="putative transcriptional regulator, PucR family
FT                   protein"
FT                   /note="COG2508 Regulator of polyketide synthase expression"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00392"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03513"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYI5"
FT                   /protein_id="ADI03513.1"
FT                   AGRL"
FT   gene            complement(460601..461983)
FT                   /locus_tag="SBI_00393"
FT   CDS_pept        complement(460601..461983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00393"
FT                   /product="6-oxohexanoate dehydrogenase"
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00393"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03514"
FT                   /db_xref="GOA:D7BYI6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYI6"
FT                   /protein_id="ADI03514.1"
FT                   AG"
FT   gene            complement(462090..462728)
FT                   /locus_tag="SBI_00394"
FT   CDS_pept        complement(462090..462728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00394"
FT                   /product="putative demethylmenaquinone methyltransferase"
FT                   /note="COG0684 Demethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00394"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03515"
FT                   /db_xref="GOA:D7BYI7"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYI7"
FT                   /protein_id="ADI03515.1"
FT   gene            complement(462725..463132)
FT                   /locus_tag="SBI_00395"
FT   CDS_pept        complement(462725..463132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00395"
FT                   /product="L-PSP family endoribonuclease"
FT                   /note="COG0251 Putative translation initiation inhibitor,
FT                   yjgF family"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00395"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03516"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYI8"
FT                   /protein_id="ADI03516.1"
FT   gene            complement(463129..464490)
FT                   /locus_tag="SBI_00396"
FT   CDS_pept        complement(463129..464490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00396"
FT                   /product="major facilitator transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00396"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03517"
FT                   /db_xref="GOA:D7BYI9"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYI9"
FT                   /protein_id="ADI03517.1"
FT   gene            464817..466481
FT                   /gene="ilvB1"
FT                   /locus_tag="SBI_00397"
FT   CDS_pept        464817..466481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB1"
FT                   /locus_tag="SBI_00397"
FT                   /product="putative acetolactate synthase, large subunit"
FT                   /note="COG0028 Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase]"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00397"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03518"
FT                   /db_xref="GOA:D7BYJ0"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ0"
FT                   /protein_id="ADI03518.1"
FT   misc_feature    466723..468619
FT                   /note="potential frameshift: common BLAST hit:
FT                   gi|290956658|ref|YP_003487840.1| putative ABC transporter"
FT   gene            468922..470592
FT                   /locus_tag="SBI_00398"
FT   CDS_pept        468922..470592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00398"
FT                   /product="hypothetical protein"
FT                   /note="COG2208 Serine phosphatase RsbU, regulator of sigma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00398"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03519"
FT                   /db_xref="GOA:D7BYJ1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ1"
FT                   /protein_id="ADI03519.1"
FT   gene            470936..471109
FT                   /locus_tag="SBI_00399"
FT   CDS_pept        470936..471109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00399"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03520"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ2"
FT                   /protein_id="ADI03520.1"
FT                   ASSGTVSRPFGP"
FT   gene            471137..471541
FT                   /locus_tag="SBI_00400"
FT   CDS_pept        471137..471541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03521"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ3"
FT                   /protein_id="ADI03521.1"
FT   gene            complement(471528..472442)
FT                   /locus_tag="SBI_00401"
FT   CDS_pept        complement(471528..472442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00401"
FT                   /product="NmrA family protein"
FT                   /note="COG0702 Predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00401"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03522"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ4"
FT                   /protein_id="ADI03522.1"
FT   gene            472659..473303
FT                   /locus_tag="SBI_00402"
FT   CDS_pept        472659..473303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00402"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00402"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03523"
FT                   /db_xref="GOA:D7BYJ5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ5"
FT                   /protein_id="ADI03523.1"
FT   gene            473450..474043
FT                   /locus_tag="SBI_00403"
FT   CDS_pept        473450..474043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00403"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="COG1131 ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00403"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03524"
FT                   /db_xref="GOA:D7BYJ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ6"
FT                   /protein_id="ADI03524.1"
FT   gene            474093..474797
FT                   /locus_tag="SBI_00404"
FT   CDS_pept        474093..474797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00404"
FT                   /product="response regulator receiver"
FT                   /note="COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00404"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03525"
FT                   /db_xref="GOA:D7BYJ7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ7"
FT                   /protein_id="ADI03525.1"
FT                   RGTGYVLRRPRQ"
FT   gene            474794..476359
FT                   /locus_tag="SBI_00405"
FT   CDS_pept        474794..476359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00405"
FT                   /product="histidine kinase"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00405"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03526"
FT                   /db_xref="GOA:D7BYJ8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ8"
FT                   /protein_id="ADI03526.1"
FT                   PLHG"
FT   gene            complement(476384..478051)
FT                   /locus_tag="SBI_00406"
FT   CDS_pept        complement(476384..478051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00406"
FT                   /product="antibiotic ABC transporter ATP-binding protein"
FT                   /note="COG0488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00406"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03527"
FT                   /db_xref="GOA:D7BYJ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ9"
FT                   /protein_id="ADI03527.1"
FT   gene            complement(478133..479767)
FT                   /locus_tag="SBI_00407"
FT   CDS_pept        complement(478133..479767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00407"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="COG0488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00407"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03528"
FT                   /db_xref="GOA:D7BYK0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK0"
FT                   /protein_id="ADI03528.1"
FT   gene            480208..482514
FT                   /locus_tag="SBI_00408"
FT   CDS_pept        480208..482514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00408"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03529"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK1"
FT                   /protein_id="ADI03529.1"
FT                   GDPVTVSGTLTVNGS"
FT   gene            complement(482615..483274)
FT                   /locus_tag="SBI_00409"
FT   CDS_pept        complement(482615..483274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00409"
FT                   /product="two-component system response regulator"
FT                   /note="COG2197 Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00409"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03530"
FT                   /db_xref="GOA:D7BYK2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK2"
FT                   /protein_id="ADI03530.1"
FT   gene            complement(483271..484401)
FT                   /locus_tag="SBI_00410"
FT   CDS_pept        complement(483271..484401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00410"
FT                   /product="putative two-component system sensor kinase"
FT                   /note="COG3851 Signal transduction histidine kinase,
FT                   glucose-6-phosphate specific"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03531"
FT                   /db_xref="GOA:D7BYK3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK3"
FT                   /protein_id="ADI03531.1"
FT   gene            complement(484437..485273)
FT                   /locus_tag="SBI_00411"
FT   CDS_pept        complement(484437..485273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00411"
FT                   /product="Abortive infection protein"
FT                   /note="COG1266 Predicted metal-dependent membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00411"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03532"
FT                   /db_xref="GOA:D7BYK4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK4"
FT                   /protein_id="ADI03532.1"
FT   gene            complement(485428..486429)
FT                   /locus_tag="SBI_00412"
FT   CDS_pept        complement(485428..486429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00412"
FT                   /product="aldo/keto reductase"
FT                   /note="COG0667 Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00412"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03533"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK5"
FT                   /protein_id="ADI03533.1"
FT   gene            486541..487143
FT                   /locus_tag="SBI_00413"
FT   CDS_pept        486541..487143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00413"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00413"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03534"
FT                   /db_xref="GOA:D7BYK6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK6"
FT                   /protein_id="ADI03534.1"
FT   gene            complement(487171..488910)
FT                   /locus_tag="SBI_00414"
FT   CDS_pept        complement(487171..488910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00414"
FT                   /product="hypothetical protein"
FT                   /note="COG1626 Neutral trehalase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00414"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03535"
FT                   /db_xref="GOA:D7BYK7"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR004888"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK7"
FT                   /protein_id="ADI03535.1"
FT                   LRN"
FT   gene            complement(488979..489824)
FT                   /locus_tag="SBI_00415"
FT   CDS_pept        complement(488979..489824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00415"
FT                   /product="putative integral membrane transport protein"
FT                   /note="COG0395 ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03536"
FT                   /db_xref="GOA:D7BYK8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK8"
FT                   /protein_id="ADI03536.1"
FT                   "
FT   gene            complement(489821..490801)
FT                   /locus_tag="SBI_00416"
FT   CDS_pept        complement(489821..490801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00416"
FT                   /product="putative sugar transport integral membrane
FT                   protein"
FT                   /note="COG1175 ABC-type sugar transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00416"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03537"
FT                   /db_xref="GOA:D7BYK9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK9"
FT                   /protein_id="ADI03537.1"
FT   gene            complement(490815..492053)
FT                   /locus_tag="SBI_00417"
FT   CDS_pept        complement(490815..492053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00417"
FT                   /product="putative sugar binding protein"
FT                   /note="COG1653 ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00417"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03538"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYL0"
FT                   /protein_id="ADI03538.1"
FT                   PQDALATAQSAVK"
FT   gene            complement(492197..493225)
FT                   /locus_tag="SBI_00418"
FT   CDS_pept        complement(492197..493225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00418"
FT                   /product="putative LacI family transcriptional regulator"
FT                   /note="COG1609 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00418"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03539"
FT                   /db_xref="GOA:D7BYL1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYL1"
FT                   /protein_id="ADI03539.1"
FT                   DS"
FT   gene            493576..496269
FT                   /locus_tag="SBI_00419"
FT   CDS_pept        493576..496269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00419"
FT                   /product="hypothetical protein"
FT                   /note="COG3664 Beta-xylosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00419"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03540"
FT                   /db_xref="GOA:D7BYL2"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYL2"
FT                   /protein_id="ADI03540.1"
FT   gene            complement(496266..497762)
FT                   /locus_tag="SBI_00420"
FT   CDS_pept        complement(496266..497762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00420"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03541"
FT                   /db_xref="GOA:D7BYL3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYL3"
FT                   /protein_id="ADI03541.1"
FT   gene            complement(497805..499016)
FT                   /locus_tag="SBI_00421"
FT   CDS_pept        complement(497805..499016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00421"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COG0446 Uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00421"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03542"
FT                   /db_xref="GOA:D7BYL4"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYL4"
FT                   /protein_id="ADI03542.1"
FT                   EGEQ"
FT   gene            complement(499016..500281)
FT                   /gene="cyp8"
FT                   /locus_tag="SBI_00422"
FT   CDS_pept        complement(499016..500281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp8"
FT                   /locus_tag="SBI_00422"
FT                   /product="putative cytochrome P450"
FT                   /note="COG2124 Cytochrome P450, CYP105B4"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00422"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03543"
FT                   /db_xref="GOA:D7BYL5"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYL5"
FT                   /protein_id="ADI03543.1"
FT   gene            complement(500463..501116)
FT                   /locus_tag="SBI_00423"
FT   CDS_pept        complement(500463..501116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00423"
FT                   /product="putative transcriptional regulator, TetR family
FT                   protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00423"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03544"
FT                   /db_xref="GOA:D7BYL6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041586"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYL6"
FT                   /protein_id="ADI03544.1"
FT   gene            501478..502698
FT                   /gene="cyp9"
FT                   /locus_tag="SBI_00424"
FT   CDS_pept        501478..502698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp9"
FT                   /locus_tag="SBI_00424"
FT                   /product="putative monooxgenase"
FT                   /note="COG2124 Cytochrome P450, CYP107AM2"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00424"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03545"
FT                   /db_xref="GOA:D7BYL7"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYL7"
FT                   /protein_id="ADI03545.1"
FT                   REVPVRW"
FT   gene            502692..502991
FT                   /locus_tag="SBI_00425"
FT   CDS_pept        502692..502991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00425"
FT                   /product="ferredoxin"
FT                   /note="COG1141 Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00425"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03546"
FT                   /db_xref="GOA:D7BYL8"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYL8"
FT                   /protein_id="ADI03546.1"
FT   gene            complement(503098..504111)
FT                   /locus_tag="SBI_00426"
FT   CDS_pept        complement(503098..504111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00426"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /note="COG1995 Pyridoxal phosphate biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00426"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03547"
FT                   /db_xref="GOA:D7BYL9"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYL9"
FT                   /protein_id="ADI03547.1"
FT   gene            504542..505522
FT                   /locus_tag="SBI_00427"
FT   CDS_pept        504542..505522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00427"
FT                   /product="aldo/keto reductase"
FT                   /note="COG0667 Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00427"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03548"
FT                   /db_xref="GOA:D7BYM0"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYM0"
FT                   /protein_id="ADI03548.1"
FT   gene            505596..506381
FT                   /locus_tag="SBI_00428"
FT   CDS_pept        505596..506381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00428"
FT                   /product="aldolase"
FT                   /note="COG3836 2,4-dihydroxyhept-2-ene-1,7-dioic acid
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00428"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03549"
FT                   /db_xref="GOA:D7BYM1"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYM1"
FT                   /protein_id="ADI03549.1"
FT   gene            506381..507334
FT                   /locus_tag="SBI_00429"
FT   CDS_pept        506381..507334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00429"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /note="COG0111 Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00429"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03550"
FT                   /db_xref="GOA:D7BYM2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYM2"
FT                   /protein_id="ADI03550.1"
FT   gene            507424..508851
FT                   /locus_tag="SBI_00430"
FT   CDS_pept        507424..508851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00430"
FT                   /product="manganese transporter NRAMP"
FT                   /note="COG1914 Mn2+ and Fe2+ transporters of the NRAMP
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03551"
FT                   /db_xref="GOA:D7BYM3"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYM3"
FT                   /protein_id="ADI03551.1"
FT                   FLGVYGVLDTLELTPGS"
FT   gene            complement(509033..509707)
FT                   /locus_tag="SBI_00431"
FT   CDS_pept        complement(509033..509707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00431"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="COG1802 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00431"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03552"
FT                   /db_xref="GOA:D7BYM4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYM4"
FT                   /protein_id="ADI03552.1"
FT                   EN"
FT   gene            complement(509776..511254)
FT                   /locus_tag="SBI_00432"
FT   CDS_pept        complement(509776..511254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00432"
FT                   /product="succinate-semialdehyde dehydrogenase,
FT                   NADP-dependent"
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00432"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03553"
FT                   /db_xref="GOA:D7BYM5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYM5"
FT                   /protein_id="ADI03553.1"
FT   gene            complement(511298..512062)
FT                   /locus_tag="SBI_00433"
FT   CDS_pept        complement(511298..512062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00433"
FT                   /product="putative oxidoreductase"
FT                   /note="COG0277 FAD/FMN-containing dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00433"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03554"
FT                   /db_xref="GOA:D7BYM6"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYM6"
FT                   /protein_id="ADI03554.1"
FT   gene            complement(512059..513324)
FT                   /locus_tag="SBI_00434"
FT   CDS_pept        complement(512059..513324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00434"
FT                   /product="hypothetical protein"
FT                   /note="COG0160 4-aminobutyrate aminotransferase and related
FT                   aminotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00434"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03555"
FT                   /db_xref="GOA:D7BYM7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYM7"
FT                   /protein_id="ADI03555.1"
FT   gene            513581..514135
FT                   /locus_tag="SBI_00435"
FT   CDS_pept        513581..514135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00435"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00435"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03556"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYM8"
FT                   /protein_id="ADI03556.1"
FT   gene            complement(514102..515418)
FT                   /locus_tag="SBI_00436"
FT   CDS_pept        complement(514102..515418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00436"
FT                   /product="hypothetical protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00436"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03557"
FT                   /db_xref="GOA:D7BYM9"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYM9"
FT                   /protein_id="ADI03557.1"
FT   gene            515521..516444
FT                   /locus_tag="SBI_00437"
FT   CDS_pept        515521..516444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00437"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00437"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03558"
FT                   /db_xref="GOA:D7BYN0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYN0"
FT                   /protein_id="ADI03558.1"
FT   gene            516667..517374
FT                   /locus_tag="SBI_00438"
FT   CDS_pept        516667..517374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00438"
FT                   /product="dehydrogenase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00438"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03559"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYN1"
FT                   /protein_id="ADI03559.1"
FT                   EILHVDGGMSAGH"
FT   gene            517387..517761
FT                   /locus_tag="SBI_00439"
FT   CDS_pept        517387..517761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00439"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03560"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYN2"
FT                   /protein_id="ADI03560.1"
FT   gene            518003..518410
FT                   /locus_tag="SBI_00440"
FT   CDS_pept        518003..518410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00440"
FT                   /product="hypothetical protein"
FT                   /note="COG1917 Uncharacterized conserved protein, contains
FT                   double-stranded beta-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03561"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYN3"
FT                   /protein_id="ADI03561.1"
FT   gene            518433..519449
FT                   /locus_tag="SBI_00441"
FT   CDS_pept        518433..519449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00441"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="COG1063 Threonine dehydrogenase and related
FT                   Zn-dependent dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00441"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03562"
FT                   /db_xref="GOA:D7BYN4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYN4"
FT                   /protein_id="ADI03562.1"
FT   gene            519581..520255
FT                   /locus_tag="SBI_00442"
FT   CDS_pept        519581..520255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00442"
FT                   /product="dehydrogenase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00442"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03563"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYN5"
FT                   /protein_id="ADI03563.1"
FT                   DS"
FT   gene            520287..520397
FT                   /locus_tag="SBI_00443"
FT   CDS_pept        520287..520397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00443"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03564"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYN6"
FT                   /protein_id="ADI03564.1"
FT   gene            520454..521242
FT                   /locus_tag="SBI_00444"
FT   CDS_pept        520454..521242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00444"
FT                   /product="hypothetical protein"
FT                   /note="COG3826 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00444"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03565"
FT                   /db_xref="InterPro:IPR018655"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYN7"
FT                   /protein_id="ADI03565.1"
FT   gene            521292..522023
FT                   /locus_tag="SBI_00445"
FT   CDS_pept        521292..522023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00445"
FT                   /product="hypothetical protein"
FT                   /note="COG3826 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03566"
FT                   /db_xref="InterPro:IPR018655"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYN8"
FT                   /protein_id="ADI03566.1"
FT   gene            522400..523440
FT                   /locus_tag="SBI_00446"
FT   CDS_pept        522400..523440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00446"
FT                   /product="aminotransferase"
FT                   /note="COG1168 Bifunctional PLP-dependent enzyme with
FT                   beta-cystathionase and maltose regulon repressor
FT                   activities"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00446"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03567"
FT                   /db_xref="GOA:D7BYN9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYN9"
FT                   /protein_id="ADI03567.1"
FT                   MAAALD"
FT   gene            complement(523499..524101)
FT                   /locus_tag="SBI_00447"
FT   CDS_pept        complement(523499..524101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00447"
FT                   /product="hypothetical protein"
FT                   /note="COG2176 DNA polymerase III, alpha subunit
FT                   (gram-positive type)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00447"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03568"
FT                   /db_xref="GOA:D7BYP0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYP0"
FT                   /protein_id="ADI03568.1"
FT   gene            complement(524300..524893)
FT                   /locus_tag="SBI_00448"
FT   CDS_pept        complement(524300..524893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00448"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03569"
FT                   /db_xref="GOA:D7BYP1"
FT                   /db_xref="InterPro:IPR032801"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYP1"
FT                   /protein_id="ADI03569.1"
FT   gene            524966..525580
FT                   /locus_tag="SBI_00449"
FT   CDS_pept        524966..525580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00449"
FT                   /product="putative transcriptional regulator"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00449"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03570"
FT                   /db_xref="GOA:D7BYP2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYP2"
FT                   /protein_id="ADI03570.1"
FT   gene            complement(525608..526306)
FT                   /locus_tag="SBI_00450"
FT   CDS_pept        complement(525608..526306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00450"
FT                   /product="transcriptional regulator"
FT                   /note="COG2186 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03571"
FT                   /db_xref="GOA:D7BYP3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYP3"
FT                   /protein_id="ADI03571.1"
FT                   HSEVEGLLSG"
FT   gene            complement(526357..526977)
FT                   /locus_tag="SBI_00451"
FT   CDS_pept        complement(526357..526977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00451"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="COG0800 2-keto-3-deoxy-6-phosphogluconate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00451"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03572"
FT                   /db_xref="GOA:D7BYP4"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYP4"
FT                   /protein_id="ADI03572.1"
FT   gene            complement(527054..528028)
FT                   /locus_tag="SBI_00452"
FT   CDS_pept        complement(527054..528028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00452"
FT                   /product="2-keto-3-deoxy-gluconate kinase"
FT                   /note="COG0524 Sugar kinases, ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00452"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03573"
FT                   /db_xref="GOA:D7BYP5"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYP5"
FT                   /protein_id="ADI03573.1"
FT   gene            complement(528048..529826)
FT                   /gene="ilvD1"
FT                   /locus_tag="SBI_00453"
FT   CDS_pept        complement(528048..529826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD1"
FT                   /locus_tag="SBI_00453"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number=""
FT                   /note="COG0129 Dihydroxyacid dehydratase/phosphogluconate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00453"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03574"
FT                   /db_xref="GOA:D7BYP6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYP6"
FT                   /protein_id="ADI03574.1"
FT                   DFLVGSTDSAPPRQAF"
FT   gene            529963..531279
FT                   /locus_tag="SBI_00454"
FT   CDS_pept        529963..531279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00454"
FT                   /product="major facilitator transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00454"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03575"
FT                   /db_xref="GOA:D7C084"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7C084"
FT                   /protein_id="ADI03575.1"
FT   gene            531546..531992
FT                   /locus_tag="SBI_00455"
FT   CDS_pept        531546..531992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00455"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="COG1846 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03576"
FT                   /db_xref="GOA:D7C085"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7C085"
FT                   /protein_id="ADI03576.1"
FT   gene            532084..532848
FT                   /locus_tag="SBI_00456"
FT   CDS_pept        532084..532848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00456"
FT                   /product="putative SAM-dependent methyltransferase"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00456"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03577"
FT                   /db_xref="GOA:D7C086"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D7C086"
FT                   /protein_id="ADI03577.1"
FT   gene            complement(532901..533365)
FT                   /locus_tag="SBI_00457"
FT   CDS_pept        complement(532901..533365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00457"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03578"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D7C087"
FT                   /protein_id="ADI03578.1"
FT   gene            533412..534020
FT                   /locus_tag="SBI_00458"
FT   CDS_pept        533412..534020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00458"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00458"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03579"
FT                   /db_xref="GOA:D7C088"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7C088"
FT                   /protein_id="ADI03579.1"
FT   gene            complement(534067..535590)
FT                   /locus_tag="SBI_00459"
FT   CDS_pept        complement(534067..535590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00459"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="COG0143 Methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00459"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03580"
FT                   /db_xref="GOA:D7C089"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:D7C089"
FT                   /protein_id="ADI03580.1"
FT   gene            complement(536035..536214)
FT                   /locus_tag="SBI_00460"
FT   CDS_pept        complement(536035..536214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03581"
FT                   /db_xref="UniProtKB/TrEMBL:D7C090"
FT                   /protein_id="ADI03581.1"
FT                   RSAFSLDPYAVEIA"
FT   gene            536204..537532
FT                   /locus_tag="SBI_00461"
FT   CDS_pept        536204..537532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00461"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00461"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03582"
FT                   /db_xref="GOA:D7C091"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7C091"
FT                   /protein_id="ADI03582.1"
FT   gene            537570..538280
FT                   /locus_tag="SBI_00462"
FT   CDS_pept        537570..538280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00462"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03583"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7C092"
FT                   /protein_id="ADI03583.1"
FT                   LARRTVIADEYPAE"
FT   gene            complement(538348..539877)
FT                   /locus_tag="SBI_00463"
FT   CDS_pept        complement(538348..539877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00463"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00463"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03584"
FT                   /db_xref="GOA:D7C093"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D7C093"
FT                   /protein_id="ADI03584.1"
FT   gene            complement(539909..541300)
FT                   /locus_tag="SBI_00464"
FT   CDS_pept        complement(539909..541300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00464"
FT                   /product="hypothetical protein"
FT                   /note="COG5383 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00464"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03585"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:D7C094"
FT                   /protein_id="ADI03585.1"
FT                   TGALG"
FT   gene            complement(541329..542501)
FT                   /locus_tag="SBI_00465"
FT   CDS_pept        complement(541329..542501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00465"
FT                   /product="sarcosine oxidase subunit beta"
FT                   /note="COG0665 Glycine/D-amino acid oxidases (deaminating)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00465"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03586"
FT                   /db_xref="GOA:D7C095"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7C095"
FT                   /protein_id="ADI03586.1"
FT   gene            542638..543318
FT                   /locus_tag="SBI_00466"
FT   CDS_pept        542638..543318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00466"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03587"
FT                   /db_xref="GOA:D7C096"
FT                   /db_xref="UniProtKB/TrEMBL:D7C096"
FT                   /protein_id="ADI03587.1"
FT                   TISG"
FT   gene            543477..543836
FT                   /locus_tag="SBI_00467"
FT   CDS_pept        543477..543836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00467"
FT                   /product="putative ArsR family transcriptional regulator"
FT                   /note="COG0640 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00467"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03588"
FT                   /db_xref="GOA:D7C097"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7C097"
FT                   /protein_id="ADI03588.1"
FT                   VNHADHMVTGAPPHD"
FT   gene            complement(543867..545345)
FT                   /locus_tag="SBI_00468"
FT   CDS_pept        complement(543867..545345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00468"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00468"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03589"
FT                   /db_xref="GOA:D7C098"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D7C098"
FT                   /protein_id="ADI03589.1"
FT   gene            complement(545375..546385)
FT                   /locus_tag="SBI_00469"
FT   CDS_pept        complement(545375..546385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00469"
FT                   /product="probable ATP-binding component of ABC dipeptide
FT                   transporter"
FT                   /note="COG4608 ABC-type oligopeptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00469"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03590"
FT                   /db_xref="GOA:D7C099"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7C099"
FT                   /protein_id="ADI03590.1"
FT   gene            complement(546382..547440)
FT                   /locus_tag="SBI_00470"
FT   CDS_pept        complement(546382..547440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00470"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03591"
FT                   /db_xref="GOA:D7C0A0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A0"
FT                   /protein_id="ADI03591.1"
FT                   HGTELRGEAVGV"
FT   gene            complement(547454..548149)
FT                   /locus_tag="SBI_00471"
FT   CDS_pept        complement(547454..548149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00471"
FT                   /product="transcriptional regulator protein"
FT                   /note="COG1802 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00471"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03592"
FT                   /db_xref="GOA:D7C0A1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A1"
FT                   /protein_id="ADI03592.1"
FT                   RNRLRAVRR"
FT   gene            complement(548139..549044)
FT                   /locus_tag="SBI_00472"
FT   CDS_pept        complement(548139..549044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00472"
FT                   /product="ABC transporter, membrane spanning protein"
FT                   /note="COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00472"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03593"
FT                   /db_xref="GOA:D7C0A2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A2"
FT                   /protein_id="ADI03593.1"
FT   gene            complement(549031..549978)
FT                   /locus_tag="SBI_00473"
FT   CDS_pept        complement(549031..549978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00473"
FT                   /product="ABC transporter, membrane spanning protein"
FT                   /note="COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00473"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03594"
FT                   /db_xref="GOA:D7C0A3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A3"
FT                   /protein_id="ADI03594.1"
FT   gene            complement(550024..551301)
FT                   /locus_tag="SBI_00474"
FT   CDS_pept        complement(550024..551301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00474"
FT                   /product="putative oxidoreductase"
FT                   /note="COG0665 Glycine/D-amino acid oxidases (deaminating)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00474"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03595"
FT                   /db_xref="GOA:D7C0A4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A4"
FT                   /protein_id="ADI03595.1"
FT   gene            complement(551307..551975)
FT                   /locus_tag="SBI_00475"
FT   CDS_pept        complement(551307..551975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00475"
FT                   /product="haloacid dehalogenase, type II"
FT                   /note="COG1011 Predicted hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00475"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03596"
FT                   /db_xref="GOA:D7C0A5"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A5"
FT                   /protein_id="ADI03596.1"
FT                   "
FT   gene            complement(552017..553486)
FT                   /locus_tag="SBI_00476"
FT   CDS_pept        complement(552017..553486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00476"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /note="COG0747 ABC-type dipeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00476"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03597"
FT                   /db_xref="GOA:D7C0A6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A6"
FT                   /protein_id="ADI03597.1"
FT   gene            complement(553869..554825)
FT                   /locus_tag="SBI_00477"
FT   CDS_pept        complement(553869..554825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00477"
FT                   /product="cation efflux system protein"
FT                   /note="COG0053 Predicted Co/Zn/Cd cation transporters"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00477"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03598"
FT                   /db_xref="GOA:D7C0A7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A7"
FT                   /protein_id="ADI03598.1"
FT   gene            complement(555178..556629)
FT                   /locus_tag="SBI_00478"
FT   CDS_pept        complement(555178..556629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00478"
FT                   /product="hypothetical protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00478"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03599"
FT                   /db_xref="GOA:D7C0A8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A8"
FT                   /protein_id="ADI03599.1"
FT   gene            complement(556715..557392)
FT                   /locus_tag="SBI_00479"
FT   CDS_pept        complement(556715..557392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00479"
FT                   /product="ArsR family transcriptional regulator"
FT                   /note="COG0640 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00479"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03600"
FT                   /db_xref="GOA:D7C0A9"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A9"
FT                   /protein_id="ADI03600.1"
FT                   GLA"
FT   gene            complement(557516..558466)
FT                   /locus_tag="SBI_00480"
FT   CDS_pept        complement(557516..558466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00480"
FT                   /product="ycaO protein"
FT                   /note="COG1944 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03601"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B0"
FT                   /protein_id="ADI03601.1"
FT   gene            complement(558527..559732)
FT                   /locus_tag="SBI_00481"
FT   CDS_pept        complement(558527..559732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00481"
FT                   /product="hypothetical protein"
FT                   /note="COG5520 O-Glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00481"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03602"
FT                   /db_xref="GOA:D7C0B1"
FT                   /db_xref="InterPro:IPR001139"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033452"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B1"
FT                   /protein_id="ADI03602.1"
FT                   TG"
FT   gene            560309..562027
FT                   /locus_tag="SBI_00482"
FT   CDS_pept        560309..562027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00482"
FT                   /product="putative ABC transporter ATP-binding subunit"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00482"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03603"
FT                   /db_xref="GOA:D7C0B2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B2"
FT                   /protein_id="ADI03603.1"
FT   gene            562206..563786
FT                   /locus_tag="SBI_00483"
FT   CDS_pept        562206..563786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00483"
FT                   /product="DNA-binding protein"
FT                   /note="COG2508 Regulator of polyketide synthase expression"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00483"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03604"
FT                   /db_xref="GOA:D7C0B3"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B3"
FT                   /protein_id="ADI03604.1"
FT                   HITGLPSAG"
FT   gene            564355..568719
FT                   /locus_tag="SBI_00484"
FT   CDS_pept        564355..568719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00484"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03605"
FT                   /db_xref="GOA:D7C0B4"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B4"
FT                   /protein_id="ADI03605.1"
FT   gene            568720..569361
FT                   /locus_tag="SBI_00485"
FT   CDS_pept        568720..569361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03606"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B5"
FT                   /protein_id="ADI03606.1"
FT   gene            complement(569438..569740)
FT                   /locus_tag="SBI_00486"
FT   CDS_pept        complement(569438..569740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00486"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03607"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B6"
FT                   /protein_id="ADI03607.1"
FT   gene            complement(569737..571851)
FT                   /locus_tag="SBI_00487"
FT   CDS_pept        complement(569737..571851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00487"
FT                   /product="AAA family ATPase"
FT                   /note="COG0464 ATPases of the AAA+ class"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00487"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03608"
FT                   /db_xref="GOA:D7C0B7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B7"
FT                   /protein_id="ADI03608.1"
FT                   AQLLDDGTPG"
FT   gene            complement(571857..573719)
FT                   /locus_tag="SBI_00488"
FT   CDS_pept        complement(571857..573719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00488"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03609"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B8"
FT                   /protein_id="ADI03609.1"
FT   gene            complement(573716..574246)
FT                   /locus_tag="SBI_00489"
FT   CDS_pept        complement(573716..574246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00489"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03610"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B9"
FT                   /protein_id="ADI03610.1"
FT                   TGWAGHLEKAAVT"
FT   gene            complement(574249..575385)
FT                   /locus_tag="SBI_00490"
FT   CDS_pept        complement(574249..575385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03611"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C0"
FT                   /protein_id="ADI03611.1"
FT   gene            complement(575382..577397)
FT                   /locus_tag="SBI_00491"
FT   CDS_pept        complement(575382..577397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00491"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03612"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C1"
FT                   /protein_id="ADI03612.1"
FT   gene            complement(577400..580630)
FT                   /locus_tag="SBI_00492"
FT   CDS_pept        complement(577400..580630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00492"
FT                   /product="NHL repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00492"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03613"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="InterPro:IPR011748"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C2"
FT                   /protein_id="ADI03613.1"
FT   gene            complement(580627..582687)
FT                   /locus_tag="SBI_00493"
FT   CDS_pept        complement(580627..582687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00493"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03614"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR011749"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C3"
FT                   /protein_id="ADI03614.1"
FT   gene            complement(582684..584297)
FT                   /locus_tag="SBI_00494"
FT   CDS_pept        complement(582684..584297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00494"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03615"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR011749"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C4"
FT                   /protein_id="ADI03615.1"
FT   gene            584522..584662
FT                   /locus_tag="SBI_00495"
FT   CDS_pept        584522..584662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03616"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C5"
FT                   /protein_id="ADI03616.1"
FT                   R"
FT   gene            complement(584643..585065)
FT                   /locus_tag="SBI_00496"
FT   CDS_pept        complement(584643..585065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00496"
FT                   /product="tail lysozyme, putative"
FT                   /note="COG3628 Phage baseplate assembly protein W"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00496"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03617"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C6"
FT                   /protein_id="ADI03617.1"
FT   gene            complement(585062..585763)
FT                   /locus_tag="SBI_00497"
FT   CDS_pept        complement(585062..585763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00497"
FT                   /product="hypothetical protein"
FT                   /note="COG3501 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00497"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03618"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C7"
FT                   /protein_id="ADI03618.1"
FT                   PAVLAKKARTA"
FT   gene            complement(585760..586941)
FT                   /locus_tag="SBI_00498"
FT   CDS_pept        complement(585760..586941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00498"
FT                   /product="hypothetical protein"
FT                   /note="COG3500 Phage protein D"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00498"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03619"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C8"
FT                   /protein_id="ADI03619.1"
FT   gene            complement(586952..587623)
FT                   /locus_tag="SBI_00499"
FT   CDS_pept        complement(586952..587623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00499"
FT                   /product="hypothetical protein"
FT                   /note="COG1652 Uncharacterized protein containing LysM
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00499"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03620"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C9"
FT                   /protein_id="ADI03620.1"
FT                   A"
FT   gene            complement(587620..587811)
FT                   /locus_tag="SBI_00500"
FT   CDS_pept        complement(587620..587811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03621"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D0"
FT                   /protein_id="ADI03621.1"
FT                   ARARHTESERRFGDGEAS"
FT   gene            complement(587808..588326)
FT                   /locus_tag="SBI_00501"
FT   CDS_pept        complement(587808..588326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00501"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03622"
FT                   /db_xref="GOA:D7C0D1"
FT                   /db_xref="InterPro:IPR010667"
FT                   /db_xref="InterPro:IPR011747"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D1"
FT                   /protein_id="ADI03622.1"
FT                   ALPRLSQGR"
FT   gene            complement(588323..589816)
FT                   /locus_tag="SBI_00502"
FT   CDS_pept        complement(588323..589816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00502"
FT                   /product="putative phage tail sheath protein"
FT                   /note="COG3497 Phage tail sheath protein FI"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00502"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03623"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D2"
FT                   /protein_id="ADI03623.1"
FT   gene            complement(589818..590273)
FT                   /locus_tag="SBI_00503"
FT   CDS_pept        complement(589818..590273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00503"
FT                   /product="hypothetical protein"
FT                   /note="COG0085 DNA-directed RNA polymerase, beta
FT                   subunit/140 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00503"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03624"
FT                   /db_xref="GOA:D7C0D3"
FT                   /db_xref="InterPro:IPR010667"
FT                   /db_xref="InterPro:IPR011747"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D3"
FT                   /protein_id="ADI03624.1"
FT   gene            complement(590294..592558)
FT                   /locus_tag="SBI_00504"
FT   CDS_pept        complement(590294..592558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00504"
FT                   /product="hypothetical protein"
FT                   /note="COG3497 Phage tail sheath protein FI"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00504"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03625"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D4"
FT                   /protein_id="ADI03625.1"
FT                   A"
FT   gene            complement(592569..593297)
FT                   /locus_tag="SBI_00505"
FT   CDS_pept        complement(592569..593297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00505"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03626"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D5"
FT                   /protein_id="ADI03626.1"
FT   gene            complement(593306..593884)
FT                   /locus_tag="SBI_00506"
FT   CDS_pept        complement(593306..593884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00506"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03627"
FT                   /db_xref="InterPro:IPR025351"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D6"
FT                   /protein_id="ADI03627.1"
FT   gene            594081..594278
FT                   /locus_tag="SBI_00507"
FT   CDS_pept        594081..594278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00507"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03628"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D7"
FT                   /protein_id="ADI03628.1"
FT   gene            594487..595323
FT                   /locus_tag="SBI_00508"
FT   CDS_pept        594487..595323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00508"
FT                   /product="transcriptional regulator, SARP family protein"
FT                   /note="COG3629 DNA-binding transcriptional activator of the
FT                   SARP family"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00508"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03629"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D8"
FT                   /protein_id="ADI03629.1"
FT   gene            595484..596761
FT                   /locus_tag="SBI_00509"
FT   CDS_pept        595484..596761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00509"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00509"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03630"
FT                   /db_xref="GOA:D7C0D9"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D9"
FT                   /protein_id="ADI03630.1"
FT   gene            complement(596938..599853)
FT                   /locus_tag="SBI_00510"
FT   CDS_pept        complement(596938..599853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00510"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03631"
FT                   /db_xref="GOA:D7C0E0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022515"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0E0"
FT                   /protein_id="ADI03631.1"
FT   gene            complement(599855..601987)
FT                   /locus_tag="SBI_00511"
FT   CDS_pept        complement(599855..601987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00511"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="COG2274 ABC-type bacteriocin/lantibiotic exporters,
FT                   contain an N-terminal double-glycine peptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03632"
FT                   /db_xref="GOA:D7C0E1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022514"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0E1"
FT                   /protein_id="ADI03632.1"
FT                   DLAAAGGPYAELMKEH"
FT   gene            complement(602146..602952)
FT                   /locus_tag="SBI_00512"
FT   CDS_pept        complement(602146..602952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00512"
FT                   /product="hypothetical protein"
FT                   /note="COG0845 Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00512"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03633"
FT                   /db_xref="GOA:D7C0E2"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0E2"
FT                   /protein_id="ADI03633.1"
FT   gene            complement(603067..603279)
FT                   /locus_tag="SBI_00513"
FT   CDS_pept        complement(603067..603279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00513"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03634"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0E3"
FT                   /protein_id="ADI03634.1"
FT   gene            604206..604688
FT                   /locus_tag="SBI_00514"
FT   CDS_pept        604206..604688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00514"
FT                   /product="urease accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00514"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03635"
FT                   /db_xref="GOA:D7C0E4"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0E4"
FT                   /protein_id="ADI03635.1"
FT   gene            complement(604660..605457)
FT                   /locus_tag="SBI_00515"
FT   CDS_pept        complement(604660..605457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00515"
FT                   /product="Acetoacetate decarboxylase"
FT                   /note="COG4689 Acetoacetate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03636"
FT                   /db_xref="GOA:D7C0E5"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="PDB:4ZBO"
FT                   /db_xref="PDB:4ZBT"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0E5"
FT                   /protein_id="ADI03636.1"
FT   gene            605570..606187
FT                   /locus_tag="SBI_00516"
FT   CDS_pept        605570..606187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00516"
FT                   /product="2, 4-DAPG biosynthesis transcriptional repressor
FT                   PhlF"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00516"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03637"
FT                   /db_xref="GOA:D7C0E6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0E6"
FT                   /protein_id="ADI03637.1"
FT   gene            complement(606179..606838)
FT                   /locus_tag="SBI_00517"
FT   CDS_pept        complement(606179..606838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00517"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00517"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03638"
FT                   /db_xref="GOA:D7C0E7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0E7"
FT                   /protein_id="ADI03638.1"
FT   gene            606974..607375
FT                   /locus_tag="SBI_00518"
FT   CDS_pept        606974..607375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00518"
FT                   /product="Stress responsive alpha-beta barrel domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00518"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03639"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0E8"
FT                   /protein_id="ADI03639.1"
FT   gene            607759..608643
FT                   /locus_tag="SBI_00519"
FT   CDS_pept        607759..608643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00519"
FT                   /product="taurine catabolism dioxygenase"
FT                   /note="COG2175 Probable taurine catabolism dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00519"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03640"
FT                   /db_xref="GOA:D7C0E9"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0E9"
FT                   /protein_id="ADI03640.1"
FT                   TVHDDHAFYGPTT"
FT   gene            608640..609206
FT                   /locus_tag="SBI_00520"
FT   CDS_pept        608640..609206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03641"
FT                   /db_xref="InterPro:IPR022598"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0F0"
FT                   /protein_id="ADI03641.1"
FT   gene            609203..609598
FT                   /locus_tag="SBI_00521"
FT   CDS_pept        609203..609598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00521"
FT                   /product="acyl carrier protein"
FT                   /note="COG3321 Polyketide synthase modules and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00521"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03642"
FT                   /db_xref="GOA:D7C0F1"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0F1"
FT                   /protein_id="ADI03642.1"
FT   gene            609650..615091
FT                   /gene="pks2"
FT                   /locus_tag="SBI_00522"
FT   CDS_pept        609650..615091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pks2"
FT                   /locus_tag="SBI_00522"
FT                   /product="modular polyketide synthase"
FT                   /note="COG3321 Polyketide synthase modules and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00522"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03643"
FT                   /db_xref="GOA:D7C0F2"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0F2"
FT                   /protein_id="ADI03643.1"
FT   gene            615088..616545
FT                   /locus_tag="SBI_00523"
FT   CDS_pept        615088..616545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00523"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="COG3321 Polyketide synthase modules and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00523"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03644"
FT                   /db_xref="GOA:D7C0F3"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0F3"
FT                   /protein_id="ADI03644.1"
FT   gene            616574..618160
FT                   /locus_tag="SBI_00524"
FT   CDS_pept        616574..618160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00524"
FT                   /product="long-chain-fatty-acid--CoA ligase"
FT                   /note="COG0318 Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00524"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03645"
FT                   /db_xref="GOA:D7C0F4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0F4"
FT                   /protein_id="ADI03645.1"
FT                   QLWADSDRKVN"
FT   gene            618181..619494
FT                   /gene="cyp10"
FT                   /locus_tag="SBI_00525"
FT   CDS_pept        618181..619494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp10"
FT                   /locus_tag="SBI_00525"
FT                   /product="cytochrome P450"
FT                   /note="COG2124 Cytochrome P450, CYP1039A1"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03646"
FT                   /db_xref="GOA:D7C0F5"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0F5"
FT                   /protein_id="ADI03646.1"
FT   gene            619521..620285
FT                   /locus_tag="SBI_00526"
FT   CDS_pept        619521..620285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00526"
FT                   /product="acetoacetate decarboxylase"
FT                   /EC_number=""
FT                   /note="COG4689 Acetoacetate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00526"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03647"
FT                   /db_xref="GOA:D7C0F6"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0F6"
FT                   /protein_id="ADI03647.1"
FT   gene            complement(620299..621843)
FT                   /locus_tag="SBI_00527"
FT   CDS_pept        complement(620299..621843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00527"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03648"
FT                   /db_xref="GOA:D7C0F7"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0F7"
FT                   /protein_id="ADI03648.1"
FT   gene            complement(621851..624298)
FT                   /locus_tag="SBI_00528"
FT   CDS_pept        complement(621851..624298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00528"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03649"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0F8"
FT                   /protein_id="ADI03649.1"
FT                   EGG"
FT   gene            complement(624295..625485)
FT                   /locus_tag="SBI_00529"
FT   CDS_pept        complement(624295..625485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00529"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03650"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0F9"
FT                   /protein_id="ADI03650.1"
FT   gene            complement(625486..627171)
FT                   /locus_tag="SBI_00530"
FT   CDS_pept        complement(625486..627171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00530"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="COG0443 Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03651"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G0"
FT                   /protein_id="ADI03651.1"
FT   gene            complement(627176..629179)
FT                   /locus_tag="SBI_00531"
FT   CDS_pept        complement(627176..629179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00531"
FT                   /product="ATPase AAA-2"
FT                   /note="COG0542 ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00531"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03652"
FT                   /db_xref="GOA:D7C0G1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G1"
FT                   /protein_id="ADI03652.1"
FT   gene            complement(629164..630597)
FT                   /locus_tag="SBI_00532"
FT   CDS_pept        complement(629164..630597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00532"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03653"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G2"
FT                   /protein_id="ADI03653.1"
FT   gene            complement(630594..631238)
FT                   /locus_tag="SBI_00533"
FT   CDS_pept        complement(630594..631238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00533"
FT                   /product="putative radical activating enzyme"
FT                   /note="COG0602 Organic radical activating enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00533"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03654"
FT                   /db_xref="GOA:D7C0G3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G3"
FT                   /protein_id="ADI03654.1"
FT   gene            complement(631235..632317)
FT                   /locus_tag="SBI_00534"
FT   CDS_pept        complement(631235..632317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00534"
FT                   /product="hypothetical protein"
FT                   /note="COG4248 Uncharacterized protein with protein kinase
FT                   and helix-hairpin-helix DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00534"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03655"
FT                   /db_xref="GOA:D7C0G4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G4"
FT                   /protein_id="ADI03655.1"
FT   gene            complement(632314..633084)
FT                   /locus_tag="SBI_00535"
FT   CDS_pept        complement(632314..633084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00535"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03656"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G5"
FT                   /protein_id="ADI03656.1"
FT   gene            complement(633081..633851)
FT                   /locus_tag="SBI_00536"
FT   CDS_pept        complement(633081..633851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00536"
FT                   /product="von Willebrand factor type A"
FT                   /note="COG4245 Uncharacterized protein encoded in toxicity
FT                   protection region of plasmid R478, contains von Willebrand
FT                   factor (vWF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00536"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03657"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G6"
FT                   /protein_id="ADI03657.1"
FT   gene            complement(633848..634063)
FT                   /locus_tag="SBI_00537"
FT   CDS_pept        complement(633848..634063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00537"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03658"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G7"
FT                   /protein_id="ADI03658.1"
FT   gene            complement(634221..635291)
FT                   /locus_tag="SBI_00538"
FT   CDS_pept        complement(634221..635291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00538"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03659"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G8"
FT                   /protein_id="ADI03659.1"
FT                   ARTRPGRDQSAPGRSV"
FT   gene            complement(635408..636085)
FT                   /locus_tag="SBI_00539"
FT   CDS_pept        complement(635408..636085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00539"
FT                   /product="RES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00539"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03660"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G9"
FT                   /protein_id="ADI03660.1"
FT                   LHR"
FT   gene            complement(636085..636777)
FT                   /locus_tag="SBI_00540"
FT   CDS_pept        complement(636085..636777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03661"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H0"
FT                   /protein_id="ADI03661.1"
FT                   AVALVEGD"
FT   gene            complement(636774..640142)
FT                   /locus_tag="SBI_00541"
FT   CDS_pept        complement(636774..640142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00541"
FT                   /product="hypothetical protein"
FT                   /note="COG4995 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00541"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03662"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H1"
FT                   /protein_id="ADI03662.1"
FT                   AFIHQGHPGQGKETV"
FT   gene            complement(640252..640860)
FT                   /locus_tag="SBI_00542"
FT   CDS_pept        complement(640252..640860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00542"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03663"
FT                   /db_xref="GOA:D7C0H2"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H2"
FT                   /protein_id="ADI03663.1"
FT   gene            640979..641110
FT                   /locus_tag="SBI_00543"
FT   CDS_pept        640979..641110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00543"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03664"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H3"
FT                   /protein_id="ADI03664.1"
FT   gene            641213..641839
FT                   /locus_tag="SBI_00544"
FT   CDS_pept        641213..641839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00544"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03665"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H4"
FT                   /protein_id="ADI03665.1"
FT   gene            complement(641860..642273)
FT                   /locus_tag="SBI_00545"
FT   CDS_pept        complement(641860..642273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03666"
FT                   /db_xref="GOA:D7C0H5"
FT                   /db_xref="InterPro:IPR025597"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H5"
FT                   /protein_id="ADI03666.1"
FT   gene            642364..643023
FT                   /locus_tag="SBI_00546"
FT   CDS_pept        642364..643023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00546"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00546"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03667"
FT                   /db_xref="GOA:D7C0H6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H6"
FT                   /protein_id="ADI03667.1"
FT   gene            643053..644183
FT                   /locus_tag="SBI_00547"
FT   CDS_pept        643053..644183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00547"
FT                   /product="regulatory protein DeoR"
FT                   /note="COG1609 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00547"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03668"
FT                   /db_xref="GOA:D7C0H7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H7"
FT                   /protein_id="ADI03668.1"
FT   gene            644441..645460
FT                   /locus_tag="SBI_00548"
FT   CDS_pept        644441..645460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00548"
FT                   /product="glycosyl hydrolase 53 domain protein"
FT                   /note="COG3867 Arabinogalactan endo-1,4-beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00548"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03669"
FT                   /db_xref="GOA:D7C0H8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011683"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H8"
FT                   /protein_id="ADI03669.1"
FT   gene            645533..646861
FT                   /locus_tag="SBI_00549"
FT   CDS_pept        645533..646861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00549"
FT                   /product="pectate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00549"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03670"
FT                   /db_xref="GOA:D7C0H9"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H9"
FT                   /protein_id="ADI03670.1"
FT   gene            complement(646895..647539)
FT                   /locus_tag="SBI_00550"
FT   CDS_pept        complement(646895..647539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00550"
FT                   /product="hydrolase"
FT                   /note="COG0412 Dienelactone hydrolase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03671"
FT                   /db_xref="GOA:D7C0I0"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0I0"
FT                   /protein_id="ADI03671.1"
FT   gene            647742..648227
FT                   /locus_tag="SBI_00551"
FT   CDS_pept        647742..648227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00551"
FT                   /product="MarR family transcriptional regulator"
FT                   /note="COG1846 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00551"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03672"
FT                   /db_xref="GOA:D7C0I1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0I1"
FT                   /protein_id="ADI03672.1"
FT   gene            648348..649454
FT                   /locus_tag="SBI_00552"
FT   CDS_pept        648348..649454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00552"
FT                   /product="transcriptional regulator"
FT                   /note="COG1609 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00552"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03673"
FT                   /db_xref="GOA:D7C0I2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0I2"
FT                   /protein_id="ADI03673.1"
FT   gene            649508..651106
FT                   /locus_tag="SBI_00553"
FT   CDS_pept        649508..651106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00553"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00553"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03674"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0I3"
FT                   /protein_id="ADI03674.1"
FT                   DRAGVQRHWPDVRGY"
FT   gene            651169..653301
FT                   /locus_tag="SBI_00554"
FT   CDS_pept        651169..653301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00554"
FT                   /product="ATP utilising protein"
FT                   /note="COG0145 N-methylhydantoinase A/acetone carboxylase,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00554"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03675"
FT                   /db_xref="GOA:D7C0I4"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0I4"
FT                   /protein_id="ADI03675.1"
FT                   ARAADEPVIAVVESRV"
FT   gene            653298..653888
FT                   /locus_tag="SBI_00555"
FT   CDS_pept        653298..653888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00555"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03676"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0I5"
FT                   /protein_id="ADI03676.1"
FT   gene            653892..655178
FT                   /locus_tag="SBI_00556"
FT   CDS_pept        653892..655178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00556"
FT                   /product="transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00556"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03677"
FT                   /db_xref="GOA:D7C0I6"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0I6"
FT                   /protein_id="ADI03677.1"
FT   gene            655252..656223
FT                   /locus_tag="SBI_00557"
FT   CDS_pept        655252..656223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00557"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00557"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03678"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0I7"
FT                   /protein_id="ADI03678.1"
FT   gene            656364..657161
FT                   /gene="thyA"
FT                   /locus_tag="SBI_00558"
FT   CDS_pept        656364..657161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="SBI_00558"
FT                   /product="thymidylate synthase"
FT                   /EC_number=""
FT                   /note="COG0207 Thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00558"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03679"
FT                   /db_xref="GOA:D7C0I8"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0I8"
FT                   /protein_id="ADI03679.1"
FT   gene            657183..657575
FT                   /locus_tag="SBI_00559"
FT   CDS_pept        657183..657575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00559"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="COG2207 AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00559"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03680"
FT                   /db_xref="GOA:D7C0I9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0I9"
FT                   /protein_id="ADI03680.1"
FT   gene            complement(657632..658252)
FT                   /locus_tag="SBI_00560"
FT   CDS_pept        complement(657632..658252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00560"
FT                   /product="hypothetical protein"
FT                   /note="COG0009 Putative translation factor (SUA5)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03681"
FT                   /db_xref="GOA:D7C0J0"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J0"
FT                   /protein_id="ADI03681.1"
FT   gene            complement(658327..658557)
FT                   /locus_tag="SBI_00561"
FT   CDS_pept        complement(658327..658557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00561"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00561"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03682"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J1"
FT                   /protein_id="ADI03682.1"
FT   gene            complement(658665..659969)
FT                   /locus_tag="SBI_00562"
FT   CDS_pept        complement(658665..659969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00562"
FT                   /product="hydrolytic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00562"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03683"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J2"
FT                   /protein_id="ADI03683.1"
FT   gene            complement(660033..663233)
FT                   /locus_tag="SBI_00563"
FT   CDS_pept        complement(660033..663233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00563"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03684"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J3"
FT                   /protein_id="ADI03684.1"
FT                   LDRLDEALRRHRPAATHG"
FT   gene            complement(663230..663964)
FT                   /locus_tag="SBI_00564"
FT   CDS_pept        complement(663230..663964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00564"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03685"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J4"
FT                   /protein_id="ADI03685.1"
FT   gene            complement(664015..666369)
FT                   /locus_tag="SBI_00565"
FT   CDS_pept        complement(664015..666369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00565"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03686"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J5"
FT                   /protein_id="ADI03686.1"
FT   gene            709390..709509
FT                   /locus_tag="SBI_00566"
FT   CDS_pept        709390..709509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00566"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03687"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J6"
FT                   /protein_id="ADI03687.1"
FT   gene            complement(722830..723243)
FT                   /locus_tag="SBI_00567"
FT   CDS_pept        complement(722830..723243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00567"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03688"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J7"
FT                   /protein_id="ADI03688.1"
FT   gene            complement(723240..723713)
FT                   /locus_tag="SBI_00568"
FT   CDS_pept        complement(723240..723713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00568"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03689"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J8"
FT                   /protein_id="ADI03689.1"
FT   gene            complement(723778..724728)
FT                   /locus_tag="SBI_00569"
FT   CDS_pept        complement(723778..724728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00569"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03690"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J9"
FT                   /protein_id="ADI03690.1"
FT   gene            724765..725325
FT                   /locus_tag="SBI_00570"
FT   CDS_pept        724765..725325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03691"
FT                   /db_xref="GOA:D7C0K0"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K0"
FT                   /protein_id="ADI03691.1"
FT   gene            725391..725546
FT                   /locus_tag="SBI_00571"
FT   CDS_pept        725391..725546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00571"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03692"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K1"
FT                   /protein_id="ADI03692.1"
FT                   SCSAFC"
FT   gene            725579..727690
FT                   /locus_tag="SBI_00572"
FT   CDS_pept        725579..727690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00572"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03693"
FT                   /db_xref="GOA:D7C0K2"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K2"
FT                   /protein_id="ADI03693.1"
FT                   GTTTAHLLS"
FT   gene            complement(727701..728189)
FT                   /locus_tag="SBI_00573"
FT   CDS_pept        complement(727701..728189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00573"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03694"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K3"
FT                   /protein_id="ADI03694.1"
FT   gene            complement(728299..728616)
FT                   /locus_tag="SBI_00574"
FT   CDS_pept        complement(728299..728616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00574"
FT                   /product="hypothetical protein"
FT                   /note="COG4842 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00574"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03695"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K4"
FT                   /protein_id="ADI03695.1"
FT                   R"
FT   gene            complement(728702..729037)
FT                   /locus_tag="SBI_00575"
FT   CDS_pept        complement(728702..729037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03696"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K5"
FT                   /protein_id="ADI03696.1"
FT                   IFDALHG"
FT   gene            complement(729252..730703)
FT                   /locus_tag="SBI_00576"
FT   CDS_pept        complement(729252..730703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00576"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03697"
FT                   /db_xref="GOA:D7C0K6"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K6"
FT                   /protein_id="ADI03697.1"
FT   gene            complement(730736..732136)
FT                   /locus_tag="SBI_00577"
FT   CDS_pept        complement(730736..732136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00577"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03698"
FT                   /db_xref="GOA:D7C0K7"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K7"
FT                   /protein_id="ADI03698.1"
FT                   SALRGLMA"
FT   gene            732514..736476
FT                   /locus_tag="SBI_00578"
FT   CDS_pept        732514..736476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00578"
FT                   /product="putative FtsK/SpoIIIE family protein"
FT                   /note="COG1674 DNA segregation ATPase FtsK/SpoIIIE and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00578"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03699"
FT                   /db_xref="GOA:D7C0K8"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K8"
FT                   /protein_id="ADI03699.1"
FT   gene            complement(736602..736793)
FT                   /locus_tag="SBI_00579"
FT   CDS_pept        complement(736602..736793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00579"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03700"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K9"
FT                   /protein_id="ADI03700.1"
FT                   CNGKIVQGREKVWDLFVR"
FT   gene            complement(737241..738449)
FT                   /locus_tag="SBI_00580"
FT   CDS_pept        complement(737241..738449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00580"
FT                   /product="putative secreted subtilisin-like serine
FT                   protease"
FT                   /note="COG1404 Subtilisin-like serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03701"
FT                   /db_xref="GOA:D7C0L0"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0L0"
FT                   /protein_id="ADI03701.1"
FT                   GSS"
FT   gene            738653..741958
FT                   /locus_tag="SBI_00581"
FT   CDS_pept        738653..741958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00581"
FT                   /product="hypothetical protein"
FT                   /note="COG0464 ATPases of the AAA+ class"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00581"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03702"
FT                   /db_xref="GOA:D7C0L1"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0L1"
FT                   /protein_id="ADI03702.1"
FT   gene            complement(742010..742684)
FT                   /locus_tag="SBI_00582"
FT   CDS_pept        complement(742010..742684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00582"
FT                   /product="putative transcriptional regulator, TetR family
FT                   protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00582"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03703"
FT                   /db_xref="GOA:D7C0L2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0L2"
FT                   /protein_id="ADI03703.1"
FT                   IA"
FT   gene            complement(742767..743465)
FT                   /locus_tag="SBI_00583"
FT   CDS_pept        complement(742767..743465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00583"
FT                   /product="hypothetical protein"
FT                   /note="COG0285 Folylpolyglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00583"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03704"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0L3"
FT                   /protein_id="ADI03704.1"
FT                   QQSMDNALSW"
FT   gene            743663..744994
FT                   /locus_tag="SBI_00584"
FT   CDS_pept        743663..744994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00584"
FT                   /product="DNA-binding protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00584"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03705"
FT                   /db_xref="GOA:D7C0L4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0L4"
FT                   /protein_id="ADI03705.1"
FT   gene            complement(744991..747312)
FT                   /locus_tag="SBI_00585"
FT   CDS_pept        complement(744991..747312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00585"
FT                   /product="alpha-xylosidase YicI"
FT                   /note="COG1501 Alpha-glucosidases, family 31 of glycosyl
FT                   hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00585"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03706"
FT                   /db_xref="GOA:D7C0L5"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0L5"
FT                   /protein_id="ADI03706.1"
FT   gene            complement(747314..748732)
FT                   /gene="bga3"
FT                   /locus_tag="SBI_00586"
FT   CDS_pept        complement(747314..748732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bga3"
FT                   /locus_tag="SBI_00586"
FT                   /product="beta-glucosidase"
FT                   /note="COG2723
FT                   Beta-glucosidase/6-phospho-beta-glucosidase/beta-
FT                   galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00586"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03707"
FT                   /db_xref="GOA:D7C0L6"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017736"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0L6"
FT                   /protein_id="ADI03707.1"
FT                   RELITVNRASTQEH"
FT   gene            complement(748773..749597)
FT                   /locus_tag="SBI_00587"
FT   CDS_pept        complement(748773..749597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00587"
FT                   /product="sugar transport integral membrane protein"
FT                   /note="COG0395 ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00587"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03708"
FT                   /db_xref="GOA:D7C0L7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0L7"
FT                   /protein_id="ADI03708.1"
FT   gene            complement(749594..750547)
FT                   /locus_tag="SBI_00588"
FT   CDS_pept        complement(749594..750547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00588"
FT                   /product="sugar transport integral membrane protein"
FT                   /note="COG1175 ABC-type sugar transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00588"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03709"
FT                   /db_xref="GOA:D7C0L8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0L8"
FT                   /protein_id="ADI03709.1"
FT   gene            complement(750557..751789)
FT                   /locus_tag="SBI_00589"
FT   CDS_pept        complement(750557..751789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00589"
FT                   /product="sugar transport sugar binding protein"
FT                   /note="COG1653 ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00589"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03710"
FT                   /db_xref="GOA:D7C0L9"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0L9"
FT                   /protein_id="ADI03710.1"
FT                   RAQSQATAGGE"
FT   gene            complement(752033..753001)
FT                   /locus_tag="SBI_00590"
FT   CDS_pept        complement(752033..753001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00590"
FT                   /product="transcriptional regulator, LacI family protein"
FT                   /note="COG1609 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03711"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7C257"
FT                   /protein_id="ADI03711.1"
FT   gene            complement(753234..754829)
FT                   /locus_tag="SBI_00591"
FT   CDS_pept        complement(753234..754829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00591"
FT                   /product="transcriptional regulator, PucR family protein"
FT                   /note="COG2508 Regulator of polyketide synthase expression"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00591"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03712"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D7C258"
FT                   /protein_id="ADI03712.1"
FT                   RTSLHTALMIVDAR"
FT   gene            754945..756450
FT                   /locus_tag="SBI_00592"
FT   CDS_pept        754945..756450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00592"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00592"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03713"
FT                   /db_xref="GOA:D7C259"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D7C259"
FT                   /protein_id="ADI03713.1"
FT   gene            756485..757849
FT                   /locus_tag="SBI_00593"
FT   CDS_pept        756485..757849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00593"
FT                   /product="hypothetical protein"
FT                   /note="COG0160 4-aminobutyrate aminotransferase and related
FT                   aminotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00593"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03714"
FT                   /db_xref="GOA:D7C260"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7C260"
FT                   /protein_id="ADI03714.1"
FT   gene            complement(757844..758059)
FT                   /locus_tag="SBI_00594"
FT   CDS_pept        complement(757844..758059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00594"
FT                   /product="hypothetical protein"
FT                   /note="COG0440 Acetolactate synthase, small (regulatory)
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00594"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03715"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:D7C261"
FT                   /protein_id="ADI03715.1"
FT   gene            758270..758731
FT                   /locus_tag="SBI_00595"
FT   CDS_pept        758270..758731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00595"
FT                   /product="transcription regulator AsnC"
FT                   /note="COG1522 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00595"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03716"
FT                   /db_xref="GOA:D7C262"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7C262"
FT                   /protein_id="ADI03716.1"
FT   gene            758954..759793
FT                   /locus_tag="SBI_00596"
FT   CDS_pept        758954..759793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00596"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /note="COG1262 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00596"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03717"
FT                   /db_xref="GOA:D7C263"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:D7C263"
FT                   /protein_id="ADI03717.1"
FT   gene            759927..762194
FT                   /locus_tag="SBI_00597"
FT   CDS_pept        759927..762194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00597"
FT                   /product="arylsulfatase"
FT                   /note="COG3119 Arylsulfatase A and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00597"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03718"
FT                   /db_xref="GOA:D7C264"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D7C264"
FT                   /protein_id="ADI03718.1"
FT                   ID"
FT   gene            complement(762267..763064)
FT                   /locus_tag="SBI_00598"
FT   CDS_pept        complement(762267..763064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00598"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00598"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03719"
FT                   /db_xref="GOA:D7C265"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7C265"
FT                   /protein_id="ADI03719.1"
FT   gene            complement(763070..764584)
FT                   /locus_tag="SBI_00599"
FT   CDS_pept        complement(763070..764584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00599"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00599"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03720"
FT                   /db_xref="GOA:D7C266"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D7C266"
FT                   /protein_id="ADI03720.1"
FT   gene            complement(764587..765420)
FT                   /locus_tag="SBI_00600"
FT   CDS_pept        complement(764587..765420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00600"
FT                   /product="ABC transporter related protein"
FT                   /note="COG1123 ATPase components of various ABC-type
FT                   transport systems, contain duplicated ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03721"
FT                   /db_xref="GOA:D7C267"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7C267"
FT                   /protein_id="ADI03721.1"
FT   gene            complement(765413..766456)
FT                   /locus_tag="SBI_00601"
FT   CDS_pept        complement(765413..766456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00601"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00601"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03722"
FT                   /db_xref="GOA:D7C268"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7C268"
FT                   /protein_id="ADI03722.1"
FT                   NQEAGRG"
FT   gene            complement(766453..767346)
FT                   /locus_tag="SBI_00602"
FT   CDS_pept        complement(766453..767346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00602"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00602"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03723"
FT                   /db_xref="GOA:D7C269"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7C269"
FT                   /protein_id="ADI03723.1"
FT                   GDGLRDRFDPKLEDRR"
FT   gene            complement(767343..768293)
FT                   /locus_tag="SBI_00603"
FT   CDS_pept        complement(767343..768293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00603"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00603"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03724"
FT                   /db_xref="GOA:D7C270"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7C270"
FT                   /protein_id="ADI03724.1"
FT   gene            complement(768310..769842)
FT                   /locus_tag="SBI_00604"
FT   CDS_pept        complement(768310..769842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00604"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="COG0747 ABC-type dipeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00604"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03725"
FT                   /db_xref="GOA:D7C271"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D7C271"
FT                   /protein_id="ADI03725.1"
FT   gene            complement(769848..770921)
FT                   /locus_tag="SBI_00605"
FT   CDS_pept        complement(769848..770921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00605"
FT                   /product="putative isocitrate/isopropylmalate dehydrogenase
FT                   / tartrate dehydrogenase ttuC"
FT                   /note="COG0473 Isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00605"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03726"
FT                   /db_xref="GOA:D7C272"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D7C272"
FT                   /protein_id="ADI03726.1"
FT                   TTADVSSAVLHTMESQG"
FT   gene            771072..772538
FT                   /locus_tag="SBI_00606"
FT   CDS_pept        771072..772538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00606"
FT                   /product="amidase"
FT                   /EC_number=""
FT                   /note="COG0154 Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit and related amidases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00606"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03727"
FT                   /db_xref="GOA:D7C273"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D7C273"
FT                   /protein_id="ADI03727.1"
FT   gene            772535..773302
FT                   /locus_tag="SBI_00607"
FT   CDS_pept        772535..773302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00607"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="COG2186 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00607"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03728"
FT                   /db_xref="GOA:D7C274"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7C274"
FT                   /protein_id="ADI03728.1"
FT   gene            complement(773318..776548)
FT                   /locus_tag="SBI_00608"
FT   CDS_pept        complement(773318..776548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00608"
FT                   /product="putative methylmalonyl-CoA mutase"
FT                   /note="COG2185 Methylmalonyl-CoA mutase, C-terminal
FT                   domain/subunit (cobalamin-binding)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00608"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03729"
FT                   /db_xref="GOA:D7C275"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033669"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D7C275"
FT                   /protein_id="ADI03729.1"
FT   gene            complement(776665..777429)
FT                   /locus_tag="SBI_00609"
FT   CDS_pept        complement(776665..777429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00609"
FT                   /product="hypothetical protein"
FT                   /note="COG0614 ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00609"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03730"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D7C276"
FT                   /protein_id="ADI03730.1"
FT   gene            complement(777477..778232)
FT                   /locus_tag="SBI_00610"
FT   CDS_pept        complement(777477..778232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00610"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /note="COG3899 Predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03731"
FT                   /db_xref="UniProtKB/TrEMBL:D7C277"
FT                   /protein_id="ADI03731.1"
FT   gene            778197..778421
FT                   /locus_tag="SBI_00611"
FT   CDS_pept        778197..778421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00611"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03732"
FT                   /db_xref="UniProtKB/TrEMBL:D7C278"
FT                   /protein_id="ADI03732.1"
FT   gene            778910..780310
FT                   /locus_tag="SBI_00612"
FT   CDS_pept        778910..780310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00612"
FT                   /product="integral membrane protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00612"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03733"
FT                   /db_xref="GOA:D7C279"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7C279"
FT                   /protein_id="ADI03733.1"
FT                   TKKKGAQA"
FT   gene            780307..781530
FT                   /locus_tag="SBI_00613"
FT   CDS_pept        780307..781530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00613"
FT                   /product="putative oxidoreductase"
FT                   /note="COG0654 2-polyprenyl-6-methoxyphenol hydroxylase and
FT                   related FAD-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00613"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03734"
FT                   /db_xref="GOA:D7C280"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7C280"
FT                   /protein_id="ADI03734.1"
FT                   LPEFAPMP"
FT   gene            complement(781777..782457)
FT                   /locus_tag="SBI_00614"
FT   CDS_pept        complement(781777..782457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00614"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family protein"
FT                   /note="COG2197 Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00614"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03735"
FT                   /db_xref="GOA:D7C281"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D7C281"
FT                   /protein_id="ADI03735.1"
FT                   GRLP"
FT   gene            complement(782466..783887)
FT                   /locus_tag="SBI_00615"
FT   CDS_pept        complement(782466..783887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00615"
FT                   /product="histidine kinase"
FT                   /note="COG4585 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00615"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03736"
FT                   /db_xref="GOA:D7C282"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7C282"
FT                   /protein_id="ADI03736.1"
FT                   TGDGRTDGGETGDAP"
FT   gene            complement(783817..786099)
FT                   /locus_tag="SBI_00616"
FT   CDS_pept        complement(783817..786099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00616"
FT                   /product="membrane transport protein"
FT                   /note="COG2409 Predicted drug exporters of the RND
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00616"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03737"
FT                   /db_xref="GOA:D7C283"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D7C283"
FT                   /protein_id="ADI03737.1"
FT                   PVGRHRH"
FT   gene            complement(786302..786484)
FT                   /locus_tag="SBI_00617"
FT   CDS_pept        complement(786302..786484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00617"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03738"
FT                   /db_xref="UniProtKB/TrEMBL:D7C284"
FT                   /protein_id="ADI03738.1"
FT                   LTGRGRVRRCHACGV"
FT   gene            complement(786606..792845)
FT                   /locus_tag="SBI_00618"
FT   CDS_pept        complement(786606..792845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00618"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /note="COG1020 Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00618"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03739"
FT                   /db_xref="GOA:D7C285"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7C285"
FT                   /protein_id="ADI03739.1"
FT   gene            793081..794091
FT                   /locus_tag="SBI_00619"
FT   CDS_pept        793081..794091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00619"
FT                   /product="methyltransferase type 12"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00619"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03740"
FT                   /db_xref="GOA:D7C286"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030899"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7C286"
FT                   /protein_id="ADI03740.1"
FT   gene            complement(794088..795257)
FT                   /locus_tag="SBI_00620"
FT   CDS_pept        complement(794088..795257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00620"
FT                   /product="aminotransferase"
FT                   /note="COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03741"
FT                   /db_xref="GOA:D7C287"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR030898"
FT                   /db_xref="UniProtKB/TrEMBL:D7C287"
FT                   /protein_id="ADI03741.1"
FT   gene            complement(795257..796297)
FT                   /locus_tag="SBI_00621"
FT   CDS_pept        complement(795257..796297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00621"
FT                   /product="scyllo-inosamine-4-phosphate amidinotransferase"
FT                   /note="COG1834 N-Dimethylarginine dimethylaminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00621"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03742"
FT                   /db_xref="GOA:D7C288"
FT                   /db_xref="InterPro:IPR033195"
FT                   /db_xref="UniProtKB/TrEMBL:D7C288"
FT                   /protein_id="ADI03742.1"
FT                   TLETYR"
FT   gene            complement(796294..796560)
FT                   /locus_tag="SBI_00622"
FT   CDS_pept        complement(796294..796560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00622"
FT                   /product="MbtH domain protein"
FT                   /note="COG3251 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00622"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03743"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:D7C289"
FT                   /protein_id="ADI03743.1"
FT   gene            796718..797905
FT                   /locus_tag="SBI_00623"
FT   CDS_pept        796718..797905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00623"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00623"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03744"
FT                   /db_xref="GOA:D7C290"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7C290"
FT                   /protein_id="ADI03744.1"
FT   gene            797881..801825
FT                   /locus_tag="SBI_00624"
FT   CDS_pept        797881..801825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00624"
FT                   /product="nonribosomal peptide synthetase DhbF"
FT                   /note="COG1020 Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00624"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03745"
FT                   /db_xref="GOA:D7C291"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7C291"
FT                   /protein_id="ADI03745.1"
FT   gene            complement(801750..807356)
FT                   /locus_tag="SBI_00625"
FT   CDS_pept        complement(801750..807356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00625"
FT                   /product="amino acid adenylation domain-containing protein"
FT                   /note="COG1020 Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00625"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03746"
FT                   /db_xref="GOA:D7C292"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7C292"
FT                   /protein_id="ADI03746.1"
FT   gene            complement(807455..808165)
FT                   /locus_tag="SBI_00626"
FT   CDS_pept        complement(807455..808165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00626"
FT                   /product="hypothetical protein"
FT                   /note="COG2045 Phosphosulfolactate phosphohydrolase and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00626"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03747"
FT                   /db_xref="GOA:D7C293"
FT                   /db_xref="InterPro:IPR005238"
FT                   /db_xref="InterPro:IPR036702"
FT                   /db_xref="UniProtKB/TrEMBL:D7C293"
FT                   /protein_id="ADI03747.1"
FT                   RPRAMQSLTDDAPI"
FT   gene            complement(808245..809153)
FT                   /locus_tag="SBI_00627"
FT   CDS_pept        complement(808245..809153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00627"
FT                   /product="putative methyltransferase"
FT                   /note="COG3315 O-Methyltransferase involved in polyketide
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00627"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03748"
FT                   /db_xref="GOA:D7C294"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7C294"
FT                   /protein_id="ADI03748.1"
FT   gene            complement(809203..810306)
FT                   /locus_tag="SBI_00628"
FT   CDS_pept        complement(809203..810306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00628"
FT                   /product="putative alcohol dehydrogenase"
FT                   /note="COG1062 Zn-dependent alcohol dehydrogenases, class
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00628"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03749"
FT                   /db_xref="GOA:D7C295"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7C295"
FT                   /protein_id="ADI03749.1"
FT   gene            complement(810309..811712)
FT                   /locus_tag="SBI_00629"
FT   CDS_pept        complement(810309..811712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00629"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00629"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03750"
FT                   /db_xref="GOA:D7C296"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D7C296"
FT                   /protein_id="ADI03750.1"
FT                   FVVHRPEEA"
FT   gene            complement(811721..812473)
FT                   /locus_tag="SBI_00630"
FT   CDS_pept        complement(811721..812473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00630"
FT                   /product="hypothetical protein"
FT                   /note="COG1891 Uncharacterized protein conserved in
FT                   archaea"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03751"
FT                   /db_xref="GOA:D7C297"
FT                   /db_xref="InterPro:IPR007565"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:D7C297"
FT                   /protein_id="ADI03751.1"
FT   gene            complement(812877..814055)
FT                   /locus_tag="SBI_00631"
FT   CDS_pept        complement(812877..814055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00631"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03752"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D7C298"
FT                   /protein_id="ADI03752.1"
FT   gene            complement(814112..814672)
FT                   /locus_tag="SBI_00632"
FT   CDS_pept        complement(814112..814672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00632"
FT                   /product="putative transcriptional regulator"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00632"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03753"
FT                   /db_xref="GOA:D7C299"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7C299"
FT                   /protein_id="ADI03753.1"
FT   gene            814743..814940
FT                   /locus_tag="SBI_00633"
FT   CDS_pept        814743..814940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00633"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03754"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A0"
FT                   /protein_id="ADI03754.1"
FT   gene            complement(815010..819215)
FT                   /locus_tag="SBI_00634"
FT   CDS_pept        complement(815010..819215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00634"
FT                   /product="secreted glycosyl hydrolase"
FT                   /note="COG3979 Uncharacterized protein contain
FT                   chitin-binding domain type 3"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00634"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03755"
FT                   /db_xref="GOA:D7C2A1"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011635"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033801"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A1"
FT                   /protein_id="ADI03755.1"
FT   gene            complement(819716..821857)
FT                   /locus_tag="SBI_00635"
FT   CDS_pept        complement(819716..821857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00635"
FT                   /product="hypothetical protein"
FT                   /note="COG3828 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00635"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03756"
FT                   /db_xref="GOA:D7C2A2"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR026071"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A2"
FT                   /protein_id="ADI03756.1"
FT   gene            complement(821881..824730)
FT                   /locus_tag="SBI_00636"
FT   CDS_pept        complement(821881..824730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00636"
FT                   /product="Glucose/sorbosone dehydrogenase-like protein"
FT                   /note="COG2133 Glucose/sorbosone dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00636"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03757"
FT                   /db_xref="GOA:D7C2A3"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A3"
FT                   /protein_id="ADI03757.1"
FT   gene            complement(825143..826201)
FT                   /locus_tag="SBI_00637"
FT   CDS_pept        complement(825143..826201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00637"
FT                   /product="tartrate dehydrogenase"
FT                   /note="COG0473 Isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00637"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03758"
FT                   /db_xref="GOA:D7C2A4"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A4"
FT                   /protein_id="ADI03758.1"
FT                   TAEFTDKLLGLL"
FT   gene            complement(826279..827157)
FT                   /locus_tag="SBI_00638"
FT   CDS_pept        complement(826279..827157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00638"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00638"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03759"
FT                   /db_xref="GOA:D7C2A5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A5"
FT                   /protein_id="ADI03759.1"
FT                   AFWTTAVPSSP"
FT   gene            complement(827353..828012)
FT                   /locus_tag="SBI_00639"
FT   CDS_pept        complement(827353..828012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00639"
FT                   /product="hypothetical protein"
FT                   /note="COG3173 Predicted aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00639"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03760"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A6"
FT                   /protein_id="ADI03760.1"
FT   gene            complement(828661..829458)
FT                   /locus_tag="SBI_00640"
FT   CDS_pept        complement(828661..829458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00640"
FT                   /product="hypothetical protein"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03761"
FT                   /db_xref="GOA:D7C2A7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A7"
FT                   /protein_id="ADI03761.1"
FT   gene            829351..829476
FT                   /locus_tag="SBI_00641"
FT   CDS_pept        829351..829476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00641"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03762"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A8"
FT                   /protein_id="ADI03762.1"
FT   gene            complement(829646..829849)
FT                   /locus_tag="SBI_00642"
FT   CDS_pept        complement(829646..829849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00642"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03763"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A9"
FT                   /protein_id="ADI03763.1"
FT   gene            complement(830117..833563)
FT                   /locus_tag="SBI_00643"
FT   CDS_pept        complement(830117..833563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00643"
FT                   /product="WGR domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00643"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03764"
FT                   /db_xref="InterPro:IPR025406"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2B0"
FT                   /protein_id="ADI03764.1"
FT   gene            complement(833706..834968)
FT                   /locus_tag="SBI_00644"
FT   CDS_pept        complement(833706..834968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00644"
FT                   /product="membrane-asso