(data stored in ACNUC7421 zone)

EMBL: CP002049

ID   CP002049; SV 1; circular; genomic DNA; STD; PRO; 3260398 BP.
XX
AC   CP002049;
XX
PR   Project:PRJNA38371;
XX
DT   01-JUN-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Truepera radiovictrix DSM 17093, complete genome.
XX
KW   .
XX
OS   Truepera radiovictrix DSM 17093
OC   Bacteria; Deinococcus-Thermus; Deinococci; Deinococcales; Trueperaceae;
OC   Truepera.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-3260398
RX   DOI; 10.4056/sigs.1563919.
RX   PUBMED; 21475591.
RA   Ivanova N., Rohde C., Munk C., Nolan M., Lucas S., Del Rio T.G., Tice H.,
RA   Deshpande S., Cheng J.F., Tapia R., Han C., Goodwin L., Pitluck S.,
RA   Liolios K., Mavromatis K., Mikhailova N., Pati A., Chen A., Palaniappan K.,
RA   Land M., Hauser L., Chang Y.J., Jeffries C.D., Brambilla E., Rohde M.,
RA   Goker M., Tindall B.J., Woyke T., Bristow J., Eisen J.A., Markowitz V.,
RA   Hugenholtz P., Kyrpides N.C., Klenk H.P., Lapidus A.;
RT   "Complete genome sequence of Truepera radiovictrix type strain (RQ-24)";
RL   Stand Genomic Sci 4(1):91-99(2011).
XX
RN   [2]
RP   1-3260398
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K.,
RA   Ovchinnikova G., Munk A.C., Detter J.C., Han C., Tapia R., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Tindall B., Pomrenke H.G., Brambilla E., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (21-MAY-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 3b1c1c932432e27e8d306bbb390d732a.
DR   BioSample; SAMN02598522.
DR   CABRI; DSM 17093.
DR   EnsemblGenomes-Gn; EBG00001187713.
DR   EnsemblGenomes-Gn; EBG00001187714.
DR   EnsemblGenomes-Gn; EBG00001187715.
DR   EnsemblGenomes-Gn; EBG00001187716.
DR   EnsemblGenomes-Gn; EBG00001187717.
DR   EnsemblGenomes-Gn; EBG00001187718.
DR   EnsemblGenomes-Gn; EBG00001187719.
DR   EnsemblGenomes-Gn; EBG00001187720.
DR   EnsemblGenomes-Gn; EBG00001187721.
DR   EnsemblGenomes-Gn; EBG00001187722.
DR   EnsemblGenomes-Gn; EBG00001187723.
DR   EnsemblGenomes-Gn; EBG00001187724.
DR   EnsemblGenomes-Gn; EBG00001187725.
DR   EnsemblGenomes-Gn; EBG00001187726.
DR   EnsemblGenomes-Gn; EBG00001187727.
DR   EnsemblGenomes-Gn; EBG00001187728.
DR   EnsemblGenomes-Gn; EBG00001187729.
DR   EnsemblGenomes-Gn; EBG00001187730.
DR   EnsemblGenomes-Gn; EBG00001187731.
DR   EnsemblGenomes-Gn; EBG00001187732.
DR   EnsemblGenomes-Gn; EBG00001187733.
DR   EnsemblGenomes-Gn; EBG00001187734.
DR   EnsemblGenomes-Gn; EBG00001187735.
DR   EnsemblGenomes-Gn; EBG00001187736.
DR   EnsemblGenomes-Gn; EBG00001187737.
DR   EnsemblGenomes-Gn; EBG00001187738.
DR   EnsemblGenomes-Gn; EBG00001187739.
DR   EnsemblGenomes-Gn; EBG00001187740.
DR   EnsemblGenomes-Gn; EBG00001187741.
DR   EnsemblGenomes-Gn; EBG00001187742.
DR   EnsemblGenomes-Gn; EBG00001187743.
DR   EnsemblGenomes-Gn; EBG00001187744.
DR   EnsemblGenomes-Gn; EBG00001187745.
DR   EnsemblGenomes-Gn; EBG00001187746.
DR   EnsemblGenomes-Gn; EBG00001187747.
DR   EnsemblGenomes-Gn; EBG00001187748.
DR   EnsemblGenomes-Gn; EBG00001187749.
DR   EnsemblGenomes-Gn; EBG00001187750.
DR   EnsemblGenomes-Gn; EBG00001187751.
DR   EnsemblGenomes-Gn; EBG00001187752.
DR   EnsemblGenomes-Gn; EBG00001187753.
DR   EnsemblGenomes-Gn; EBG00001187754.
DR   EnsemblGenomes-Gn; EBG00001187755.
DR   EnsemblGenomes-Gn; EBG00001187756.
DR   EnsemblGenomes-Gn; EBG00001187757.
DR   EnsemblGenomes-Gn; EBG00001187758.
DR   EnsemblGenomes-Gn; EBG00001187759.
DR   EnsemblGenomes-Gn; EBG00001187760.
DR   EnsemblGenomes-Gn; EBG00001187761.
DR   EnsemblGenomes-Gn; EBG00001187762.
DR   EnsemblGenomes-Gn; EBG00001187763.
DR   EnsemblGenomes-Gn; EBG00001187764.
DR   EnsemblGenomes-Gn; EBG00001187765.
DR   EnsemblGenomes-Gn; EBG00001187766.
DR   EnsemblGenomes-Gn; EBG00001187767.
DR   EnsemblGenomes-Gn; EBG00001187768.
DR   EnsemblGenomes-Gn; EBG00001187769.
DR   EnsemblGenomes-Gn; EBG00001187770.
DR   EnsemblGenomes-Gn; Trad_R0001.
DR   EnsemblGenomes-Gn; Trad_R0002.
DR   EnsemblGenomes-Gn; Trad_R0003.
DR   EnsemblGenomes-Gn; Trad_R0004.
DR   EnsemblGenomes-Gn; Trad_R0005.
DR   EnsemblGenomes-Gn; Trad_R0006.
DR   EnsemblGenomes-Gn; Trad_R0007.
DR   EnsemblGenomes-Gn; Trad_R0008.
DR   EnsemblGenomes-Gn; Trad_R0009.
DR   EnsemblGenomes-Gn; Trad_R0010.
DR   EnsemblGenomes-Gn; Trad_R0011.
DR   EnsemblGenomes-Gn; Trad_R0012.
DR   EnsemblGenomes-Gn; Trad_R0013.
DR   EnsemblGenomes-Gn; Trad_R0014.
DR   EnsemblGenomes-Gn; Trad_R0015.
DR   EnsemblGenomes-Gn; Trad_R0016.
DR   EnsemblGenomes-Gn; Trad_R0017.
DR   EnsemblGenomes-Gn; Trad_R0018.
DR   EnsemblGenomes-Gn; Trad_R0019.
DR   EnsemblGenomes-Gn; Trad_R0020.
DR   EnsemblGenomes-Gn; Trad_R0021.
DR   EnsemblGenomes-Gn; Trad_R0022.
DR   EnsemblGenomes-Gn; Trad_R0023.
DR   EnsemblGenomes-Gn; Trad_R0024.
DR   EnsemblGenomes-Gn; Trad_R0025.
DR   EnsemblGenomes-Gn; Trad_R0026.
DR   EnsemblGenomes-Gn; Trad_R0027.
DR   EnsemblGenomes-Gn; Trad_R0028.
DR   EnsemblGenomes-Gn; Trad_R0029.
DR   EnsemblGenomes-Gn; Trad_R0030.
DR   EnsemblGenomes-Gn; Trad_R0031.
DR   EnsemblGenomes-Gn; Trad_R0032.
DR   EnsemblGenomes-Gn; Trad_R0033.
DR   EnsemblGenomes-Gn; Trad_R0034.
DR   EnsemblGenomes-Gn; Trad_R0035.
DR   EnsemblGenomes-Gn; Trad_R0036.
DR   EnsemblGenomes-Gn; Trad_R0037.
DR   EnsemblGenomes-Gn; Trad_R0038.
DR   EnsemblGenomes-Gn; Trad_R0040.
DR   EnsemblGenomes-Gn; Trad_R0041.
DR   EnsemblGenomes-Gn; Trad_R0042.
DR   EnsemblGenomes-Gn; Trad_R0043.
DR   EnsemblGenomes-Gn; Trad_R0044.
DR   EnsemblGenomes-Gn; Trad_R0045.
DR   EnsemblGenomes-Gn; Trad_R0046.
DR   EnsemblGenomes-Gn; Trad_R0047.
DR   EnsemblGenomes-Gn; Trad_R0048.
DR   EnsemblGenomes-Gn; Trad_R0049.
DR   EnsemblGenomes-Gn; Trad_R0050.
DR   EnsemblGenomes-Gn; Trad_R0051.
DR   EnsemblGenomes-Gn; Trad_R0052.
DR   EnsemblGenomes-Gn; Trad_R0053.
DR   EnsemblGenomes-Tr; EBT00001766003.
DR   EnsemblGenomes-Tr; EBT00001766004.
DR   EnsemblGenomes-Tr; EBT00001766005.
DR   EnsemblGenomes-Tr; EBT00001766006.
DR   EnsemblGenomes-Tr; EBT00001766007.
DR   EnsemblGenomes-Tr; EBT00001766008.
DR   EnsemblGenomes-Tr; EBT00001766009.
DR   EnsemblGenomes-Tr; EBT00001766010.
DR   EnsemblGenomes-Tr; EBT00001766011.
DR   EnsemblGenomes-Tr; EBT00001766012.
DR   EnsemblGenomes-Tr; EBT00001766013.
DR   EnsemblGenomes-Tr; EBT00001766014.
DR   EnsemblGenomes-Tr; EBT00001766015.
DR   EnsemblGenomes-Tr; EBT00001766016.
DR   EnsemblGenomes-Tr; EBT00001766017.
DR   EnsemblGenomes-Tr; EBT00001766018.
DR   EnsemblGenomes-Tr; EBT00001766019.
DR   EnsemblGenomes-Tr; EBT00001766020.
DR   EnsemblGenomes-Tr; EBT00001766021.
DR   EnsemblGenomes-Tr; EBT00001766022.
DR   EnsemblGenomes-Tr; EBT00001766023.
DR   EnsemblGenomes-Tr; EBT00001766024.
DR   EnsemblGenomes-Tr; EBT00001766025.
DR   EnsemblGenomes-Tr; EBT00001766026.
DR   EnsemblGenomes-Tr; EBT00001766027.
DR   EnsemblGenomes-Tr; EBT00001766028.
DR   EnsemblGenomes-Tr; EBT00001766029.
DR   EnsemblGenomes-Tr; EBT00001766030.
DR   EnsemblGenomes-Tr; EBT00001766031.
DR   EnsemblGenomes-Tr; EBT00001766032.
DR   EnsemblGenomes-Tr; EBT00001766033.
DR   EnsemblGenomes-Tr; EBT00001766034.
DR   EnsemblGenomes-Tr; EBT00001766035.
DR   EnsemblGenomes-Tr; EBT00001766036.
DR   EnsemblGenomes-Tr; EBT00001766037.
DR   EnsemblGenomes-Tr; EBT00001766038.
DR   EnsemblGenomes-Tr; EBT00001766039.
DR   EnsemblGenomes-Tr; EBT00001766040.
DR   EnsemblGenomes-Tr; EBT00001766041.
DR   EnsemblGenomes-Tr; EBT00001766042.
DR   EnsemblGenomes-Tr; EBT00001766043.
DR   EnsemblGenomes-Tr; EBT00001766044.
DR   EnsemblGenomes-Tr; EBT00001766045.
DR   EnsemblGenomes-Tr; EBT00001766046.
DR   EnsemblGenomes-Tr; EBT00001766047.
DR   EnsemblGenomes-Tr; EBT00001766048.
DR   EnsemblGenomes-Tr; EBT00001766049.
DR   EnsemblGenomes-Tr; EBT00001766050.
DR   EnsemblGenomes-Tr; EBT00001766051.
DR   EnsemblGenomes-Tr; EBT00001766052.
DR   EnsemblGenomes-Tr; EBT00001766053.
DR   EnsemblGenomes-Tr; EBT00001766054.
DR   EnsemblGenomes-Tr; EBT00001766055.
DR   EnsemblGenomes-Tr; EBT00001766056.
DR   EnsemblGenomes-Tr; EBT00001766057.
DR   EnsemblGenomes-Tr; EBT00001766058.
DR   EnsemblGenomes-Tr; EBT00001766059.
DR   EnsemblGenomes-Tr; EBT00001766060.
DR   EnsemblGenomes-Tr; Trad_R0001-1.
DR   EnsemblGenomes-Tr; Trad_R0002-1.
DR   EnsemblGenomes-Tr; Trad_R0003-1.
DR   EnsemblGenomes-Tr; Trad_R0004-1.
DR   EnsemblGenomes-Tr; Trad_R0005-1.
DR   EnsemblGenomes-Tr; Trad_R0006-1.
DR   EnsemblGenomes-Tr; Trad_R0007-1.
DR   EnsemblGenomes-Tr; Trad_R0008-1.
DR   EnsemblGenomes-Tr; Trad_R0009-1.
DR   EnsemblGenomes-Tr; Trad_R0010-1.
DR   EnsemblGenomes-Tr; Trad_R0011-1.
DR   EnsemblGenomes-Tr; Trad_R0012-1.
DR   EnsemblGenomes-Tr; Trad_R0013-1.
DR   EnsemblGenomes-Tr; Trad_R0014-1.
DR   EnsemblGenomes-Tr; Trad_R0015-1.
DR   EnsemblGenomes-Tr; Trad_R0016-1.
DR   EnsemblGenomes-Tr; Trad_R0017-1.
DR   EnsemblGenomes-Tr; Trad_R0018-1.
DR   EnsemblGenomes-Tr; Trad_R0019-1.
DR   EnsemblGenomes-Tr; Trad_R0020-1.
DR   EnsemblGenomes-Tr; Trad_R0021-1.
DR   EnsemblGenomes-Tr; Trad_R0022-1.
DR   EnsemblGenomes-Tr; Trad_R0023-1.
DR   EnsemblGenomes-Tr; Trad_R0024-1.
DR   EnsemblGenomes-Tr; Trad_R0025-1.
DR   EnsemblGenomes-Tr; Trad_R0026-1.
DR   EnsemblGenomes-Tr; Trad_R0027-1.
DR   EnsemblGenomes-Tr; Trad_R0028-1.
DR   EnsemblGenomes-Tr; Trad_R0029-1.
DR   EnsemblGenomes-Tr; Trad_R0030-1.
DR   EnsemblGenomes-Tr; Trad_R0031-1.
DR   EnsemblGenomes-Tr; Trad_R0032-1.
DR   EnsemblGenomes-Tr; Trad_R0033-1.
DR   EnsemblGenomes-Tr; Trad_R0034-1.
DR   EnsemblGenomes-Tr; Trad_R0035-1.
DR   EnsemblGenomes-Tr; Trad_R0036-1.
DR   EnsemblGenomes-Tr; Trad_R0037-1.
DR   EnsemblGenomes-Tr; Trad_R0038-1.
DR   EnsemblGenomes-Tr; Trad_R0040-1.
DR   EnsemblGenomes-Tr; Trad_R0041-1.
DR   EnsemblGenomes-Tr; Trad_R0042-1.
DR   EnsemblGenomes-Tr; Trad_R0043-1.
DR   EnsemblGenomes-Tr; Trad_R0044-1.
DR   EnsemblGenomes-Tr; Trad_R0045-1.
DR   EnsemblGenomes-Tr; Trad_R0046-1.
DR   EnsemblGenomes-Tr; Trad_R0047-1.
DR   EnsemblGenomes-Tr; Trad_R0048-1.
DR   EnsemblGenomes-Tr; Trad_R0049-1.
DR   EnsemblGenomes-Tr; Trad_R0050-1.
DR   EnsemblGenomes-Tr; Trad_R0051-1.
DR   EnsemblGenomes-Tr; Trad_R0052-1.
DR   EnsemblGenomes-Tr; Trad_R0053-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01786; c-di-GMP-II.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002049.
DR   SILVA-SSU; CP002049.
DR   StrainInfo; 622178; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085721
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Truepera radiovictrix RQ-24, DSM 17093
CC   Culture Collection ID :: DSM 17093, CIP 108686, LMG 22925
CC   GOLD Stamp ID         :: Gi02949
CC   Greengenes ID         :: 131852
CC   Funding Program       :: DOE-GEBA 2009
CC   Isolation Site        :: "Water sample from a hot spring runoffs on
CC                            the Island of Sco Miguel in the Azores,
CC                            Portugal"
CC   Isolation Country     :: Portugal
CC   Latitude              :: 37.946797
CC   Longitude             :: -25.490113
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Sphere-shaped
CC   Temperature Range     :: Thermophile
CC   Temperature Optimum   :: 50C
CC   pH                    :: 7.5 - 7.9
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Fresh water, Hot spring
CC   Phenotypes            :: Radiation resistant
CC   Energy Source         :: Chemoorganotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3260398
FT                   /organism="Truepera radiovictrix DSM 17093"
FT                   /strain="DSM 17093"
FT                   /mol_type="genomic DNA"
FT                   /country="Portugal:Island of Sco Miguel, Azores"
FT                   /lat_lon="37.95 N 25.49 W"
FT                   /isolation_source="hot spings runoff"
FT                   /db_xref="taxon:649638"
FT   gene            166..1500
FT                   /locus_tag="Trad_0001"
FT   CDS_pept        166..1500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COGs: COG0593 ATPase involved in DNA replication
FT                   initiation;
FT                   InterProIPR001957:IPR013317:IPR013159:IPR020591:IPR
FT                   010921:IPR003593:IPR018312; KEGG: tth:TTC1608 chromosomal
FT                   replication initiation protein; PFAM: Chromosomal
FT                   replication initiator DnaA; Chromosomal replication
FT                   initiator DnaA domain; SMART: Chromosomal replication
FT                   initiator DnaA domain; AAA ATPase; SPTR: B7ABI9 Chromosomal
FT                   replication initiator protein dnaA; TIGRFAM: chromosomal
FT                   replication initiator protein DnaA; PFAM: domain; Bacterial
FT                   dnaA protein; TIGRFAM: chromosomal replication initiator
FT                   protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13144"
FT                   /db_xref="GOA:D7CWQ3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWQ3"
FT                   /protein_id="ADI13144.1"
FT                   /translation="MLRHENAIWDDILEYVRDKIPEVEFRTWFKQVRPLGIENGVFMIG
FT                   VPHSFARDWLKNHYSPVLEHALKDLGAASPRVGFQVVSFPTTEQPDIFQPQTTGDDSSQ
FT                   VKRPRLNPKYVFSNFVVGPNNNLASAAALAVAEAPGRAYNPLFIYGDAGLGKTHLMHAV
FT                   GHAVAERLPQLYIEYVTTEAFTNDLINAIREDRMTAFRDRYRSVDVLLVDDVQFIAGKE
FT                   RTQEEFFHTFNALYESGKQIILSSDRPPKDIPTLENRLRSRFEWGLITDIQAPELETRI
FT                   AILKMNAEYRGVKIPPDVIDYIARQVTSNIRELEGALVRVILYASMNQVELNRQTVAAA
FT                   LSDVYAPSELNLSMEEILRATAFHFEADAEDLRSKGRRHELVVPRQVAMYLMRELTSHS
FT                   YPEIGQFFSGRDHSTVVYAVQKVGEQLAKDRELEMRIQAIKSDLL"
FT   gene            1830..2921
FT                   /locus_tag="Trad_0002"
FT   CDS_pept        1830..2921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); InterPro IPR001001; KEGG: ddr:Deide_00020
FT                   putative DNA-directed DNA polymerase (DNA polymerase III,
FT                   beta subunit); PFAM: DNA polymerase III beta chain; PRIAM:
FT                   DNA-directed DNA polymerase; SMART: DNA polymerase III beta
FT                   chain; SPTR: C1CXJ2 Putative DNA-directed DNA polymerase
FT                   (DNA polymerase III, beta subunit); TIGRFAM: DNA polymerase
FT                   III, beta subunit; PFAM: DNA polymerase III beta subunit,
FT                   C-terminal domain; DNA polymerase III beta subunit,
FT                   N-terminal domain; DNA polymerase III beta subunit, central
FT                   domain; TIGRFAM: DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13145"
FT                   /db_xref="GOA:D7CWQ4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWQ4"
FT                   /protein_id="ADI13145.1"
FT                   /translation="MNVEVPRKALGEVLAHLERIVPSRSSNPSLSLLRLELSDGHLTLS
FT                   GSNLDLDLQATLAVSSSGERGGPWALPAHVFGQVARALPGELVELTFESAELEVRSGSY
FT                   ATKLQLMTTDLPDLVFPNDLPGRFSAERLGAALSHVRYAAAVAEYQAIFRGVKLELHDG
FT                   RTRAVATDGFRLAYYHLGASTGLAQDIVIPARSADELVKLLGDGETKLGLSEGQLSLET
FT                   GPYRLNVKLMEGTFPDYERVIPSHFPVSITLAARTLLEGVQRVAVMADRTANNRVDLFV
FT                   RDGTLQITAEGAYGRAQEALAVAQEGSESEIALAYNADYLLSALRPVGGDVRFSFSGPT
FT                   SPSVLVSLADPSYLAMVVPLRTG"
FT   gene            3121..4389
FT                   /locus_tag="Trad_0003"
FT   CDS_pept        3121..4389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0003"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="COGs: COG0148 Enolase; InterPro
FT                   IPR000941:IPR020811:IPR020810:IPR020809; KEGG:
FT                   dge:Dgeo_0004 phosphopyruvate hydratase; PFAM:
FT                   Enolase-like; PRIAM: Phosphopyruvate hydratase; SPTR:
FT                   Q1J2H6 Enolase; TIGRFAM: enolase; PFAM: Enolase, N-terminal
FT                   domain; Enolase, C-terminal TIM barrel domain; TIGRFAM:
FT                   phosphopyruvate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13146"
FT                   /db_xref="GOA:D7CWQ5"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWQ5"
FT                   /protein_id="ADI13146.1"
FT                   /translation="MTQIETVYAAELLDSRGNPTVGATVRLTSGVAASAAVPSGASTGM
FT                   HEAVELRDGGERYGGKGVLKAVANVNETLAPALVGVDAADQSGLDALLLELDGTPNKAN
FT                   LGANALLAVSLAAARAVAQTLELPLYRYLGGVAARTLPVPMMNVINGGKHADNRVDMQE
FT                   FMLAPIGFERFSEALRAGVETFHALKKVLTKRGYNTNVGDEGGFAPDLKSNQEAIEVIL
FT                   EAIEAAGYTPGDEIAIALDPASTEFYRDGRYHLEAEGKVLTSGEMIAYWSDWVSRYPIV
FT                   SVEDGLAEDDWEGWAELTRALGDRCQLVGDDLFVTNVTRLQRGIDEGVGNAILVKVNQI
FT                   GTLTEALEAIELAKRAGYRNMISHRSGETEDAFIADLAVAVNAGQIKTGSASRSDRLAK
FT                   YNRLLLIEAELGEAARFLGRRAF"
FT   sig_peptide     3121..3225
FT                   /locus_tag="Trad_0003"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            4389..5840
FT                   /locus_tag="Trad_0004"
FT   CDS_pept        4389..5840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0004"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="COGs: COG0469 Pyruvate kinase;
FT                   InterProIPR001697:IPR015793:IPR015794:IPR015813:IPR
FT                   015795:IPR011037:IPR018209; KEGG: ddr:Deide_00040 putative
FT                   pyruvate kinase; PFAM: Pyruvate kinase barrel; Pyruvate
FT                   kinase alpha/beta; PRIAM: Pyruvate kinase; SPTR: C1CXJ4
FT                   Pyruvate kinase; TIGRFAM: pyruvate kinase; PFAM: Pyruvate
FT                   kinase, barrel domain; Pyruvate kinase, alpha/beta domain;
FT                   TIGRFAM: pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13147"
FT                   /db_xref="GOA:D7CWQ6"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWQ6"
FT                   /protein_id="ADI13147.1"
FT                   /translation="MRQVRRTKIVATLGPASSDPEVIKNLIQAGVNVFRLNFSHGSRET
FT                   HQNNIALIRQEAARLGTPIGVLQDLQGPKIRTTTFAEGKVMLTAGQRFNLTCDDTSPGD
FT                   AARVGVTYPNLFADVKVGDTLLLDDGRLALRVTAVRGETIETEVTLGGVLSNNKGINIP
FT                   DADLSIPALTDKDVEDLLFGAELDVDWVAMSFVRSRDDLLLARHYLARAGSRAKLMAKI
FT                   EKPSAVARFDEILAEVDGIMVARGDLGVELPPERVPIIQKRLIRACVEAGKPVVTATQM
FT                   LESMISSPTPTRAEASDVANAIYDGTDAIMLSAETAVGSYPVEAVRMMARIALSVEGDA
FT                   SYQANLREHYPQPDSTTADAVSLAACQMAHFLSARMIVTFTSSGTTALRVAHNRPSAPI
FT                   LALTPSERAYRQLSLSWGILPVFSEEIHSTDEMVEVANAKIIELMKRTAGLTVGDRYVI
FT                   TAGVPFGMRGTTNLIRVEVIRETPG"
FT   gene            complement(5962..6411)
FT                   /locus_tag="Trad_0005"
FT   CDS_pept        complement(5962..6411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0005"
FT                   /product="ribosomal protein L9"
FT                   /note="COGs: COG0359 Ribosomal protein L9; InterPro
FT                   IPR020594:IPR020070:IPR020069:IPR009027; KEGG: ttj:TTHA0242
FT                   50S ribosomal protein L9; PFAM: Ribosomal protein L9-like;
FT                   SPTR: B7A904 Ribosomal protein L9; TIGRFAM: ribosomal
FT                   protein L9; PFAM: Ribosomal protein L9, N-terminal domain;
FT                   Ribosomal protein L9, C-terminal domain; TIGRFAM: ribosomal
FT                   protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13148"
FT                   /db_xref="GOA:D7CWQ7"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWQ7"
FT                   /protein_id="ADI13148.1"
FT                   /translation="MNVILLEPVEKLGEAGDLVSVKPGFARNFLVPRGLALPATQANQR
FT                   ELEARLAQRAKQLAERKADAERLKEMLAEAQLEIPVRAGEDRIYGSVTARDIAEALEKR
FT                   FEVTIDRRKLDLHEPIKTLGEYTVVYKPHPEVPIDLKVAVVAENA"
FT   gene            complement(6408..6692)
FT                   /locus_tag="Trad_0006"
FT   CDS_pept        complement(6408..6692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0006"
FT                   /product="ribosomal protein S18"
FT                   /note="COGs: COG0238 Ribosomal protein S18; InterPro
FT                   IPR001648; KEGG: ddr:Deide_00110 putative 30S ribosomal
FT                   protein S18; PFAM: ribosomal protein S18; SPTR: C1CXK0 30S
FT                   ribosomal protein S18; TIGRFAM: ribosomal protein S18;
FT                   PFAM: Ribosomal protein S18; TIGRFAM: ribosomal protein
FT                   S18"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13149"
FT                   /db_xref="GOA:D7CWQ8"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWQ8"
FT                   /protein_id="ADI13149.1"
FT                   /translation="MAQARNTKSRRDRDDRRGGRRGRRPKVCPFCTGEQEVTDYRDGRM
FT                   LRRFISDTAKILPRRRTGVCAKHQRRLATTIKQARVLAIVPITEKLVRK"
FT   gene            complement(6693..7541)
FT                   /locus_tag="Trad_0007"
FT   CDS_pept        complement(6693..7541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0007"
FT                   /product="single-strand binding protein"
FT                   /note="COGs: COG0629 Single-stranded DNA-binding protein;
FT                   InterPro IPR000424:IPR011344:IPR016027:IPR012340; KEGG:
FT                   dge:Dgeo_0165 single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; SPTR: C1XJL0 Single-stranded DNA-binding
FT                   protein; TIGRFAM: single-strand binding protein; PFAM:
FT                   Single-strand binding protein family; TIGRFAM: single
FT                   stranded DNA-binding protein (ssb)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13150"
FT                   /db_xref="GOA:D7CWQ9"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWQ9"
FT                   /protein_id="ADI13150.1"
FT                   /translation="MARGLNSVQLIGTLTQAPDMKYTAGGLAILELNLAGNDHVVGSDG
FT                   QLRELAWYHRVSVFGKQAEYLVDQLAAGTPVFVEGRLNYRAWEDASGQKRSALGINAVR
FT                   VDVLTHGPRKGEPTVLDARGQERLKNALNHVTIIGNLIRDAELRYTPSGDAVTRFVVAV
FT                   NEQYRDRSGQDQESVHFVEVNVWRELAESCAELAKGDPVLVIGRLVKDNWTDKDGNRQY
FT                   KDKLEGSRVEYLTRGPGGGGASTRPQPAQQAVGAQRGQQSRPSPALDIDEEFPPEEDLP
FT                   F"
FT   gene            complement(7590..7940)
FT                   /locus_tag="Trad_0008"
FT   CDS_pept        complement(7590..7940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0008"
FT                   /product="ribosomal protein S6"
FT                   /note="COGs: COG0360 Ribosomal protein S6; InterPro
FT                   IPR000529:IPR020814:IPR014717; KEGG: dge:Dgeo_0166 30S
FT                   ribosomal protein S6; PFAM: Ribosomal protein S6,
FT                   bacterial-like; SPTR: C1XS83 SSU ribosomal protein S6P;
FT                   TIGRFAM: ribosomal protein S6; PFAM: Ribosomal protein S6;
FT                   TIGRFAM: ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13151"
FT                   /db_xref="GOA:D7CWR0"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWR0"
FT                   /protein_id="ADI13151.1"
FT                   /translation="MHNYDLNVILDPNLSEAQLGLEKDAIAAQIERFEGEVLSTDEWGN
FT                   KRLAYPIRKLNEGYYIIYRLRLPETAPRQLATNLRLRDNVMRVLITRDRPEQRTQRSSE
FT                   RDAGQEAPAASA"
FT   gene            8116..8838
FT                   /locus_tag="Trad_0009"
FT   CDS_pept        8116..8838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0009"
FT                   /product="SNARE associated Golgi protein-like protein"
FT                   /note="COGs: COG0398 conserved hypothetical protein;
FT                   InterPro IPR015414; KEGG: hau:Haur_1237 SNARE associated
FT                   Golgi protein; PFAM: SNARE associated Golgi protein; SPTR:
FT                   A9B1K0 SNARE associated Golgi protein; PFAM: SNARE
FT                   associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13152"
FT                   /db_xref="GOA:D7CWR1"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWR1"
FT                   /protein_id="ADI13152.1"
FT                   /translation="MPEPKRTERTRRRRSAGEGGQRRTLHTLVVVALWLGGLLALWLFA
FT                   RAQGQTPGGLLQELLEALRVHPLAPFLLFGLYLVRPLFLLPVTLLTLTAGLLFGAFWGF
FT                   WYAAAATLASATVAYIVGRFFAQDLPGRFGQGVSTRLQRFPFETVLLCRFLLLPGDLVN
FT                   YLAGFLRVRLGAFLLATLIGGAPGLLVGVLAGASLEGLPGEVRLNAWYLVASGVLLGLS
FT                   LGVSRWLRRRNPLGRNPL"
FT   sig_peptide     8116..8256
FT                   /locus_tag="Trad_0009"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(9119..9415)
FT                   /locus_tag="Trad_0010"
FT   CDS_pept        complement(9119..9415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0010"
FT                   /product="YCII-related protein"
FT                   /note="InterPro IPR005545:IPR011008; KEGG: YCII-related
FT                   domain protein ; K09780 hypothetical protein; PFAM:
FT                   YCII-related; SPTR: C4CYG7 Uncharacterized conserved
FT                   protein; PFAM: YCII-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13153"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWR2"
FT                   /protein_id="ADI13153.1"
FT                   /translation="MTFLVIAKDGTDPDAPARRQRARQRHLDEIRPAVDAGRVRLGGAL
FT                   LDGAGTMIGSALLLEAPSLEAARELLENDVYFKEGVWQQLEIYPFRRAVGLEL"
FT   gene            9656..11530
FT                   /locus_tag="Trad_0011"
FT   CDS_pept        9656..11530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0011"
FT                   /product="chaperone protein DnaK"
FT                   /note="COGs: COG0443 Molecular chaperone; InterPro
FT                   IPR012725:IPR013126:IPR001023:IPR018181; KEGG: tth:TTC1127
FT                   molecular chaperone DnaK; PFAM: Heat shock protein 70;
FT                   SPTR: C1XQY4 Chaperone protein DnaK; TIGRFAM: chaperone
FT                   protein DnaK; PFAM: Hsp70 protein; TIGRFAM: chaperone
FT                   protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13154"
FT                   /db_xref="GOA:D7CWR3"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWR3"
FT                   /protein_id="ADI13154.1"
FT                   /translation="MARAVGIDLGTTNSVIAIMEGGEPTVLVNSEGNRTTPSVVAFKGD
FT                   QRLVGQVAKRQAVLNPKGTLFEVKRYMGRTWDEVKEEAERSPYDVVRGSDGGVRFVVEG
FT                   KQYTPEEISAMVLQKLVQDASATLGEKITKAVITVPAYFNNSQREATQNAGRIAGLEVL
FT                   RIVNEPTAAALAYGLDKKGNETVLVFDLGGGTFDVSVLEVGDGVFEVRSTSGDTHLGGS
FT                   DFDYAVVNWLADEFQREYNVDLRKDKQALQRLLEAAEKAKIELSGIPETTISLPFIAMD
FT                   PASNAPLYLEKRLSRAKFEELIAPLLNRVRGPVETALRDAKLSKDEIDEVILVGGSTRV
FT                   PAVKKLVQEMLGKAPNQSVNPDEVVALGAAVQAGVLTGDVEDIVLLDVTPLSLGVETKG
FT                   GVFTKLVERNTAIPVRKTEVFTTAENNQTGVEVHVLQGERAMAADNKSLGRFKLDGIPP
FT                   MPAGMPQIEISYDIDANGVLKVTAREKSTGKEANITIQNTTTLSEAEVERMVQDAAANA
FT                   ERDREAREHAEAKNTLDSLRVQAQRAVDESTADDDTKQPVRRLIAEAQSAIDSDAPKSR
FT                   LEELGRELAEKVAQLQQAAPSQGGDGGGDQTPPKADEDVVDADFKPAG"
FT   gene            11532..12236
FT                   /locus_tag="Trad_0012"
FT   CDS_pept        11532..12236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0012"
FT                   /product="GrpE protein"
FT                   /note="COGs: COG0576 Molecular chaperone GrpE (heat shock
FT                   protein); InterPro IPR000740:IPR009012:IPR013805; KEGG:
FT                   dge:Dgeo_2077 GrpE protein; PFAM: GrpE protein; SPTR:
FT                   Q1IWL3 Protein grpE; PFAM: GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13155"
FT                   /db_xref="GOA:D7CWR4"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWR4"
FT                   /protein_id="ADI13155.1"
FT                   /translation="MRDDVQERPTLDGVAEEVGENPTPSEGPEAAQGAAPEAPVADAGD
FT                   ADTAGATDAAPEGAPASDEASSSVGAPPEAAVSPEEVALLRSELERARTEVSDFKNRFL
FT                   RARADLENYRRRAAQDAARAREAGLDSAILTVLAVYDDLGRALSVASDDPTKLLPNLEA
FT                   VREGLKRNLESLGFSEVGSVGEAFNPDLHEALTAVPTDDEAAANTIAEVIQTGFVKGER
FT                   LVRPARVVVFQG"
FT   gene            12280..13263
FT                   /locus_tag="Trad_0013"
FT   CDS_pept        12280..13263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0013"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="COGs: COG0484 DnaJ-class molecular chaperone with
FT                   C-terminal Zn finger domain;
FT                   InterProIPR001623:IPR002939:IPR003095:IPR008971:IPR 018253;
FT                   KEGG: dge:Dgeo_2078 chaperone DnaJ-like protein; PFAM: heat
FT                   shock protein DnaJ domain protein; chaperone DnaJ domain
FT                   protein; SMART: heat shock protein DnaJ domain protein;
FT                   SPTR: Q1IWL2 Chaperone DnaJ-like protein; PFAM: DnaJ
FT                   domain; DnaJ C terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13156"
FT                   /db_xref="GOA:D7CWR5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWR5"
FT                   /protein_id="ADI13156.1"
FT                   /translation="MAAYKDYYKILGVPRNATQKEVRAAYRKLAAKHHPDRNPGDKSAE
FT                   ERFKEIGEAYAVLGDKEKRAFYDRYGAAAAQPGFSPGGGFSGGGFSGGRPGGVEGDFSD
FT                   FFQTLFGGGFGGFSAGTPQGGRFTTTFSTGTSGTFPFGFQEQRPRPTDVAVEMPVSLED
FT                   AYAGAKKTINIEGRRLEVTLPKGSRDGSRLRLRGQAPEGGDLYLTLRLEPHPRFRLDGD
FT                   DVRVTVDVPDYVAALGGKVRVPTLDGDVEMKLPGPTPSGRSFRLRGRGWPRKDGTRGDQ
FT                   YAEVRATVPATLSDEQRAAYVRLQALAEMRAKGASDARPNDPVTSS"
FT   gene            13462..14658
FT                   /locus_tag="Trad_0014"
FT   CDS_pept        13462..14658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0014"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="COGs: COG0760 Parvulin-like peptidyl-prolyl
FT                   isomerase; InterPro IPR000297; KEGG: dra:DR_1063
FT                   peptidyl-prolyl cis-trans isomerase C; PFAM: PpiC-type
FT                   peptidyl-prolyl cis-trans isomerase; SPTR: Q9RVG6
FT                   Peptidyl-prolyl cis-trans isomerase C; PFAM: PPIC-type
FT                   PPIASE domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13157"
FT                   /db_xref="GOA:D7CWR6"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWR6"
FT                   /protein_id="ADI13157.1"
FT                   /translation="MVYKRFALLAALVLLAGVLFVVAQPMGGAAATGGADGAATGGAVS
FT                   GGAMTGGAMTSGAAAEDPDAVVLELGGERVSAGDFEGRFNIALRNLAAQQGIPLDPVTL
FT                   AQFGTLKPAFLEQFATERALLQEAEARGLAPADEAVEAELEQARAAAGENYEALLAQGG
FT                   FEDEAALRELIYESLALQGLVDALEAEVEVGDEAVSAYYEANQAQFERSEEVCARHILV
FT                   EDEATAEALLTRLEAGEDFGELARDNSTDPGSAPEGGDLGCLPRGVTVPEFEEAAFATE
FT                   VGETTGPVRSDFGYHLIRVYERNPAETAPLEEVRSQIEGQLRNEGLNERIASLVEASGV
FT                   QTYPENLLSAAPEAPTPLPGEAMTGGAMTGGAMTGGAMTGGAMTGGALPEGAQTGGGQ"
FT   sig_peptide     13462..13548
FT                   /locus_tag="Trad_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(14789..15418)
FT                   /locus_tag="Trad_0015"
FT   CDS_pept        complement(14789..15418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0015"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="COGs: COG0259 Pyridoxamine-phosphate oxidase;
FT                   InterProIPR000659:IPR011576:IPR019576:IPR009002:IPR
FT                   012349:IPR019740; KEGG: bte:BTH_I0717 pyridoxamine
FT                   5'-phosphate oxidase; PFAM: pyridoxamine 5'-phosphate
FT                   oxidase-related FMN-binding; Pyridoxine 5'-phosphate
FT                   oxidase, dimerisation-like; PRIAM: Pyridoxal 5'-phosphate
FT                   synthase; SPTR: Q2T0M6 Pyridoxine/pyridoxamine 5'-phosphate
FT                   oxidase; TIGRFAM: pyridoxamine 5'-phosphate oxidase; PFAM:
FT                   Pyridoxamine 5'-phosphate oxidase; Pyridoxine 5'-phosphate
FT                   oxidase C-terminal dimerisation region; TIGRFAM:
FT                   pyridoxamine-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13158"
FT                   /db_xref="GOA:D7CWR7"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWR7"
FT                   /protein_id="ADI13158.1"
FT                   /translation="MLADLRRDYTRGALRRADLDPDPVAQFRAWLDEACAAKLPEPNAM
FT                   VLATVGPSGQPSARAVLLKGLDERGFHFFTNFESRKAREIAHNPLVALVFNWLELERQV
FT                   RVEGRAARLPREDAEAYHKSRPYGSQLSAWVSPQSRVIGSRAELEARREALRARFPGEV
FT                   PLPDFWGGYAVAPNALEFWQGRPDRLHDRFRYTREGGTWRLERLAP"
FT   gene            15524..15817
FT                   /locus_tag="Trad_0016"
FT   CDS_pept        15524..15817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: KLTH0F15928p; SPTR: C5DJF2 KLTH0F15928p"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13159"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWR8"
FT                   /protein_id="ADI13159.1"
FT                   /translation="MADYERELDGDLGGDATPYMSDDDEFERDGTHTILGDENENLARR
FT                   NDLARQLEDLVAAALDWSEISDDEDAREIYEDLVDLYERVSAPLEDTDDEVV"
FT   gene            15908..18022
FT                   /locus_tag="Trad_0017"
FT   CDS_pept        15908..18022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0017"
FT                   /product="protein of unknown function DUF255"
FT                   /note="COGs: COG1331 Highly conserved protein containing a
FT                   thioredoxin domain; InterPro
FT                   IPR004879:IPR008928:IPR012336:IPR012335; KEGG:
FT                   rxy:Rxyl_2540 hypothetical protein; PFAM: protein of
FT                   unknown function DUF255; SPTR: Q1AT21 Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function,
FT                   DUF255"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13160"
FT                   /db_xref="GOA:D7CWR9"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWR9"
FT                   /protein_id="ADI13160.1"
FT                   /translation="MGRLSSGARFLRPGYGRGASGALALGMNRLSRETSPYLLQHAENP
FT                   VDWFPWGEEAFAKARAEDKPILLSVGYAACHWCHVMAHESFENPEIADLMNAHFVNVKV
FT                   DREERPDVDAVYMSAVQAMTGSGGWPMTVALTPDGKPFFGGTYYPPEDRLGHPGFKRVL
FT                   LSLAEAWRSRRDEVLRAAETLTNHLADLNKLPAAGEPSPGALGEEVLAEAVRALQRTFD
FT                   PQHGGFGGAPKFPPHGALAFLLRRPEPEAREMAYVTLDKMAAGGIFDQLGGGFARYSVD
FT                   ARWLVPHFEKMLYDNAQLVGVYAEAYAQTRRARYREVVEATLAFVQRELTSPEGCFYSA
FT                   LDADSEGEEGKFYVWRADEFDVLGEDAALAKVYFGVSAAGNFEGRNVLFVPHPPAAVAE
FT                   RFGLSEAALAARLARVKRALFEIRSRRTRPGLDDKVLASWNGLMIGAFARAGRVLAEDA
FT                   YLEAARRAARGVRSALLREGRLWHTFRGGEAKVEGLLEDYALLGLGLLELYRATLEGPW
FT                   LLWALELAEVIAARFTDPEGGFFSTAADAEALVVRPKELFDAALPASSAAAALLLASLA
FT                   RYTDRRAWETLAARALTPLREALVRHPNGFGTSLQVLAQLLAPPQEVALVGPLEHPEMR
FT                   AMEALLSTLPPEVAVARVAAEGDPLAAHLPFVRGRRALQGEPTAYVCQRGACQLPVTSA
FT                   AALAAQLGVA"
FT   sig_peptide     15908..15979
FT                   /locus_tag="Trad_0017"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            18109..20448
FT                   /locus_tag="Trad_0018"
FT   CDS_pept        18109..20448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ttj:TTHA0999 hypothetical protein; SPTR:
FT                   C1XVZ8 ATP-dependent exonuclease V beta subunit, helicase
FT                   and exonuclease domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13161"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWS0"
FT                   /protein_id="ADI13161.1"
FT                   /translation="MTASFRLLLGPPGSGRTTRLLARARAATAAGQRVWWVGLPGQRTD
FT                   LYRRAAATGGVMGLEFLSAQQVFYRLLARALTLKPLVVGTARVALVGEALKQVAGELPA
FT                   PGEARLFTRAVAEAKRFGVAWSDLPAADREAERFRAVYRAYEAIKGERWDYDDFRREAL
FT                   GLARAGRAQPEAQLIVVDGFRELGPLELELYRALAQRCADPPEVWLSLPEAVPGLTPEE
FT                   LGGAERLPRRPNAVAVYAAPNPVAEARWVLRALKRDLAAGAEPRSLAVVLPEREVRAFR
FT                   ALADEYGVPLADETPKSLAELPGGQLLVNLLELPDYPTPARLLALPELEALAKAALAAR
FT                   VAGREALEALAHEQGLAGPLRAWLTRLEAPTSELEWARDLLYSLPELGGGVAPRFVDAA
FT                   MERAKEAASLAKGAQFRAWWAALLRETRLKPPAGGGVPLLSATLASGRRFRRVYLMRAL
FT                   EGAYGTGEAEDYFFPEELRRPLGERAPQLPKRFGGRDAALFAELLTRGDEVVVTFPEAD
FT                   QGGPRVAEPALTPCAAQPLPQLPAGSAVELGVRHTFTPCEARAERPLRVGRTDVQALVR
FT                   FERCAFRFWAERFVVREDPPWWRALVAELRALGRLSEVRLKLLQTRFPAAAPWLAAHGE
FT                   RLYELTFGVVLPTGGVGPVARLDAAGRTGREVQLYTFTEPGRPWGAAEARAWVEARDRL
FT                   RELWAAAHLFEAHGVTRVHLFLWPVLGQPVAVYEGGIAAPTRAMRARQARVAQLYARLS
FT                   SGDRSAKPGYGCRDCEVFDLCREGTR"
FT   sig_peptide     18109..18186
FT                   /locus_tag="Trad_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            20445..23219
FT                   /locus_tag="Trad_0019"
FT   CDS_pept        20445..23219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0019"
FT                   /product="UvrD/REP helicase"
FT                   /note="COGs: COG1074 ATP-dependent exoDNAse (exonuclease V)
FT                   beta subunit (contains helicase and exonuclease domains);
FT                   InterPro IPR014016:IPR014017:IPR000212; KEGG: ttj:TTHA0998
FT                   ATP-dependent DNA helicase; PFAM: UvrD/REP helicase; SPTR:
FT                   C1XVZ8 ATP-dependent exonuclease V beta subunit, helicase
FT                   and exonuclease domain-containing; PFAM: UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13162"
FT                   /db_xref="GOA:D7CWS1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWS1"
FT                   /protein_id="ADI13162.1"
FT                   /translation="MKLRVASAGTGKTTSLVRRYLELIGAGTPLRRLAGVTFTGVGAAE
FT                   LRTRVRAGVAEVGATGRFLDLAFPPEHRPRFEEAALELSGATLTTIHGFMAAALRLNAP
FT                   LLGLDPDFGALGEWEARALFEEELATLRFLARAPEHALHAPLQRLAGGAEALCTQLFAA
FT                   RALAERFRLAAAASERERDLLALFEAAYARYRTRLGALLLPPPEIERRALELTRHPEAM
FT                   ARLRARYQLLLVDEFQDVNPVQGRFFEALEASGLTLEVVGDPKQAIYGFRHADVEVFRG
FT                   ALRRARARGELAPPLTETRRHAQVVTRFLNHLTRAFAERGWGFSAAEAPEVTCAGPQAA
FT                   ERGRVEIHWVTGEAAMGELRAYEARVLAGRVAALLERYAPREVAVLARSYAGLAQMEGA
FT                   LRALGVPATMLQGRGYFERLEIRDLYHALKVGLDPQGLSLAAWLRGPFAGLSLGDVERV
FT                   VLAEAPLATLERLAPEVSRRLERLREVVRRGPVEALKLLVRAPLIGERRYVDFLEPRAR
FT                   ENVDALLFAVAAHPPPDVGALLENLRRLSRQEDAGDVPQSGDGVSLLTVHRAKGLEWPV
FT                   VALFDLGRFDTPRAAALYVAPGSGEVALEGSGAFAELEAAARARDAEESYRLLYVAASR
FT                   ARDVLLVSGSVKGGRPRGWAAALAALGFGPEARPWARGDFVLQRWPAQRVAPAAAAVAD
FT                   ERALPAAPWTTRRFLEPPQPPLCSPSAAATLGDEGDESCEPLPITDPDEGEPLPGRARA
FT                   VGTLVHYAVSQNWSARSATHLRNLEAQEVMFAFSAAERAEILAEVAELLGRYEALLGAA
FT                   LPALEAREADFAELPFALPFAGTVWQGVIDRLYCAGGRWYLDDYKTDRTVRPESYYRQL
FT                   GLYARAAWAVRGLRPEVRLVYLRAQQVVRVPEEALEGALEALLARAPPDLRSA"
FT   gene            complement(23227..24087)
FT                   /locus_tag="Trad_0020"
FT   CDS_pept        complement(23227..24087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0020"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_6160 allergen V5/TPX-1 family
FT                   protein; SPTR: Q01TD4 Allergen V5/Tpx-1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13163"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWS2"
FT                   /protein_id="ADI13163.1"
FT                   /translation="MRRRYWYVLLCPLAALAAYARPLQRPPSPPELTLGASEEVVRPGE
FT                   AVTLTWSLRSGAGWRTALLPGVGPTSETAATVRPRLSTTYTLLAQRQGSSVQRDVRVEV
FT                   QSAPQGAAPGAPVTGGADVAPREGSEQERDEAPSGTFGVSARAEGPFLNDRAGGIAAPD
FT                   DERIVRVAPGESFYAQASFRDPDGIAEVVINLVNSSPEGLAGNLAPTRGPFTLEGEPQG
FT                   ACNLLALPTEVRCVFEIRVAEDAQNIDALPGAGDEFAYVFRVRVTDNLGNSANRPIRGY
FT                   VIVEP"
FT   sig_peptide     complement(23980..24087)
FT                   /locus_tag="Trad_0020"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            24171..24596
FT                   /locus_tag="Trad_0021"
FT   CDS_pept        24171..24596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0021"
FT                   /product="ribosomal protein L19"
FT                   /note="COGs: COG0335 Ribosomal protein L19; InterPro
FT                   IPR001857:IPR018257; KEGG: ddr:Deide_07240 putative 50S
FT                   ribosomal protein L19; PFAM: ribosomal protein L19; SPTR:
FT                   C1D158 50S ribosomal protein L19; TIGRFAM: ribosomal
FT                   protein L19; PFAM: Ribosomal protein L19; TIGRFAM:
FT                   ribosomal protein L19, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13164"
FT                   /db_xref="GOA:D7CWS3"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWS3"
FT                   /protein_id="ADI13164.1"
FT                   /translation="MKYNKGAILRAIEQPFLKSDLPEFDTGDTVRVDYRVSEGNRTRIQ
FT                   AFEGVVIARQNGKKGARATFTVRKMSFGTGVERVFPLHSPLISAITVVRRGKTRRAKLY
FT                   YLRDLRGKAARLKTDVSRQEVDRAAARAEREAAQSAE"
FT   gene            24698..24773
FT                   /locus_tag="Trad_R0001"
FT   tRNA            24698..24773
FT                   /locus_tag="Trad_R0001"
FT                   /product="tRNA-Ala"
FT   gene            24921..25226
FT                   /locus_tag="Trad_0022"
FT   CDS_pept        24921..25226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0022"
FT                   /product="ribosomal protein L21"
FT                   /note="COGs: COG0261 Ribosomal protein L21; InterPro
FT                   IPR001787; KEGG: ttj:TTHA1783 50S ribosomal protein L21;
FT                   PFAM: ribosomal protein L21; SPTR: P60492 50S ribosomal
FT                   protein L21; TIGRFAM: ribosomal protein L21; PFAM:
FT                   Ribosomal prokaryotic L21 protein; TIGRFAM: ribosomal
FT                   protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13165"
FT                   /db_xref="GOA:D7CWS4"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWS4"
FT                   /protein_id="ADI13165.1"
FT                   /translation="MFAIIQSGGKQYRVAEGDVVRLEALAAEPGETVELPVMMVAGDEI
FT                   KVGAPLVDGASVRAEVLGHGRGKKLYIYKFKAKSNYRRKTGHRQNYTEVRITHIAG"
FT   gene            25247..25522
FT                   /locus_tag="Trad_0023"
FT   CDS_pept        25247..25522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0023"
FT                   /product="ribosomal protein L27"
FT                   /note="COGs: COG0211 Ribosomal protein L27; InterPro
FT                   IPR001684:IPR018261; KEGG: dge:Dgeo_2217 50S ribosomal
FT                   protein L27; PFAM: ribosomal protein L27; SPTR: Q1IW73 50S
FT                   ribosomal protein L27; TIGRFAM: ribosomal protein L27;
FT                   PFAM: Ribosomal L27 protein; TIGRFAM: ribosomal protein
FT                   L27"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13166"
FT                   /db_xref="GOA:D7CWS5"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWS5"
FT                   /protein_id="ADI13166.1"
FT                   /translation="MAHKKGVGSSKNGRDSESKRLGVKRFDGQVVAAGNILVRQRGSKF
FT                   KPGPNVGQGKDFTLFALREGVVRFHNKGSKGRFISVEERTEAIAAD"
FT   gene            25757..27157
FT                   /locus_tag="Trad_0024"
FT   CDS_pept        25757..27157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0024"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="COGs: COG0536 GTPase;
FT                   InterProIPR014100:IPR005225:IPR015349:IPR006169:IPR
FT                   002917:IPR006073:IPR006074; KEGG: dge:Dgeo_2218 GTPase
FT                   ObgE; PFAM: GTP1/OBG sub domain protein; GTP-binding
FT                   protein HSR1-related; GTP1/OBG domain protein; SPTR: Q1IW72
FT                   GTPase obg; TIGRFAM: GTP-binding protein Obg/CgtA; small
FT                   GTP-binding protein; Obg family GTPase CgtA; PFAM: GTPase
FT                   of unknown function; GTP1/OBG; Domain of unknown function
FT                   (DUF1967); TIGRFAM: Obg family GTPase CgtA; Obg family
FT                   GTPase CgtA, C-terminal extension; small GTP-binding
FT                   protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13167"
FT                   /db_xref="GOA:D7CWS6"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR036346"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWS6"
FT                   /protein_id="ADI13167.1"
FT                   /translation="MALRDILDITVQGGKGGDGGLSFLRLKYLPKGGPDGGHGGDGGDV
FT                   VLEAIDDVTSLERLVSRRLYRAGTGGQGEGRNRTGARGEDVVLKVPVGTVATDLDTGER
FT                   LADLTEVGQRALVARGGLGGRGNASFASSRRRTPRFAERGTPGETRRLRLELRTIADAG
FT                   LVGYPNAGKSSLLAALSNARPQIASYPFTTLSPNLGVVERGLERFTLADIPGIIEGASE
FT                   GKGLGLEFLRHISRTRLLVFVLDVAEAPAQTLEALRHELRAYDPSLLTLPALIALNKVD
FT                   LAAPSEVAAAVAELTPFGLPVLPVSALEGAGLEALKGTLFDLLPQRPQRPAPAPAPRRV
FT                   VVDPVRVERHERGGWRVLGRDVTELVARFDASNREAVAYLQGHFIALGVYKLLKRAGAE
FT                   AGDDVWIGDAVFEYFDEAGEADAEDSAPEADAAADDDDAPAPLAAEGDGAPEPVGAAGG
FT                   DGVAEGDG"
FT   gene            27179..27751
FT                   /locus_tag="Trad_0025"
FT   CDS_pept        27179..27751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0025"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="COGs: COG1057 Nicotinic acid mononucleotide
FT                   adenylyltransferase; InterPro
FT                   IPR004821:IPR005248:IPR004820:IPR014729; KEGG: ttj:TTHA1780
FT                   nicotinic acid mononucleotide adenylyltransferase; PFAM:
FT                   cytidylyltransferase; PRIAM: Nicotinate-nucleotide
FT                   adenylyltransferase; SPTR: B7A5T9 Nicotinate (Nicotinamide)
FT                   nucleotide adenylyltransferase; TIGRFAM: nicotinate
FT                   (nicotinamide) nucleotide adenylyltransferase;
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   Cytidylyltransferase; TIGRFAM: nicotinate (nicotinamide)
FT                   nucleotide adenylyltransferase; cytidyltransferase-related
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13168"
FT                   /db_xref="GOA:D7CWS7"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWS7"
FT                   /protein_id="ADI13168.1"
FT                   /translation="MRLGLFGGRFDPPHIGHLLAAQGALEALALDELWFVPAKAPPHKP
FT                   TCAGAEDRYQMLVLATLTHPQLRVSRLELERRGVSYTFDTAVQVRAQHPDARLFFITGA
FT                   DAYAEIASWHRAAELVRLVNMVAIPRPGYTLSNVASPFKEAVYPLALRACDVSSTEIRN
FT                   RLAQGRSVRYLVPELVETYLEKHALYR"
FT   gene            27726..28319
FT                   /locus_tag="Trad_0026"
FT   CDS_pept        27726..28319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0026"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG1713 HD superfamily hydrolase involved in
FT                   NAD metabolism; InterPro IPR005249:IPR006674:IPR003607;
FT                   KEGG: tth:TTC1420 metal dependent phosphohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region; SPTR: C1XI98
FT                   Metal dependent phosphohydrolase; PFAM: HD domain; TIGRFAM:
FT                   conserved hypothetical protein TIGR00488"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13169"
FT                   /db_xref="GOA:D7CWS8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWS8"
FT                   /protein_id="ADI13169.1"
FT                   /translation="MRNTLFTVNSPCTRPSILPYCERVKERVTPKRFEHIVRVAILTET
FT                   IAQANRFDRGELRAACLAAVLHDVARDLSAEELFALAPPETELEREHPLAVHGRAGRRI
FT                   AESWGVSDERVLAAIEGHVFGVAHDNRIGMALYVADVSEPGRGVNHDIRELAMHNLFRA
FT                   YQRAVNTKVAYLRSRGKTVHPVTLRVYREICGAL"
FT   gene            28380..29675
FT                   /locus_tag="Trad_0027"
FT   CDS_pept        28380..29675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0027"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="COGs: COG1316 Transcriptional regulator; InterPro
FT                   IPR004474; KEGG: dra:DR_2581 LytR/CspA/Psr family protein;
FT                   PFAM: cell envelope-related transcriptional attenuator;
FT                   SPTR: C1XI97 Cell envelope-related function transcriptional
FT                   attenuator common domain; TIGRFAM: cell envelope-related
FT                   function transcriptional attenuator, LytR/CpsA family;
FT                   PFAM: Cell envelope-related transcriptional attenuator
FT                   domain; TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator common domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13170"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWS9"
FT                   /protein_id="ADI13170.1"
FT                   /translation="MQLLGLLIAVLGLCGYWLTRDVQRTVLSPEEARLLNPEGAAFQAS
FT                   FVVAGRDYDYDPAGPLVWQDGEWVRSFTTEPRLGYRTDTILYVNFVGNRIYMVSVPRDI
FT                   FLPRFQIPINEVYAYPETYGSASRADNLRRAVSELLGVPIDYYAVINIDIFERLVDAIG
FT                   GVELEVPRAMVYRDQAAGLEIDLQPGFQRLSGAEAAGFVRYRELLRGDIDRIDNVKTLA
FT                   YAVLGRLQELNVRAALKLPELIDTYFDEVDTNASPALFSQLLPRLGEMTLEAATLPTSD
FT                   MEGSGRFLETDPEAVEAFLATLFGGTARTVTRTPEGRVLLTDRSGVPGAGDRVRELLLA
FT                   AGVAPEQLRVRRGAPDAITRVIVTRESLAAAPFYADLLGVGWQQIDRFAVDADIEVILG
FT                   QDAARFDLFRRAQAPTPQMSTPPSSPHVSTGG"
FT   sig_peptide     28380..28436
FT                   /locus_tag="Trad_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            29707..30069
FT                   /locus_tag="Trad_0028"
FT   CDS_pept        29707..30069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0028"
FT                   /product="iojap-like protein"
FT                   /note="COGs: COG0799 Iojap protein; InterPro IPR004394;
FT                   KEGG: ttj:TTHA1777 hypothetical protein; PFAM:
FT                   Iojap-related protein; SPTR: C1XSQ3 Iojap-related protein;
FT                   TIGRFAM: iojap-like protein; PFAM: Domain of unknown
FT                   function DUF143; TIGRFAM: iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13171"
FT                   /db_xref="GOA:D7CWT0"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWT0"
FT                   /protein_id="ADI13171.1"
FT                   /translation="MPDVVQRIVDALDDRRAKDIAVLDLRRASETLDYFIVATGESSLQ
FT                   LRALEESVRDKLEAVGVRPKGVEGPSTRWVLLDYGFVVVHIMSPEARDFYDLEGLWADA
FT                   ERLEVTPTPPAATPPA"
FT   gene            30075..30413
FT                   /locus_tag="Trad_0029"
FT   CDS_pept        30075..30413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0029"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="COGs: COG0792 endonuclease distantly related to
FT                   Holliday junction resolvase; InterPro IPR003509:IPR011335;
FT                   KEGG: ttj:TTHA0372 hypothetical protein; PFAM: protein of
FT                   unknown function UPF0102; SPTR: B7A9I8 Putative
FT                   uncharacterized protein; PFAM: Uncharacterised protein
FT                   family UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13172"
FT                   /db_xref="GOA:D7CWT1"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWT1"
FT                   /protein_id="ADI13172.1"
FT                   /translation="MRHWAEEVAKAHLQRLGYRVVAENYRVRGAEIDLIAEAEGVLVIV
FT                   EVKQRRRDRFGTPAEQLTPQKLRRLQQAALLYLAERYGRDDLPLRFDAVLVSGSRERYR
FT                   LEHLQRIL"
FT   gene            30523..31134
FT                   /locus_tag="Trad_0030"
FT   CDS_pept        30523..31134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0030"
FT                   /product="N-(5'phosphoribosyl)anthranilate isomerase
FT                   (PRAI)"
FT                   /note="COGs: COG0135 Phosphoribosylanthranilate isomerase;
FT                   InterPro IPR001240:IPR011060:IPR013785; KEGG: gem:GM21_2257
FT                   phosphoribosylanthranilate isomerase; PFAM:
FT                   N-(5'phosphoribosyl)anthranilate isomerase (PRAI); SPTR:
FT                   C1XXV7 N-(5'-phosphoribosyl)anthranilate isomerase; PFAM:
FT                   N-(5'phosphoribosyl)anthranilate (PRA) isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13173"
FT                   /db_xref="GOA:D7CWT2"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWT2"
FT                   /protein_id="ADI13173.1"
FT                   /translation="MGAVRVKICGVTRTEDALLAEAAGADAVGFIFAERSKRHVTLEAA
FT                   REMSAALGPFIARVGVFVDAPFEEVVACVRALRLDAVQLHGGEDAPYAAALQRHVRVVR
FT                   AVGFSPELDPAALSGYPADALLLDGLTPGSGERFSWAAAAAFRGWPRLLLAGGLTPDNV
FT                   AAGIAALRPYGVDVASGVELRPGVKDPRKVQDFVRAAKSL"
FT   gene            31517..33187
FT                   /locus_tag="Trad_0031"
FT   CDS_pept        31517..33187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0031"
FT                   /product="Methylcrotonoyl-CoA carboxylase"
FT                   /EC_number="6.4.1.4"
FT                   /note="COGs: COG4799 Acetyl-CoA carboxylase
FT                   carboxyltransferase component (subunits alpha and beta);
FT                   InterPro IPR011762:IPR011763:IPR000022; KEGG: dge:Dgeo_0811
FT                   propionyl-CoA carboxylase; PFAM: carboxyl transferase;
FT                   PRIAM: Methylcrotonoyl-CoA carboxylase; SPTR: C1XQB4
FT                   Acetyl-CoA carboxylase, carboxyltransferase component
FT                   (Subunits alpha and beta); PFAM: Carboxyl transferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13174"
FT                   /db_xref="GOA:D7CWT3"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWT3"
FT                   /protein_id="ADI13174.1"
FT                   /translation="MDELKSSLTLTERREGPFHAHRKAWKALAAQLAADRARLAAGGGE
FT                   GAVARQHAKGRLTARERVAALVDPGTPFDELMTFAGDGLYPEVGGAPSGGVVTGIGRVA
FT                   GRNWLIIANDATVKAGAFFPITAKKVIRAQTIALENHLPVIYLVDSAGVYLPMQDEIFP
FT                   DQDDFGRVFYLNARLSAAGVPQLAAIMGNCVAGGAYLPVMCDTLVMTEGSGLYLAGPAL
FT                   VKAAIGQNVSSEELGGGRLHAEVSGTADYLERSDADALQRLRTLAGSYAPAAQAPWALG
FT                   RTESREPKLPADDLYGLVPADGGTAPYDVREVIGRLVDASQFSEYRARYGRTIVCGTAR
FT                   LGGFSVGIVANQRLVVRNKGRLEVGGVIYAEAADKAARFVLNCNQAGIPILFLHDVTGF
FT                   MVGRESEAEGIIRRGAKLVNAVSNSVVPRLSVILGGSYGAGHYAMCGKAYGPRFLYAWP
FT                   SARYSVMGGQQAAKTILDIQVAQLKRRGVTPDDAALAELYERIKADYDRALDIRYAAAR
FT                   LWVDEVILPLETRERLIRALEVCALNPQQEALKLGVFQV"
FT   gene            complement(33208..33705)
FT                   /locus_tag="Trad_0032"
FT   CDS_pept        complement(33208..33705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aca:ACP_0152 hypothetical protein; SPTR:
FT                   C1F8M4 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF664)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13175"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWT4"
FT                   /protein_id="ADI13175.1"
FT                   /translation="MNLRDTTLRQTLEKLLRGEGAHVSLLGALEGLPPEWRTHRPPGLH
FT                   SIWQLLEHVRIAQHDLLHYTVDPAWRSPEWPGGYWPENRSDLPESAWQAALEGYARDLE
FT                   AFVALVRDPTCDLVAPLPHHPEHTPLRQVLLAADHTAYHAGQIVDLRRMLGDWPPKRRS
FT                   RS"
FT   gene            34154..35818
FT                   /locus_tag="Trad_0033"
FT   CDS_pept        34154..35818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR011933; KEGG: rca:Rcas_1973 hypothetical
FT                   protein; SPTR: A7NKP1 Conserved hypothetical membrane
FT                   protein; TIGRFAM: conserved hypothetical protein; PFAM:
FT                   Aerotolerance regulator N-terminal; TIGRFAM: N-terminal
FT                   double-transmembrane domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13176"
FT                   /db_xref="GOA:D7CWT5"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011933"
FT                   /db_xref="InterPro:IPR024163"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWT5"
FT                   /protein_id="ADI13176.1"
FT                   /translation="MSFAQPLFLGLLAALPLIVWLHFLRARRRTERVSALFLWVQAREA
FT                   AAQRRRLSPTWLLVAQLLFVTLLALALAQPQFGRPAVPPRILILDASASMAAEEPQGTR
FT                   LAQAVALAEGLLGGAGEVAVVRAGLAATVVQPLTSDHAAVRAALSGLEAADASAALGEA
FT                   LELARTLAPDAELHVIGDQAPPPGWQVYVHPVGTEVPNVGISALEAAFGRLFASVVSNT
FT                   PYPQTLELVFERGDESVRTTVLVPARGQANVSVPVDDTGGVYRARLEGLGEDALALDNE
FT                   AWIGSRELRALVSPPSTPVERALGAMPGVAVQSLLLREGDSLPEAELTVWLGLPPDPLP
FT                   AGDVILFAPPQEAPTYGRVADWVRSDPLLRFVDLAGVVLPLASAEQLRAWSPLPLAEAE
FT                   VLAQTSALTPALLRWRADGRTVLFFPFYPSQTDLVRRPAFPVLLANAVAEGRTDAPLPL
FT                   GTPLGGGARALAPGLFEVGERTVAASLLSAAESRLEVTAQPRVPPEAARPAASPPQGRT
FT                   GARLPFWLLVVAVALLLAEWLLWSRGRGLGYRLRRGA"
FT   sig_peptide     34154..34231
FT                   /locus_tag="Trad_0033"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            35882..36205
FT                   /locus_tag="Trad_0034"
FT   CDS_pept        35882..36205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0034"
FT                   /product="protein of unknown function DUF59"
FT                   /note="COGs: COG2151 metal-sulfur cluster biosynthetic
FT                   protein; InterPro IPR002744; KEGG: ddr:Deide_11230
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF59; SPTR: C1XNG6 Predicted metal-sulfur cluster
FT                   biosynthetic enzyme; PFAM: Domain of unknown function
FT                   DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13177"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWT6"
FT                   /protein_id="ADI13177.1"
FT                   /translation="MSELPSKEALLEALKVVKDPEIPVNVVDLGLIYRLEVKEGGEVDI
FT                   DMTLTSMGCPVQDMIQADAELACVQVEGVKKVNVEFVWSPPWSPAKMSEDGKKQMRMFG
FT                   FNF"
FT   gene            complement(36240..36698)
FT                   /locus_tag="Trad_0035"
FT   CDS_pept        complement(36240..36698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0035"
FT                   /product="protein of unknown function DUF163"
FT                   /note="COGs: COG1576 conserved hypothetical protein;
FT                   InterPro IPR003742; KEGG: pth:PTH_2857 hypothetical
FT                   protein; PFAM: protein of unknown function DUF163; SPTR:
FT                   A5CY81 Ribosomal RNA large subunit methyltransferase H;
FT                   PFAM: Predicted SPOUT methyltransferase; TIGRFAM: conserved
FT                   hypothetical protein TIGR00246"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13178"
FT                   /db_xref="GOA:D7CWT7"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWT7"
FT                   /protein_id="ADI13178.1"
FT                   /translation="MKYRVVAIGRLKRGFYAEGCAHYAARLKAYAPLELLELKEGRGQD
FT                   LESVKQQEGEALLGAARGYLIALDERAQQRRSEALAERVTALETRGVSQVSLLIGGAAG
FT                   LSELVREAAGELWSLSALTLPHELARLVLLEQLYRLETIRAGHPYHRA"
FT   gene            complement(36717..37586)
FT                   /locus_tag="Trad_0036"
FT   CDS_pept        complement(36717..37586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0036"
FT                   /product="thymidylate synthase, flavin-dependent"
FT                   /note="COGs: COG1351 alternative thymidylate synthase;
FT                   InterPro IPR003669; KEGG: ttj:TTHA1096 FAD-dependent
FT                   thymidylate synthase; PFAM: thymidylate synthase
FT                   complementing protein ThyX; SPTR: C8PQF4 Thymidylate
FT                   synthase, flavin-dependent; TIGRFAM: thymidylate synthase,
FT                   flavin-dependent; PFAM: Thymidylate synthase complementing
FT                   protein; TIGRFAM: thymidylate synthase, flavin-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13179"
FT                   /db_xref="GOA:D7CWT8"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWT8"
FT                   /protein_id="ADI13179.1"
FT                   /translation="MTPPPHAADDPQTEPLLDREYRVLDKGFVRLVDHMGGDARIVQAA
FT                   RVSYGAGTKSTREDAQLIDYLMRQGHTSPFEQVVMTFHLKMPLFVARQWLRHRTARVNE
FT                   LSGRYSVLRDEFYVPEALRGQDESNKQGSAGALGEEANAQLLAELVASQARAYDTYEAL
FT                   LEAGVARELARINLPLSLYTEFYWQIDLHNLFHFLKLRLDPHAQREIRMYAEALLAFAK
FT                   GVAPVACAAFEEHVLCAKTFSRGELELLRAAIDSGALQAALETSDLRASRRRELLEKLG
FT                   FADAQRLA"
FT   gene            38205..41105
FT                   /locus_tag="Trad_0037"
FT   CDS_pept        38205..41105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0037"
FT                   /product="S-layer domain protein"
FT                   /note="InterPro IPR001119; KEGG: tth:TTC1532 S-layer
FT                   protein; PFAM: S-layer domain protein; SPTR: P35830 S-layer
FT                   protein; PFAM: S-layer homology domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13180"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWT9"
FT                   /protein_id="ADI13180.1"
FT                   /translation="MKKLLLATLALLIVSGAAAQSFPDVPEGSYAEEAVARLADLGIII
FT                   GFPDGTFRGNEPFNRYQAALVVSRLLDLIDSEFLSAEDLDTVRNALQELASDVAANEEA
FT                   IAALEEALAGAAGADADAVAQLQTQLDALRVELDTAIAASQGLAALEQQVASNTSQIQQ
FT                   LTDLVTILNEDIAALATGGEVDPGFLEQIEQNTGDIANLREFVVLLRRDQVATTERVAA
FT                   LEASDAEQSARLDDLETRVTELEATAVAFSGSIGLEYDVRRLSGAEIPFDTDRIFGVGL
FT                   EREEAPSFFTTGAADLNDDGDQTDMGERAEDRQDIFQQRGRFRPVLELNVDFSAERGLA
FT                   PASGLNQFESTVALRLREARVLQSGADITDPTFDFTNPDNYFTGYVFEFTGITATLGPI
FT                   GADPINFFFGQEPGADFSAYVFESLGPGFRVEIGSPDFLAFLQPTLELAYGVYEQGGDA
FT                   QNDPVELPDHRAPQLSLGGAPQPNPWTDAYYRGVRGTLTPFSGPDFSMTGGFSVGQIAG
FT                   NAGDNADAANDNIEVTAWSLDGQVNLSVFNLEFEYAANDIPQGALFQQGNQVLRDEEGN
FT                   LVDFEGNPLEEGAAGIPVVQEIDSTSLVYAELTVDTEAAGLPLLRSLSANYRSIPQFWY
FT                   GLKYDTDTFPWSLDQVGYGAEATVGLSIFNLTGFVDTYTITNPATETGVDGAPVTGTEV
FT                   FAYGARLGVEVFRAIEVYGFYNVVTLDGQQVEALDPARRNEAYVAGVGLGVEHDGAAAN
FT                   ALVPGLNFNVAYDLLSGSIAAATVDTEVTVGPFALSPYVGFDRSFSAGQFTDDTIELRA
FT                   GTGLATEPLDLPLAPSFLANVNFRNTDHFDVAADVDDYTATVLQYSVGIQFTEFLLPES
FT                   SLGVRYGSFTGENIVVEPNTIGSGDFASDISGGGNAARRDVPGTGTQSTEGYEVVWNYY
FT                   GLELAYGAYTNTNPPASPNPGLTGGQAFAIRYTVEF"
FT   sig_peptide     38205..38297
FT                   /locus_tag="Trad_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            41250..41918
FT                   /locus_tag="Trad_0038"
FT   CDS_pept        41250..41918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0038"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="COGs: COG1207 N-acetylglucosamine-1-phosphate
FT                   uridyltransferase (contains nucleotidyltransferase and
FT                   I-patch acetyltransferase domains); InterPro
FT                   IPR001451:IPR011004:IPR018357; KEGG: dtu:Dtur_1633
FT                   transferase hexapeptide repeat containing protein; SPTR:
FT                   B8E332 Transferase hexapeptide repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13181"
FT                   /db_xref="GOA:D7CWU0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWU0"
FT                   /protein_id="ADI13181.1"
FT                   /translation="MLTCYDLFDLSRVSPNLRPLLEVTRPWEVLAKLDAFCTEIPDQRL
FT                   GEVHPTAVLVGNVYLEAGAKVGPHALIEGPAWIAAGAEVGHGAYLRGGVVLAAGAKVGH
FT                   ATEVKRALFLEGAKAPHFNYVGDTVLGRGVNLGAGVKLANLKTFGDTIEVAGESTGLRK
FT                   FGAALGDGVSIGCNAVTAPGTIVGPRTIIYHGATVRGVVPADVVVKLKQPLQTVPRRDP
FT                   "
FT   gene            41950..42600
FT                   /locus_tag="Trad_0039"
FT   CDS_pept        41950..42600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0039"
FT                   /product="Rhomboid family protein"
FT                   /note="COGs: COG0705 membrane protein; InterPro IPR002610;
FT                   KEGG: ttj:TTHA1474 hypothetical protein; PFAM: Rhomboid
FT                   family protein; SPTR: B7ABV4 Rhomboid family protein; PFAM:
FT                   Rhomboid family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13182"
FT                   /db_xref="GOA:D7CWU1"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWU1"
FT                   /protein_id="ADI13182.1"
FT                   /translation="MFPLHDANPRHGPSFVNWALIALNVAVFFYSLGVSPFEARTLVLT
FT                   YAFIPQFFFFDPLGNAYRLLSSLFLHGGLAHILGNMFFLYVFGDNVEDRLGHGRYLLFY
FT                   LLGGVVATLAHGVFVPGSPVPMIGASGAVSAVLGAYIVLFPRQRILTFVPPLFLFWLPA
FT                   WLYLGYWALIQLLEAFGGLVVMGTGGGIAWWAHVGGFFFGVFAVRSFARPRGL"
FT   sig_peptide     41950..42066
FT                   /locus_tag="Trad_0039"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            42660..43328
FT                   /locus_tag="Trad_0040"
FT   CDS_pept        42660..43328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0040"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyn:Cyan7425_4038 hypothetical protein; SPTR:
FT                   B8HVP0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13183"
FT                   /db_xref="GOA:D7CWU2"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWU2"
FT                   /protein_id="ADI13183.1"
FT                   /translation="MRRSLTPLVATLLVAALTFGGAQGEVETYLSANGSDPETTRGASR
FT                   LLRYQLEDFPVPVYVPLPPVAPPETATGGVQTGGASAPGSAAWRRQEVIRAFDAWAEAV
FT                   PEIVSWTFVETPGEETLVVSWEDLPPNLAGSYRYAFSVTPSNEYRFRATRILLDPNTPE
FT                   GDLYRFALLQVGHALGLLGRSPFEGDALSAVPSGVVSERDVATLRALYALPSGTVLHGD
FT                   "
FT   sig_peptide     42660..42731
FT                   /locus_tag="Trad_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(43486..44058)
FT                   /locus_tag="Trad_0041"
FT   CDS_pept        complement(43486..44058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0041"
FT                   /product="ribosomal subunit interface protein"
FT                   /note="COGs: COG1544 Ribosome-associated protein Y
FT                   (PSrp-1); InterPro IPR003489; KEGG: dge:Dgeo_1384 sigma 54
FT                   modulation protein/ribosomal protein S30EA; PFAM: sigma 54
FT                   modulation protein/ribosomal protein S30EA; SPTR: Q1IYK5
FT                   Sigma 54 modulation protein/ribosomal protein S30EA;
FT                   TIGRFAM: ribosomal subunit interface protein; PFAM: Sigma
FT                   54 modulation protein / S30EA ribosomal protein; TIGRFAM:
FT                   ribosomal subunit interface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13184"
FT                   /db_xref="GOA:D7CWU3"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWU3"
FT                   /protein_id="ADI13184.1"
FT                   /translation="MDIYQMIGRNIEVTDAMRAYAEEKLEKLERFSDHIVDAKVVMSYA
FT                   TDGNPAMPAKVEVQLNVPNGIVRAEESGPDTYAATDLVVEKLERQLRRFKERRLAKRNQ
FT                   EPPPSDLDVAPMEGAGVAADESQEREPAIVRVKRHVMRPMSPEDAALQMEALGHAFFVF
FT                   HNMETDTISVLYRRHDGDYGLIEPANN"
FT   gene            44472..44816
FT                   /locus_tag="Trad_0042"
FT   CDS_pept        44472..44816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0042"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="COGs: COG0640 transcriptional regulator protein;
FT                   InterPro IPR001845:IPR011991; KEGG: ddr:Deide_2p00101
FT                   putative transcriptional regulator, ArsR family; PFAM:
FT                   regulatory protein ArsR; SMART: regulatory protein ArsR;
FT                   SPTR: C1XMQ5 Transcriptional regulator, ArsR family; PFAM:
FT                   Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13185"
FT                   /db_xref="GOA:D7CX61"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX61"
FT                   /protein_id="ADI13185.1"
FT                   /translation="METLSSRLKALADPVRLAMLDFLLNPVQACLTQADGVCACDFEAG
FT                   LGMTQSAVSHHMKILVQAGFVHAEKHGRWVRYSVNPTVFASVCEALRPYVEASPVPEAA
FT                   PRLAVAGGRS"
FT   sig_peptide     44472..44558
FT                   /locus_tag="Trad_0042"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            44820..45608
FT                   /locus_tag="Trad_0043"
FT   CDS_pept        44820..45608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0043"
FT                   /product="cation efflux protein"
FT                   /note="COGs: COG1230 Co/Zn/Cd efflux system component;
FT                   InterPro IPR006121:IPR002524; KEGG: prw:PsycPRwf_0699
FT                   cation efflux protein; PFAM: cation efflux protein; SPTR:
FT                   A2TNV0 Integral membrane protein; PFAM: Cation efflux
FT                   family; Heavy-metal-associated domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13186"
FT                   /db_xref="GOA:D7CX62"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX62"
FT                   /protein_id="ADI13186.1"
FT                   /translation="MDRSLFQVPKMDCAAEENLVRMQLDGMAAVKSLDFDLSARKVTVY
FT                   HEGGLGEIENALVQLGLGSKLVETGETDEAAPETAQQRRLLWVVLLINFSFFVLEMTTG
FT                   FISGSMGLVADSLDMLADALVYGLSLLAVGATVARKKNVARYSGYFQATLAVLGFVEVL
FT                   RRFFGVEALPDFRTMIVVSVLALIANGVCLYLLQRSKDREAHMQASMIFTSNDVIINLG
FT                   VITAGVLGLWLGSGIPDLVIGAIVFVIVTLGAVRILRLAR"
FT   gene            45840..47465
FT                   /locus_tag="Trad_0044"
FT   CDS_pept        45840..47465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3666 Transposase and inactivated
FT                   derivatives; KEGG: ana:alr7249 hypothetical protein; SPTR:
FT                   Q8YKP4 Alr7249 protein; PFAM: Transposase domain (DUF772)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13187"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX63"
FT                   /protein_id="ADI13187.1"
FT                   /translation="MLKPQPVPPVPEMTARAAHAAFPKGHCYLTLRDELGTIFTDDMFA
FT                   DLFPTVGRPAEAPWRLALVTIVQFAEGLSDRDVADAVRDRITLKYLLGLEYDDSGFDYS
FT                   ILSRFRDRLVEGNSVAILLDALVEASRKAGLIKHRGKVRTDATHILAKIRELSRLELVG
FT                   ETLRHALNEIAKAAPEWLRALAPDDWYKRYAKRFEEESYRSRYKQGPGYSAQVGRDGFL
FT                   LMTAVYSADAPTGLGNLKAVELLRRCWLEQFMVEGDEVKMRKGGNMPPSAARLESPYDA
FT                   EAHYGVNGGLSWVGYKVHYTESCDEDAPHLVVHVDTTEAAMADLVRVTPIHEQLKQRQL
FT                   LPAEHFVDNQYVTSKLLVDSKKHYSVELVGPIKPHYEAKGFGIGEFKIDWEHKVVTCPG
FT                   GEQSTRWRPEVPKSGRAQITVRFAPSDCRACSLNDRCAKNTTRVGRTLALLPREQYEAR
FT                   EAVKQKQHTQEWLARYQIRTGSEGTFSQAVSAGLRQSRYYGLNKNHLQNVAIAAGMNFQ
FT                   RLSDWFEEIPRAQTRTSRFAALRA"
FT   gene            complement(47715..47954)
FT                   /locus_tag="Trad_0045"
FT   CDS_pept        complement(47715..47954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0045"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="COGs: COG0851 Septum formation topological
FT                   specificity factor; InterPro IPR005527; KEGG: ttj:TTHA1242
FT                   cell division inhibitor MinE; PFAM: Septum formation
FT                   topological specificity factor MinE; SPTR: C1XUL0 Cell
FT                   division topological specificity factor MinE; TIGRFAM: cell
FT                   division topological specificity factor MinE; PFAM: Septum
FT                   formation topological specificity factor MinE; TIGRFAM:
FT                   cell division topological specificity factor MinE"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13188"
FT                   /db_xref="GOA:D7CX64"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX64"
FT                   /protein_id="ADI13188.1"
FT                   /translation="MFGLFGRNRSKDTVKERLKLVLSYDRARLSPGKMDALKNELLEVI
FT                   SKYFPADETNYDVSLEQQGDRMVLVANLPAKPSA"
FT   gene            complement(47954..48760)
FT                   /locus_tag="Trad_0046"
FT   CDS_pept        complement(47954..48760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0046"
FT                   /product="septum site-determining protein MinD"
FT                   /note="COGs: COG2894 Septum formation inhibitor-activating
FT                   ATPase; InterPro IPR010223:IPR002586; KEGG: ttj:TTHA1243
FT                   septum site-determining protein MinD; PFAM: Cobyrinic acid
FT                   ac-diamide synthase; SPTR: C1XUL1 Septum site-determining
FT                   protein MinD; TIGRFAM: septum site-determining protein
FT                   MinD; PFAM: CobQ/CobB/MinD/ParA nucleotide binding domain;
FT                   TIGRFAM: septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13189"
FT                   /db_xref="GOA:D7CX65"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX65"
FT                   /protein_id="ADI13189.1"
FT                   /translation="MNAKAIVVTSGKGGVGKTTTTANVGAALALLGEKVAVIDTDVGLR
FT                   NLDVVMGLEGRVVYDLIDVFEGRCKLKQALIRDKRVDNLYLLAASQTRDKSALSEARMK
FT                   ETVELLLGEEGFDRILIDSPAGIESGFQTAASAAQGALVVVNPEVSSVRDADRIIGLLE
FT                   AREITEVKCIINRLRPEMVKRGDMLEVDDILEILGIKLIGIVPEDEKIIVSTNVGSPIS
FT                   LENGKTGAGDAFRSIAKRIQGEEIPHRALESRGNFLGYLRRLFGMG"
FT   gene            complement(49011..52331)
FT                   /locus_tag="Trad_0047"
FT   CDS_pept        complement(49011..52331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0047"
FT                   /product="UvrD/REP helicase"
FT                   /note="COGs: COG0210 Superfamily I DNA and RNA helicase;
FT                   InterProIPR006141:IPR014016:IPR014017:IPR000212:IPR 003586;
FT                   KEGG: dge:Dgeo_0868 UvrD/REP helicase; PFAM: UvrD/REP
FT                   helicase; SMART: Hedgehog/intein hint domain protein; SPTR:
FT                   B4VQT2 UvrD/REP helicase subfamily; PFAM: UvrD/REP
FT                   helicase; TIGRFAM: intein N-terminal splicing region;
FT                   intein C-terminal splicing region"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13190"
FT                   /db_xref="GOA:D7CX66"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX66"
FT                   /protein_id="ADI13190.1"
FT                   /translation="MPETVSDHPLLAVLNEEQRAAAEHFQGPALVLAGAGSGKTRTVVH
FT                   RIAYLMDAHEVYPTEILAVTFTNKAAGELKERVAHLMGEAAKDLWVSTFHSACLRILRA
FT                   YGGLIGLEPGFAIYDDTDQLEVLKEILERVTGLGDANPRVLRALIDRAKSNLWTPAELA
FT                   REGERVFGGMVAGLPLELVAEVYERYSSRLRSVNAVDFNDILGRTVELFERFPEVLEKV
FT                   QQRAVFIHVDEYQDTNTAQYRLTRLLANKYANLMVVGDPDQCLPPETRIPTRRGCLPIA
FT                   CVQEGDEVLGTGGGLQPTWGHVTTVKRGRYRGPMWEVRVGGRVVRGTPHHLVLARLDPE
FT                   AGFYYVYLMYREDRGYRLGLTKSLRANDFGQDEVGFRVRLAQENGDKLWVLRVCQTYAE
FT                   ARYWEARFAAEYGLPTLVFHGVGRRLKMDEGWIARLYQDVDTTASAARLMAQLHLHPDF
FT                   PHYRPQNGLRRQSVNLVMFQDFRHGGVGYHRVQWSSIRADLAARLLAAGYPVRSNGRGG
FT                   YRTEICRKSYRDALAFARGFAEAGGLELQRKAYIDGRMYHVTPLAHLHPGMRVLVKREQ
FT                   SLEEAVVETVSQVAYDGPVFDLEVTPTHTYLANGMLVHNSIYAFRGADVRNILDFREDF
FT                   PDAAVYRLELNYRSVASVLELANAVIAPNEGRLEKRLRPVKGAGDKVRLYRAADHRAEA
FT                   DFVARQIERLQAERGLSAKDFTVLYRTNSQSRVLEEALRRAGIPAKIVGGVGFYERREV
FT                   KDILSYARAALNPADDVAWRRVLNRPKRGIGKTSEETLVAFAAKRGIRFSEALRRAEEP
FT                   LRGTPALKRIGEFVALMDDLREAAETLPAAQFLQAAIDQSGYLQALKDEKSFEAQGRIE
FT                   NLDELVNAVAEWQEETGGSIGEFLDEAALLASVDDRAVKAVNQGQAPEEAVTLMTLHNA
FT                   KGLEFPVVFLVGLEENLIPHRSSLASLQEIEEERRLLYVGVTRAQELLFLVHCESRMSF
FT                   GRTEFARPSRFLEDIPKGMLQEIDVFGQELHAERLSKYSRAVWAPPKLGATGASAPASA
FT                   EDGGGVSFRGGERVKHPKFGLGTVVGVSGEGARAEVTVVFQEAGPKRLLFKYANLTRA"
FT   gene            complement(52380..53330)
FT                   /locus_tag="Trad_0048"
FT   CDS_pept        complement(52380..53330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0048"
FT                   /product="DNA-3-methyladenine glycosylase II"
FT                   /note="COGs: COG0122 3-methyladenine DNA
FT                   glycosylase/8-oxoguanine DNA glycosylase; InterPro
FT                   IPR011257; KEGG: mac:MA3207 DNA-3-methyladenine glycosylase
FT                   II; SPTR: Q8TL35 DNA-3-methyladenine glycosylase II"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13191"
FT                   /db_xref="GOA:D7CX67"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX67"
FT                   /protein_id="ADI13191.1"
FT                   /translation="MEQTTLTVTATPPFSLQRSLDYIRAFYGRPYERVPAAEQIACKTV
FT                   GDERVQGLRRVVSVRGQAVLFEVWPTAQPERLELTLYAKMLDDALTRAATDRVRFYLSL
FT                   DDDLTPLYARCDPLFAEVVARLYGYHPVKVLTPFEAACWALVQQRTPNGFAHKTMARLA
FT                   ESFGPRLEHGGRRYVAFPEAQQLLDDPHARILAATNNTRKTERMLHLVRAFALADEAFL
FT                   RAAPFDEVARWLGRIKGLGAWSVDFIALRGLGRYERVPWTDTGLLAAISKVYTKGLPIS
FT                   AGSAREIAERYGWYAGLWAHYVKTAAYGALAEGPP"
FT   gene            53391..53957
FT                   /locus_tag="Trad_0049"
FT   CDS_pept        53391..53957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0049"
FT                   /product="Protein of unknown function DUF2227,
FT                   metal-binding protein"
FT                   /note="COGs: COG2389 Uncharacterized metal-binding protein;
FT                   InterPro IPR019250; KEGG: dra:DR_1889 hypothetical protein;
FT                   PFAM: Protein of unknown function DUF2227, metal-binding;
FT                   SPTR: C1XUS9 Uncharacterized metal-binding protein; PFAM:
FT                   Uncharacterized metal-binding protein (DUF2227)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13192"
FT                   /db_xref="GOA:D7CX68"
FT                   /db_xref="InterPro:IPR019250"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX68"
FT                   /protein_id="ADI13192.1"
FT                   /translation="MASGRTHEAINLGVFAALAGGYAYARARSLADPTNLLFAPETLWA
FT                   FVLSYLIGTFFITPDLDLAENRMRARNNWGLLGLLWVPYGALFSHRGLSHTWFVGPLTR
FT                   LLYLVLLALALGWAASEIAPHFGYRVGFEAEVGESWPQLLVGSLAGYYLSQWLHLIADG
FT                   IQPDHAWRRKGARTRGRKRRRRSPS"
FT   sig_peptide     53391..53465
FT                   /locus_tag="Trad_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            54053..55123
FT                   /locus_tag="Trad_0050"
FT   CDS_pept        54053..55123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0050"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG0687 Spermidine/putrescine-binding
FT                   periplasmic protein; InterPro IPR006059:IPR001188; KEGG:
FT                   cyc:PCC7424_1221 extracellular solute-binding protein
FT                   family 1; PFAM: extracellular solute-binding protein family
FT                   1; SPTR: B7K7A1 Extracellular solute-binding protein family
FT                   1; PFAM: Bacterial extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13193"
FT                   /db_xref="GOA:D7CX69"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX69"
FT                   /protein_id="ADI13193.1"
FT                   /translation="MHLKRAVALGLFAVCASAAAQEGWTCPEGFAGQRLNVYNWTTYIA
FT                   EDTIANFEALCDVSVTYDTYPTEDDMLARIRQGNPGYDIVVPSGTIMVLMINEGLLEPL
FT                   NLENIPNVANLDDTFLDLPFDPGNQYSLPYQWGTVGIGYNRTRVGGEITSWREMFAYEG
FT                   PVSWLEDVRGIMGVALLLAGFDPNSTDPDEIAAARDFLIDNGSNVVYINQDDGQEVLLR
FT                   GEADIVMEYSGDIFQIIEECDCDDFAYVIPEEGTYFWVDNVAIPVGAQNRALAEVFIDY
FT                   LLDPQVGADISNFTAYGSPNRAAIEAGLIDEALLNNPGIYPSEEVEERLFTIINDPEAE
FT                   GLYNDAWDEVKIFVGG"
FT   sig_peptide     54053..54112
FT                   /locus_tag="Trad_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            55170..56282
FT                   /locus_tag="Trad_0051"
FT   CDS_pept        55170..56282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0051"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="COGs: COG3842 ABC-type spermidine/putrescine
FT                   transport systems ATPase components;
FT                   InterProIPR003439:IPR005893:IPR013611:IPR008995:IPR
FT                   003593:IPR017871; KEGG: sti:Sthe_1276 spermidine/putrescine
FT                   ABC transporter ATPase subunit; PFAM: ABC transporter
FT                   related; Transport-associated OB domain protein; SMART: AAA
FT                   ATPase; SPTR: D1C394 Spermidine/putrescine ABC transporter
FT                   ATPase subunit; TIGRFAM: spermidine/putrescine ABC
FT                   transporter ATPase subunit; PFAM: ABC transporter; TOBE
FT                   domain; TIGRFAM: spermidine/putrescine ABC transporter
FT                   ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13194"
FT                   /db_xref="GOA:D7CX70"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX70"
FT                   /protein_id="ADI13194.1"
FT                   /translation="MQPAVELREVTKAYADPRGAGTVRAMDAVSLRIDEGGFFALLGPS
FT                   GCGKTTTLRSIAGFEQPDSGAVLIRGRPVQGIPPFHRPVNTVFQDYALFPHMSVLQNVM
FT                   FGLKMAKVPAREARRRAEEALELVHLPHVGARRPSQLSGGQRQRVALARALVNRPAVLL
FT                   LDEPLGALDLKLRKAMQFELKRMQQQVGITFVFVTHDQEEAMAMADHIAVMDRGRVLQV
FT                   GTPAEIYEHPVNRFVADFIGETNFLEGTLEASGPVGHFRLADGRTLPVVLGAAAPTSGP
FT                   ATLAVRPERIRLTRATHGTGAGGVRLAARVTEVHYLGTDTRYHLVSGSATLSVRQPNTG
FT                   GQLGAEGRFAPGDEVVAWWQPDGAAVLRPE"
FT   gene            complement(56350..58404)
FT                   /locus_tag="Trad_0052"
FT   CDS_pept        complement(56350..58404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0052"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /note="COGs: COG4666 TRAP-type uncharacterized transport
FT                   system fused permease components; InterPro
FT                   IPR011853:IPR010656; KEGG: amt:Amet_4705 TRAP transporter,
FT                   4TM/12TM fusion protein; PFAM: TRAP C4-dicarboxylate
FT                   transport system permease DctM subunit; SPTR: A3JCL7
FT                   Hypothetical permease; TIGRFAM: TRAP transporter, 4TM/12TM
FT                   fusion protein; PFAM: DctM-like transporters; TIGRFAM: TRAP
FT                   transporter, 4TM/12TM fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13195"
FT                   /db_xref="GOA:D7CX71"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX71"
FT                   /protein_id="ADI13195.1"
FT                   /translation="MNSQPPGSQPASDVTPTFSDNSPTARAPTARAALVLSSLVAVALS
FT                   LFQLVTAGLVPLGLFYQRSIHLSLILVLAFLLYPARRGRRRGALGWAFDSVFIAGSALS
FT                   GFYLSYNLDAIIGRTGFWTPTDIAVGVVTIVTLLEASRRVIGLPITLIGLAFIVYAMAG
FT                   ERGALPFLADLLPGILAHRGYTVERIVSTLYLGQGGIYGTPLGVAATFVFIFILFGAFL
FT                   EVTGAGKFFIDLAYAAAGRQRGGPAKAAVVASAFMGSISGSAIANVVTSGAFTIPLMKR
FT                   LGYKAEEAGGVEAAASTGGQIMPPIMGAGAFIIAEYTGLPYAEIVKLSVLPALMYFATV
FT                   YLFVDIIAAKRGMTGIARAELPRIREVLRSGWHFLLPLGLLVYFLVRNVSPNRVGFIAV
FT                   VSIVVVAFVRALLQLALRRSEAATSGAAQLGRSGAQGLFTALAAGAKNAVPVSVACAVA
FT                   GIVVGIISLTGLGLKFSALMLSFSGGNLVLAIALVALASLVLGLGLPVTASYIVLAVLT
FT                   APALQSEFGIPLVIAHLLIFWYSQDSNVTPPVALAAFAGAGIAGSDPMRTGLAAWKFAK
FT                   GLYLIPLFMVFNPEIILGGTPQGVAWSVLTAFAALGAFAGALEGFLFAPLNPLLRLLAA
FT                   AGTVAIFWPNIWVEIGGFAALLVVFAVNFLKAKREGRLGVAQVQPQHPV"
FT   sig_peptide     complement(58309..58404)
FT                   /locus_tag="Trad_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(58401..58889)
FT                   /locus_tag="Trad_0053"
FT   CDS_pept        complement(58401..58889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0053"
FT                   /product="Domain of unknown function DUF1850"
FT                   /note="InterPro IPR015001; KEGG: bbe:BBR47_09150
FT                   hypothetical protein; PFAM: Domain of unknown function
FT                   DUF1850; SPTR: A3VFZ1 Putative uncharacterized protein;
FT                   PFAM: Domain of unknown function (DUF1850)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13196"
FT                   /db_xref="InterPro:IPR015001"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX72"
FT                   /protein_id="ADI13196.1"
FT                   /translation="MRRRHRWLVGALLLGVAAAHAQQLVVMRDDGAVLLRLELSAVPTW
FT                   EVRWYHSVAGFEVRDRYRLKGGQMLLQDSYAPDFAAGLGHIPGRGRLESDPNGGYWLRE
FT                   IDEPVPNNRYALRVGSARVDHRLVHAGRSISLSALAAGERVTLAVVPAAQSPAADVTP"
FT   sig_peptide     complement(58827..58889)
FT                   /locus_tag="Trad_0053"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(58893..59861)
FT                   /locus_tag="Trad_0054"
FT   CDS_pept        complement(58893..59861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0054"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="COGs: COG2358 TRAP-type uncharacterized transport
FT                   system periplasmic component; InterPro IPR011852:IPR015168;
FT                   KEGG: afu:AF0635 immunogenic protein (bcsp31-2); PFAM:
FT                   NMT1/THI5 like domain protein; SPTR: A3JCL9 Immunogenic
FT                   protein; TIGRFAM: TRAP transporter solute receptor, TAXI
FT                   family; PFAM: NMT1/THI5 like; TIGRFAM: TRAP transporter
FT                   solute receptor, TAXI family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13197"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX73"
FT                   /protein_id="ADI13197.1"
FT                   /translation="MRTLRLFVGLLVMLVPLEATAQSNLSIATGGTGGTYYPLGGGIAE
FT                   LINTHVEGYQAVAEATGASEENVALVFQGESDIAFALADTAFQAYSGSGNFEGRPIPSL
FT                   RALGAVYPNALHLVTLAGSGIETLEDLRSARVSIGAPGSGTAISAEALLSANGISLDEL
FT                   SVQRLDFNETAAALRDGQIDAGFWSAGPPTASILDLATTRDVRLVSLTEAQIAAAQELD
FT                   PSYAPYTMSAGTYPGQDEEVLALSTPNLLIVDESLDETLVYEVTKTIFEHVDDLIAIHP
FT                   AANDTTVAFSLASTPIPLHPGAVRYYQEVGADVPEHLIAGE"
FT   sig_peptide     complement(59799..59861)
FT                   /locus_tag="Trad_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(59968..61209)
FT                   /locus_tag="Trad_0055"
FT   CDS_pept        complement(59968..61209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0055"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="COGs: COG1804 acyl-CoA transferase/carnitine
FT                   dehydratase; InterPro IPR003673; KEGG: ttj:TTHA1887
FT                   CaiB/BaiF family protein; PFAM: L-carnitine
FT                   dehydratase/bile acid-inducible protein F; SPTR: C1XSG3
FT                   Predicted acyl-CoA transferase/carnitine dehydratase;
FT                   manually curated; PFAM: CoA-transferase family III"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13198"
FT                   /db_xref="GOA:D7CX74"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX74"
FT                   /protein_id="ADI13198.1"
FT                   /translation="MPQTNATPHPGALAGVRVLDLSRVLAGPYCTQLFADLGATVWKLE
FT                   ALTGDDTRRWGPPFAEGESAYFLSVNRGKKGLCIDLKHPEGREVAWRLALEADVLVENF
FT                   KVGDLARYGLDYASLAAAHPGLIYASVTGFGQTGPRRAEPGYDAAMQAFGGLMSLTGTP
FT                   DGPPVKVGVAVVDVLAGLHLAVGILAALFERTRSGRGQHLDVALFDVAVASLINQAQGF
FT                   LLTGTPPRRLGSEHPQIVPYGAFRAADGFLVLAVGNDAQFVRACLALGLPELAADPRFE
FT                   TNAGRVAAREEVVGRLAERLKAQPRAVWLARLRAANVPATPVQNLAEVFAEPQLAARGM
FT                   TGSVLHPALGPLEVVGSPLKHLSRTPARLGAAPPRLGEHTAEVLQEVLGLSAEEVGRLE
FT                   REGALRTLPESQEG"
FT   sig_peptide     complement(61132..61209)
FT                   /locus_tag="Trad_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            61421..62080
FT                   /locus_tag="Trad_0056"
FT   CDS_pept        61421..62080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tro:trd_A0513 hypothetical protein; SPTR:
FT                   B9L3Z9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13199"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX75"
FT                   /protein_id="ADI13199.1"
FT                   /translation="MTLTAAQTLRRSALITLYLLALSLLPWAAAQLTVRYDGGPTGGFE
FT                   AFIVLQEAIAFELDGEAAGLYVVARRGDEVLLDTSVALEPVVSGRVAVGMITVPIFGMC
FT                   EGGPTLFIQVQTTKVEGSGSRSLTGCLETSGGYLERTVASGPGTFVATAPLDRWIALQA
FT                   LLTPEAYTDTVLGEDAVTFFAFFGREDPARLGAPYPPLPDVRTFDELQALALFPAP"
FT   sig_peptide     61421..61504
FT                   /locus_tag="Trad_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            62206..63411
FT                   /locus_tag="Trad_0057"
FT   CDS_pept        62206..63411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0057"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /EC_number="1.3.8.6"
FT                   /note="COGs: COG1960 Acyl-CoA dehydrogenase;
FT                   InterProIPR006092:IPR006091:IPR006090:IPR009100:IPR
FT                   009075:IPR013786:IPR013764:IPR006089; KEGG: tth:TTC0435
FT                   glutaryl-CoA dehydrogenase; PFAM: acyl-CoA dehydrogenase
FT                   domain protein; SPTR: Q72KT2 Glutaryl-CoA dehydrogenase;
FT                   PFAM: Acyl-CoA dehydrogenase, C-terminal domain; Acyl-CoA
FT                   dehydrogenase, middle domain; Acyl-CoA dehydrogenase,
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13200"
FT                   /db_xref="GOA:D7CX76"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX76"
FT                   /protein_id="ADI13200.1"
FT                   /translation="MTRTAQKTDVGARSSVALDDFYGLEPLYTAEERRLRDTMRAFVAA
FT                   EILPHIGDWWQREHFPPHLPRALGELGLLGVSLPKAYGGQGASHTAYGLVCQALEYGDS
FT                   GLRSFLSVQSSLVMYPLYKYASETLQKRWLPPLATGEAVGCFALTEPHGGSDPSRMKVT
FT                   ARRVGGEYVLSGHKRWSTNGLIADLAIVWAKEEGSDQVVGFAVETRSEGFEARGIPGRA
FT                   SLRASVSSEVFLHEVRVPAENKLAVEGLRGPLSCLNAARFGIAFGALGAGYACFDEARR
FT                   YVAERELFGESLAHKQLVQAGLADMLAELTKGSLLAYHLGRLKEAGQDTPARVSLAKRD
FT                   NVRAAQRVARTARDLLGGNGILTEHASIRHLLNLESVATYEGTDAVHTLVLGREITGHN
FT                   AF"
FT   gene            63493..64578
FT                   /locus_tag="Trad_0058"
FT   CDS_pept        63493..64578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0058"
FT                   /product="peptidase C45 acyl-coenzyme A:6-aminopenicillanic
FT                   acid acyl-transferase"
FT                   /note="InterPro IPR005079; KEGG: hoh:Hoch_4555 peptidase
FT                   C45 acyl-coenzyme A:6-aminopenicillanic acid
FT                   acyl-transferase; PFAM: peptidase C45 acyl-coenzyme
FT                   A:6-aminopenicillanic acid acyl-transferase; SPTR: A6GBF3
FT                   Peptidase C45, acyl-coenzyme A:6-aminopenicillanic acid
FT                   acyl-transferase; PFAM: Acyl-coenzyme A:6-aminopenicillanic
FT                   acid acyl-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13201"
FT                   /db_xref="GOA:D7CX77"
FT                   /db_xref="InterPro:IPR005079"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX77"
FT                   /protein_id="ADI13201.1"
FT                   /translation="MTPRRIRVQELSGTPYQMGVQHGRAHRDTIRAFAEERVRLAGESA
FT                   WAGRDVPREEVLALAEACVSAHRRYSPALTEELAGMAAATGLTLAELVVVGGFTDFIDT
FT                   VYGAAKGAAAPSAADNCTAFLVPNARAALGSGFLGQTWDMHAGATPHVILLRGAPAGAP
FT                   PFLAFSTVGCLGMIGMNALGVAVGINNLLGADGRVGVTWPFVVRQMLTCSEADEALEVL
FT                   LEAPLAGAHNYLILDAAGRGFNVEATSTTHHVTPLAGEALVHTNHCLAGVTRAAERVRD
FT                   PLSQASSERRLADAQALLSGDGITAEDLQALTRDERAICLRPAPPKFVETCGAAIMRPA
FT                   TGDFWAVWGLPSENAYEHFRV"
FT   gene            64594..65226
FT                   /locus_tag="Trad_0059"
FT   CDS_pept        64594..65226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0059"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="InterPro IPR000182:IPR016181; KEGG: rca:Rcas_0119
FT                   hypothetical protein; PFAM: GCN5-related
FT                   N-acetyltransferase; SPTR: A7NFM9 Putative uncharacterized
FT                   protein; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13202"
FT                   /db_xref="GOA:D7CX78"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX78"
FT                   /protein_id="ADI13202.1"
FT                   /translation="MERDVLITTLRPEHAEGLEQLQIDCYPTLAPHERMRREHFLSHAR
FT                   LFPEGNFVALLGDRIVGLGSGFLTDFDLQHPDHTFQEIIAGGFYTHHDPQGAWYYGGDI
FT                   SVHPDVRGRGIGRRLYEARKEVVRRLGRRGIVAGGLLPGYRAYKGRLSVHDYVAKVVAG
FT                   ELTDPTLSFQLRNGFEVRGLLPGYLEDSASDNWATLIVWENPAWRPE"
FT   gene            65211..66380
FT                   /locus_tag="Trad_0060"
FT   CDS_pept        65211..66380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0060"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG0665 Glycine/D-amino acid oxidase
FT                   (deaminating); InterPro IPR006076; KEGG: ddr:Deide_1p00040
FT                   putative FAD dependent oxidoreductase; PFAM: FAD dependent
FT                   oxidoreductase; SPTR: C1XF90 Glycine/D-amino acid oxidase,
FT                   deaminating; PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13203"
FT                   /db_xref="GOA:D7CX79"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX79"
FT                   /protein_id="ADI13203.1"
FT                   /translation="MAARVVAATTADALVLGAGIIGAACAFRLAERGLRVRVLERASAL
FT                   GEGSTGRSGAGVRVQFSEAVNVRLSWESIQEYRTFGERYGAESGYVPNGYLFLVPAHAW
FT                   EAHLAGVAVQRRVGAPVEVLSPEAAQSHVPFVPEGIAGCTYGPADGYIDPVRVLRVYLE
FT                   EAARRGAQLHLGAAAQRVARTASGWRVTTPVGTFEAPVLVNATGAWAGAVAHLAGLEVP
FT                   VTPLKRCVYRTRGGNGGRGGAPSYPLTVDTASNFWLRGHGETLIFTISNPHQAPGFHEG
FT                   MDWGWLATVRRVGEARFPWLSALRVDPAGSFWGFYEMTPDGSPILGEMAEAPGWLNACG
FT                   FSGHGVQQAAAVGRIIAAEAVGERPFIPVDALRLERFAQPSTLLERHIV"
FT   sig_peptide     65211..65288
FT                   /locus_tag="Trad_0060"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            66399..67307
FT                   /locus_tag="Trad_0061"
FT   CDS_pept        66399..67307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0061"
FT                   /product="ornithine cyclodeaminase/mu-crystallin"
FT                   /note="COGs: COG2423 ornithine cyclodeaminase mu-crystallin
FT                   homolog; InterPro IPR003462:IPR016040; KEGG: rxy:Rxyl_2927
FT                   ornithine cyclodeaminase; PFAM: ornithine
FT                   cyclodeaminase/mu-crystallin; SPTR: Q1ARZ1 Ornithine
FT                   cyclodeaminase; PFAM: Ornithine
FT                   cyclodeaminase/mu-crystallin family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13204"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX80"
FT                   /protein_id="ADI13204.1"
FT                   /translation="MRLYTAAETARRLPYPALAERLREALLERARAQVPERLAVPLAAR
FT                   GVLLAMPAADPELAMTKLVTVHPDNAAQGLPTIQGEVVALDARTGVRLGVLDGATVTGR
FT                   RTAALSLLAAQTLAPEPDGALLVVGAGVQARAHLEAFRAGLGTERVLVASRTQERAEAL
FT                   AAHARSLGMAAEVIRDPHDALGRVSLIVTATTSARPVLRAPLPERAMVCAVGAFRPEMA
FT                   ELSPELIAGASVVVDTLEGARSEAGDLIQAAAAGLWGWERATPLEALLAGEAHPLPGPL
FT                   VFKSVGHALFDLAACHLAFGR"
FT   gene            complement(67338..68495)
FT                   /locus_tag="Trad_0062"
FT   CDS_pept        complement(67338..68495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0062"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.1"
FT                   /note="COGs: COG1364 N-acetylglutamate synthase
FT                   (N-acetylornithine aminotransferase); InterPro
FT                   IPR002813:IPR016117; KEGG: ddr:Deide_10200 putative
FT                   arginine biosynthesis bifunction; PFAM: arginine
FT                   biosynthesis protein ArgJ; PRIAM: Amino-acid
FT                   N-acetyltransferase; SPTR: C1CUN5 Putative Arginine
FT                   biosynthesis bifunction; TIGRFAM: arginine biosynthesis
FT                   bifunctional protein ArgJ; PFAM: ArgJ family; TIGRFAM:
FT                   glutamate N-acetyltransferase/amino-acid acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13205"
FT                   /db_xref="GOA:D7CX81"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX81"
FT                   /protein_id="ADI13205.1"
FT                   /translation="MNATLKLPRGFRTAALAAGIKASGRPDCALIAADAPLRWALAATT
FT                   NTLQAACVVRNRALFTGERAVRAVAINSGNANCATGEAGARANGAFAAAAAAALGVAPD
FT                   EVLTASTGVIGEPLPVDKLTAALPRLAAALTDDAAGLAQAILTTDLVPKVAEARLEGGA
FT                   RIVGVAKGSGMIHPNMATMFAFVMTDADLPQGALRALWPEVVAQSFNQISVDGDTSPND
FT                   MAFLLANPRVAVREAAFAEALRRVARELAKRIARDGEGATKLLCVRVTGASSDAEARRA
FT                   ARAVVVSPLVKAAAHGCDPNWGRVLSAVGASGVPLALPRLSLRVQGVSVYAGAPAPFDA
FT                   AAVSRKMDAEELVLELDLAAGSGTGEAWGCDLSAEYVTINADYHT"
FT   sig_peptide     complement(68445..68495)
FT                   /locus_tag="Trad_0062"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(68492..69571)
FT                   /locus_tag="Trad_0063"
FT   CDS_pept        complement(68492..69571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0063"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="COGs: COG0002 Acetylglutamate semialdehyde
FT                   dehydrogenase; InterPro
FT                   IPR000706:IPR000534:IPR012280:IPR016040; KEGG: ttj:TTHA1197
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; Semialdehyde
FT                   dehydrogenase dimerisation region; PRIAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; SPTR: Q5SJ17
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase, dimerisation domain;
FT                   Semialdehyde dehydrogenase, NAD binding domain; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase, common form"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13206"
FT                   /db_xref="GOA:D7CX82"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX82"
FT                   /protein_id="ADI13206.1"
FT                   /translation="MTRLKVGVLGASGYGGAELLRRLVTHPFVTVSGLASRQFAGQAVA
FT                   ACWPQLAGAALPAFEDAEAVIAGCDVLFCATPHGETAPFVQRALAAGKRVVDLSADFRL
FT                   APKDYAAWYGPHPYPEGCARAVYGLTELHREELRGAELVAVPGCNCTAGNLALAPLALH
FT                   GLLGEHVTVNVLTGVSGAGRSAALGFHFPELNENARPYKAGGTHRHTAELEDTLGRVAA
FT                   FGRQVKTRGDFARPTVSFTPHLVPMTRGILATCTVRPDPEHPEAAGLSTAALLERYEDF
FT                   YRGEPLVTVQEDLPQTKAVSGSDRTLVSVRYDKRSGTVTAFAALDNLGKGAAGGAVQAF
FT                   NAAHGFGETLGLFTQGVWP"
FT   sig_peptide     complement(69437..69571)
FT                   /locus_tag="Trad_0063"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(69568..70512)
FT                   /locus_tag="Trad_0064"
FT   CDS_pept        complement(69568..70512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0064"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="COGs: COG0078 Ornithine carbamoyltransferase;
FT                   InterPro IPR002292:IPR006132:IPR006131:IPR006130; KEGG:
FT                   dge:Dgeo_1605 ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; PRIAM: Ornithine
FT                   carbamoyltransferase; SPTR: C1XTU2 Ornithine
FT                   carbamoyltransferase; TIGRFAM: ornithine
FT                   carbamoyltransferase; PFAM: Aspartate/ornithine
FT                   carbamoyltransferase, carbamoyl-P binding domain;
FT                   Aspartate/ornithine carbamoyltransferase, Asp/Orn binding
FT                   domain; TIGRFAM: ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13207"
FT                   /db_xref="GOA:D7CX83"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX83"
FT                   /protein_id="ADI13207.1"
FT                   /translation="MSSPTIIESLRGRDLLALSDLTRDEFTGLLTSALELKRGWQAGER
FT                   PALLKHQTLAMIFEKQSLRTRSTFDIAMYQLGGHSVLLSQNYIGWGVRETIKDVAHNLE
FT                   RWTQGIMARTYGHGTLLELAEHAGVPVINGLSDLLHPCQLTADYLTLKETFGDLEGLKI
FT                   AFVGDGNNVCNSHLNAAALTGTSLTVACPEGFEPDAEVLAAARARGADITLVRDPREAA
FT                   EGADVLYTDVWISMGQEEEAVRRREAFRGYTVTLEWLDGLSERGIFMHDLPAHYGEEVT
FT                   EEVVYSPRSRVFDQAENRLHAHKAILFQLMRDG"
FT   gene            complement(70645..71310)
FT                   /locus_tag="Trad_0065"
FT   CDS_pept        complement(70645..71310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0065"
FT                   /product="peptidase A24A prepilin type IV"
FT                   /note="InterPro IPR000045; KEGG: dra:DR_2065 prepilin
FT                   peptidase, type IV; PFAM: peptidase A24A prepilin type IV;
FT                   SPTR: Q9RSQ9 Prepilin peptidase, type IV; PFAM: Type IV
FT                   leader peptidase family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13208"
FT                   /db_xref="GOA:D7CX84"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX84"
FT                   /protein_id="ADI13208.1"
FT                   /translation="MDQVNVAALGGAVGGLAAGLAAAALSLALNLALRRTLRLSEGPLY
FT                   ALWAAALLASPLSPIISPLGAAVGTLGAAGAVAILGALYWWLHDWGGREAPVRAAHPGA
FT                   ETAGDAPNVARAIVGDTATEGTTEGAAENTAEGPDEPVAMGFGDVKLAAVLGALLGPQN
FT                   LLVGLLLAFVLGAVGGAAGRAFGGARVVPFGPYLVLGTLAALLFGDALAAWYLGLLGL"
FT   sig_peptide     complement(71242..71310)
FT                   /locus_tag="Trad_0065"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(71298..71837)
FT                   /locus_tag="Trad_0066"
FT   CDS_pept        complement(71298..71837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0066"
FT                   /product="peptidase A24A domain protein"
FT                   /note="COGs: COG1989 Type II secretory pathway prepilin
FT                   signal peptidase PulO and related peptidase; InterPro
FT                   IPR010627:IPR000045; KEGG: ddr:Deide_21130 putative
FT                   prepilin peptidase (type 4 prepilin-like proteins leader
FT                   peptide-processing enzyme) (peptidase A24A-like protein);
FT                   PFAM: peptidase A24A domain protein; peptidase A24A
FT                   prepilin type IV; SPTR: C1CYV7 Putative Prepilin peptidase
FT                   (Type 4 prepilin-like proteins leader peptide-processing
FT                   enzyme) (Peptidase A24A-like protein); PFAM: Bacterial
FT                   Peptidase A24 N-terminal domain; Type IV leader peptidase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13209"
FT                   /db_xref="GOA:D7CX85"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX85"
FT                   /protein_id="ADI13209.1"
FT                   /translation="MLWTLSAGLLGALIGSFANVVVYRLPRGASVVWPGSHCPHCGRAL
FT                   GALELVPVVSWALLSGRCRGCRGAVSARYPLVELLMALGFAGLAARYPPERYGLTALPL
FT                   LALFALLVILSLIDLDTHTLPDALTLPALAVALVGSFAYAPGSGLPDPRGALLGSVLGA
FT                   GGLALLNRLGRSGWTR"
FT   sig_peptide     complement(71778..71837)
FT                   /locus_tag="Trad_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            71963..72499
FT                   /locus_tag="Trad_0067"
FT   CDS_pept        71963..72499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0067"
FT                   /product="outer membrane chaperone Skp (OmpH)"
FT                   /note="InterPro IPR005632; KEGG: tth:TTC0475 putative
FT                   cationic outer membrane protein OmpH; PFAM: outer membrane
FT                   chaperone Skp (OmpH); SPTR: Q72K52 Putative cationic outer
FT                   membrane protein ompH; PFAM: Outer membrane protein
FT                   (OmpH-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13210"
FT                   /db_xref="GOA:D7CX86"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX86"
FT                   /protein_id="ADI13210.1"
FT                   /translation="MTGLFPRPRRVAAALLVALALAPFGMAQQPLSIAFIRTAEVLAAH
FT                   PAGQQAAQLTERARAELEEIAATLQPLLARFNAGEQLTAEERDTLELSQRTYQETQARY
FT                   QEEIQAAARPAEEAIDAIIRQIAEENGYTLVFNREVAAASQLIVYGAESVPDITEEVIA
FT                   RIRAETGGAAPAGEN"
FT   sig_peptide     71963..72091
FT                   /locus_tag="Trad_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(72597..73340)
FT                   /locus_tag="Trad_0068"
FT   CDS_pept        complement(72597..73340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0068"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="COGs: COG0336 tRNA-(guanine-N1)-methyltransferase;
FT                   InterPro IPR002649:IPR016009; KEGG: dra:DR_2011 tRNA
FT                   (guanine-N1)-methyltransferase; PFAM: tRNA
FT                   (guanine-N1-)-methyltransferase; PRIAM: tRNA
FT                   (guanine-N(1)-)-methyltransferase; SPTR: C1XQ20 tRNA
FT                   (guanine-N(1)-)-methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N1)-methyltransferase; PFAM: tRNA
FT                   (Guanine-1)-methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13211"
FT                   /db_xref="GOA:D7CX87"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX87"
FT                   /protein_id="ADI13211.1"
FT                   /translation="MHYTVLTLFPQLIRPWTEEALLGRAVRSGRISFDIRDLREHAGNK
FT                   HRRVDDTPYGGGAGMVIRVDVAARALAAVREVSAPDEVILLTPAGEPLTQPLAETLAAK
FT                   GHLCLLSGRYEGFDARVETLVTREVSVGDFVMMGGEVAALALIEATARLLPGVLGDAES
FT                   FAQDSFTTGLLDYPEYTRPLEWEGQRVPEVLLSGHHANVARWRRERALERTLKRRPELL
FT                   ERAALTEADRAFLRELGRETDAPES"
FT   gene            complement(73398..73913)
FT                   /locus_tag="Trad_0069"
FT   CDS_pept        complement(73398..73913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0069"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="COGs: COG0806 RimM protein required for 16S rRNA
FT                   processing; InterPro IPR011961:IPR002676:IPR011033; KEGG:
FT                   ttj:TTHA1033 16S rRNA-processing protein RimM; PFAM: RimM
FT                   protein; SPTR: Q5SJH5 Ribosome maturation factor rimM;
FT                   TIGRFAM: 16S rRNA processing protein RimM; PFAM: RimM
FT                   N-terminal domain; TIGRFAM: 16S rRNA processing protein
FT                   RimM"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13212"
FT                   /db_xref="GOA:D7CX88"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX88"
FT                   /protein_id="ADI13212.1"
FT                   /translation="MALAPPEGSVLLGTLGKTFQLQGGLRFYALGEAEAAAIAALQRVF
FT                   VAGFGERALARVRPVGAQQIVYFVGVDTPQAAKALVNADVYAPRAALPELETGFYVDLL
FT                   LGLPVRLGGEVIGEVVEVIPKATALGQDLLVVDTGESEHLIPLQADYVHLHETHVQLTN
FT                   PPEGLLEP"
FT   gene            complement(73917..74150)
FT                   /locus_tag="Trad_0070"
FT   CDS_pept        complement(73917..74150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1837 RNA-binding protein (contains KH
FT                   domain); InterPro IPR004088:IPR009019; KEGG: dge:Dgeo_1484
FT                   hypothetical protein; SPTR: B6GBS1 Putative uncharacterized
FT                   protein; PFAM: KH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13213"
FT                   /db_xref="GOA:D7CX89"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX89"
FT                   /protein_id="ADI13213.1"
FT                   /translation="MVVELVTYIAQNLVADPDRLEVEAREGGRGLTINIRCAKGDAGRI
FT                   IGRGGRTINSIRTLARAAAEGHERVEVQLVDA"
FT   gene            complement(74224..74538)
FT                   /locus_tag="Trad_0071"
FT   CDS_pept        complement(74224..74538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0071"
FT                   /product="ribosomal protein S16"
FT                   /note="COGs: COG0228 Ribosomal protein S16; InterPro
FT                   IPR000307; KEGG: ttj:TTHA1035 30S ribosomal protein S16;
FT                   PFAM: ribosomal protein S16; SPTR: B7A7I5 Ribosomal protein
FT                   S16; TIGRFAM: ribosomal protein S16; PFAM: Ribosomal
FT                   protein S16; TIGRFAM: ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13214"
FT                   /db_xref="GOA:D7CX90"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX90"
FT                   /protein_id="ADI13214.1"
FT                   /translation="MMVKIRLMRLGAKKNPHYRIVVVDARKRRNSAYIESLGYYDPRET
FT                   VAEPLKVNAERAQYWLSQGAQPTDTALKLLERAGVDAGNVDVKRGKAYAARTQAAQAQA
FT                   "
FT   sig_peptide     complement(74464..74538)
FT                   /locus_tag="Trad_0071"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(74651..75970)
FT                   /locus_tag="Trad_0072"
FT   CDS_pept        complement(74651..75970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0072"
FT                   /product="signal recognition particle protein"
FT                   /note="COGs: COG0541 Signal recognition particle GTPase;
FT                   InterProIPR004780:IPR013822:IPR000897:IPR004125:IPR 003593;
FT                   KEGG: dge:Dgeo_1440 signal recognition particle protein;
FT                   PFAM: GTP-binding signal recognition particle SRP54 G-
FT                   domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; Signal peptide binding (SRP54) M- domain
FT                   protein; SMART: AAA ATPase; SPTR: C1XNM7 Signal recognition
FT                   particle subunit FFH/SRP54 (Srp54); TIGRFAM: signal
FT                   recognition particle protein; PFAM: SRP54-type protein,
FT                   GTPase domain; SRP54-type protein, helical bundle domain;
FT                   Signal peptide binding domain; TIGRFAM: signal recognition
FT                   particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13215"
FT                   /db_xref="GOA:D7CX91"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX91"
FT                   /protein_id="ADI13215.1"
FT                   /translation="MFESLGDRLQGVFDSLRGRGRLTEDEVRAALREVRVALLEADVSL
FT                   EVARDFTKRVQEKAVGSETLMSLQPDQRVIAIVHDELVELLGGKTAQPSLKNDANVWLL
FT                   LGLQGAGKTTTAGKLAYKYKAQGRRPLLVAADTQRPAAREQLRVLGKQIGVPVLEVEDH
FT                   ETPARTRARLQEVLRTTYHDLVIVDTAGRLQIDEALMDAVAELKAELSPSETMLVIDAM
FT                   TGQQSLPVAKTFDERVGVTGLIMTKLDGDARGGAALSARHVTGKPIYFAGMSEKIDGLE
FT                   AFHPDRIAGRILGMGDVLTLIEKAKALEGDDEADAAATLKDFSLQDMLTQMQKIKRMGS
FT                   FTEILKMIPGASRLLPPGAEIDEREIARIEAIISSMTERERRQPKLLNASRRKRIAAGS
FT                   GTSVQDVNRLMKNYEQMKKVMKQLGRRPPGRGLPGRGLGR"
FT   gene            76103..77494
FT                   /locus_tag="Trad_0073"
FT   CDS_pept        76103..77494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0073"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="InterProIPR019734:IPR013026:IPR001440:IPR013105:IPR
FT                   011990; KEGG: dra:DR_0121 hypothetical protein; PFAM:
FT                   Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; SPTR: C1XZG9 Tetratricopeptide
FT                   repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13216"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX92"
FT                   /protein_id="ADI13216.1"
FT                   /translation="MGNAKRVRSGVVALALALAPVGWGQEVSAAAQALAAAQRAVAEAR
FT                   ATYQGAPTFDRPLWREAVRQGEAARALEPHNPEVLRFLAETYSTLSWDVRAWDAWEALL
FT                   QAGGELSADDLAQMFAAGRELGYARYTAGELAAAETVFSRMVQLDPENVDALTWLGRIA
FT                   LERGDSVAARAHWARVLELRPNDPTARYYLGRSEQQLAFGAEASGAFHEGLAAYDGGDL
FT                   EGALAAFTRAAEANADFEEAFVWAARTALEAGQPEVAQRYAEALLARDPEHERAGFFMQ
FT                   QIALQRTWGAEAGSAFLEGQGLYSQGRVAEAAERFAAASDANTQFLEAATWAARSYQET
FT                   GQAARAATYWERVVALSPDDARARFFLEEARAQSGVAPAAVSAFNRGLRAYADADLAAA
FT                   EAAFAEATREDPAYAEAWGWLGRLAFEGGRYAEAAAAYAQASALEPADETYAFFAAEAR
FT                   RLAER"
FT   sig_peptide     76103..76189
FT                   /locus_tag="Trad_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            77555..78085
FT                   /locus_tag="Trad_0074"
FT   CDS_pept        77555..78085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0074"
FT                   /product="Lipoprotein LpqB, GerMN domain protein"
FT                   /note="COGs: COG5401 Spore germination protein; InterPro
FT                   IPR019606; KEGG: sti:Sthe_0621 spore germination
FT                   protein-like protein; PFAM: Lipoprotein LpqB, GerMN domain;
FT                   SPTR: D1C1E1 Spore germination protein-like protein; PFAM:
FT                   Sporulation and spore germination"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13217"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX93"
FT                   /protein_id="ADI13217.1"
FT                   /translation="MAAYVIVGVALGWVGWSTLRPERPSPAAGTFRTYRVYFVRDAGTY
FT                   LTLEPVRRSAPLSAADDEAVLGAALLALRDGPTGAERARGLSSAFPPDARVRALRVTGD
FT                   EVAVDLSAAFAAGGGTALMQGRLFQLLYTLSDPATVTRVRVAIEGEPVRSFSGEGILLE
FT                   QPWRRPAGGLPRW"
FT   sig_peptide     77555..77611
FT                   /locus_tag="Trad_0074"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(78223..78299)
FT                   /locus_tag="Trad_R0002"
FT   tRNA            complement(78223..78299)
FT                   /locus_tag="Trad_R0002"
FT                   /product="tRNA-Arg"
FT   gene            78565..80490
FT                   /locus_tag="Trad_0075"
FT   CDS_pept        78565..80490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0075"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="InterPro IPR000297; KEGG: ttj:TTHA0352
FT                   peptidyl-prolyl cis-trans isomerase; PFAM: PpiC-type
FT                   peptidyl-prolyl cis-trans isomerase; SPTR: B7ABE7 PpiC-type
FT                   peptidyl-prolyl cis-trans isomerase; PFAM: PPIC-type PPIASE
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13218"
FT                   /db_xref="GOA:D7CX94"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX94"
FT                   /protein_id="ADI13218.1"
FT                   /translation="MRLSKQTNTVILWLIAIALLVSMVIAFTPGTLFGGAQPQQAEAAL
FT                   LVNGQPIRTVDVARFEATPPFNAVQEGPAAEDLEQVLLDELIDQELLRQAASRVNVSNA
FT                   EVRARVNAFREEQGVAGSANDRAYLDLIGSAGYTDESFRALMREQLQRERYLESVAGDL
FT                   EVTDEEVRAHFEANRDVYQSEPRIVARQLVVTDEGLANDLYARALAGEDFAALAREHST
FT                   ERAEQGGALGAAEGESDPRPVTRVALPTAVADAAFALQGTGLTEPIEAAGAFYIVSVEA
FT                   YEPPQPRPFEEVQEQVREDALAAKETGAQEAALRTLREEATIETPAGSPYVYENPVVAR
FT                   VGDHEIRAAELNRNTYLSPQLQGLISPGFADVIAESIKPGVLEQLIDRELAYQGADALG
FT                   VPFVGSRAQVAQSVLGYVSREAEASDDEVARYYEENQAFFTQPAEAAVTRFTFTGEAAA
FT                   AAFREAVLAEGITAGEALREEAEAAGGSAERLGTLTPGGQPEAIEAALFDFEGGMTPIA
FT                   GDGGLEISEVLSVEVPVDPDTMTGGAMTGGALTGGEGATERQFVVLVAARTPERVRPLE
FT                   EVRALVEQAVLNQNRRELQEAWLEERRQETPVENLLVAEAPESVQTGGAMTGGEPLQAP
FT                   QTGGAQ"
FT   sig_peptide     78565..78693
FT                   /locus_tag="Trad_0075"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            80609..82168
FT                   /locus_tag="Trad_0076"
FT   CDS_pept        80609..82168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0076"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /note="COGs: COG0138 AICAR transformylase/IMP
FT                   cyclohydrolase PurH (only IMP cyclohydrolase domain in
FT                   Aful); InterPro IPR002695:IPR011607:IPR013982; KEGG:
FT                   ttj:TTHA0930 bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM:
FT                   AICARFT/IMPCHase bienzyme formylation region; MGS domain
FT                   protein; PRIAM: Phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase; SMART: AICARFT/IMPCHase bienzyme
FT                   formylation region; SPTR: Q72K86
FT                   Phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM:
FT                   AICARFT/IMPCHase bienzyme; MGS-like domain; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13219"
FT                   /db_xref="GOA:D7CX95"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX95"
FT                   /protein_id="ADI13219.1"
FT                   /translation="MRALLSVSDKTGLEPFARALQELGCELLSTGGTYEQLRGAGLSVR
FT                   RVADETGFPEILDGRVKTLHPKLHGALLATSAPDHEAALRAHGITPIDVLVVNLYPFRE
FT                   TVARGAPFAEVVENIDIGGPAMLRAAAKNHARVFAVCDPADYPRVLAALRSGGGAGLRL
FT                   ELAHKAFAHTAAYDAAIERYLAAQLTPPDAQPEGHAPEADAALPPTLTLRLERAQSLRY
FT                   GENPHQRGARYREVGRRGCWDEAVQRSGVALSYLNLFDAEAAWRLVHALGEAPAAVIVK
FT                   HANPCGVALGESIERAYRRAFEADPKSAFGGVVALNRPVSEALADELLANPKADVLIAP
FT                   AFVPGVAERLAAKRKNLRVLEAPPPNRPARELRPIDGGFLVQEPDTVLPERAAWRVVTE
FT                   RQPTDAEWRDLELAWVVCAYTKSNAIVLVKDGQALGIGAGQQSRVDASRIAAQKAAGRA
FT                   RGGACASDAFYPFRDGLEVAAEAGVAAVIQPGGSVKDGELIEAANELGLAMVMTGRRHF
FT                   LH"
FT   gene            82597..86307
FT                   /locus_tag="Trad_0077"
FT   CDS_pept        82597..86307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0077"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /note="COGs: COG1372 Intein/homing endonuclease;
FT                   InterProIPR006141:IPR004042:IPR013344:IPR013509:IPR
FT                   000788:IPR006142:IPR003587:IPR003586:IPR003006; KEGG:
FT                   dra:DR_2374 ribonucleoside-diphosphate reductase-related
FT                   protein; PFAM: ribonucleotide reductase large subunit;
FT                   Ribonucleotide reductase large subunit domain protein;
FT                   SMART: Hedgehog/intein hint domain protein; SPTR: Q9RRW1
FT                   Ribonucleoside-diphosphate reductase; TIGRFAM:
FT                   ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: Ribonucleotide
FT                   reductase, all-alpha domain; Ribonucleotide reductase,
FT                   barrel domain; TIGRFAM: intein N-terminal splicing region;
FT                   ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; intein C-terminal splicing
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13220"
FT                   /db_xref="GOA:D7CX96"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX96"
FT                   /protein_id="ADI13220.1"
FT                   /translation="MTNLKAASPEVLARFDEHAVAIAKRQYFQPGDEDVLGMFRRVAAW
FT                   VASPEAEGERSRYEARFYDLMVSKRFCPGGRVLAGAATGHGNVLNCFVQDGSPEVVGTD
FT                   AWVIRLATKLALVTKVGGGNGLCLDPLPPKRPFTRPVGKLYLTISPAHPDYAKVKTGTY
FT                   MDLVHGKYTTKGYRCAQFLEPDEVPSALHVTAVGDSVESIWQSAGESVTKLLAGEDVLL
FT                   DLSKLRAEGTPVKGSGGNSSGPSSFAVEVFDNFALWASLGGAAHAGPVATLRYIFAPTL
FT                   RVIRQGGTRRGAGMATLSVTHPDIEDFITCKDLSREQTEGDISTFNISVLVSDAFMERA
FT                   KRTLSSGVLQDIADHAWQTGEPGLIFIDRINAFNPMRESLGEIKATNPCVTADTWVLTQ
FT                   LGARRVGDLVGKKFCAVVDGKAYGLTSQGFWSTGVKPVFKLRTKRGFELRLTGNHKLKK
FT                   VLRQTRYVQDAVWAELESLKVGDRILLSNHRGVAPWAGPGTFAEGWLLGALIGDGTFAE
FT                   DKRRACLDFWGESRATMTELATAMLRHLFGANTSLWVTQTAEKTRIASDDLYELAARYG
FT                   LRPGYKTLTDALEEGSFDLICGLLCGLFDTDGSVQGNQDKGFSVRLAQSDAELLVRAQR
FT                   MLARLGIVSTRYENRRPEGWRTLPDGNGGSRAYRCRAEHELVISCDNLAVFAALVGFEE
FT                   PAKRQRLTAHLNGEHKALDRERFSDEIVSISPDGEEEVFDVTVEHVHAFDANGLLAHNC
FT                   GEIPLFPGEPCDLGAINLAAYVTGEGLENFAWDAFREDVRTCVRFLDNVLEVNRFALED
FT                   NRAMSMKLRRLGLGIMGLADALIKLGYRYDTDEGRAAVEAIITAMRESATEASRALAEE
FT                   RGAFPEFGKSSLKTPRRNVALLTVAPTGTTSMLMGVSSGVEPIFAPFIYRKIGDTYAAL
FT                   IAPLFKEMLEQHPPHPDYEHEGAWDWERVVEAVQANHGSVQGLAFIPEAVKRVLVCAHD
FT                   IAPEDHVKMQGAVQRAFDAGGEMVANSISKTINLPNKATVADVYSAYSMAFDVGCKGIT
FT                   VYRDGSRQFQVLSTSKGASEKQDAATPPAPARPERLPGEPLFDRPARLVGFTDNVKLTM
FT                   SNGEKRSFYITVNTQDGLPTEVFIQSGKGGEEIMADSEALGRLVSIALQYGVPAEAIVK
FT                   TLRGINGGMYGSYQGRMVASKADLIAVALETAGVENPLHADLRCPEGCGGTLVREEGCY
FT                   KCYTCGYSKCG"
FT   gene            86621..88117
FT                   /locus_tag="Trad_R0003"
FT   rRNA            86621..88117
FT                   /locus_tag="Trad_R0003"
FT                   /product="16S ribosomal RNA"
FT   gene            88383..91332
FT                   /locus_tag="Trad_R0004"
FT   rRNA            88383..91332
FT                   /locus_tag="Trad_R0004"
FT                   /product="23S ribosomal RNA"
FT   gene            91384..91500
FT                   /locus_tag="Trad_R0005"
FT   rRNA            91384..91500
FT                   /locus_tag="Trad_R0005"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(91876..94434)
FT                   /locus_tag="Trad_0078"
FT   CDS_pept        complement(91876..94434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0078"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="COGs: COG1404 Subtilisin-like serine protease;
FT                   InterPro IPR000209:IPR007280; KEGG: dra:DR_A0283 serine
FT                   protease; PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; peptidase domain protein; SPTR: Q9RYM8 Probable
FT                   subtilase-type serine protease DR_A0283; PFAM: Bacterial
FT                   pre-peptidase C-terminal domain; Subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13221"
FT                   /db_xref="GOA:D7CX97"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX97"
FT                   /protein_id="ADI13221.1"
FT                   /translation="MTRSVIGTLLLALALAACTLNPPAPSVRNPTPSYTIDRVGDQSFI
FT                   RGQLIVGYREGASPEAIARRLGATVQQDWPLLRAALLQLPPRLSVPKAKVSAERLEGVR
FT                   YAEPNLVHFRPEPARGVATTALSPTQVSVSDPEFGRQWMHRQMNSLGAWSQGVSGSGIR
FT                   IGIHDDFIDHRHPDLVDNMFYPGFDGFAASNPEVPIEAALITPETPHDGVGFHGTSVAG
FT                   TAAAVGNDLGGRGTAYGASIVPLAINEPEQGGLVLSAIVNSAIFAVLGPDFAFGGDDRA
FT                   PGTDPETGPYVHIVNMSWGGAFYNQLIKDTMDLMLASGIVLVTSAGNTPTEGPSFPSWN
FT                   PGLINVAATTARGTRTNFSNRGLHLDLAAPGENIWTTTTRGCIFATPDGASCSEEEPEV
FT                   AYTYINGTSFSSPAVAGTAALILEAGAERDAEGNITALPSAAQVQRVLTETAFQPSGYE
FT                   RSALGAGIADSAAAVARVLSGDPIPDGGSLLAEVVWAGNPDIRVPQVGLTLIPEDGDAA
FT                   VKYTQTSDGTLLTPLGIGLFQQMPSGRYTLQASGPYRSVHGIEVGTAQTSVEIRPGEAT
FT                   AVRLALELSPFEDPFEPNNTLETAAELEEVGVTVRASLYDPEAASDVDVYSIPVTAGSV
FT                   YRASLKTASGNVAPALTVYDASGTPIAQSGSTQAFTLNPFVEFEAPEDGLAYIEVTETS
FT                   GLEGSNSPFNLYDLDIARYIGEEEEPNGSAVVIGTSIQNIDFTDAQRIPLGSALDAELT
FT                   EGDTDIFQVEVPAGATVVGDIVTAVDGQPDTLLGVYNEAGQQVAFNDDYNGRASRVLYA
FT                   SQTGGLYYFVVAPWDAINPQNATTGPYNFSVTRHLNPPTE"
FT   sig_peptide     complement(94330..94434)
FT                   /locus_tag="Trad_0078"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(94444..96117)
FT                   /locus_tag="Trad_0079"
FT   CDS_pept        complement(94444..96117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0079"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR008969:IPR014766; KEGG: ttj:TTHA0285
FT                   hypothetical protein; SPTR: B7A934 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13222"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX98"
FT                   /protein_id="ADI13222.1"
FT                   /translation="MRRTPRRALFALLLLLAACARTPSGTPPLDQTTWQPGTGSIAGYV
FT                   VNRKAGTNVAGTTVAVAGTDLSAVTDESGLYRIMDVPAGLHTLTFTQDGYATSRVEGLR
FT                   VDDQAETRYDTIQAEAFDPFLPTIPPTLSISVENGDSFPGGPEGALSFTVSGTVASPES
FT                   NGFFSFGTAALGTSRGTSGFLNAAVPGTLFPFDGGVETTVNLPTAAFSGETSLHVVAYD
FT                   VNFNRTEVIRYVTITPAETAGRLAEVTNLGAFAVTFGDTAVFGPLSRIRPFDGRALLDA
FT                   VRNNDVSALQRLATEARGGAPTLGPQNALDEVITWVDVDFAYQGGALPTAFRVHRRLAT
FT                   QGRFWPIGQVGPEQICATLTEDEQPGPLDPDAGIICTFRDATAGLEAGVEATYRIEAIL
FT                   GDQNTLSGDSSVTPLPAFYVNALSPSNNATNVSVSPVYEFSVENRSSLLFIGALVLDRV
FT                   HAEGSPVEWVAVLRDDSGITAGGIPHNFDGTAVNETLQPFHGYDWQPIAVTANGTITED
FT                   NEVEGVNAVSIAADFFDLLGVGFGVSDGPVNTFSTGDGSF"
FT   sig_peptide     complement(96058..96117)
FT                   /locus_tag="Trad_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            96612..98525
FT                   /locus_tag="Trad_0080"
FT   CDS_pept        96612..98525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0080"
FT                   /product="arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /note="COGs: COG1166 Arginine decarboxylase (spermidine
FT                   biosynthesis); InterPro IPR002985:IPR000183; KEGG:
FT                   ddr:Deide_04410 putative arginine decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; SPTR: C1D018 Arginine
FT                   decarboxylase; TIGRFAM: arginine decarboxylase; PFAM:
FT                   Pyridoxal-dependent decarboxylase, C-terminal sheet domain;
FT                   Pyridoxal-dependent decarboxylase, pyridoxal binding
FT                   domain; TIGRFAM: arginine decarboxylase, biosynthetic"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13223"
FT                   /db_xref="GOA:D7CX99"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR040634"
FT                   /db_xref="InterPro:IPR041128"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX99"
FT                   /protein_id="ADI13223.1"
FT                   /translation="MKSVLDKRRLSASDAADLYGVPTWNGGYFQIGAGGLMEVVTGERE
FT                   RVPLPDIIAELRERGVSLPLILRFPQILENRLERLNRAFAEAREKFGYESHYQGVFPIK
FT                   VNQRRVVVETLAEAGARFRTGVEAGSKAELALCLVQDIHPEALLCCNGFKDDDFIRLAL
FT                   WGRRLGKNVVITLEKFTELARVLRISEEMGIRPALGLRYKLHAQGSGQWEDSGGDRAKF
FT                   GLSTSEMLSVTQSLRERGMLDTLVMVHCHVGSQVTDIRKIRTAVREAAQTYVELRELGV
FT                   EIRYLNVGGGLAVDYDGSKTSFYASANYGLQEYADTVVYTVLETCQQASVPHPVLVSES
FT                   GRALTAHHALLVLPVIDVVGPTKTAVTLPPLEGEPHTLVADMRELLETLSVKNYREVFY
FT                   DAASNKDTMHSLFDLGYLSITERAHVEELYNRILAKIARIIRDLDYVPDDFEDLPKLLA
FT                   DKYICNFSLFQSLPDHWAIGALFPIVPLSRLDEPPTRDATLVDITCDSDGKIEKFIDLR
FT                   DVKATLRLHEVRKGEPYYLGVFLMGAYQDVLANAHNLFGRVNEAHVRVSEDGFTVERIV
FT                   NGQKARRVIENMGYEAPQLRAWLFEEAEEARAEGRLSAEEAEALVATYNAELVGYTYLE
FT                   DI"
FT   gene            98645..98719
FT                   /locus_tag="Trad_R0006"
FT   tRNA            98645..98719
FT                   /locus_tag="Trad_R0006"
FT                   /product="tRNA-Asn"
FT   gene            complement(98907..99905)
FT                   /locus_tag="Trad_0081"
FT   CDS_pept        complement(98907..99905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0081"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="COGs: COG0598 Mg2+ and Co2+ transporter; InterPro
FT                   IPR002523; KEGG: dge:Dgeo_0150 Mg2+ transporter protein,
FT                   CorA-like protein; PFAM: Mg2 transporter protein CorA
FT                   family protein; SPTR: Q1J231 Mg2+ transporter protein,
FT                   CorA-like protein; PFAM: CorA-like Mg2+ transporter
FT                   protein; TIGRFAM: magnesium Mg(2+) and cobalt Co(2+)
FT                   transport protein (corA)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13224"
FT                   /db_xref="GOA:D7CXA0"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXA0"
FT                   /protein_id="ADI13224.1"
FT                   /translation="MADPAPLTPHPEPALAPHPNIRVKDLSACADAPWCGQRHGVWIDL
FT                   ENPTREQVAALQESFSFNPLALEDALATEHWSRFERYPEHLFLIFRTLAEPGALTERTE
FT                   EIDLFWFPQQRALITFRHEPVGYLEAVWQELDRFAERTPVEVLYTLLQRGTDTFFTFLD
FT                   ELEDRTDALERRAFEDHGGGRRESPLYQEVFTLRRTMIAARRHASSARENVAQLSRHAS
FT                   ELSPEGALYLRDVADHLARVYDGLDTARDVLTGLLEVYLNIENQRLNEVMRTLTTVSTV
FT                   FLPLTFLAGVWGMNFQYEPEFAWRYGYLFAWATFVTIGGSLLVFFKRKGWW"
FT   gene            100057..100626
FT                   /locus_tag="Trad_0082"
FT   CDS_pept        100057..100626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0082"
FT                   /product="Clp domain protein"
FT                   /note="COGs: COG0542 ATPase with chaperone activity
FT                   ATP-binding subunit; InterPro IPR004176; KEGG:
FT                   dge:Dgeo_1215 ATPase AAA-2; PFAM: Clp domain protein; SPTR:
FT                   Q1IZ22 ATPase AAA-2; PFAM: Clp amino terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13225"
FT                   /db_xref="GOA:D7CXA1"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXA1"
FT                   /protein_id="ADI13225.1"
FT                   /translation="MNHFDRGARLVVHFAREESAQLGHTMVGPEHLLLGLLREGGGGAR
FT                   VLHELGLSLEGARRRVVALIGVGAGLPRGEVAALTPSARLVMAFALSEARALGSRLVTT
FT                   EHLLLGLLRGGDGLVFRVLQRAGVAPSELRRRLKLSGAAAGMPEERLLAPLYFRAAPEA
FT                   APPPATATRGGWRLLGRGARHLLRRR"
FT   gene            100630..101475
FT                   /locus_tag="Trad_0083"
FT   CDS_pept        100630..101475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0083"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="COGs: COG0107 Imidazoleglycerol-phosphate synthase;
FT                   InterPro IPR004651:IPR006062:IPR011060:IPR013785; KEGG:
FT                   dra:DR_0732 imidazole glycerol phosphate synthase subunit
FT                   HisF; PFAM: histidine biosynthesis protein; SPTR: B9XMG0
FT                   Imidazole glycerol phosphate synthase subunit hisF;
FT                   TIGRFAM: imidazoleglycerol phosphate synthase, cyclase
FT                   subunit; PFAM: Histidine biosynthesis protein; TIGRFAM:
FT                   imidazoleglycerol phosphate synthase, cyclase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13226"
FT                   /db_xref="GOA:D7CXA2"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXA2"
FT                   /protein_id="ADI13226.1"
FT                   /translation="MLLGAERGAGCYAARVLAKRIIPCLDVHNGRTTRGQQFGRAEHGE
FT                   LRDVGDPVALALRYDEGGADELVFYDITATAEGRGAMLDIITQVAERCFMPLTVGGGVR
FT                   TLADFRALFLAGADKVSINSGAVANPEVVRAAAEHYGSQAVVFSIDAKKRPDASGWEVY
FT                   VAGGRKATGLDLLEWAVRGQELGAGEIVLNSIDADGMKTGYDLEATRAVARAVDIPVIA
FT                   SGGAGNALHMRDVLLYGEADAALAAGIFHSGQTTVGEVKRLLAAAGVHVRLVQHATLGW
FT                   "
FT   gene            101472..101669
FT                   /locus_tag="Trad_0084"
FT   CDS_pept        101472..101669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cyh:Cyan8802_1845 hypothetical protein; SPTR:
FT                   C0GV20 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13227"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXA3"
FT                   /protein_id="ADI13227.1"
FT                   /translation="MKAFEVPVKLSEGKLELPDELLGLAQNPSARLLLLVDEEDDWVRL
FT                   SETQFAAGYTDADSIYDTLE"
FT   gene            101662..101997
FT                   /locus_tag="Trad_0085"
FT   CDS_pept        101662..101997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR011067; KEGG: cyh:Cyan8802_1846
FT                   hypothetical protein; SPTR: C7QV65 Putative uncharacterized
FT                   protein; manually curated; PFAM: PemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13228"
FT                   /db_xref="GOA:D7CXA4"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXA4"
FT                   /protein_id="ADI13228.1"
FT                   /translation="MSSPRFSAGEVVLLTFPFTGVLGAKRRPALVLLDAGDEDILVARI
FT                   TSALARSAFDVKVQNWRGAGLLLPLVVRLHKLATLEKRLVARMLGALGAEDRDAVRGVL
FT                   ATMWTAL"
FT   sig_peptide     101662..101730
FT                   /locus_tag="Trad_0085"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            101994..103136
FT                   /locus_tag="Trad_0086"
FT   CDS_pept        101994..103136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0086"
FT                   /product="Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein"
FT                   /note="COGs: COG0626 Cystathionine beta-lyase/cystathionine
FT                   gamma-synthase; InterPro
FT                   IPR000277:IPR015424:IPR015421:IPR015422; KEGG:
FT                   rca:Rcas_3473 cystathionine gamma-synthase; PFAM: Cys/Met
FT                   metabolism pyridoxal-phosphate-dependent protein; SPTR:
FT                   A7NPM7 Cystathionine gamma-synthase; PFAM: Cys/Met
FT                   metabolism PLP-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13229"
FT                   /db_xref="GOA:D7CXA5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXA5"
FT                   /protein_id="ADI13229.1"
FT                   /translation="MNRELRLETLAVHAGAEPDAATGAVTPPIHLSTTFERDPDGSYPK
FT                   GFVYSRTDNPNRRALEAALAALEGGEAAACFASGSAAVASVLRTLRPGDHVLAPDDLYH
FT                   GVRKLLQQVFVPWGLAVSFADLSDTAAAARALRPNTRLIWVETPSNPLLKLTDIGALAA
FT                   LARDVGALLVCDATWTPPPVTRALTLGAHLVVHSTTKYLAGHSDVLGGAVVAARADGTF
FT                   ERLRAVQNLEGAVPSPFDCWLVLRSLRTLPYRMRAHCDNAARVAAFLAGHARVASVHYP
FT                   GLASHPAHALAARQMAYPGGMLSFRVRGGEAAAMAVAARVRLFTRGTSLGGVESLIEHR
FT                   ASIEGPESTTPRDLLRVSVGLEHPDDLIEDLEQAMAEDLT"
FT   gene            103138..103794
FT                   /locus_tag="Trad_0087"
FT   CDS_pept        103138..103794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0087"
FT                   /product="phosphoribulokinase / uridine kinase family"
FT                   /note="COGs: COG1072 Panthothenate kinase; KEGG:
FT                   ara:Arad_12443 phosphoribulokinase / uridine kinase family;
FT                   SPTR: C1RLE1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13230"
FT                   /db_xref="GOA:D7CXA6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXA6"
FT                   /protein_id="ADI13230.1"
FT                   /translation="MNLRRALLEAVAERLLATPSPFVLRVAIDGVDGAGKTTFADELAP
FT                   LLAPSRAVIRASVDGFHHPREVRYRRGRTSPEGFYRDSYNYGALKRFLLDPLSPGGSGY
FT                   YRTAVYDVEAERPVEVPEKLAAPGSVLLLDGIFLHRPELRDAWDVSVWLEVPFEVSVPR
FT                   GAARGPGFGSPDPHAESNRRYIEGQRLYMSEAEPRRHATMVVNNEDVNAPYVVAR"
FT   gene            103897..104907
FT                   /locus_tag="Trad_0088"
FT   CDS_pept        103897..104907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0088"
FT                   /product="deoxyhypusine synthase"
FT                   /note="COGs: COG1899 Deoxyhypusine synthase; InterPro
FT                   IPR002773; KEGG: rca:Rcas_3399 deoxyhypusine synthase;
FT                   PFAM: deoxyhypusine synthase; SPTR: A7NPF3 Deoxyhypusine
FT                   synthase; PFAM: Deoxyhypusine synthase; TIGRFAM:
FT                   deoxyhypusine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13231"
FT                   /db_xref="GOA:D7CXA7"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR036982"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXA7"
FT                   /protein_id="ADI13231.1"
FT                   /translation="MSQTAQTAAQAKTQGPVSDFIRHHYRHFNAAALVDAADAYTAHLA
FT                   SGGHMMVTLAGAMSTAELGLSLAEMIRADKVHIISCTGANLEEDVFNLIAHDFYERVPA
FT                   WRDLSAEDEQALLERHMNRVTDTCIPEEEAMRRLERALLDEWRRADAAGERLFPHEFLY
FT                   RLIRSGALKEHYQIDPKDSWLVAAAEKDLPIVVPGWEDSTTGNMYAAHCLTGEITNVHT
FT                   VKTGIEYMMALAEWYTKTAPEHSVGFYQIGGGIAGDFPICVVPMLHQDLQREGVPMWGY
FT                   FCQISDSTTSYGSYSGAVPNEKITWGKLSVDTPKFIIESDATIVAPLMFALILGW"
FT   gene            complement(104929..105201)
FT                   /locus_tag="Trad_0089"
FT   CDS_pept        complement(104929..105201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0436 hypothetical protein; SPTR:
FT                   Q3JDY6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13232"
FT                   /db_xref="InterPro:IPR027598"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXA8"
FT                   /protein_id="ADI13232.1"
FT                   /translation="MGREVRRFKSEERKSRGEVSAFLRQLADKLDEGRITLRSGGEEVV
FT                   LEPPQQLTLELQVEDEEKGARGVEHSLEVELAWFDGDEGGAVELS"
FT   gene            complement(105351..106108)
FT                   /pseudo
FT                   /locus_tag="Trad_0090"
FT   gene            complement(106240..106836)
FT                   /locus_tag="Trad_0091"
FT   CDS_pept        complement(106240..106836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0091"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647:IPR009057:IPR012287; KEGG:
FT                   hau:Haur_1751 TetR family transcriptional regulator; PFAM:
FT                   regulatory protein TetR; SPTR: Q0YPN1 Regulatory protein,
FT                   TetR; PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13233"
FT                   /db_xref="GOA:D7CXA9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXA9"
FT                   /protein_id="ADI13233.1"
FT                   /translation="MTPTPLKTPKRAAGEDLRVTRTRRALGEALVALTLERGFEHLSVR
FT                   DLAERAGVGYATFFRHYASKEALLEAVSEATLRELTELLGPLSATDDPRGAGTRLFRHA
FT                   AANAALYRVLLRTRHHGPLQRALEVAARSFRETFDDRPGSAVPLEVAAHHVVHACVALL
FT                   EWWLERDMPYPPERMGDVFGALIVGPTKAALQAKG"
FT   gene            106937..108148
FT                   /locus_tag="Trad_0092"
FT   CDS_pept        106937..108148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0092"
FT                   /product="putative cytochrome P450"
FT                   /note="COGs: COG2124 Cytochrome P450; InterPro
FT                   IPR002397:IPR001128:IPR006162:IPR017972; KEGG:
FT                   hoh:Hoch_4349 putative cytochrome P450; SPTR: D0LMD7
FT                   Putative cytochrome P450; PFAM: Cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13234"
FT                   /db_xref="GOA:D7CXB0"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXB0"
FT                   /protein_id="ADI13234.1"
FT                   /translation="MTDSREGCPVHAAPQSGLKDVRKVARRSAPGAPAIERRGEVWHVR
FT                   SYAHVRAILRDAEATRQAGFNAESVGAIRMRQPVLFQDGPEHKRYRTAVARFFTPKTVS
FT                   ERYRAMMEALARELIAELVQRGRAELSALSLRLAVQVAAQVVGLTNSRGMEGRLEAFFR
FT                   LQRFDGLSRSARVLSGARSQLRLLRFYLLDVRPAIAARRRAPQEDVISHLLEKGYKEAE
FT                   ILSECVTYAAAGMATTREFISLAAWHLLEDGELRRTYVAGDAATRQRVLSELLRLEPVV
FT                   GHLYRRAVQEITLEGAGQTVRIPAGALLDLYVHAANTDPEAVGSAPLAACPARALAPGV
FT                   QPAVMSFGDGAHRCPGAFIALQESDIFLRQLLALPVRLVRPPTLRYNALIESYEVRGLE
FT                   VALD"
FT   gene            108295..108822
FT                   /locus_tag="Trad_0093"
FT   CDS_pept        108295..108822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aba:Acid345_4635 hypothetical protein; SPTR:
FT                   C4CXI2 Predicted membrane protein, COG3918"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13235"
FT                   /db_xref="InterPro:IPR025196"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXB1"
FT                   /protein_id="ADI13235.1"
FT                   /translation="MPTPRAKAAHARAAYTQAAPVQAALIGVAAGMRAAVAPALVAHHV
FT                   RRSPHAPLGRLGWLGSRRAAGALTLAAAGELVGDKLPATPDRTDLGPLVGRALSGALCG
FT                   AALCRAAGGRGARGALVGAVSALGGAWAFFHLRRALTAAGVPDLAAALAEDGLVLALAE
FT                   AALGAPRSDRVG"
FT   sig_peptide     108295..108363
FT                   /locus_tag="Trad_0093"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            108991..110190
FT                   /locus_tag="Trad_0094"
FT   CDS_pept        108991..110190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0094"
FT                   /product="alanine dehydrogenase/PNT domain protein"
FT                   /note="COGs: COG3288 NAD/NADP transhydrogenase alpha
FT                   subunit; InterPro IPR007886:IPR007698:IPR016040:IPR008143;
FT                   KEGG: ote:Oter_4580 NAD(P) transhydrogenase subunit alpha;
FT                   PFAM: alanine dehydrogenase/PNT domain protein; SPTR:
FT                   B4CXA0 NAD(P)(+) transhydrogenase (AB-specific); PFAM:
FT                   Alanine dehydrogenase/PNT, C-terminal domain; Alanine
FT                   dehydrogenase/PNT, N-terminal domain; TIGRFAM: NAD(P)
FT                   transhydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13236"
FT                   /db_xref="GOA:D7CXB2"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXB2"
FT                   /protein_id="ADI13236.1"
FT                   /translation="MRIAFPKEAPPETRVTLTPTVAAKFATLGAAVRLEAGLGAPLGFS
FT                   DDAYREAGAEVVPKEGLLEGAEAVVRLNPLREDEARALPAGAVVVGLLDPFRNLGAVRA
FT                   LAERGVSALCMELIPRTTYAQKMDALSSQASLAGYAAVVLAAERLDKVLPMMSTPAGTI
FT                   APARVFVVGAGVAGLQAIATAKRLGARVEAFDTRPVVEEQVRSLGAKFVKIDVGETGQT
FT                   AQGYATALTTEQLERQRQGMAKVCAASDIVITTAQVFGKRAPLLLTEEMVAGMRPGSVI
FT                   VDLAAATGGNVAGTVAGEEVVKRGVRLVGLTNLPGAVARDASQMYAANVYNLIEHLWDR
FT                   AQGRVVLRLEDEVTSACLLTHEGAVRHAGVRELLESLGAPTQAEAAKATVTEEHHEPTP
FT                   "
FT   gene            110174..110473
FT                   /locus_tag="Trad_0095"
FT   CDS_pept        110174..110473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0095"
FT                   /product="putative NAD(P) transhydrogenase subunit alpha"
FT                   /note="COGs: COG3288 NAD/NADP transhydrogenase alpha
FT                   subunit; KEGG: ote:Oter_4579 putative NAD(P)
FT                   transhydrogenase subunit alpha; SPTR: B5JJ24 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13237"
FT                   /db_xref="GOA:D7CXB3"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXB3"
FT                   /protein_id="ADI13237.1"
FT                   /translation="MNPPPDTHTLLLLLFIFVLALFLGRELITKVPSQLHTPLMSGSNA
FT                   ISGITIVGAILAAGSEGAFSTALGVVALVAATINVVGGYLVTDRMLGMFKKGGR"
FT   sig_peptide     110174..110308
FT                   /locus_tag="Trad_0095"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            110475..111866
FT                   /locus_tag="Trad_0096"
FT   CDS_pept        110475..111866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0096"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="COGs: COG1282 NAD/NADP transhydrogenase beta
FT                   subunit; InterPro IPR012136:IPR004003; KEGG: ote:Oter_4578
FT                   NAD(P)(+) transhydrogenase (AB-specific); PFAM: NAD(P)
FT                   transhydrogenase beta subunit; PRIAM: NAD(P)(+)
FT                   transhydrogenase (AB-specific); SPTR: A0YCU4 NAD(P)
FT                   transhydrogenase subunit beta; PFAM: NAD(P)
FT                   transhydrogenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13238"
FT                   /db_xref="GOA:D7CXB4"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXB4"
FT                   /protein_id="ADI13238.1"
FT                   /translation="MSVLTNLLYIAASVFFIYGLKMLGRADTARRGNLVSAIGMLLAVV
FT                   ATLLVGGLNLVWVAVGVLVGAAIGAVAAYRVKMTAMPEMVALFNGSGGLASLLVGWAEY
FT                   HRALLTPTFTAVAIFFAVLIGGVAFTGSLVAFGKLSERLPGRPILFPNQHLYNAALGAL
FT                   ALAFGAMFALAPDTVGGYLAFALALLAALVLGVTLVIPIGGADMPIVISLLNAYSGIAA
FT                   SAAGFVLQNNVLIVAGSLVGASGLILTSIMCKAMNRSLTNVLFGGFGAAQGASAAGGAQ
FT                   GEVRAITADDAYFLLEAASNVLIVPGYGMAVAQAQHAVKELADLLEENGAEVRYAIHPV
FT                   AGRMPGHMNVLLAEANVPYEQLVEPDDVNPTMDAVDVAIVIGANDVVNPAARENPGSPL
FT                   YGMPIIDVDRARTVFVLKRSLASGFSGVENPLFFKENARMLFGDAKGTVSQLVAAFKEA
FT                   LRDAA"
FT   sig_peptide     110475..110531
FT                   /locus_tag="Trad_0096"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   repeat_region   112115..112453
FT                   /note="CRISPR"
FT   gene            complement(112661..112737)
FT                   /locus_tag="Trad_R0007"
FT   tRNA            complement(112661..112737)
FT                   /locus_tag="Trad_R0007"
FT                   /product="tRNA-Met"
FT   gene            112874..114700
FT                   /locus_tag="Trad_0097"
FT   CDS_pept        112874..114700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0097"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="COGs: COG0741 Soluble lytic murein transglycosylase
FT                   and related regulatory protein (some contain LysM/invasin
FT                   domains);
FT                   InterProIPR019734:IPR013026:IPR011717:IPR008258:IPR 011990;
FT                   KEGG: ttj:TTHA1471 putative transglycosylase; PFAM: Lytic
FT                   transglycosylase catalytic; Tetratricopeptide TPR_4; SPTR:
FT                   Q72IM5 Putative uncharacterized protein; PFAM:
FT                   Transglycosylase SLT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13239"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXB5"
FT                   /protein_id="ADI13239.1"
FT                   /translation="MLSLLLLIGCALWLALELRVGAARALPYPEVAAAVRSVYEGEPLL
FT                   ADYRAVEAMVRRGDIEGLSAFVAEAPESFLRYRTLLALARDVRVPMARRAAFYEHLLAA
FT                   GLIEPLAREEVRAAFLEVARVAELAGQTERALDAYTRALPLPAAALGVARLEPDAERRA
FT                   ELLLRVGAPADAQRALARAPKPPPPLLAARVYRALGEHERALEQLERLLQAEPTHLEGR
FT                   TERAWVLLALGRTDEAAAAFGSLDEVARTRGLAALAAARGAYAEAGERYRQLAERSGEA
FT                   GALWRATEMLERAGEPEAALPLYLELAQKRSPYRTDAAYRALVLAERLGDAAVAQRAAA
FT                   LLPEDAYFGALRHGLPELLPVSRLERAAPEVLERAAALARVGDREAAIGELLVALAAAR
FT                   GSEAETVALAEALQDLGEFRRSAQAATRWLERGSRDPRTWHVAFPRAYAQVVERYAAAW
FT                   GVEPELVWAVMRQESAFYPRAVSTSRAMGLMQIVPATWAWLAELLDDAAADPFSVADNV
FT                   RFGAFYLGSLMDLFGGDLERVVTAYNGGPGYIGAIAALEAVQRDPEAFYRLIDRQETRD
FT                   YLQKVMWGYLVYRDVLGDTRVAEVQAARADPP"
FT   sig_peptide     112874..112948
FT                   /locus_tag="Trad_0097"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            114727..115251
FT                   /locus_tag="Trad_0098"
FT   CDS_pept        114727..115251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR018062; KEGG: npu:Npun_F2200
FT                   hypothetical protein; SPTR: B2J699 Putative uncharacterized
FT                   protein; PFAM: HPP family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13240"
FT                   /db_xref="GOA:D7CXB6"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXB6"
FT                   /protein_id="ADI13240.1"
FT                   /translation="MAQRDSLKPLEGASRSLRERLNLADELVMALLPTATVLTVLALVE
FT                   VFSQQRLLFASLASSAFLIYLDPLHGANRKRTLVGAQLLAASLGLVTYVAFGPGYLAAG
FT                   GAMTATILLMVVLDLMHPPAVATALSFALRAEGASDALLFALAVAMTAALVGLQQSALW
FT                   LLARAKRRAAR"
FT   gene            complement(115273..115779)
FT                   /locus_tag="Trad_0099"
FT   CDS_pept        complement(115273..115779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0099"
FT                   /product="NUDIX hydrolase"
FT                   /note="InterPro IPR000086:IPR015797; KEGG: tro:trd_A0271
FT                   NUDIX hydrolase, putative; PFAM: NUDIX hydrolase; SPTR:
FT                   D1C9D6 NUDIX hydrolase; PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13241"
FT                   /db_xref="GOA:D7CXB7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXB7"
FT                   /protein_id="ADI13241.1"
FT                   /translation="MLLPNAFALYTALFLQRGDRWLLLQRAPHKRFAPGRWTGLGGRVE
FT                   PGELGDLRGAALRELQEETGLSADALEDLSLRRVLLHNRPGEPLTALLYFTARLTVDVL
FT                   PECTEGTLHWVSPRDLAARDLIETTARVLPELVRDVMRAPQGGEAVRLGTAYYEGAAIR
FT                   EVRWS"
FT   gene            complement(115882..117804)
FT                   /locus_tag="Trad_0100"
FT   CDS_pept        complement(115882..117804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0100"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="COGs: COG1086 nucleoside-diphosphate sugar
FT                   epimerase; InterPro IPR003781:IPR003869:IPR016040; KEGG:
FT                   cts:Ctha_2155 polysaccharide biosynthesis protein CapD;
FT                   PFAM: polysaccharide biosynthesis protein CapD; CoA-binding
FT                   domain protein; SPTR: B3QVK6 Polysaccharide biosynthesis
FT                   protein CapD; PFAM: Polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13242"
FT                   /db_xref="GOA:D7CXB8"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXB8"
FT                   /protein_id="ADI13242.1"
FT                   /translation="MRPDPMPEMPPATESPKSPPPSGKPSRLNRLFKLSLDALSWLLAT
FT                   PIAFFIRYDWAPPADTLGPMAVATAGLFALKLATTSFFGLYQRSWTKVAFRELGDIVRA
FT                   VIGAAALGSLILLWLGPSLDIPRSVAFLDGLVTLFLMTGMRAFARYRHEASLGQHSARR
FT                   AKSVLVIGAGEAGSLVVREMLRHPEMGLRPVGFLDDDRKKVGYRIATVPVLGTTQDINK
FT                   VVRSHDVDEVLIAIPSSDGRVVREIVGRIEGAKAGLKYRIIPGVYELLSGQVGISRIRE
FT                   VQIEDLLRRPPVELDTAAISSYLTDRVVMITGAGGSIGSELVRQICRFRPKELILFGRG
FT                   ENSIYTLERELERDWPDIPYHSVIAGVQHIVRLDYVFRRYQPEVVFHAAAHKHVPLMEL
FT                   NPEEAVFNNIIGSKNLVTLALKYGVTHFVNISTDKAVNPTSVMGASKRMVERLVQSAAL
FT                   RASPEQTFVSVRFGNVLGSRGSVIPVFKQQILAGGPVTVTHPDMTRYFMTIPEASQLVL
FT                   QAAGQGKNGEIYILDMGEPVRIVDLARDLIKLSGFEPDVDIPIAFSGVRPGEKLYEELM
FT                   TDEERGDATAHEKIFVAKPSPLDQGALERTVQTLQEAALRSDHAVIRRELKAYISGSLL
FT                   EDVPA"
FT   gene            118411..119424
FT                   /locus_tag="Trad_0101"
FT   CDS_pept        118411..119424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0101"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="InterPro IPR000182:IPR016181; KEGG: chl:Chy400_2316
FT                   GCN5-related N-acetyltransferase; PFAM: GCN5-related
FT                   N-acetyltransferase; SPTR: C1XFQ1 Sortase-like
FT                   acyltransferase; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13243"
FT                   /db_xref="GOA:D7CXB9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXB9"
FT                   /protein_id="ADI13243.1"
FT                   /translation="MPDAETPPPRPRPFVEADYPALAALQRRVFPEAPLSEAALRYEDA
FT                   RLQEPYRRGRWVMGQQGALVGWGGFYQHPSWYHPDRYALELGVAPEAQRQGIGGALYGA
FT                   IIGALQAHGARAGEVLELRTSVRGRYPQQLAFFTRRGFAERQRSWLLTLELARFTPAPW
FT                   EPLLAELGQQGYAFASVEELERDETQLYALYTFYQELVADVPRTQPFTPWSFEQFLAHR
FT                   RSAPNLLPEGSFVALYRGTFAAVSELKRGATPEQLQTGLTAVRRAYRGQKLALACKVMA
FT                   LRYARACGAAVVTTRNAASNAAMLKVNRALGFTVEDADIELARTLDPGRADGSGEA"
FT   gene            119684..120367
FT                   /locus_tag="Trad_0102"
FT   CDS_pept        119684..120367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0102"
FT                   /product="sugar transferase"
FT                   /note="COGs: COG2148 Sugar transferase involved in
FT                   lipopolysaccharide synthesis; InterPro IPR003362; KEGG:
FT                   pca:Pcar_1529 putative YVfC-like sugar transferase; PFAM:
FT                   sugar transferase; SPTR: Q3A4D2 Putative YVfC-like sugar
FT                   transferase; PFAM: Bacterial sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13244"
FT                   /db_xref="GOA:D7CXC0"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXC0"
FT                   /protein_id="ADI13244.1"
FT                   /translation="MSEAAKGAAGLAQRVLEMSGARYERLKRALDVTFAALGLLVLGPL
FT                   MAVIALVIRWRMGAPVLFRQVRPGRFERPFTLLKFRTMHDTRGADGELLPPPQRITPLG
FT                   VWLRKTSLDELPQLFNVLRGDMSFVGPRPLLASYLPYYRERERLRHRVRPGITGLAQVS
FT                   GRNRLPWDERLELDARYAETLSLALDARIVLATLVKVLRRSDVLDIPLDHGGFIKERAA
FT                   RGEGG"
FT   gene            120364..121449
FT                   /locus_tag="Trad_0103"
FT   CDS_pept        120364..121449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0103"
FT                   /product="protein of unknown function DUF201"
FT                   /note="COGs: COG0458 Carbamoylphosphate synthase large
FT                   subunit (split gene in MJ); InterPro IPR011761:IPR003806;
FT                   KEGG: reu:Reut_A2484 carbamoyl phosphate synthase-like
FT                   protein; PFAM: protein of unknown function DUF201; SPTR:
FT                   Q46YD8 Putative uncharacterized protein; PFAM: ATP-grasp
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13245"
FT                   /db_xref="GOA:D7CXC1"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXC1"
FT                   /protein_id="ADI13245.1"
FT                   /translation="MKRQSGASVPDASGADVGRPGGAQSTLNILLTSAGRRNYLVEYFQ
FT                   EALGGRGRVFAADAKSSAPALQEADGILLVPPIGHKHYIDALVEFCQEERVALLVPLND
FT                   LELPLLASAKARFEAVGTTLVVSSREVVDLCFDKWAAYRWLCGEGFLTPQTYLSLEAAK
FT                   AGLERGELRFPLVLKPRWGSASVGLEFPQDLEELELAFALARRRLARTSLAGEAPGNAL
FT                   LIQAFVAGDEYGLDVVNDLQGGHVTTFVKQKLGMRAGETDSAVTVADAALQDLGAALGR
FT                   RLQHLGNLDCDVLVNETGAWVLELNPRFGGGYPFSHVAGANLPAALLAWAAGETPEQAW
FT                   FQTQAGVAASKYSRLMLVRRT"
FT   gene            121468..122526
FT                   /locus_tag="Trad_0104"
FT   CDS_pept        121468..122526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0104"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gbm:Gbem_1795 hypothetical protein; SPTR:
FT                   B9ZER4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13246"
FT                   /db_xref="InterPro:IPR039523"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXC2"
FT                   /protein_id="ADI13246.1"
FT                   /translation="MLGKLRRTAQTLRSAALAEVAGGAALPLPQKLALWRRGFKSTSYV
FT                   LFDLAHHPPEAYVSDLEVARARRINGAFGRMLKDKLLFEAMLRPYARVPKVLALIERGR
FT                   LVWLPEVGERGDKGTLEALFALSPAGVIAKPVRGNKGRGVLSLQQQEGALLLSGHAVTA
FT                   ARAEEVFAQLDGYLVVERVEQAPYAAQIFPGAANTVRVLSMRDPDTGEVFFPAAMHRFG
FT                   GVRTQPTDNFQTGGVSAAIDLATGRLGRAVRHPNVTGGRLVWLSHHPDTGALIEGVVLP
FT                   HWEALLATLARVLEVYPFLRYVGWDVLVTPEGVCLIEGNHNVNLGLQVHGPLLRDPRVR
FT                   RFYEAHGVLRRR"
FT   sig_peptide     121468..121542
FT                   /locus_tag="Trad_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(122523..123722)
FT                   /locus_tag="Trad_0105"
FT   CDS_pept        complement(122523..123722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0105"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="COGs: COG0523 Putative GTPase (G3E family); InterPro
FT                   IPR003495:IPR011629; KEGG: rca:Rcas_2945 cobalamin
FT                   synthesis protein P47K; PFAM: cobalamin synthesis protein
FT                   P47K; cobalamin synthesis CobW domain protein; SPTR: A7NN74
FT                   Cobalamin synthesis protein P47K; PFAM: Cobalamin synthesis
FT                   protein cobW C-terminal domain; CobW/HypB/UreG,
FT                   nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13247"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXC3"
FT                   /protein_id="ADI13247.1"
FT                   /translation="MLPLPVTVLSGFLGAGKTTLLNHVLSNRQGLKVAVIVNDMSEVNI
FT                   DRELVARGDAGLSRTEETLVELSNGCICCTLRDDLLREVSRLARAGRFDYLLVESTGIS
FT                   EPLPVAQTFVFEDATGASLSEVARLDALVTVVDAATFPRDLACDDDLAERGESAGEGDE
FT                   RTVAALLADQVEWADVIVVNKTDLVGDAELERLEAVLRALNPRAALYRAERGRVPLEAV
FT                   LHTGRFDLEAASQSAAWLQELASEHRPETDTYGISSFVFRARAPFHPQRLAAALADPHL
FT                   EAVLRAKGTFWLATRPDYVGLLSKAGPTYTLDPIGTWWATLPEASWELPEAERQALLAS
FT                   WHPVWGDREQQLVFIGVDMDEAAIRRRLSWALLTDEELEDVARWTQFADPLPAWEVPHP
FT                   "
FT   sig_peptide     complement(123663..123722)
FT                   /locus_tag="Trad_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(124197..125171)
FT                   /locus_tag="Trad_0106"
FT   CDS_pept        complement(124197..125171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0106"
FT                   /product="ribonucleotide reductase"
FT                   /note="COGs: COG0208 Ribonucleotide reductase beta subunit;
FT                   InterPro IPR000358:IPR009078:IPR012348; KEGG: sru:SRU_0131
FT                   ribonucleoside-diphosphate reductase, beta subunit; PFAM:
FT                   ribonucleotide reductase; SPTR: Q2S697
FT                   Ribonucleoside-diphosphate reductase, beta subunit; PFAM:
FT                   Ribonucleotide reductase, small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13248"
FT                   /db_xref="GOA:D7CXC4"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXC4"
FT                   /protein_id="ADI13248.1"
FT                   /translation="MLTERRSTLRPAEYPEFLAYRDAIRHSYWLHTEYNLTEDVNDYRV
FT                   GVREAERQVLTRALLAIAQVEVAVKTFWGDLYRKFPKPEVGAVGYTFAESEVRHQDAYA
FT                   HLLELLGLTDAFARLHEAPALGERLAVLDAHLVPVRQDGRDDAFSVALFSAFVEHVSLF
FT                   GQFLILKAFNQATGRFKGVANIVEATSKEEQIHGMFGYKLVETLRRERPEWFGAAFSAR
FT                   LRAACVDAERAERAILRWICEAGALPFLPLAQLEAFMQARFNGALVALGEAPLWEVDPA
FT                   LLAPTRWFEEELLSSKQVDFFHKRPTAYAKKTRPITADDLFAV"
FT   gene            complement(125171..126835)
FT                   /locus_tag="Trad_0107"
FT   CDS_pept        complement(125171..126835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0107"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   chain"
FT                   /note="InterPro IPR013350:IPR000788; KEGG: dno:DNO_0607
FT                   ribonucleotide-diphosphate reductase subunit alpha; PFAM:
FT                   ribonucleotide reductase large subunit; SPTR: C8N7R7
FT                   Ribonucleoside-diphosphate reductase, alpha subunit;
FT                   TIGRFAM: ribonucleoside-diphosphate reductase, alpha chain;
FT                   PFAM: Ribonucleotide reductase, barrel domain; TIGRFAM:
FT                   ribonucleoside-diphosphate reductase, alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13249"
FT                   /db_xref="GOA:D7CXC5"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013350"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXC5"
FT                   /protein_id="ADI13249.1"
FT                   /translation="MSAPVSAPRFAWLTEESRAFLRRGYLLPGVSPEGRLRQISERAEA
FT                   LLGLPGFAERFFDYLARGFYSLSSPIWANFGLSRGLPISCFGSYVPDSMAGILGAAAEV
FT                   GIMSKYGGGTSAYFGDLRPRGAPIRDNGFSEGAVNFLRLFDTLIDVTKQGATRRGSFAA
FT                   YLPIDHPDVEEFLAIRSDGNPIQNLFFGVAVSDAWLEAMRAGDADKRRVWAKVLQKRTE
FT                   VGLPYVLFTDNATRGAPEVYRDRGLVVRSSNLCTEIMLPVAEDESFVCDLASMNLATYD
FT                   AWRATDAVRLLVFFLDAVMTEFIDKSASLPFFERARRFAVRHRALGVGVVGYHSLLQAR
FT                   RVPFGSLQAALLNRQIFRELREAADDASAELARRYGEPALCEGTGRRNTTLLAVAPTTS
FT                   SAFILGGVSPSVEPLRSNYYVRDLAKAVVTYRNPALREVLRERGHDTPAVWRSILAHDG
FT                   SVQHLDCLSDEEKGVFATFSEISPRDIIVQAAGRQAFIDQGQSLNLMIHPETPARDLNA
FT                   LVLEAHARGLKSLYYQHAISAAQALNRELLTCSACEA"
FT   gene            complement(126832..127383)
FT                   /locus_tag="Trad_0108"
FT   CDS_pept        complement(126832..127383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0108"
FT                   /product="thioesterase superfamily protein"
FT                   /note="COGs: COG1607 Acyl-CoA hydrolase; InterPro
FT                   IPR006683; KEGG: sru:SRU_0133 thioesterase family protein;
FT                   PFAM: thioesterase superfamily protein; SPTR: Q2S695
FT                   Thioesterase family protein; PFAM: Thioesterase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13250"
FT                   /db_xref="GOA:D7CXC6"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXC6"
FT                   /protein_id="ADI13250.1"
FT                   /translation="MRARSPPRAASWDTHPLQSQPLQPVDRSRELCTALVSAPDVRTSP
FT                   SEGESMPTTTRAAETRLVHPVFPSDTNHYHTLFGGQAMAWMDQAAFICATRYCRRRVVT
FT                   VHSSDLSFRRPVPEGSIVELVAQVARTGRTSLEVAVEMWIEPMEREGRELACRGAFTLV
FT                   ALGDDGKPVPVPPLAQRVGA"
FT   sig_peptide     complement(127357..127383)
FT                   /locus_tag="Trad_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            127720..128070
FT                   /locus_tag="Trad_0109"
FT   CDS_pept        127720..128070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0109"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SORBIDRAFT_02g000410; hypothetical protein;
FT                   SPTR: C4RIM3 Phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13251"
FT                   /db_xref="GOA:D7CXC7"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXC7"
FT                   /protein_id="ADI13251.1"
FT                   /translation="MSARGWWRSGAWTPDVGTSLRRGFRVGVAGYALAFLVTALLLAPL
FT                   IADSCSFGLHPHSDAQAHHLCATVSVASAEATVDAPKPQLSRVGVRPRGGVQYLERRTP
FT                   PRANGSRAPPVA"
FT   sig_peptide     127720..127860
FT                   /locus_tag="Trad_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            128327..129268
FT                   /locus_tag="Trad_0110"
FT   CDS_pept        128327..129268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0110"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG4558 ABC-type hemin transport system
FT                   periplasmic component; InterPro IPR002491; KEGG:
FT                   ttj:TTHB220 hemin ABC transporter, periplasmic
FT                   hemin-binding protein; PFAM: periplasmic binding protein;
FT                   SPTR: C1XQC8 ABC-type hemin transport system, periplasmic
FT                   component; PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13252"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXC8"
FT                   /protein_id="ADI13252.1"
FT                   /translation="MNVLSVCPPLRALLVALAVLAPAPAVAAGAMGAAVPPEARIVSLH
FT                   FYATEALLELGLSEQVVGIDIMSRSYYDAALDRSFAELPVIGHWADLSAESVLALQPTL
FT                   VVGTERSGPETAVRQLQGATEVLLLDPRDDLAGALARVGQLAAHLGLEGRAAALEAEMA
FT                   AVRAELAARTAAVEPVGALALASHGGVERVCGRGPHETLLELAGLTNLAPQVSACEELS
FT                   REALVGIDAEVLVFSNPETFDFFGGHEGLSAHPVFGRTEAVRQERYIVLGSAEQVLGVG
FT                   LRTPSFALALHEAVYGHEGPVVIERDLAVAPL"
FT   sig_peptide     128327..128422
FT                   /locus_tag="Trad_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            129280..130179
FT                   /locus_tag="Trad_0111"
FT   CDS_pept        129280..130179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0111"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG4558 ABC-type hemin transport system
FT                   periplasmic component; InterPro IPR002491; KEGG:
FT                   ttj:TTHB220 hemin ABC transporter, periplasmic
FT                   hemin-binding protein; PFAM: periplasmic binding protein;
FT                   SPTR: C1XQC8 ABC-type hemin transport system, periplasmic
FT                   component; PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13253"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXC9"
FT                   /protein_id="ADI13253.1"
FT                   /translation="MGVVCAALVALLGSALAQERIVSLHQKTTDVLFDLGLAEAVVGRS
FT                   FHSSPFVDPASGVSAEDLPDIGFEFNVSAEAVLALSPTLIVGTEDNGPPQAIAQLRGAG
FT                   VPVLLVSAQSDLEGSAARIREIAAALGVSGRGEALLERLEAQRQALEARLAATPERVGG
FT                   LVMVGWSGAPQACGGDSDFHAMYVLAGGHNLLEALNGCPEINPEALPELPVDVLFFPAL
FT                   SQYEAVGGVAGLRARPGFAQLRAVQTGRAVIMESPAFRGMGASAPRFAQAIHEALYEHG
FT                   GVVLVTPEGAVTPYAEAP"
FT   sig_peptide     129280..129330
FT                   /locus_tag="Trad_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            130176..131207
FT                   /locus_tag="Trad_0112"
FT   CDS_pept        130176..131207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0112"
FT                   /product="transport system permease protein"
FT                   /note="COGs: COG0609 ABC-type Fe3+-siderophore transport
FT                   system permease component; InterPro IPR000522; KEGG:
FT                   tth:TT_P0178 hemin transport system permease protein HmuU;
FT                   PFAM: transport system permease protein; SPTR: C1XW08
FT                   ABC-type Fe3+-siderophore transport system, permease
FT                   component; PFAM: FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13254"
FT                   /db_xref="GOA:D7CXD0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXD0"
FT                   /protein_id="ADI13254.1"
FT                   /translation="MSARYRTALVGCALALPPALLLAAGLGAFYIPPLEIPRVLLERGL
FT                   GYEVLTQIRLPRVLMTALVGAGLAVAGAVLQGLFRNPLAEPSLIGVSSGAALGAAVWIV
FT                   LLGGGFGSGQPVRASAAFQWGLPLAAFVGACVTTLLVWRVARTGGRTLVVSLLLAGIAM
FT                   NSLAGAGIGLMQFFADDQQLRSFVFWTLGGFNRVSWREFWVAAPLIALALALLLRQGRR
FT                   LNALVLGESEAYLLGVQVERVKRRAVVLSALLVGASVAVAGVIGFVGLVVPHMFRLVAG
FT                   PDHRYLLPGAALMGASLLLVADVLCRTLLVPAELPIGILTALVGGPFFIYLLTVQQREV
FT                   LRA"
FT   sig_peptide     130176..130259
FT                   /locus_tag="Trad_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            131200..132009
FT                   /locus_tag="Trad_0113"
FT   CDS_pept        131200..132009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0113"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1120 ABC-type cobalamin/Fe3+-siderophores
FT                   transport systems ATPase components; InterPro
FT                   IPR003439:IPR003593:IPR017871; KEGG: tth:TT_P0177
FT                   transporter; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: B7AB93 ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13255"
FT                   /db_xref="GOA:D7CXD1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXD1"
FT                   /protein_id="ADI13255.1"
FT                   /translation="MLEVSGLGYRAAGRWLVRDVALQVPAGEFCAILGPNGAGKTTLLR
FT                   LLSGELTPSRGAVQLLGRPLSSYAPLALAQQRALLSQKRHLEFPFRALEVVMLGRLPHQ
FT                   ARGHETPRDRAVVAESLTRVEAQGLSERVYPSLSGGEASRVDLARVLAQEPQLLLLDEP
FT                   TNHLDPRHQLAVLALARELAAGGCAVIATMHDLNLAARFADRLVLMHRGEVVSLGSASE
FT                   VLTEDRLRSVYGVEAQVTQLRGRPLVVLEGATPRDPQPHDPHALVSV"
FT   gene            132028..132621
FT                   /locus_tag="Trad_0114"
FT   CDS_pept        132028..132621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0114"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="InterPro IPR007138:IPR011008; KEGG: dge:Dgeo_2196
FT                   antibiotic biosynthesis monooxygenase; PFAM: Antibiotic
FT                   biosynthesis monooxygenase; SPTR: A7BZR6 Antibiotic
FT                   biosynthesis monooxygenase; PFAM: Antibiotic biosynthesis
FT                   monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13256"
FT                   /db_xref="GOA:D7CXD2"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXD2"
FT                   /protein_id="ADI13256.1"
FT                   /translation="MIVAMNRFYLHDPWAERLRRRFLGLEPSDHAHAPPAGLLRSCMLV
FT                   PRCGDLPHVSVALWEDMAALRRWVQSDAFKRSHSPQSPNRLPPEAFSRRRELELYTTSA
FT                   PLPELNAGVVSLCRVRPQGAQPPRSASERGLPLTPMGAGQPWVLLDVWRDLSWALAAAE
FT                   HYEGAVGETGEVRLEVYPQVLVKPAAPYASASEA"
FT   gene            complement(132657..133616)
FT                   /locus_tag="Trad_0115"
FT   CDS_pept        complement(132657..133616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0115"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="COGs: COG0111 Phosphoglycerate dehydrogenase and
FT                   related dehydrogenase; InterPro
FT                   IPR006139:IPR006140:IPR016040; KEGG: gym:GYMC10_5362
FT                   D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
FT                   protein; PFAM: D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase catalytic region; SPTR: D1C9F2 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase NAD-binding protein;
FT                   PFAM: D-isomer specific 2-hydroxyacid dehydrogenase, NAD
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13257"
FT                   /db_xref="GOA:D7CXD3"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXD3"
FT                   /protein_id="ADI13257.1"
FT                   /translation="MRVLLVGFSEDRFSPEQRAAILGAAEGLEVVFTRERAEITARLED
FT                   IEVAVGSFPRDLMKRAPRLRWFQQWGAGADWLLKHPELVAKDFVLTNVSGIHAVPISEH
FT                   IFAYLLAFARGLPKALRDQAARRWPTDRGAFFELQGQTMLLLGTGAIGARTAQLAQAFG
FT                   MRVVGVRRNPDRPVAHVDEMVALSDLHAALPEADAVVLTLPLTRDTRHVITEGELRRMK
FT                   GSAHLVNIGRGGLVDEGALVRALQEGWIAGAGLDVFEEEPLPESSPLWELENVIITPHT
FT                   SGDTPHYDARALAIFLENLRRYRAGEPLTHVVDKALGY"
FT   gene            complement(133687..134589)
FT                   /locus_tag="Trad_0116"
FT   CDS_pept        complement(133687..134589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0116"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpb:Cphamn1_0745 hypothetical protein; SPTR:
FT                   B3ENG8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13258"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXD4"
FT                   /protein_id="ADI13258.1"
FT                   /translation="MNGKAAFSLRGRNPDVLTCIANLSNDEVFTPPEFANRMLDTLAEA
FT                   WAVDHGGANLWADPAVRFLDPCTKSGVFLREVTRRLTEGLAGANMTQIDAGGILDIAMA
FT                   GTSATLLARKWESALLVNVDNDTLRRILENPEALAAVERIEGWRSLGDNILETIINKSE
FT                   KIKELKSKGKERELTPKEKKELSDEEKEYKSKRKQLQEKLIKFATRIPAFMYLTDFREN
FT                   TLQDVITKLEPDLFLTVTGLTVEDFHLLVRLRVFNTEQMNQAVFAFRRYEDASLRYTGI
FT                   ESHEELTYYGLYDTVVARE"
FT   gene            complement(134586..134768)
FT                   /locus_tag="Trad_0117"
FT   CDS_pept        complement(134586..134768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dac:Daci_2436 hypothetical protein; SPTR:
FT                   A9BVK7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13259"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXD5"
FT                   /protein_id="ADI13259.1"
FT                   /translation="MTQQELSLAKDPDLRGSLAALRRAAAMARQTAIQTDTAIVVVKDG
FT                   KLLRISAAELRAGKR"
FT   gene            complement(134765..135295)
FT                   /locus_tag="Trad_0118"
FT   CDS_pept        complement(134765..135295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG4185 conserved hypothetical protein; KEGG:
FT                   pph:Ppha_0746 hypothetical protein; SPTR: B4SEE8 Putative
FT                   uncharacterized protein; PFAM: Zeta toxin"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13260"
FT                   /db_xref="GOA:D7CXD6"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXD6"
FT                   /protein_id="ADI13260.1"
FT                   /translation="MPGGASREKIIIIAGPNGAGKTTFARSFLPAEAGLPRFINADLIA
FT                   AGLAPFAPETAAIKAGRLMLEEIERHTQRGESFAFETTLASLSYLRRIKAWRAQGYRVN
FT                   LFFLMLPNVETALARVAERVRQGGHSIPEAVIRRRFTSGLRNLPHYRQAVSKWAIYDNS
FT                   GTEPVLLEWGENQ"
FT   gene            complement(135297..135950)
FT                   /locus_tag="Trad_0119"
FT   CDS_pept        complement(135297..135950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0119"
FT                   /product="type III restriction system methylase"
FT                   /note="InterPro IPR002296; KEGG: dge:Dgeo_0927 type III
FT                   restriction system methylase; SPTR: Q1IZV5 Type III
FT                   restriction system methylase; PFAM: N-6 DNA Methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13261"
FT                   /db_xref="GOA:D7CXD7"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXD7"
FT                   /protein_id="ADI13261.1"
FT                   /translation="MCAPVKLVKSKQRVADHGEVFTPPWLVAAMLDLVKGETERIDARF
FT                   LEPACGSGNFLVEVLRRKLAAVELKYGRSDFERRHYALFALMCVYGIELLADNIAECRA
FT                   NLLEIFADYLNLDASDDLYRAASHVLAQNLVHGDALKMQTHEGAAITFAEWGYLGRGKY
FT                   QRRDFHLDTLTMSSTFSAEGSLFASLGKHEIFKPTKSYPPMTIKELGEMGREGA"
FT   gene            complement(136117..137595)
FT                   /locus_tag="Trad_0120"
FT   CDS_pept        complement(136117..137595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0120"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterPro IPR015590:IPR016161:IPR016162:IPR016160; KEGG:
FT                   sth:STH722 succinate-semialdehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase; SPTR: Q67RI6 Succinate-semialdehyde
FT                   dehydrogenase; PFAM: Aldehyde dehydrogenase family;
FT                   TIGRFAM: succinate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13262"
FT                   /db_xref="GOA:D7CXD8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXD8"
FT                   /protein_id="ADI13262.1"
FT                   /translation="MTNTLNAGMNAETEQGFVFKQLIGGAWVDAAGGGTWELIDPATEG
FT                   LIARVPFGGREDAEAAVDAAAAAFPAWAKRTPYERAEVLNRAAAWIRPRVAALARVSTE
FT                   ESGKPLAEAKAEWTSACGYLEWFAGEGVRAYGRVIPARAPGRRITVLHQPMGVIGTITA
FT                   WNFPVYNLVRTWAAALAAGCTVVGRPSEYTPRSAMLLARALQAGGAPDGVINVVNGDPA
FT                   AVAEVMMADPRVRKVAFTGSPRVGKLLMDQASRTVTRLSLELGGNAPVIVFGDVDVERA
FT                   AKSAVTWKTRNCGQVCVAPQRFYVHESLYRAFAERVAELMGALRLGHGLDESTQVGPLI
FT                   NETQRERVADLVARSVAAGAKLETGGERPAGQGYFYRPTVLSEVTPDMPVHTEEVFGPV
FT                   MPLIPFRDADEVLGLANRSEYGLAGFVLTNDLNTSVRMSEGLEVGLVCVNDWLPATPEA
FT                   PFGGVKGSGFGRETGSEGLLEYMETKTVFTGGVG"
FT   gene            complement(137588..138949)
FT                   /locus_tag="Trad_0121"
FT   CDS_pept        complement(137588..138949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0121"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /note="COGs: COG0160 4-aminobutyrate aminotransferase and
FT                   related aminotransferase; InterPro
FT                   IPR004632:IPR005814:IPR015424:IPR015421; KEGG:
FT                   chl:Chy400_3624 aminotransferase class-III; PFAM:
FT                   aminotransferase class-III; SPTR: C1XG95 4-aminobutyrate
FT                   aminotransferase; TIGRFAM: 4-aminobutyrate
FT                   aminotransferase; PFAM: Aminotransferase class-III;
FT                   TIGRFAM: 4-aminobutyrate aminotransferase, prokaryotic
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13263"
FT                   /db_xref="GOA:D7CXD9"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXD9"
FT                   /protein_id="ADI13263.1"
FT                   /translation="MGTIRLITELPGPKSLELTRRREAATARGAAKLTPVAVAHAHGAA
FT                   VTDVDGNTLLDFAGGIGTLAVGHTPAGVVGALKAQAEKLVHLCAIVGTYEPYVALAELL
FT                   CEIAPVSGPKKAVLLNSGAEAVETAVKVARAHTGRAAVVVFEGAYHGRTNLTLAMTSKY
FT                   GLFKKGFGPFAPEVYRLPFPNLFRRPPGMSEAAFVEEAIRGLERAFVAHVDPSAVAAVV
FT                   IEPVQGEGGFLPVPAPFLRRLRELCTEHGMLLVADEIQCGMGRTGKLFAVEHYGVEPDL
FT                   VTVAKSLAAGMPLSAVVGRAEVMDAPHPGGLGGTYSGNPLACVAALEAVAMIRDEAFLR
FT                   RAREVGERLRGHLEGLQRAFDAIGDVRGLGPMLALELVREDGSPDPDAVQRVTAEALKR
FT                   GLIVLRAGLYSNCLRFLPPLNLSDDELDEGMAVLREAFAAAFAPKEPQEVVSGD"
FT   gene            complement(139100..140452)
FT                   /locus_tag="Trad_0122"
FT   CDS_pept        complement(139100..140452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0122"
FT                   /product="amine oxidase"
FT                   /note="COGs: COG1231 Monoamine oxidase; InterPro
FT                   IPR002937:IPR001613; KEGG: cag:Cagg_2955 amine oxidase;
FT                   PFAM: amine oxidase; SPTR: B8G682 Amine oxidase; PFAM:
FT                   Flavin containing amine oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13264"
FT                   /db_xref="GOA:D7CXE0"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXE0"
FT                   /protein_id="ADI13264.1"
FT                   /translation="MRVLVLGAGVAGLAAARALKEAGQQVIVLEAKDRLGGRTYTNRDF
FT                   ASVPVEFGAEFIHGERAATWELVRALGLETLPWPKQDDSLVRLEDGRLLSMREARSQCP
FT                   DFDLTRSWALPEVDALPGEDFHSYLRRIGFSATQLRYVRRSFANACGESMRFLSARAVL
FT                   EGLREGGEESGSEDFRLLSGYDALVRALAAGLEVHLHDPVTEVRWSPGTGVHVRTLGEE
FT                   RYDAEAAIITVPLGVLQAGAIRFSPELPDAKQSALLGLKMGPVIKLVYRFAEAPLPPHV
FT                   MALYSRLNPPMWWSPSFGHTPPAQEHVWTAFVSGDWASELLSLGEAGALEAALASFRSE
FT                   LGRPELTPLGARLVNWPDDPYTRGGYSFVLPGHDGAREKLAAPTPPLFWAGEATEPEHR
FT                   AATVHGALLSGRRAAAEVCAHLARSAHRGGARAPDPVPERAAHAERPRARS"
FT   sig_peptide     complement(140393..140452)
FT                   /locus_tag="Trad_0122"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(140449..141132)
FT                   /locus_tag="Trad_0123"
FT   CDS_pept        complement(140449..141132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0123"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="InterPro IPR016181; KEGG: chl:Chy400_3625
FT                   GCN5-related N-acetyltransferase; SPTR: B9LDA5 GCN5-related
FT                   N-acetyltransferase; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13265"
FT                   /db_xref="GOA:D7CXE1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXE1"
FT                   /protein_id="ADI13265.1"
FT                   /translation="MQARPEHGAGIHEVICRANGFPIGTRGCASEAEVAQMLRRFPEGQ
FT                   FVVVTDTPGGERVIGVALAMRTDYPPSARPLSWSAMIGDLTLPNHDPEGRWLYGVDKAV
FT                   HPEFQGRGVASALYKAQFALVEALGLEGMYAGGMLKGYGRYRDVMSVREYAAKVIAGEI
FT                   FDPTVSVQMKRGFKPCGVIEDYAWDSDADHAGMLIVWRPERAARAAHPAPQGLPAAGPQ
FT                   PSARL"
FT   gene            141722..142576
FT                   /locus_tag="Trad_0124"
FT   CDS_pept        141722..142576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0124"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1176 ABC-type spermidine/putrescine
FT                   transport system permease component I; InterPro IPR000515;
FT                   KEGG: tro:trd_0522 spermidine/putrescine transport system
FT                   permease protein PotB; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component; SPTR: B9KYH6
FT                   Spermidine/putrescine transport system permease protein
FT                   potB; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13266"
FT                   /db_xref="GOA:D7CXE2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXE2"
FT                   /protein_id="ADI13266.1"
FT                   /translation="MAGRVQRTGTGASVLLALPGLFWLVTFFLLPLLFVLYASFQTRGA
FT                   GGLPVPPTTLEHYERTFDVFWPVIWRTLYFSGLTTLVCLLLGFPVAFFISTRKSARARQ
FT                   LLLFLILLPFWTNFLVRTYALQTILGREGPLNALLLNLGVIQAPLTMLNTPFAVMLGLV
FT                   YGFVPFMVLPVYASVERLDKRLLEASSDLGANDWHTFWRVVLPLTLPGIVAGSMLVFIP
FT                   AIGAFVTPDLLGGTRGLMIGNLIQSQFRGRGNIPLGSAISVVLMVVVLLGLLVYTRFGE
FT                   RRD"
FT   sig_peptide     141722..141862
FT                   /locus_tag="Trad_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            142604..143515
FT                   /locus_tag="Trad_0125"
FT   CDS_pept        142604..143515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0125"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1177 ABC-type spermidine/putrescine
FT                   transport system permease component II; InterPro IPR000515;
FT                   KEGG: ter:Tery_2817 binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Q110T1 Binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13267"
FT                   /db_xref="GOA:D7CXE3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXE3"
FT                   /protein_id="ADI13267.1"
FT                   /translation="MTERTARPPNPTGDAEGRGRLRRDLALRRWGKVGLVLIPVLTYLF
FT                   LWVPIVVLIVFSFNDAASVSVWRGFSTRWYSNLLGLGGGAFQTELLLRSVRNSLLVAGV
FT                   ATALSTVIGTLFALAVARGSFPGRRFFEALFYLPVIIPDITQGVALAVFFNTLFAAAQN
FT                   LFGVRLVSGFGTIIIAHVAFNIAYVAVVVRARLAAMDPTLEEAARDLGANHFQTFWRVT
FT                   LPNLMPGVLGGALLAFTISLDDFVVTFFTAGVGTTTLPLFVYGLLKQRVPPEINAVSAL
FT                   MILVSIVLVAGSLLLQRRRPEA"
FT   gene            143678..144670
FT                   /locus_tag="Trad_0126"
FT   CDS_pept        143678..144670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3181 conserved hypothetical protein;
FT                   InterPro IPR005064; KEGG: csa:Csal_1453 hypothetical
FT                   protein; PFAM: conserved hypothetical protein; SPTR: Q1QXK2
FT                   Uncharacterized protein UPF0065; PFAM: Tripartite
FT                   tricarboxylate transporter family receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13268"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXE4"
FT                   /protein_id="ADI13268.1"
FT                   /translation="MRALGPFARFQIFVFTLAVFGLGLAQGFTPRNPTCIAPADPGGGW
FT                   DFTCRNIATLLSDIGAVRGRLRTQNMPGAGGGVAYAHVVGQQSGNDNLIVAASTATTTR
FT                   IAQGQFSGFDEDDVRWVAALGADYGVIAVSPDSPYDDLTELMEALRAEPASLSIVGASA
FT                   VGGWDHLKVLLVAQAAGLENLSALRYVSFSSGGQAIVELLGGRAEVFSGDVSEALPQIE
FT                   AGNLKVLGILAEERADGLLAEVPTAAEQGYDVVGANWRGFYMPAGTSDEAYTFWVEAFR
FT                   ELEASEAYATVRQQSGLSPFWRGGEEMTAFVYDEVETIRELSEQINLTE"
FT   sig_peptide     143678..143794
FT                   /locus_tag="Trad_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            144676..145116
FT                   /locus_tag="Trad_0127"
FT   CDS_pept        144676..145116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0127"
FT                   /product="putative tricarboxylic transport membrane
FT                   protein"
FT                   /note="KEGG: csa:Csal_1454 putative tricarboxylic transport
FT                   membrane protein; SPTR: C1XGJ9 Putative uncharacterized
FT                   protein; PFAM: Tripartite tricarboxylate transporter TctB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13269"
FT                   /db_xref="GOA:D7CXE5"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXE5"
FT                   /protein_id="ADI13269.1"
FT                   /translation="MSDRVAALLLLLLALFFGLEALSYRAGDFTDALGARAFPLAVTAL
FT                   LVPSALYLLLRPQPDKPWPPAPVWGVLGVAVATFIAYALLLEPLGFIFATTLFFVVFGA
FT                   FFAAPWWRSALAGLAFSAALYAIFVWALDLYLPVGGLFERFI"
FT   sig_peptide     144676..144738
FT                   /locus_tag="Trad_0127"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            145117..146637
FT                   /locus_tag="Trad_0128"
FT   CDS_pept        145117..146637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0128"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="COGs: COG3333 conserved hypothetical protein;
FT                   InterPro IPR002823; KEGG: pmy:Pmen_1455 hypothetical
FT                   protein; PFAM: protein of unknown function DUF112
FT                   transmembrane; SPTR: C1XW64 Uncharacterized conserved
FT                   protein; PFAM: Tripartite tricarboxylate transporter TctA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13270"
FT                   /db_xref="GOA:D7CXE6"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXE6"
FT                   /protein_id="ADI13270.1"
FT                   /translation="MDVLSSLGNGFGVALQPLNLLVAFIGVFLGTVIGMLPGIGPINGI
FT                   AILIPITFVLGLDPTAMLILFAGIYYGSQYGNSISTILLNVPGTASSVATALDGYEMTK
FT                   QGRGGPALAISAIASFVGGTLSVVGLMFLAPLMAQWAIRFGPAEYFVLIVFTFSTLSAL
FT                   TGKQFVKGLIATALGLMLASVGIDPGTGIPRYTFGQLELYDGLDFVVVTIGFFAVSEVL
FT                   TLIESSRFGQEGLHKVGRIMVSMRELVMSLWVMLRSSVLGFLVGVLPGAGATIASFLAY
FT                   TVEQRLVDRQGSFGKGDIRGVAAPEAANNASVSGALIPLLTLGVPGSGTTAVILGALLA
FT                   LNLTPGPLFIERNPELFWGLVASMYIGNVMLLILNLPLIGLFVRILLVPRWILVPAVAT
FT                   IGYIAVYAVNSSVFDLMLMTAFGVLGYLMRKTDFPVAPVILALVLGPLMEVNLRRALSL
FT                   SGGDWGALFGTPLAVGLWVLVALSLVLPLVTNRRRAVGLEAGVDASKE"
FT   sig_peptide     145117..145218
FT                   /locus_tag="Trad_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(146641..147564)
FT                   /locus_tag="Trad_0129"
FT   CDS_pept        complement(146641..147564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0129"
FT                   /product="diacylglycerol kinase catalytic region"
FT                   /note="COGs: COG1597 Sphingosine kinase; InterPro
FT                   IPR001206; KEGG: dge:Dgeo_1293 diacylglycerol kinase,
FT                   catalytic region; PFAM: diacylglycerol kinase catalytic
FT                   region; SMART: diacylglycerol kinase catalytic region;
FT                   SPTR: Q1IYU5 Diacylglycerol kinase, catalytic region; PFAM:
FT                   Diacylglycerol kinase catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13271"
FT                   /db_xref="GOA:D7CXE7"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXE7"
FT                   /protein_id="ADI13271.1"
FT                   /translation="MTATNNTATGQTTTDYTLFVNPRAGRGGAPRLAEAVARVLRAAGR
FT                   HCDVALHPSPEAALAHAQTLPQGTAIVPVGGDGTVSALLPAAVCTGRPFGLVPAGRGND
FT                   FAYALGWRRWTPERIAERLQRETRALDVLRVTLGGRTRYSLNGFGMGFDAQVAAYAAEM
FT                   PRSLGGFGSYAAGVVLAFRDLRQQALTVTVDGAEVFSGLSFLGAVMNGRRYGGGFHISP
FT                   EGELTDGRLELIVGRAVGRAGLVPLIARLLFGQHLKHPRVVYARGQRASLHWAVPVKLH
FT                   LDGDLHPATGDVQVEVVPKSVRVLGA"
FT   gene            147741..148985
FT                   /locus_tag="Trad_0130"
FT   CDS_pept        147741..148985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0130"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="COGs: COG0112 Glycine/serine
FT                   hydroxymethyltransferase; InterPro
FT                   IPR001085:IPR015424:IPR015421:IPR019798; KEGG:
FT                   dge:Dgeo_0221 serine hydroxymethyltransferase; PFAM:
FT                   glycine hydroxymethyltransferase; PRIAM: Glycine
FT                   hydroxymethyltransferase; SPTR: C1XSL7 Serine
FT                   hydroxymethyltransferase; PFAM: Serine
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13272"
FT                   /db_xref="GOA:D7CXE8"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXE8"
FT                   /protein_id="ADI13272.1"
FT                   /translation="MTTSTPPKMNTDRRDEALFALLEREFERQRDGLELIASENFTSQA
FT                   VMAAVGSVLTNKYAEGYPGKRYYGGCEVVDEVEQLAIARAKELFGAAWANVQPHSGSSA
FT                   NLAVYYALLEPGDTVLGMDLAHGGHLTHGSPVNFSGMNYRVVGYPVDRETERIDLGTVR
FT                   QLALEHRPKLIIAGASAYSRVIDFAGFRAVADEVGAYLMADIAHIAGLVAAGVHPSPVP
FT                   HAHVVTTTTHKTLRGPRGGLILSRDPELGKRFDKMIFPGTQGGPLEHVIAGKAVAFFEA
FT                   LQPEFKTYSEQIVRNARALAGALAGRGYRIVSGGTDNHCFVVDLRPQGLTGNKASKLLD
FT                   EARITVSKSMIPFDPEKPWVTSGIRLGTPALTTRGFTEREMVAVADAIDRTLRGEDPRV
FT                   VGAEVAALAQRFPMP"
FT   gene            149054..149130
FT                   /locus_tag="Trad_R0008"
FT   tRNA            149054..149130
FT                   /locus_tag="Trad_R0008"
FT                   /product="tRNA-Met"
FT   gene            149277..149573
FT                   /locus_tag="Trad_0131"
FT   CDS_pept        149277..149573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rme:Rmet_1197 dihydrolipoamide
FT                   acetyltransferase; SPTR: Q1LP43 Dihydrolipoamide
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13273"
FT                   /db_xref="GOA:D7CXE9"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXE9"
FT                   /protein_id="ADI13273.1"
FT                   /translation="MHQLIARLLLSVALLLPLSQAQLALAGSPAPQGATAPAAPAPADP
FT                   AASPALEATPEPVIEPAGDAEATTAIGLGVILLAAFVFIAAIVVVVNLLRRRR"
FT   sig_peptide     149277..149390
FT                   /locus_tag="Trad_0131"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            149906..153217
FT                   /locus_tag="Trad_0132"
FT   CDS_pept        149906..153217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0132"
FT                   /product="alpha amylase catalytic region"
FT                   /note="COGs: COG0366 Glycosidase;
FT                   InterProIPR006047:IPR006046:IPR017853:IPR013784:IPR
FT                   006589:IPR013781; KEGG: dge:Dgeo_1746 alpha amylase,
FT                   catalytic region; PFAM: alpha amylase catalytic region;
FT                   SMART: alpha amylase catalytic sub domain; SPTR: Q1IXJ3
FT                   Alpha amylase, catalytic region; PFAM: Alpha amylase,
FT                   catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13274"
FT                   /db_xref="GOA:D7CXF0"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXF0"
FT                   /protein_id="ADI13274.1"
FT                   /translation="MGKLRRLVLGALLAALLGACAQQEAPQVEPARQPLGALELSVTGL
FT                   PEGTPAAVTVTGPARYRQVLTRSTTLRDLQPGAYTTRAEGVSFLGVTYTPTVDPQRAVV
FT                   TKGQTARVGVRYARPAPQSAELVVSVTGLPDGVASDVTVLGPEGFEVTLTESARLRDLT
FT                   PGSYTVTRLSVWTGSEVFVPDAPAETVTVAAAAETVAAVTYGRPEPVARPEPTDWRREV
FT                   IYFAMTDRFRNGDPTNDSGARRPGAADEVTTEAENPLGWHGGDFAGLTQAIRSGYFQEM
FT                   GFTALWLTPVYLQVPAITVTDGGSPNDGKRFAGYHGYWAEDFFQVDPHLGTKEEYRELV
FT                   ATAQAHGIRVIQDMVVNHTGYGATLTETRPEWFHDEADCAAGDPVVACPLAGLPDFDQR
FT                   RADVTAFLNATVDYWVEHFGIDGIRMDTVKHVYDDYWRQFFAPGGVGDPARVWTVGELF
FT                   DGNPGFIARYLDDLGLPAAFDFPLYFRIKDHLSSPAGNLDDVAVIFDQDGAYEDPTRLV
FT                   TFVDNHDVPRFMSEALSRGVSEAHARERLDAALSLIYTVRGTPSVYYGTENAATGRGDP
FT                   YSYGPFEGNRVKLAPDAPAPLAPRLRALAAARAAYPALTHGAQRELWRPNGREPVMAFR
FT                   RTLAGERTVVAVLNNGDAPIDLTTLSAGGIPLRGTFALSTTLTEVTGRAHNLSITDTGL
FT                   LVGTVPPRTLLAVAGDPGEDEETGTTTVTLTVDARSQGEAQIELRRFDTGREERLPMTP
FT                   VAGQPGFWTITLSDLERFRSLAFKFGNAAPGAKNAGYEGFGQGDRTLYLDAAEMTYEGV
FT                   YNFISVPAPETAFTGTVTLDGAPATRALVEASDTPARFYAFTFADGSFYLPYSGTTDLT
FT                   ASKDGQSQTLSGVSAPASGLTFTLGGSGLRYAIDGDLGDWTQPRARLINPPYDGGFGPD
FT                   NLFSELLVDWDATYLYLGYRYRAAGNSAIIHLDVRDGGVTSVANLNAWPRLASFANPID
FT                   AFVAQYQGDPAQLWEVRSSTQAARIDDGVITATAGSGPAYTIEVALPWRALGFASRPTA
FT                   TLNLHAGIYGGDGYGAGDIAPHAGSTPPASGNTVAGFDASRRVDFQTPFSVPLGD"
FT   sig_peptide     149906..150061
FT                   /locus_tag="Trad_0132"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            153273..154724
FT                   /locus_tag="Trad_0133"
FT   CDS_pept        153273..154724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0133"
FT                   /product="cation transporter"
FT                   /note="COGs: COG0168 Trk-type K+ transport systems membrane
FT                   components; InterPro IPR003445; KEGG: ttj:TTHA1173 trk
FT                   system potassium uptake protein (TrkG); PFAM: cation
FT                   transporter; SPTR: B7A9Q5 Cation transporter; PFAM: Cation
FT                   transport protein; TIGRFAM: potassium uptake protein, TrkH
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13275"
FT                   /db_xref="GOA:D7CXF1"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXF1"
FT                   /protein_id="ADI13275.1"
FT                   /translation="MRGRFTIYVQGVGLLGLAGLGLVFATYAWLSAEPTDGFLAMALLS
FT                   GALGGALLGLGRSDADPGRRESLIGVLLLWLLLPLLGGVPFAVTLELSVLDAVFESMSG
FT                   FTTTGATMLVSFAEVPASLFMWRALTQWLGGVGIIVIFIAVFPPFGVAGRQLFFAEVPG
FT                   PTEERLTPRLRNTAAAVLLVYLLLTLLCGLSYAVAGMSRYDALLHALTTIASGGFSSHP
FT                   LSFEGFSPAQNWVAVLFMVFAGANFALQYQLVVGRPLALLRDREFQTYLAIVGVGGLLL
FT                   TLTLWELYTPIEALRHGMFQSLTMVTTTGYASADFVRWPLPAQATLVLLMFVGGSAGSA
FT                   AGGIKVIRWLILVKATAVELRRTLHPRVVKPVMVGRRVVREEVIRAVAAFITLYLLLFA
FT                   ATTWTVTVLGEDFTTALTAAVACIGNIGPGLGAVGPMANFAELHPVSKGLLTFGMYAGR
FT                   LEVVTVFVLLNRDFWYLPRKKGARY"
FT   sig_peptide     153273..153368
FT                   /locus_tag="Trad_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(154824..155981)
FT                   /locus_tag="Trad_0134"
FT   CDS_pept        complement(154824..155981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0134"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="COGs: COG0019 Diaminopimelate decarboxylase;
FT                   InterPro IPR002986:IPR000183:IPR009006; KEGG: dge:Dgeo_0790
FT                   diaminopimelate decarboxylase; PFAM: Orn/DAP/Arg
FT                   decarboxylase 2; SPTR: Q1J092 Diaminopimelate
FT                   decarboxylase; TIGRFAM: diaminopimelate decarboxylase;
FT                   PFAM: Pyridoxal-dependent decarboxylase, C-terminal sheet
FT                   domain; Pyridoxal-dependent decarboxylase, pyridoxal
FT                   binding domain; TIGRFAM: diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13276"
FT                   /db_xref="GOA:D7CXF2"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXF2"
FT                   /protein_id="ADI13276.1"
FT                   /translation="MDPGRAALLHRIAERYSTPTYVYDLDAIGDRVARLRAALPTAELL
FT                   YAVKANPCGAVLRHLAAAGLGAEVISVGELARARRAGFPEGRILLGGPRQDPPLVAAAW
FT                   GVGWVSLDNPSQWRGWQRFAAREGAPRFLLRLNPGLDPRTHEHLATGAARSKFGMPFGE
FT                   LAALGAALGEHLAGFHVHIGSQITELGAYEPVFAQLGALLTRFPHADTLDLGGGFAVPG
FT                   FALPEFSARVRAFLAQVPFRRLLLEPGRFLVAESGVLLTRVLHVKEGPVRHVIADAGMA
FT                   DLLRPALYGAQHPVRVLGAADGASGSADLDGPLCENADRLARGVALPALTPGTLLAVEQ
FT                   AGAYGFAMASNYASSLRPAEVVVAGGEVRLARRRETPDDLVQLEL"
FT   gene            156021..157358
FT                   /locus_tag="Trad_0135"
FT   CDS_pept        156021..157358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0135"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG0446 NAD(FAD)-dependent dehydrogenase;
FT                   InterPro IPR013027:IPR004099:IPR016156:IPR016040; KEGG:
FT                   ttj:TTHA1835 NADH oxidase; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; pyridine
FT                   nucleotide-disulphide oxidoreductase dimerisation region;
FT                   SPTR: Q5SH95 NADH oxidase; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase; Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13277"
FT                   /db_xref="GOA:D7CXF3"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXF3"
FT                   /protein_id="ADI13277.1"
FT                   /translation="MRPQRLVVVGGVAGGMSAAAKAKRQNPALEVTVFERNAYISYGAC
FT                   GLPYATSGVVPNLQRLIARTPAAMRARGVDVRVRHEVTEVDGERRCVKGRNLETGEAFC
FT                   APYDALVLATGALPVCPQVPGRALPGVHVMRRLEDAAALREAIAAGATRAVVVGGGYIG
FT                   LEMVEALVTAGLDVRVLERQAGLLLPFGPKPAELALEEVTARAEVVLAAELLGFEGRGR
FT                   LERVVTSAGTFPADVALVAVGVRPNNALARALGLRLGPAEAVLTDAQLRTDRDGVFAVG
FT                   DLTAAHHRVTGRPAWIPLGDTANRQGRVAGTVIGGGDARFRGIVGTAITKVFERAFATT
FT                   GLTLAEAQRHGLSARETQITTTDHASYYPGHRPLHVTLVWEEGTGRLLGGQLVGYGDAV
FT                   KRIDVLAALLFRQGTLQDLADLDFAYAPPFSNVWDPLAVAANAALG"
FT   sig_peptide     156021..156086
FT                   /locus_tag="Trad_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            157409..157915
FT                   /locus_tag="Trad_0136"
FT   CDS_pept        157409..157915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0136"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_3476 anti-sigma-factor antagonist;
FT                   SPTR: A5UYY1 Anti-sigma-factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13278"
FT                   /db_xref="GOA:D7CXF4"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXF4"
FT                   /protein_id="ADI13278.1"
FT                   /translation="MNRQLRRANERSDKRREREQERRKEARRAARVVPAPRKNAATPEA
FT                   APKTRPAPGTLRQGLSLAYLVLVVGILLAQAFVPQRTDPFSLFVHALFYVIFGYFLALQ
FT                   LFRRGVARAGPVTVVAGLLLAALVEAAKLLTGAGAPEAVLVALALPGLLLGAWLGGFVH
FT                   RQEGR"
FT   gene            158143..159510
FT                   /locus_tag="Trad_0137"
FT   CDS_pept        158143..159510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0137"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterPro IPR015590:IPR016161:IPR016162:IPR016160; KEGG:
FT                   rmr:Rmar_2008 aldehyde dehydrogenase; PFAM: Aldehyde
FT                   Dehydrogenase; SPTR: D0MKH7 Aldehyde Dehydrogenase; PFAM:
FT                   Aldehyde dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13279"
FT                   /db_xref="GOA:D7CXF5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXF5"
FT                   /protein_id="ADI13279.1"
FT                   /translation="MALVSTNPATGETLAHYPVMSAAEVQEAIAEAHAAFEVWRTWPVR
FT                   RRAEPMRRAALLLRDEVAAQARLISEEMGKPIKQARAEVEKCAWVCDYYAEHAEALLAP
FT                   QRVQTDAYKSFVSYRPLGVVLAVMPWNFPLWQTFRFAAPSLMAGNGALLKHAPNVTGCA
FT                   LATEALLRRAGFPEGLFRALRIEVDQVEGVLDHPHVVAATLTGSTRAGAAVAALAGARL
FT                   KKTVLELGGSDPYVILEDAELELAVEACAVGRLQNSGQSCIAAKRFIVVAPLVERFTER
FT                   LVARFRACCMGDPRDEATELGPQAREDLREALHRQVTRSVEAGAELLLGGTLPEGPGYF
FT                   YPATVLGGVRPGMPAFDEETFGPVAAIVRAEDEEEAIALANRSPYGLGAAVFTRDRSRG
FT                   ERIAEERLEAGSCFVNAFVRSDPRLPFGGIKRSGYGRELAAFGIHEFVNVKTVYVA"
FT   gene            159755..160504
FT                   /locus_tag="Trad_0138"
FT   CDS_pept        159755..160504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0138"
FT                   /product="cyclase/dehydrase"
FT                   /note="COGs: COG5637 integral membrane protein; InterPro
FT                   IPR005031; KEGG: dra:DR_2377 hypothetical protein; PFAM:
FT                   cyclase/dehydrase; SPTR: Q9RRV8 Putative uncharacterized
FT                   protein; PFAM: Polyketide cyclase / dehydrase and lipid
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13280"
FT                   /db_xref="GOA:D7CXF6"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXF6"
FT                   /protein_id="ADI13280.1"
FT                   /translation="MCSPLETSTYQRGLHVSYEDYKRTYGQDYGQTYGQSYGQSYGQYG
FT                   SYNRYDDDDGDTNWTYVVTGTLFIAAGAYLIYKGLSSDDEDHTYTYDTRSEKQSRGKGV
FT                   QVRESIVVNKPVSELYAYWRKLENLPRIMSHLESVTEMGTRSHWKAKGPLGMSPEWDAT
FT                   ITDERKDETISWRSLEGSEVPNEGTVRFIKRGDSSTEILVSLTYHPPLGPVGAAVAKLF
FT                   GEEPSQQIRDDLQNFKQSVESGSLSLV"
FT   gene            complement(160579..163599)
FT                   /locus_tag="Trad_0139"
FT   CDS_pept        complement(160579..163599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0139"
FT                   /product="transcription-repair coupling factor"
FT                   /note="COGs: COG1197 Transcription-repair coupling factor
FT                   (superfamily II helicase);
FT                   InterProIPR014021:IPR001650:IPR004576:IPR003711:IPR
FT                   011545:IPR005118:IPR014001; KEGG: dra:DR_1532
FT                   transcription-repair coupling factor; PFAM: transcription
FT                   factor CarD; DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; TRCF domain protein; SMART:
FT                   DEAD-like helicase ; helicase domain protein; SPTR: Q9RU62
FT                   Transcription-repair coupling factor; TIGRFAM:
FT                   transcription-repair coupling factor; PFAM: Helicase
FT                   conserved C-terminal domain; TRCF domain; CarD-like/TRCF
FT                   domain; DEAD/DEAH box helicase; TIGRFAM:
FT                   transcription-repair coupling factor (mfd)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13281"
FT                   /db_xref="GOA:D7CXF7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXF7"
FT                   /protein_id="ADI13281.1"
FT                   /translation="MSQTLTLTSTRLLGLPAVARLMLFARHEGPAVLLTTTERAPLFEG
FT                   AGVFGAPVSRDPDLSSWHERRDKVVLTLPAALRPFPADPARYTLALTLGRDYPRETLLE
FT                   RLVAFGFERDAMPGFVVRGDTLTLYLDAEDEAKTLRLEFFGDELERLTLGEEGLGSYTL
FT                   APLPHAELGEEAWTSRLLEQLPGVVFLDSSELFAGEAEAAELKWLWAHLGARTVVTFGR
FT                   DPLELPEGERALEPLGYYRGKLRAFAKDAQLWLEGGYSVTLLLRFERTGRYLLEKVLGD
FT                   LDAGWEPSVRAHPGRLGLTVGAETRGGFRDPEAREIVLTEDLLYGYQGARAGGGKKLAG
FT                   RRVQDAVQLSAGDYLIHPDHGIGRFMGLEPRQVLGVTRDYLILQYAGAGKLYLPVEQLP
FT                   LLRRHPGTTDDPPRLSTLGTNEWARARERARVGAQELALKLIRTYAERQLQQGLAMPAN
FT                   PEWDPLIDENCPFELTPDQKSATQAVLHDMARPVPMDRLISGDVGFGKTEVAIRAAHRA
FT                   VGHGKQVAMLVPTTVLAKQHFETFAERFAGLPVVVELLSRFSTDKEARDILAGLKAGTI
FT                   DVVIGTHRLLSEEVAFKDLGLLIVDEEHRFGVGQKERMKAMKANLDVLSLSATPIPRTL
FT                   YMSLVGLRDVSQIMTPPAGRKPIQTVLQPFDPMVAREAVMFELERGGKVFYIHDRVGSM
FT                   GAKALWLQKLVPEARIGVAHGQMSGDELEEVMLNFQGGAYDVLLATTIVESGLDVAGAN
FT                   TLLIERADKLGLAQLYQLRGRVGRRSTEAWAYLLYPGRLTEGAQRRLFALAELNDLGSG
FT                   HLLAEKDMEIRGVGNLLGPEQHGHISAVSLEVYTEMLAEEIAKLKGETQEAPQAVAIDL
FT                   NLDARLSPSYIADDDARIAFYGRLAETTSLAEVARVQREMRERYGPLPDEVRTFTELVK
FT                   LRLLAAQKGVVTITEHMTDIQVSFAHENLDYDARKLKTLPFGVEPTRYPPGFSLKKRGL
FT                   RGSEVLGALTDTLYLYA"
FT   sig_peptide     complement(163525..163599)
FT                   /locus_tag="Trad_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(163723..164412)
FT                   /locus_tag="Trad_0140"
FT   CDS_pept        complement(163723..164412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0140"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="COGs: COG0546 phosphatase; InterPro
FT                   IPR006402:IPR006439:IPR005834:IPR005833; KEGG:
FT                   npu:Npun_F0767 HAD family hydrolase; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; SPTR: B4B5M9
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1;
FT                   TIGRFAM: HAD-superfamily hydrolase, subfamily IA, variant
FT                   3; HAD-superfamily hydrolase, subfamily IA, variant 1;
FT                   PFAM: haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   haloacid dehalogenase superfamily, subfamily IA, variant 3
FT                   with third motif having DD or ED; haloacid dehalogenase
FT                   superfamily, subfamily IA, variant 1 with third motif
FT                   having Dx(3-4)D or Dx(3-4)E"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13282"
FT                   /db_xref="GOA:D7CXF8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXF8"
FT                   /protein_id="ADI13282.1"
FT                   /translation="MGHPKAVLLDVDGTLVDSNDAHARAYVDALKAYGYDVPFEKVRPL
FT                   IGMGGDKLLPQVIDVESDAPLREEIDARRGEIFKSRYLPDIKPFPGVRELLERLRRDGL
FT                   TLVAASSAKEDEADALLERAGVADLIDARTSSDDAENSKPDPDILQAALERAGVSAQEA
FT                   LLLGDTPYDLQAAAPLGLGVVALRCGGWRDEDLLGALAVYDDPQALLAGYDASPLAPEP
FT                   ASAPGDV"
FT   gene            complement(164977..165804)
FT                   /locus_tag="Trad_0141"
FT   CDS_pept        complement(164977..165804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0141"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="COGs: COG0313 methyltransferase; InterPro
FT                   IPR008189:IPR000878:IPR014777; KEGG: dra:DR_0636
FT                   hypothetical protein; PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; SPTR: Q9RWN0 Putative
FT                   uncharacterized protein; PFAM: Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylases; TIGRFAM: conserved
FT                   hypothetical protein TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13283"
FT                   /db_xref="GOA:D7CXF9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXF9"
FT                   /protein_id="ADI13283.1"
FT                   /translation="MAKLTLVPTPIGNLEDVTLRALRVLREADAVAAEDTRHSGKLLAH
FT                   FGISKPLERLDAHTIPARAPALLGRYAHLAFVTDAGTPGLSDPGAELVRLALAAGHEVE
FT                   VLPGPTALIPALVLSGLPLGSFAFEGFLPRKGAARRERLAAIAASDRTVALYESPKRLL
FT                   ATLNDLAAVCGEARAVSVSRELTKRFEATYRGTLGAVAAQLAALGEVRGECVVVVGPRE
FT                   RGAESPHVDFAAAAARLAASGLSGRALRAALEAAGAPRNVAYALTLERANESG"
FT   sig_peptide     complement(165709..165804)
FT                   /locus_tag="Trad_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(165818..166015)
FT                   /locus_tag="Trad_0142"
FT   CDS_pept        complement(165818..166015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dge:Dgeo_1639 hypothetical protein; SPTR:
FT                   Q1IXV0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13284"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXG0"
FT                   /protein_id="ADI13284.1"
FT                   /translation="MRAFKGRVERGVVVLPEGADLPEGTIVTVTVGEVEMIRARMRAAL
FT                   IRNAKRRSRGRVTNPDVVGV"
FT   gene            complement(166002..166448)
FT                   /locus_tag="Trad_0143"
FT   CDS_pept        complement(166002..166448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dge:Dgeo_1640 hypothetical protein; SPTR:
FT                   Q1IXU9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13285"
FT                   /db_xref="GOA:D7CXG1"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXG1"
FT                   /protein_id="ADI13285.1"
FT                   /translation="MNYAALLALLAALAFVSPFLVNLATQVGVPRGFGIVTTLTVGVFI
FT                   VAWAVVRQRVERHQRLEARIALLQARRRTAPHDPRGYFSEGEHLGDLLTEAGRPREALR
FT                   VFEAYARLLQTLPEREGERAVTEAVIAKLRRELAEREEEHGASV"
FT   sig_peptide     complement(166347..166448)
FT                   /locus_tag="Trad_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(166609..166857)
FT                   /locus_tag="Trad_0144"
FT   CDS_pept        complement(166609..166857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ddr:Deide_22810 hypothetical protein; SPTR:
FT                   C1D044 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13286"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXG2"
FT                   /protein_id="ADI13286.1"
FT                   /translation="MPWPSLTEVRHAHLRARFAERSAEWHLVIKEYLFCLEAAECAQDV
FT                   RAIRFFALRLAHAYRTIGMPHKAERYRELGAVPTELR"
FT   gene            167118..168002
FT                   /locus_tag="Trad_0145"
FT   CDS_pept        167118..168002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0145"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.3.1.34"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro
FT                   IPR002198:IPR002347:IPR016040:IPR017441; KEGG:
FT                   hau:Haur_0971 short-chain dehydrogenase/reductase SDR;
FT                   PFAM: short-chain dehydrogenase/reductase SDR; SPTR: C1XPG8
FT                   Putative uncharacterized protein; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13287"
FT                   /db_xref="GOA:D7CXG3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXG3"
FT                   /protein_id="ADI13287.1"
FT                   /translation="MTGNEASSEPREVFSRDLLRDKVVLITGGGTGLGRAMGERFLALG
FT                   ASLVITGRREGVLREAAEAMAAATGGAVLPVSGDVRDPERVAATLDAAYERFGRVDALV
FT                   NNAAGNFISPTERLSHRAVDAVLGIVLHGTFYYTLELGKRWIGAGRGGVVLNIATTYAT
FT                   SGSGYVVPSAAAKAGVVAMTKSLAAEWGKYGIRLNAIAPGPFPTEGAWSRLMPTPQIQA
FT                   LFEKRVPLRRVGEHLELANLAAYLLSDAAAFITGDLIAIDGGESAWNGGEFNILDELTP
FT                   EQWDALAAARSRS"
FT   gene            complement(167999..169786)
FT                   /locus_tag="Trad_0146"
FT   CDS_pept        complement(167999..169786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0146"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001910; KEGG: pdi:BDI_1655 putative
FT                   nucleoside hydrolase; SPTR: C4CYY6 Inosine-uridine
FT                   nucleoside N-ribohydrolase; PFAM: Inosine-uridine
FT                   preferring nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13288"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXG4"
FT                   /protein_id="ADI13288.1"
FT                   /translation="MHVSNANRVRVGRRLAAACLSLGMIASLAACAGAGPQTAPPLEVT
FT                   ATRTLSVVVSSSGDDAENRADGTITFISPDLELGLKRGQPQTVGLRFTGVQLPRGAKIR
FT                   RAYVQFTADEAHSAPARVTIRAEATGSAKPFRAAHHNLAYRAKTRARVVWTPLPWTRAG
FT                   EAGAAQRTPDLAAVLQEVVDRPDWRSGGSVALLFQGHSGLRVARAFDRHPNAAPRLVIE
FT                   LGGGSQSVAARGVPVIFDTDLGIDVDDAGALAVLHALADRGEARLLATIANVNDPYAAA
FT                   ALGAINTFYGRPDVPVGRNPRPQYAVATPYWRTFAPRFVKDLAERFPHNTAPNPEAAVA
FT                   VYRRVLAAQPDSSVTLIAVGFLQNLADLLASSPDRYSGLSGEALVRRKVRQLVVMAGTH
FT                   PGSSRDLYLRGGAGDDAGAGHEGAGNVAHPGRLHPGERLRGLRHRTHARSQHPAGKPRA
FT                   RRLHPVFRPGGRRPQLVGPVHGPLRRARHGAPGGRHLLRARRPRSAAPEPRRRQRLARP
FT                   RQRPPPAALPRDRADRAAAPARGAAHRAAQRPLSTSRLPFRASAFFALSITAETYFLPD
FT                   APSCGASRSSWAKAPPKDT"
FT   sig_peptide     complement(169685..169786)
FT                   /locus_tag="Trad_0146"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(169996..172728)
FT                   /locus_tag="Trad_0147"
FT   CDS_pept        complement(169996..172728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0147"
FT                   /product="aconitate hydratase 1"
FT                   /EC_number="4.2.1.3"
FT                   /note="COGs: COG1048 Aconitase A;
FT                   InterProIPR006249:IPR001030:IPR000573:IPR015928:IPR
FT                   015931:IPR015932:IPR018136; KEGG: ddr:Deide_07920 putative
FT                   aconitate hydratase (citrate hydro-lyase) (aconitase);
FT                   PFAM: aconitate hydratase domain protein; SPTR: C1D1D2
FT                   Putative aconitate hydratase (Citrate hydro-lyase)
FT                   (Aconitase); TIGRFAM: aconitate hydratase 1; PFAM:
FT                   Aconitase C-terminal domain; Aconitase family (aconitate
FT                   hydratase); TIGRFAM: aconitate hydratase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13289"
FT                   /db_xref="GOA:D7CXG5"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXG5"
FT                   /protein_id="ADI13289.1"
FT                   /translation="MALTPKNTFGAKATLELGSSRLAYYRLDKLQELGLGDVAKLPFSI
FT                   KVLLESLLRNENGYDVTEEDVKRLAAYDAKRPAEVEIPFKPARVILQDFTGVPAVVDLA
FT                   ALRSAMQRMGGDPQAINPQIPVDLVIDHSVQVDEYDSPFALANNAAIEFERNRERYEFL
FT                   RWGQQAFRNFSVVPPASGIVHQVNLEYLAKGVQVGKQGDDEVIYPDSLVGTDSHTTMIN
FT                   GLGVVGWGVGGIEAEAVMLGQPIYMLTPEVIGFKLTGKLPEGSTATDLALVVTQMLRRH
FT                   GVVGKFVEFYGSGLSSMSLPDRATIANMAPEYGATMGFFPVDDETLRYLRQTGRLDDEV
FT                   EAVERYCKAQGLFRTDDTPDPVFQETLELDLGTVQPSLAGPKRPQDRVLLSDMKRAWRE
FT                   GLQAPPEKRGFGLRDAQLTKTATLRMKGQELRLKHGDVVIAAITSCTNTSNPSVMLAAG
FT                   LLAKKAVEAGLEVKPYVKTSLAPGSKVVTEYLDDTGLTPYLEQLGFYTVGYGCTTCIGN
FT                   SGPLPEPVVEAIHEGDLVAASVLSGNRNFEGRINPHVRANYLASPPLVVAYAIAGTVDI
FT                   DLTTEPLGKGKDGRDVYLRDIWPSFKDITEGMNRAITPEVFKRMYEGIERSNEMWNQIP
FT                   VKGGDLFEWDRESTYIQEPPFFEEMTMELTPIAPIEGARVLVKVGDSVTTDHISPAGAI
FT                   GRDTPAGKYLIERGVDPKDFNSYGSRRGNDRVMTRGTFANIRLKNQMAPGTEGGYTTYL
FT                   PTGEVMSIYDASLRYGETKTPTIVLAGSDYGMGSSRDWAAKGTFLLGVKAVIAESFERI
FT                   HRSNLVGMGVLPLQYVEGQSAETLGLSGHEVFTIHVTDAVKPKERLTVTARRDDGSEVR
FT                   FEVVCRLDTPVEVDYYRNGGILQTVLRGILQRQKAGAQA"
FT   gene            172929..173564
FT                   /locus_tag="Trad_0148"
FT   CDS_pept        172929..173564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR011991; KEGG: ddr:Deide_22910
FT                   hypothetical protein; SPTR: C1XNB4 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13290"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXG6"
FT                   /protein_id="ADI13290.1"
FT                   /translation="MRWVSGREAAAALTDPRTLRQLEPFLARECSVSQAAKETHTKPNT
FT                   MLARVRRFLALGLLEVAREVPRKGRPVRLYRTVADAFFVPYEATSAESLEAAMRERDAY
FT                   WEELLRANVVRARLEDAPRNGGNWGTRIYRDARGRLQVQAAVTPDENYTLLGPERPAAL
FT                   SSWRDSVYLDFEDAKALQRELFFLLKRYQQKRGAQRYILRVAMAPILE"
FT   gene            173641..174093
FT                   /locus_tag="Trad_0149"
FT   CDS_pept        173641..174093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0149"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chl:Chy400_2463 ABC-type sugar transport
FT                   system periplasmic component-like protein; SPTR: A6NX25
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXT1"
FT                   /protein_id="ADI13291.1"
FT                   /translation="MTPAALRPIRLGLAALCAALALAACAPRAGAPAPTQTPAPRPAPE
FT                   TPTAPPEREAPGETIVLTDPVALETDRAAREAFHLMELAYLETGAYSANILLAELTLPS
FT                   GVRWMLEDLSETSYTLRITADALPTVAWFVTPEGVVARQVEDNRIR"
FT   sig_peptide     173641..173733
FT                   /locus_tag="Trad_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(174418..174750)
FT                   /locus_tag="Trad_0150"
FT   CDS_pept        complement(174418..174750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0150"
FT                   /product="thioredoxin"
FT                   /note="COGs: COG3118 Thioredoxin domain-containing protein;
FT                   InterProIPR017936:IPR005746:IPR013766:IPR006662:IPR
FT                   012336:IPR012335:IPR017937; KEGG: dge:Dgeo_1837
FT                   thioredoxin; PFAM: Thioredoxin domain; SPTR: Q1IXA2
FT                   Thioredoxin; TIGRFAM: thioredoxin; PFAM: Thioredoxin;
FT                   TIGRFAM: thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13292"
FT                   /db_xref="GOA:D7CXT2"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXT2"
FT                   /protein_id="ADI13292.1"
FT                   /translation="MAETVEFTDSNFRDETQTGLVLVDFWAPWCGPCRMVGPVIEELAS
FT                   DYAGKVKVGKLNVDDNQQTAMQFRVMSIPTVILFKDGEPVETMIGAQPKSAYQARLEKH
FT                   VTSLVS"
FT   gene            complement(174816..175952)
FT                   /locus_tag="Trad_0151"
FT   CDS_pept        complement(174816..175952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0151"
FT                   /product="amidohydrolase"
FT                   /note="COGs: COG0402 Cytosine deaminase and related
FT                   metal-dependent hydrolase; InterPro IPR006680; KEGG:
FT                   ttj:TTHA0872 amidohydrolase family protein; PFAM:
FT                   amidohydrolase; SPTR: C1XT71 Cytosine deaminase-like
FT                   metal-dependent hydrolase; PFAM: Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13293"
FT                   /db_xref="GOA:D7CXT3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXT3"
FT                   /protein_id="ADI13293.1"
FT                   /translation="MRILSAEVVYTGLGTPIRGGAVVLQGERVAAILSREDARRFYPEA
FT                   PVTDVGFAISPPPVNAHTHLDLSSLPPFRGPYEDFVRHVIRHKRARGVAAADAGLAELQ
FT                   RAAPLAFGDIVADEAAMRKLLQTPGLRGVAYWEVFAPDPAEAEAAFSETVARLRAFRRL
FT                   ERPDGLKLGLSPHTPHTVSAPLLQRLTRLAIAERLPLQIHVAESPAEAALHRDGSGPLF
FT                   ELMRPFLGDWRPSGLSPVQYLARLGVLEARPTLVHMVHVGEEDVRTVAKAGCTVVHCPR
FT                   SNEALRCGRLPWELLAKHSVEVAFGTDSKGSAPDLDVTREVAAARALHGAKASPIALVR
FT                   AAVKGGSRALGLTPPRFGRGSPARALYVWQTPSAEPRV"
FT   gene            complement(175971..176240)
FT                   /locus_tag="Trad_0152"
FT   CDS_pept        complement(175971..176240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0152"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH0735 hypothetical protein; SPTR: Q9KEW4
FT                   BH0735 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13294"
FT                   /db_xref="GOA:D7CXT4"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXT4"
FT                   /protein_id="ADI13294.1"
FT                   /translation="MDHRDPYVSDAPRGARGGFDVISVGNWLLTLVLLAIPLVNLVALL
FT                   YWAFAGAVHPSKRTFAQAGLILTVISASFYLLLLFTGTAVPLTP"
FT   gene            complement(176261..176566)
FT                   /locus_tag="Trad_0153"
FT   CDS_pept        complement(176261..176566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0153"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001395; KEGG: bha:BH1011 oxidoreductase;
FT                   SPTR: Q9KE47 Oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13295"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXT5"
FT                   /protein_id="ADI13295.1"
FT                   /translation="MKRNRLGQGDLWVSELGFGCMSLSLDHAREALQTRGSRSRTTAQL
FT                   ALRYLLAHPAVAQLEENAQAARVTRSEAERRSLQGAARALTDTQHRLARCTTRTRP"
FT   gene            complement(176576..177142)
FT                   /locus_tag="Trad_0154"
FT   CDS_pept        complement(176576..177142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0154"
FT                   /product="protein of unknown function DUF820"
FT                   /note="COGs: COG4636 conserved hypothetical protein;
FT                   InterPro IPR008538:IPR012296; KEGG: ttj:TTHA1553
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF820; SPTR: Q1NRE5 Putative uncharacterized protein;
FT                   PFAM: Protein of unknown function (DUF820)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13296"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXT6"
FT                   /protein_id="ADI13296.1"
FT                   /translation="MGEAALKLKPLSSEDYLELEAASAVKHEFVDGQVYALAGATDRHN
FT                   RIVTNLTGHLWLATRRGPCRVYSSDMKLRIATGPSERFYYPDVMVTCSESDTHDLYKVA
FT                   PCLLAEVTSPSTAATDHREKLMAYQRLPELRDYLIVSAEERLVERYRRDPEEGWWYHEY
FT                   REQATLTLPYLNLTLTLDDVYEGVL"
FT   gene            complement(177158..178306)
FT                   /locus_tag="Trad_0155"
FT   CDS_pept        complement(177158..178306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0155"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1060 Thiamine biosynthesis protein ThiH;
FT                   InterPro IPR020050:IPR005244:IPR007197:IPR013785; KEGG:
FT                   tth:TTC0727 biotin synthase/thiamine biosynthesis enzyme;
FT                   PFAM: Radical SAM domain protein; SPTR: C1XJJ8 Putative
FT                   uncharacterized protein; PFAM: Radical SAM superfamily;
FT                   TIGRFAM: radical SAM domain protein, CofH subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13297"
FT                   /db_xref="GOA:D7CXT7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022431"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXT7"
FT                   /protein_id="ADI13297.1"
FT                   /translation="MNLLAKAASGARLSADEATALYHLPLFELAAAAHAVRSQRTDPEV
FT                   VSYLIDRNINYSNVCTVGCAFCGFYRTRRQADAYVLSYEEVSAKVLELEAVGGTRILMQ
FT                   GGVHPTLPFSWYTGLLEHLKQRHPRIRLEAFSPEEIRGMAKLTGMPSLEVLKALQAAGL
FT                   DGLPGGGGEMLVDEVRHARHISPARISAGDWIRIMDEAQSLGLYTTATMVIGFGETHAQ
FT                   RVASMQRVRDQQDKALASYGNGFSAFISWTLQTEGVRVHGKVPGAGAHEYLQNLAVSRL
FT                   FLDNIPNFQASWPTMGHKVAQTALFFGANDYGSTMLEENVVSQAGAKHRRVNEREIIRQ
FT                   ITEAGFRPVQRDSLYNVVRVPDAAAILAQKPEVDFGALEAAF"
FT   sig_peptide     complement(178202..178306)
FT                   /locus_tag="Trad_0155"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            178693..180594
FT                   /locus_tag="Trad_0156"
FT   CDS_pept        178693..180594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0156"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="COGs: COG0747 ABC-type dipeptide transport system
FT                   periplasmic component; InterPro IPR000914; KEGG:
FT                   rlg:Rleg_6804 extracellular solute-binding protein family
FT                   5; PFAM: extracellular solute-binding protein family 5;
FT                   SPTR: Q2CJJ0 Oligopeptide ABC transporter, periplasmic
FT                   oligopeptide-binding protein; PFAM: Bacterial extracellular
FT                   solute-binding proteins, family 5 Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13298"
FT                   /db_xref="GOA:D7CXT8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXT8"
FT                   /protein_id="ADI13298.1"
FT                   /translation="MAKLKACLLAISLVVACQIALAQDEEPEAPPLQELPREQTLILQN
FT                   PEGTIRNPGWFNLWVSGAGGGLSTGLQQLMMDTFWYIDPNQGIDGPNYNSLATGPAEYN
FT                   DDYTEMTVRLREGVYWSDGVEFTADDVVYTVETQMNTPGMGWSGAFSQQVERVEALDDY
FT                   TVRFTLNAPNSRFHSIFSVRWNGAWIMPKHIFEEVDNVLEYDFNPPVGLGPYTLHSFDP
FT                   NGDWYIWEKREDWDRTAMAEFGEPAPQYVIYRNGGPTDRRLIEMRNGNLDVVHDLTPEG
FT                   MFAIVQQDPTARGWFSGFPYAHPDPTLPMVIFNHQNEKFQDRRVRWALTLMLDARALSM
FT                   ASYRGAATLTAIAIPPTGTHPDDYHIPMQEWVSNFTLEAGGQAFQPYNPDLTLQIADMV
FT                   RGQFGDQVPTDEDEIRRAFGYGWWEQNLEAAAALLEEAGFTRRGNDWYMPNGERFSIRV
FT                   MIPPDGVINRLGTMIAQNWSQAGVAAQVEAAPDSWDRQSVGDFEVNIAWSIETWGGHPD
FT                   LSFFLDSWHSQYLAEPGELQPARNWQRWSHPELDRIIEEVRRTDFYDLEANIELGKQFI
FT                   QLMVEEMPVIPIMSYNVFSVVSERYWTGYPTAENPYANPVNNWANSRYILTQLESTQ"
FT   sig_peptide     178693..178758
FT                   /locus_tag="Trad_0156"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            180811..181815
FT                   /locus_tag="Trad_0157"
FT   CDS_pept        180811..181815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0157"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: rlt:Rleg2_5892 binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Q2CJI9 Oligopeptide ABC transporter,
FT                   permease protein; PFAM: Binding-protein-dependent transport
FT                   system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13299"
FT                   /db_xref="GOA:D7CXT9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXT9"
FT                   /protein_id="ADI13299.1"
FT                   /translation="MRAYLWFVAKRALQLLAIVFVGISASFFISHLSPINPVEQTLGRI
FT                   TTRSNISPEAIASLRAALTDMYGVDEPLWNRFVNFWVRFVQGDMGPSLIAFPTPAMTLI
FT                   QRALPWTVGLLSVTVVITWLVGNLLGGLAGYYQNNRLLKAFGVLAMGVQPIPYYIVAFI
FT                   LLIVFGFVWPVLPISGGFAMNVRPGWTPEFVASVIRHAILPATSIVLVGMGLWFLGMRA
FT                   LVSNIITEDYVTYAELAGVKRSRIVGSYVIRNAMIPQLTALAMTLGGVFSGTVITEQVF
FT                   SYPGLGTLLVDAVNGGDYGLVVAVTSVAIIAVAVAIFVVDLIYPILDPRIRVE"
FT   sig_peptide     180811..180885
FT                   /locus_tag="Trad_0157"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            181821..182681
FT                   /locus_tag="Trad_0158"
FT   CDS_pept        181821..182681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0158"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: rle:RL4415 putative transmembrane component of ABC
FT                   transporter; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: Q2CJI8 Oligopeptide
FT                   ABC transporter, permease protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13300"
FT                   /db_xref="GOA:D7CXU0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXU0"
FT                   /protein_id="ADI13300.1"
FT                   /translation="MFSVFKDLLRYNTEFAIGVVLVGVVVVYAGLSFFSSVDPTLMYTV
FT                   MPDMAPSAEHWFGTNSRGQDMFWQLSFAFRNTLVFGLLVVVLSRIISITVGLVSGYLGG
FT                   ATDRALMFVNDIFVALPIFPILVLFYFTMRSDLNTVNLAFLMACLGWPFDARLIRSVAL
FT                   GLRHREFTRHAVFSGMSARKIMFEEHLPYVMPIIFSTAMANLIWAIGLEVTLAVLGFTN
FT                   INIPTVGTTIYWANNHSALVVGVWWWVVIPVVLIVMLFIGLFLLAVSINEYIDPRSRLR
FT                   RMERA"
FT   sig_peptide     181821..181907
FT                   /locus_tag="Trad_0158"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            182683..183714
FT                   /locus_tag="Trad_0159"
FT   CDS_pept        182683..183714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0159"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COGs: COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component;
FT                   InterProIPR003439:IPR010066:IPR013563:IPR003593:IPR 017871;
FT                   KEGG: rec:RHECIAT_PA0000147 probable oligopeptide ABC
FT                   transporter, ATP-binding protein; PFAM: ABC transporter
FT                   related; Oligopeptide/dipeptide ABC transporter domain
FT                   protein; SMART: AAA ATPase; SPTR: Q2CJI7 Oligopeptide ABC
FT                   transporter, ATP-binding protein; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter; Oligopeptide/dipeptide transporter,
FT                   C-terminal region; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13301"
FT                   /db_xref="GOA:D7CXU1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXU1"
FT                   /protein_id="ADI13301.1"
FT                   /translation="MVDDVLTVQNLKAYYQMAYFGVKREVRAVDDITLTVRKNEIYGIA
FT                   GESSSGKTTLIKTFAAAIRPPLRIVGGSVTYNFGGQLIEPNTAKKEEVDKIRWKHLAYI
FT                   MQGSMSVLNPVRRIRHSFEDFALRPMGVAKKEFWQRVEAHLKRLNLSPEVLNAYPHELS
FT                   GGMRQRVTIALATVCRPQFIIADEPTTALDVVVQKDVLAMLRDVQKQMGSSVVFVTHDM
FT                   SVHANMADRIGIMYAGRLVEEGPTRALFTAPKHPYTAHLVASLPRIGDTTQKPALEGQP
FT                   PNLADPPQGCRFHPRCPLAIARCETEVPPLALIGADHRTACWRAADVRPLTTLRPQRAE
FT                   VVS"
FT   gene            183711..184625
FT                   /locus_tag="Trad_0160"
FT   CDS_pept        183711..184625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0160"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1123 ATPase components of various ABC-type
FT                   transport systems contain duplicated ATPase; InterPro
FT                   IPR003439:IPR003593:IPR017871; KEGG: rle:RL4413 putative
FT                   ATP-binding component of ABC transporter; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: Q2CJI6
FT                   Oligopeptide ABC transporter, ATP-binding protein; PFAM:
FT                   ABC transporter; Oligopeptide/dipeptide transporter,
FT                   C-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13302"
FT                   /db_xref="GOA:D7CXU2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXU2"
FT                   /protein_id="ADI13302.1"
FT                   /translation="MSTLLDVSHVSKRFSMGGILSRKYTDAVVDVSFSLQADHPEIFTI
FT                   IGESGSGKTTLARMILGLETPSHGTITFAGKSTSEWKRRAARSDFMRRVQPVFQNPFEA
FT                   FNPLKQVDRYLEATARRLLGATERKAVDAAMDEALQKVGLSLKEIKGRFAHELSGGQLQ
FT                   RVAIARALIPNPSLLIADEPVSMVDASLRMSIVNLLKRLRDDLNVSVIYITHDLATAYY
FT                   ISDRIIIMQKGYVVEMGPARAILESPEHAYSQLLKSSVLSIDTAGMGVLEPADRRMTEA
FT                   AWSTMGRGRLEPRPDGRMVRVAA"
FT   gene            184660..186132
FT                   /locus_tag="Trad_0161"
FT   CDS_pept        184660..186132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0161"
FT                   /product="alpha-L-arabinofuranosidase domain protein"
FT                   /note="COGs: COG3534 Alpha-L-arabinofuranosidase; InterPro
FT                   IPR010720:IPR017853; KEGG: rrs:RoseRS_3514
FT                   alpha-N-arabinofuranosidase; PFAM:
FT                   alpha-L-arabinofuranosidase domain protein; SMART:
FT                   alpha-L-arabinofuranosidase domain protein; SPTR: A5UZ19
FT                   Alpha-N-arabinofuranosidase; PFAM:
FT                   Alpha-L-arabinofuranosidase C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13303"
FT                   /db_xref="GOA:D7CXU3"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXU3"
FT                   /protein_id="ADI13303.1"
FT                   /translation="MSNTIAIDPLRTLGRLERNVFGGFAEHLGRCIYGGLYDPNSPHAD
FT                   ASGLRTDVLDALKRLNMPVMRYPGGNFVSGYRWRDGVGPKAERPARTELAWHDVEPNTF
FT                   GTNEFVDFCRRLGTEPYLVVNAGDGDMREARDWLEYCNGTQDTALVKLRRAHGYEAPHG
FT                   VRYWGIGNEVDGPWQIGYKTPEEYARTYTEFAKVMKWTDPSVKLVASGISAWDASAVER
FT                   VKLLMEHAAAHIDYLAIHWYVGNDAQRGYRDDDFASYMALSERIEDMLVATEGVLRAMS
FT                   RALRLGREVAIAVDEWNVWYRTGNEEKLEEVYNLEDALMTGIQLNALIRHARSVKMANL
FT                   AQVVNVIAPILTRPDGLVLQSIFYPFELYSRFARGVALDVYWAGDTFSTPEHTGLRVLD
FT                   VAATLDESAKELAVFVVNRSLEAREATLSLGTRASGAKAFVVNGPDIKATNTFEAPDRV
FT                   GVRETGLEVDGDTLTYTFEPHSVTVLSVALEP"
FT   gene            186223..187911
FT                   /locus_tag="Trad_0162"
FT   CDS_pept        186223..187911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0162"
FT                   /product="L-ribulokinase"
FT                   /EC_number="2.7.1.16"
FT                   /note="COGs: COG1069 Ribulose kinase; InterPro
FT                   IPR005929:IPR018484:IPR018485:IPR018483; KEGG:
FT                   hau:Haur_3662 ribulokinase; PFAM: Carbohydrate kinase,
FT                   FGGY-like; SPTR: A9B687 Ribulokinase; TIGRFAM:
FT                   L-ribulokinase; PFAM: FGGY family of carbohydrate kinases,
FT                   N-terminal domain; FGGY family of carbohydrate kinases,
FT                   C-terminal domain; TIGRFAM: L-ribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13304"
FT                   /db_xref="GOA:D7CXU4"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXU4"
FT                   /protein_id="ADI13304.1"
FT                   /translation="MLKETLIETYTLGLDYGTESGRALLVRVSDGAEVATAVYPYKDGV
FT                   LDRALPDGTPLPPDWALQNPDDYLDVLKNAVPAVLKESGVAPDAVVGVGIDFTSCTMLP
FT                   TLRDGTPLCRLGDLRGNPHAWVKLWKHHAAQPQADRINEVARARGEPWLGRYGGKISSE
FT                   WFFSKALQILEEAPEVYARAERLIEAADWLVWQLTGVETRSACTAGYKAMVQDGSFPSP
FT                   EYFAALHPDFRDVVDEKMSRELLPLGAKAGGLSEAAAAWTGLKPGTPVAVANVDAHVTV
FT                   PATGHVAPGTLVMIMGTSTCHVLVGESLHEVEGMCGVVEGGVVPGAYGYEAGQSGVGDL
FT                   FAWLVKRLAPPEVHDAARAEGVSVHEVLTREAARQRPGESGLLALDWLNGNRSVLVDAE
FT                   LSGLIVGLTLATTPAELYRALLEATAYGTRMIVEAFRGAQVPVTRLVAAGGLPSKNPLL
FT                   MQIYADVLNQEVYLIRSEQGPALGAAMHAAVAAGVYPDIAAAAAKMGGLSETVYRPVPE
FT                   NAAVYERLYADYRVLHDLFGRSGADEPGGVMKRLRSLRREARRAG"
FT   gene            187908..188774
FT                   /locus_tag="Trad_0163"
FT   CDS_pept        187908..188774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0163"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="COGs: COG0451 Nucleoside-diphosphate-sugar
FT                   epimerase; InterPro IPR001509:IPR016040; KEGG:
FT                   ttr:Tter_1321 NAD-dependent epimerase/dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; SPTR: D1CBR3
FT                   NAD-dependent epimerase/dehydratase; PFAM: NAD dependent
FT                   epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13305"
FT                   /db_xref="GOA:D7CXU5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXU5"
FT                   /protein_id="ADI13305.1"
FT                   /translation="MTLAELKVVVTGSSGRAGRAVVRGLKEQGLEVLGVDRVKPLEDPG
FT                   VPTLQADLTDLGETLEVLKGADAVVHLANIPAPGIFPPGRTFVENTVMNYNVFSAAVDV
FT                   GLGRVVWASSETTLGLPFDTPPRYAPVDEAHYPVPESSYALSKVASETLAEQFARWSGV
FT                   PFIGLRFSNILSEREYRTFPETCWRDPAARKWNLWGYVDERDVALACRLSLTAHVTGAD
FT                   ALIIAANDTVMNRPSRELMAEVFPGVPVADDLPEYGTLLSVERARRTLGYEPAHSWREV
FT                   LEGERVG"
FT   gene            188774..189406
FT                   /locus_tag="Trad_0164"
FT   CDS_pept        188774..189406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0164"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="InterPro IPR000182:IPR016181; KEGG: dge:Dgeo_1160
FT                   GCN5-related N-acetyltransferase; PFAM: GCN5-related
FT                   N-acetyltransferase; SPTR: Q1IZ77 GCN5-related
FT                   N-acetyltransferase; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13306"
FT                   /db_xref="GOA:D7CXU6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXU6"
FT                   /protein_id="ADI13306.1"
FT                   /translation="MDAKPQPAPGFSLRSYHPEDLGAVYRICLETGDTGEDATHLYRDP
FT                   ELLGHLYAGPYVTLEPELAFVLEDAAGVCGYVLGARDSSAFYARLEAEWFPPLRARYPE
FT                   PEGDPDTWTRDEHLITHLYTAPPQDEALFGRYPSHLHIDLLKRAQGRGNGRALMAALFA
FT                   ALRAQGSPGVHLGTSPQNVRAERFYRKLGFRELKREPPYTLVMGRGL"
FT   gene            complement(189497..191029)
FT                   /locus_tag="Trad_0165"
FT   CDS_pept        complement(189497..191029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0165"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /EC_number="5.4.2.-"
FT                   /note="COGs: COG0696 Phosphoglyceromutase;
FT                   InterProIPR005995:IPR011258:IPR006124:IPR017850:IPR 017849;
FT                   KEGG: pth:PTH_2720 phosphoglyceromutase; PFAM:
FT                   BPG-independent PGAM domain protein; metalloenzyme domain
FT                   protein; PRIAM: Phosphoglycerate mutase; SPTR: B7DUE1
FT                   Phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; TIGRFAM:
FT                   phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: Metalloenzyme
FT                   superfamily; BPG-independent PGAM N-terminus (iPGM_N);
FT                   TIGRFAM: 2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13307"
FT                   /db_xref="GOA:D7CXU7"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXU7"
FT                   /protein_id="ADI13307.1"
FT                   /translation="MTTFNPIMLVVLDGFGLAPDGPGNAVSLAHTPNFDRLWRDYPHTT
FT                   LQASGKAVGLPEGQIGNSEVGHLNLGAGRVVMQSLTYIQSLIDDGTFFQNEVSNRAYDL
FT                   PAGAALHLMGLVSRGGVHSDLEHLFALLELAKRRNAAPVYVHAFTDGRDTPPQSGLGYV
FT                   RELQYKIDELGHDIHIASVTGRYYAMDRDNRWERTQRAYEAIVCGRADYRAENAIEAVE
FT                   QAYARGETDEFIQPTLVLRDGAPVEIHDNDSVVFFNFRADRARQLTYALLGDDSWDKFR
FT                   RCRVLHRLTYASLMEYDKELRAPFALELPELKNPLAEVLSRAGKTQYHTAETEKYPHVT
FT                   YFFDAKIEKPFEGETRHLVPSPKVATYDLKPEMSAPELTDATVKRIKEHDDDFILINYA
FT                   NPDMVGHTGVLGAAIKACEAVDEGLGRIIGAVQQKGGVAIILADHGNAEVMIADDGGPH
FT                   TAHTTNPVPFILVGAGDAKLRSGGVLGDVAPTILELMGLEKPAEMTGRSLLE"
FT   sig_peptide     complement(190955..191029)
FT                   /locus_tag="Trad_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(191143..191640)
FT                   /locus_tag="Trad_0166"
FT   CDS_pept        complement(191143..191640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xce:Xcel_1008 hypothetical protein; SPTR:
FT                   D1BK51 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13308"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXU8"
FT                   /protein_id="ADI13308.1"
FT                   /translation="MLTPEPCGPLEVPIAQLVLPFPEALALATADKPLPPPVERVSCSG
FT                   STVHVTLNPEALLPRPLRALAPRVRLELHYLGFAAGVVSFSLVSSVLALPIHRLLNLLT
FT                   AAIPLPPGVSVHKGAAAPELRVDVQALLNRQLSGVTLTELYLHDGDVVMVARIDNVRRP
FT                   PA"
FT   gene            complement(191706..192554)
FT                   /locus_tag="Trad_0167"
FT   CDS_pept        complement(191706..192554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0167"
FT                   /product="protein of unknown function DUF721"
FT                   /note="InterPro IPR007922; KEGG: dge:Dgeo_1621 hypothetical
FT                   protein; PFAM: protein of unknown function DUF721; SPTR:
FT                   Q1IXW8 Zn-finger containing protein; PFAM: Protein of
FT                   unknown function (DUF721)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13309"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXU9"
FT                   /protein_id="ADI13309.1"
FT                   /translation="MKDARSVADLLAEVFKKGGLRRGVRRAEAVLLWPQVVGPEVAKFT
FT                   EAKTLQDGVLIVEVPDSETAMHLSFQRQKFLHVYRAKFGVRDIRDVRFRTGRRASPEAP
FT                   KAPPPEAHPDPKALAELSRYLSAAALPDPLTQSAMRAAKAMLVWRAQRQAEGWAPCTVC
FT                   GALSPPQLKGTLCSTCARYAAAPKVLRASRTLAVAPGSATPLLSDDERAVAAELAKGYL
FT                   ERRLQELLPQTLADPTFRPHLERAARCYLAHQLGKRLEDVGEDDFGYLDARVARALGRW
FT                   G"
FT   sig_peptide     complement(192468..192554)
FT                   /locus_tag="Trad_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(192567..193625)
FT                   /locus_tag="Trad_0168"
FT   CDS_pept        complement(192567..193625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0168"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="COGs: COG1195 Recombinational DNA repair ATPase
FT                   (RecF pathway); InterPro IPR001238:IPR003395:IPR018078;
FT                   KEGG: dge:Dgeo_1620 recombination protein F; PFAM: SMC
FT                   domain protein; SPTR: Q1IXW9 DNA replication and repair
FT                   protein recF; TIGRFAM: DNA replication and repair protein
FT                   RecF; PFAM: RecF/RecN/SMC N terminal domain; TIGRFAM: recF
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13310"
FT                   /db_xref="GOA:D7CXV0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXV0"
FT                   /protein_id="ADI13310.1"
FT                   /translation="MRLLSLQQLNYRNLNTPRVTFGGGVTAIVGRNAAGKSNLLEAVYL
FT                   GLTGELPHGKIAEAVRLGESEGFVSVKLEHGGGLSTVQVGLAPGRKTVRLDGQSVRAFE
FT                   LARVSAAVLITPEDAELVHGPPALRRGYLDTLLSRLSLRYALLQREYTRVVEQRNAALK
FT                   SLPYGDPTLEVWTERFVALGDEITALRERALARVGEVARASYAEISGDDKPLGVSHRAA
FT                   AQGVGLRAALAATQHEERARGVTVVGPHRDDLELTLAGHSVQAYGSRGEARTVALALRV
FT                   AEYTLLQEKLREAPVLLIDDFTAELDASRREFLLQLAARAPQALVSGTEAPPHAAAQLF
FT                   IAGGDVRLERPA"
FT   gene            193818..194051
FT                   /locus_tag="Trad_0169"
FT   CDS_pept        193818..194051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0169"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:alr3165 bacteriorhodopsin; SPTR: Q8YSC4
FT                   Bacteriorhodopsin"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13311"
FT                   /db_xref="GOA:D7CXV1"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXV1"
FT                   /protein_id="ADI13311.1"
FT                   /translation="MDTQTLLIWLYVGLMAAGMLVFWAMSRSPKGVPALEYMVALLIKK
FT                   GLGGKPTHLWVGCRTQAAQRAAVPELMLDASA"
FT   sig_peptide     193818..193919
FT                   /locus_tag="Trad_0169"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            194075..195274
FT                   /locus_tag="Trad_0170"
FT   CDS_pept        194075..195274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0170"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="COGs: COG0675 Transposase and inactivated
FT                   derivatives; InterPro IPR010095:IPR001959:IPR007087; KEGG:
FT                   cyc:PCC7424_1224 transposase, IS605 OrfB family; PFAM:
FT                   putative transposase IS891/IS1136/IS1341 family;
FT                   transposase IS605 OrfB; SPTR: B5W808 Transposase, IS605
FT                   OrfB family; TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   Putative transposase DNA-binding domain; Probable
FT                   transposase; TIGRFAM: transposase, IS605 OrfB family,
FT                   central region"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13312"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS03"
FT                   /protein_id="ADI13312.1"
FT                   /translation="MVILEFKAYGRAEQFVAIDEAIRVTQFIRNKALRYWMDNRGVSKY
FT                   DLNKLCAVLAAEYDFADRLNSQARQAAAERAWSAIARFYDNCKKKVKGKKGYPQFKKNV
FT                   RSVEYKTTGWKLSEDRKSITFTDKCGIGKLKMKGTRDLLFYHPSLIKRVRLVRKADGYY
FT                   IQFAVDADRKEPLEATGKTLGLDVGLQDFYTDSNGHKEPNPRFLRKAEKQIKKLQRRVS
FT                   KKAKGSNNRRKAVKRLARKHLQIQRQRKDHAIKLARCVIQSADLVAYEDLRIRNMVKNH
FT                   GLAKSISDASWYQFRTWLEYFGKVFGRITVAVPPQYTSQACSECGCKVEKTLSTRTHVC
FT                   PHCGYVADRDENAARNILTLGIGTVGHIGTYAWGDSASTEMGETASSASAVAEPRIPRL
FT                   "
FT   gene            195277..195801
FT                   /locus_tag="Trad_0171"
FT   CDS_pept        195277..195801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0171"
FT                   /product="rhodopsin"
FT                   /note="COGs: COG5524 Bacteriorhodopsin; InterPro
FT                   IPR001425:IPR018229; KEGG: cyc:PCC7424_3927 rhodopsin;
FT                   PFAM: rhodopsin; SPTR: B7KKH0 Rhodopsin; PFAM:
FT                   Bacteriorhodopsin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13313"
FT                   /db_xref="GOA:D7CXV3"
FT                   /db_xref="InterPro:IPR001425"
FT                   /db_xref="InterPro:IPR018229"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXV3"
FT                   /protein_id="ADI13313.1"
FT                   /translation="MWSVNPVWSGAAYMAMAMGQATTEVAGRTVFYGRYIDWVVTTPLL
FT                   LLALALTAMYRGPKSKTLIAGLMATDVIMILSGLAADLSEEPMRWVWFVFGCVSFGVIL
FT                   YMIWWPLYDIAKSRGPRHAASFRNVALFLTVLWFVYPISWYIGPSGIGLVDTTTDWFPL
FT                   YRDAVFLQGRL"
FT   sig_peptide     195277..195345
FT                   /locus_tag="Trad_0171"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            196095..196941
FT                   /pseudo
FT                   /locus_tag="Trad_0172"
FT   gene            complement(197059..197430)
FT                   /locus_tag="Trad_0173"
FT   CDS_pept        complement(197059..197430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0173"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /note="COGs: COG0736 Phosphopantetheinyl transferase
FT                   (holo-ACP synthase); InterPro
FT                   IPR002582:IPR004568:IPR008278; KEGG: dge:Dgeo_1927
FT                   phosphopantethiene-protein transferase domain-contain
FT                   protein; PFAM: 4'-phosphopantetheinyl transferase; SPTR:
FT                   C1XXM0 Phosphopantethiene--protein transferase; TIGRFAM:
FT                   holo-acyl-carrier-protein synthase; PFAM:
FT                   4'-phosphopantetheinyl transferase superfamily; TIGRFAM:
FT                   phosphopantethiene--protein transferase domain;
FT                   holo-[acyl-carrier-protein] synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13314"
FT                   /db_xref="GOA:D7CXV4"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXV4"
FT                   /protein_id="ADI13314.1"
FT                   /translation="MIVAIGLDIVELSRIQGVWNRHRDRFLERHFHPEELAYCLRKKDP
FT                   IPSLAARFAAKEAFQKTWPEAHGWRDVWVVRRGDKPSFAFAPTLADALTQRGWRAHLSL
FT                   SHSKEHAAAVVVLEASAAR"
FT   gene            complement(197439..198122)
FT                   /locus_tag="Trad_0174"
FT   CDS_pept        complement(197439..198122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0174"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /note="COGs: COG0120 Ribose 5-phosphate isomerase; InterPro
FT                   IPR004788; KEGG: rca:Rcas_2980 ribose-5-phosphate isomerase
FT                   A; PFAM: Ribose 5-phosphate isomerase; PRIAM:
FT                   Ribose-5-phosphate isomerase; SPTR: C1XT84
FT                   Ribose-5-phosphate isomerase; TIGRFAM: ribose 5-phosphate
FT                   isomerase; manually curated; PFAM: Ribose 5-phosphate
FT                   isomerase A (phosphoriboisomerase A); TIGRFAM: ribose
FT                   5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13315"
FT                   /db_xref="GOA:D7CXV5"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXV5"
FT                   /protein_id="ADI13315.1"
FT                   /translation="MSAEAQKEQAAMSAVAHVESKMVLGLGTGSTAKYATLEIGRRLAA
FT                   GELRDLRAAVTSEATGALARSLGIPVIDLPRGGVDLAIDGMDEVTGTLDAIKGLGGALL
FT                   REKIVEARAARFILIGDASKRVRYLGERAPVPVEVLPFGLEAASRDLEALGCRPVLRLS
FT                   GGRPVTTDNGHHLLDCHFSHPFDPQEVALAISQIPGVLGHGLFLGLAHLAYLASDDGVD
FT                   VLERA"
FT   gene            198258..198731
FT                   /locus_tag="Trad_0175"
FT   CDS_pept        198258..198731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0175"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="COGs: COG1225 Peroxiredoxin; InterPro
FT                   IPR017936:IPR000866:IPR012336:IPR012335; KEGG: ttj:TTHA1300
FT                   bacterioferritin comigratory protein, thiol peroxidase,
FT                   putative; PFAM: alkyl hydroperoxide reductase/ Thiol
FT                   specific antioxidant/ Mal allergen; SPTR: Q5SIR4
FT                   Bacterioferritin comigratory protein, thiol peroxidase,
FT                   putative; PFAM: AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13316"
FT                   /db_xref="GOA:D7CXV6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXV6"
FT                   /protein_id="ADI13316.1"
FT                   /translation="MAAPQRLRVGDDAPPFALPSNRGEQRLSDYAGQWTVLYFYPKDNT
FT                   PGCTQEACDFRDALPGMGAAVLGVSADDVSSHEGFAAAHNLPFPLLSDPDGAVAKRYGA
FT                   YGTKQLYGKTYEGVLRSTFIISPEGKIAEAMYNVKATGHAERVAKRLEALRSA"
FT   gene            198828..201416
FT                   /locus_tag="Trad_0176"
FT   CDS_pept        198828..201416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0176"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="COGs: COG0542 ATPase with chaperone activity
FT                   ATP-binding subunit;
FT                   InterProIPR017730:IPR004176:IPR003959:IPR013093:IPR
FT                   019489:IPR001270:IPR003593:IPR018368; KEGG: ttj:TTHA1487
FT                   ATP-dependent Clp protease, ATP-binding subunit ClpB; PFAM:
FT                   ATPase AAA-2 domain protein; AAA ATPase central domain
FT                   protein; Clp domain protein; Clp ATPase-like; SMART: AAA
FT                   ATPase; SPTR: C1XQZ8 ATP-dependent chaperone ClpB; TIGRFAM:
FT                   ATP-dependent chaperone ClpB; PFAM: AAA domain (Cdc48
FT                   subfamily); C-terminal, D2-small domain, of ClpB protein;
FT                   Clp amino terminal domain; ATPase family associated with
FT                   various cellular activities (AAA); TIGRFAM: ATP-dependent
FT                   chaperone ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13317"
FT                   /db_xref="GOA:D7CXV7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXV7"
FT                   /protein_id="ADI13317.1"
FT                   /translation="MSIMDADRMTDSTLQAMASSQQLARARGHQTITPSHVVLALLADA
FT                   DAPAARLIGRAGGDVGAIKGALEANLARLPQVSGSENQYAAPALGRAFDEADRLAKGWG
FT                   DAFIAADALLVALRRTAGDELKSLPDARALEAAAQEIRGGRTVDSKSAERTFEALERYG
FT                   IDLTQRARDGKLDPVIGRDEEIRRTVQILLRRTKNNPVLIGEPGVGKTAIVEGLAQRIV
FT                   NKDVPEGLQGKRVISLDMGSLLAGAKFRGEFEERLKAVISETVQSKGEVILFMDELHTV
FT                   VGAGKAEGAVDAGNMLKPPLARGELRMIGATTLSEYRQIEKDAALERRFQPIVVDEPSV
FT                   EDTISILRGIKEKYEVHHGVEIADSALVAAATLSHRYIADRQLPDKAIDLIDEAASRLR
FT                   VQLDSLPEEIDALSRRKLQLEIEQQALKREQDAESANRLLRIEEELRAIEDQIHQARSE
FT                   WEAERKLLEELRNAQEERDAVRTQIELAEREYDLNRAAELKYGRLPKLEAQLKELSERL
FT                   AHAKYVSLKVDADEVAEVVSRWTNIPLSRLLESEREKLLRLEAELHKRVVGQDEALTAV
FT                   ADAIRRARAGLSDPNRPIGSFIFLGPTGVGKTETAKALAELLFDTEENLIRLDMSEYME
FT                   RHATARLIGAPPGYIGYDEGGQLTEAVRRRPYSVLLFDEIEKAHPDVFNTLLQLLDDGR
FT                   LTDSQGRTVDFRNTVVIMTSNIGSPQILEASRSGADYESIKRTVFGLLQTHFRPEFLNR
FT                   VDDTIVFHALDRDQVGMIAEIQLQRLRERLAERRMTLTLSAGAKEQLARVGYDPVFGAR
FT                   PLKRAIQQLIETPLSRLIIAGELTEGDDVLVEPGAAGFTFKKQQHAEVLN"
FT   gene            complement(201501..203174)
FT                   /locus_tag="Trad_0177"
FT   CDS_pept        complement(201501..203174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0177"
FT                   /product="Glycerol-3-phosphate dehydrogenase"
FT                   /note="COGs: COG0578 Glycerol-3-phosphate dehydrogenase;
FT                   InterPro IPR006076:IPR000447; KEGG: bid:Bind_0378 FAD
FT                   dependent oxidoreductase; PFAM: FAD dependent
FT                   oxidoreductase; PRIAM: Glycerol-3-phosphate dehydrogenase;
FT                   SPTR: C1XTT3 Glycerol-3-phosphate dehydrogenase; PFAM: FAD
FT                   dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13318"
FT                   /db_xref="GOA:D7CXV8"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXV8"
FT                   /protein_id="ADI13318.1"
FT                   /translation="MNRHAQLQRLQSETFDVLVIGGGATGAGVALDAASRGLKTALVER
FT                   NDFAAGTSSRSTKLIHGGVRYLEQAVKKLDKTQLNLVRDALKERATLLKLAPHLARPLP
FT                   ILTPLYNWWEIPYMMSGLKLYDLLAGRTNLAGSRFVGRSEALTRFPMLRRAGLRGGVLY
FT                   FDGQFDDARMNVALALTAAREGAAVANHVEVTGLLKSGGRLRGAAVRDALTGETWEVAA
FT                   KVVVNATGPFSDAIRQLDDPSAPPMLSASSGSHIVLDGRFSPPETGLLIPQTDDGRVLF
FT                   LLPWLGYTLVGTTDHPAPIEAHPQATEDDIAYILRHVERYFDLPVTRADVRAAWSGLRP
FT                   LVSNPKAADTARLSRDHVLNLAPSGLVTIAGGKWTTYRKMALDTVDAAVRVGGLRAGPS
FT                   RTEALKLVGADSFQPGGAASLERGFGLEPDVAAYLHRAYGDRAPEVAGLAREHPGRLVP
FT                   GHPHLAAEVLYGARFEGAQTATDILARRTRLAFVDQRAALEALPQVVQLLGEALAWDEA
FT                   RARAEMEAARAYLGVGAESPAPPTADTPFTLPADKASGSA"
FT   gene            203533..204306
FT                   /locus_tag="Trad_0178"
FT   CDS_pept        203533..204306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0178"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="COGs: COG2086 Electron transfer flavoprotein beta
FT                   subunit; InterPro IPR012255:IPR014730:IPR014729; KEGG:
FT                   dge:Dgeo_0719 electron transfer flavoprotein beta-subunit;
FT                   PFAM: Electron transfer flavoprotein alpha/beta-subunit;
FT                   SPTR: Q1J0G3 Electron transfer flavoprotein beta-subunit;
FT                   PFAM: Electron transfer flavoprotein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13319"
FT                   /db_xref="GOA:D7CXV9"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXV9"
FT                   /protein_id="ADI13319.1"
FT                   /translation="MKIMTLIRQVPDVEARLRVTGGEVDLSGATLVIDGMDEYGVEAAL
FT                   ELKEGARGEEAVGAEVVVVAVGPRRNEEALRTALAMGADRAVHVETDLALDPIALSQVV
FT                   AELVRREGAELLLLGAQQADWDSQALGPATAERLGWPQLTWTNALTVQGGVLSGRHDVD
FT                   EGSDAFEVPLPAVVTTQQGLNEPRYPTLPNIMKAKRKELRKESLEAFGVRPLLTRVAAD
FT                   VQTKERLGRVVDGKDAAAAAAALVTFLREEAKVSR"
FT   gene            204303..205256
FT                   /locus_tag="Trad_0179"
FT   CDS_pept        204303..205256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0179"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="COGs: COG2025 Electron transfer flavoprotein alpha
FT                   subunit; InterPro IPR001308:IPR014730:IPR014731:IPR014729;
FT                   KEGG: dge:Dgeo_0720 electron transfer flavoprotein, alpha
FT                   subunit; PFAM: Electron transfer flavoprotein alpha subunit
FT                   ; Electron transfer flavoprotein alpha/beta-subunit; SPTR:
FT                   Q1J0G2 Electron transfer flavoprotein, alpha subunit; PFAM:
FT                   Electron transfer flavoprotein domain; Electron transfer
FT                   flavoprotein FAD-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13320"
FT                   /db_xref="GOA:D7CXW0"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXW0"
FT                   /protein_id="ADI13320.1"
FT                   /translation="MILILAEHDGARLRKSAYELVSAARATGREGPVTMLVLGSGVAAV
FT                   ADEAAALAEQVLVADLPELTAYDPELWAAAAAQIATEGEAHTVLVAGSRSGREYSPRLA
FT                   VKLAAPLLEDVIALVGEGDALRAQRGVFLARVTETLQTDAPVVVVSVKPGSFAPAQPAD
FT                   ARGEQYDVELSLPERRVRASDRRSDKTGRVPLTEAEVVVTGGRGLGSAERFAELVEGLA
FT                   DTLGAGVGATRAVVDAGWRPYAEQIGQTGKTVQPNVYVALGTSGAVQHLSGMNKSRYVV
FT                   AVNKDPDAPIFKVTDFGVVGDVTEVVPALIRALKAG"
FT   gene            205280..207874
FT                   /locus_tag="Trad_0180"
FT   CDS_pept        205280..207874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0180"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="COGs: COG0247 Fe-S oxidoreductase;
FT                   InterProIPR017896:IPR004017:IPR009051:IPR012285:IPR 017900;
FT                   KEGG: dge:Dgeo_0874 protein of unknown function DUF224,
FT                   cysteine-rich region; PFAM: protein of unknown function
FT                   DUF224 cysteine-rich region domain protein; SPTR: Q1J008
FT                   Fe-S oxidoreductase subunit (Cysteine-rich domain domain
FT                   enzyme); PFAM: Cysteine-rich domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13321"
FT                   /db_xref="GOA:D7CXW1"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXW1"
FT                   /protein_id="ADI13321.1"
FT                   /translation="MLPLDHQIAFVVYACLTLTLGGWGFYRLYKRVRRGRRATDARFDA
FT                   PLRRLGYALLTTLTQSRTFRDRPRWSTFHAFIFYGFVFYLLVNVVDALEGFTHVTVRST
FT                   TPLGALYNLLADVLSLLVLVGVAALALRRFFLTERRDFRFGARTPLHERVRAGMIPLDS
FT                   AVVSLFIFVHVGSRALAQGAKLHGERDLFQPFSSLLAGLFTPASAEVGLIVGYWGALGS
FT                   ILAFLAYFPYSKHLHIFAAPAKYFVHREGPLGALPPLGTDIEAALEAAAETGETPPLGA
FT                   AKLEDLAWPRLLDAYACIQCNRCQDVCPASATGKALSPAALEINKRMELNALAGSPLIL
FT                   KEAPFEAGAPSPRPLLSFALSPEALWACTTCGACMQVCPVEDEQMLDIIDIRRHQVMVA
FT                   GEVPAPLTTAFRGMERSSNPWGISRDARLAWAEGLKVPTVAENPNPDVLYWVGCAAAYD
FT                   PSAQRTARAFVQLLEAAGVSYAVLGKSEGCTGDAARRAGNEYLYETLARSNIAALDAVK
FT                   PKRIVATCPHCFNALANDYPQLGGHYRVTHHTAYLEELLASGALPVETGAQRVTYHDPC
FT                   YLGRHNGVYDAPRELIRRLAGEVLELERSREGSFCCGAGGAQFWKEEEPGGERVSDNRF
FT                   REIQRRLDEATARAAAAERGEKVLAVGCPFCKSMLASTPSRAEAEDVAIKDVAELLLER
FT                   VPGLAAASGAAAPRAPEAAGVPNLERTPPENLQTAPTGAAAGDRPAATSAVVAAKAAGE
FT                   RPARKPWRPKGQGEGAPAAISGEASAPPERKVWKPKRTEPDAAPRAEGGAEAPKRKAWR
FT                   PKASSQKGQPAPDAAETPQAEAAEPDATEPDAAGAAAPRKKWRPKTKPPSDA"
FT   gene            207887..209410
FT                   /locus_tag="Trad_0181"
FT   CDS_pept        207887..209410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0181"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="COGs: COG1472 Beta-glucosidase-related glycosidase;
FT                   InterPro IPR001764:IPR017853:IPR019800; KEGG: cvi:CV_0259
FT                   glycosy hydrolase family protein; PFAM: glycoside hydrolase
FT                   family 3 domain protein; SPTR: C1XRD5 Beta-glucosidase-like
FT                   glycosyl hydrolase; PFAM: Glycosyl hydrolase family 3 N
FT                   terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13322"
FT                   /db_xref="GOA:D7CXW2"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXW2"
FT                   /protein_id="ADI13322.1"
FT                   /translation="MTDALLMIDLKQPRLTPDERAFLGERRVGGVCLFARNVEDRVQLG
FT                   ELTAELRALLGPDVLIAVDQEGGAVVRVRDVPYPPSMMALGAADDLGLTRKMGAMSARG
FT                   LRAVGVNVNFAPVADVNHNPRNPVIAERAFGGDPEAVARHVAAFVAGHQEAGVGAVVKH
FT                   FPGHGDTDLDSHLELPHLAADAARLERLELPPFRRAVAAGVAGVMSAHIVLPALDPALP
FT                   ATLSRAVLTGLLRERLGFDGVIFTDALDMRAIAASFAPAEAALRAVAAGADMALYLGPL
FT                   KEHEAILRRLEAGLASGELDPEAVARARARLRALARRFPVAPAPEAAWEVGDEARLEAA
FT                   AFRGTVALGELPKLEPGARVTLVAAAAVAAGGASSAVRAPAEALAAALEGAGVRVTRAF
FT                   YARGAEGASVLGALAGAELVLFASTSRTRMEGAELALARAVARAVRPPQRFVHVALWNP
FT                   YHALDLPGPALLTFGFRGPSARAAARALLEGGAPGRLPVALEVARGPYA"
FT   gene            209524..210975
FT                   /locus_tag="Trad_0182"
FT   CDS_pept        209524..210975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0182"
FT                   /product="protein of unknown function DUF187"
FT                   /note="COGs: COG1649 conserved hypothetical protein;
FT                   InterPro IPR003790; KEGG: ddr:Deide_2p00260 conserved
FT                   hypothetical protein, precursor; PFAM: protein of unknown
FT                   function DUF187; SPTR: C1D2P2 Putative uncharacterized
FT                   protein; PFAM: Uncharacterised BCR, COG1649"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13323"
FT                   /db_xref="InterPro:IPR003790"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXW3"
FT                   /protein_id="ADI13323.1"
FT                   /translation="MRGALRRPLARVALGACLALGGTGAARAQGGWLDAEAGGVRWKTE
FT                   AHATPSAELGELRGIWVDAFGPGFKTPDEIEALVADAEAMNLNALFVQVVRRGNCYCNR
FT                   STLPRAEDPALAPGFDPLEALIARARAAGLQVHAWVVTLALWGADAPPQDPAHPYNRHG
FT                   PAAVGEANWLTVRYDGVTRPDRDVYLDPGHPAVHDYLAGVVRSLAENYDLDGVAIDRLR
FT                   YPDFNSGALPSWGYNAVSLSRFAAETGAPIPPPPSDPVWTAWRREQVSALMRRLYEEIK
FT                   AVDPTLWVSAATIAYGAPPEDETDFASSHAYKVVLQDWAGWAQGGFLDLNLPMNYKRAD
FT                   YPQAAVWFDAWNALAPRLAGEAQTAIATGLYLNDLPGSLAQLESVRRTEGVIGWVGYAY
FT                   RSPERRALAGQVPFEASLAALARELTALGAPFAAAAAFGRPGPAAPAAVEAPLDTLVGA
FT                   PENAPAAPWYAQAEVGGLVEGWEIR"
FT   sig_peptide     209524..209607
FT                   /locus_tag="Trad_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            210972..211946
FT                   /locus_tag="Trad_0183"
FT   CDS_pept        210972..211946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0183"
FT                   /product="mannose-6-phosphate isomerase, class I"
FT                   /EC_number="5.3.1.8"
FT                   /note="COGs: COG1482 Phosphomannose isomerase; InterPro
FT                   IPR001250:IPR014628:IPR011051:IPR014710; KEGG:
FT                   rca:Rcas_1081 mannose-6-phosphate isomerase; PFAM:
FT                   mannose-6-phosphate isomerase type I; PRIAM:
FT                   Mannose-6-phosphate isomerase; SPTR: A7NI81
FT                   Mannose-6-phosphate isomerase; TIGRFAM: mannose-6-phosphate
FT                   isomerase, class I; PFAM: Phosphomannose isomerase type I;
FT                   TIGRFAM: mannose-6-phosphate isomerase, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13324"
FT                   /db_xref="GOA:D7CXW4"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014628"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXW4"
FT                   /protein_id="ADI13324.1"
FT                   /translation="MTLYPLELERFLSPRLWGGDRLVSYLGIAEPAEEEPLGESWQVYA
FT                   GCRILNGPLQGKTLAEASRDHGAALLGTAPMARYGHTFPLLAKFIDAGEALSIQVHPDD
FT                   AYAREHEPETGFLGKSEAWYILEAAPGAGVIWGFKDALTPEEVRRAAEEARLEAHLNFV
FT                   PVRAGEVVYNPAGTVHAIGAGVFLFEIQQTSDLTYRLYDYGRRGADGKPRELHLDRALE
FT                   VADLTPGERAKVPPKELGEGKTELLSTEHFVLERWDVAGDREESTRETSVELLTTISGG
FT                   LELYAGASHVRLPQGRSVVLPAALGAYTLKGEGALLRAFVPPR"
FT   gene            complement(211900..212406)
FT                   /locus_tag="Trad_0184"
FT   CDS_pept        complement(211900..212406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0184"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="COGs: COG1225 Peroxiredoxin; InterPro
FT                   IPR017936:IPR000866:IPR012336:IPR012335; KEGG: scl:sce4618
FT                   peroxiredoxin; PFAM: alkyl hydroperoxide reductase/ Thiol
FT                   specific antioxidant/ Mal allergen; PRIAM: Peroxiredoxin;
FT                   SPTR: A9F9N6 Peroxiredoxin (AhpC/TSA family); PFAM:
FT                   AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13325"
FT                   /db_xref="GOA:D7CXW5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXW5"
FT                   /protein_id="ADI13325.1"
FT                   /translation="MKPPARLQPGDRAPDFALRDASGRTVALRDLLGKGPVVVYFYPKD
FT                   NTKGCTAQACAFRDHYLVFKEAGAEVVGISTDSEASHRAFAEQHDLPFILLSDPKGEVA
FT                   RAYGATALLGLMTGRVSFVLDERGTVRHVFNDLFHATRHVDEALKVVRALSAAGQTPAA
FT                   APPHP"
FT   gene            complement(212531..213178)
FT                   /locus_tag="Trad_0185"
FT   CDS_pept        complement(212531..213178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0185"
FT                   /product="dienelactone hydrolase"
FT                   /note="COGs: COG4099 peptidase; InterPro IPR002925; KEGG:
FT                   npu:Npun_F5261 dienelactone hydrolase; PFAM: dienelactone
FT                   hydrolase; SPTR: B2J3D7 Dienelactone hydrolase; manually
FT                   curated; PFAM: Dienelactone hydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13326"
FT                   /db_xref="GOA:D7CXW6"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXW6"
FT                   /protein_id="ADI13326.1"
FT                   /translation="MSTRLRPQHVTTGPLPYLHYAPQTPGRPAPLVLFLHGAGERGEDL
FT                   KRVTTHGLPRELSAGDPLPEAAHVLAPQCPAESWWPFELHHLSALVEDALARLPVDPAR
FT                   VYLTGISMGGYGAWALATKHPERFAALAPVCSGGTPLLASRLTDLPIWAFHGAEDEVVP
FT                   LEESERMVRAVNAAGGHAKLTVYPDVTHDAWTRTYRDPAFYAWLFAQRRQDR"
FT   gene            213259..215052
FT                   /locus_tag="Trad_0186"
FT   CDS_pept        213259..215052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0186"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1132 ABC-type multidrug transport system
FT                   ATPase and permease components;
FT                   InterProIPR003439:IPR017940:IPR001140:IPR011527:IPR
FT                   003593:IPR017871; KEGG: sru:SRU_2284 ABC transporter,
FT                   ATP-binding protein; PFAM: ABC transporter related; ABC
FT                   transporter transmembrane region; SMART: AAA ATPase; SPTR:
FT                   Q2S093 ABC transporter, ATP-binding protein; PFAM: ABC
FT                   transporter transmembrane region; ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13327"
FT                   /db_xref="GOA:D7CXW7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXW7"
FT                   /protein_id="ADI13327.1"
FT                   /translation="MMPRSRAADPPRDRKGALKTLWRLIRPRWAQAASLSLLLTLTAAL
FT                   GQVFPQFVRLVIDDLIPRGEGRLLLLVGAGMLLFYLLTAALGYAAMYFSYAFTQRVISE
FT                   VRLEAYGKLLRLPLARFTSERSGSLVSRVVSDVNALETMIQSGASRLLGQLFSVVFVLA
FT                   VLFATDWVLALVALAIVFAMAFFTGVYQGPLRESARRIRSRVGELTATATEAIGNIGVV
FT                   KSFANEGLEYRRFERDNDRYVAGNLERRKQVGLMEALVGLSADLGLAAVLVLGGWLVVQ
FT                   RGLTVGELSAFLLYLGNLIGPVRSVMFFNNALQAGLAALERVDELLHDRPEQEGGRTAV
FT                   PHGGLSFHGVTFRYPGGGAPALRGLSFTVAPGQTVALVGPSGAGKSTVAKLVSRLYDPD
FT                   EGEILLGGFDLRTYALSALRGRVAVVPQEPTLFSGSVLDNIRYAKPEAADDEVREAARL
FT                   ANAEAFILGLPQGFDTEIGERGVKLSGGQKQRVAIARAILKEAAVLILDEATSSLDTES
FT                   EAVIQDALAGLFERRSRVTTLIIAHRLSTVLGADAILVLNNGQLVERGTHRELVARRGL
FT                   YWALQRLAQEDGRRRAEVLGD"
FT   sig_peptide     213259..213354
FT                   /locus_tag="Trad_0186"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(215049..215453)
FT                   /locus_tag="Trad_0187"
FT   CDS_pept        complement(215049..215453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: geo:Geob_2748 hypothetical protein; SPTR:
FT                   B9M1L5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13328"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXW8"
FT                   /protein_id="ADI13328.1"
FT                   /translation="MDTPPDRPPADELELVFVYNADSGLLNALGDALHKLVSPQTYPCS
FT                   LCALTYGGVRMRPQWRRFIAGLGVRTRFLHADELRRAYSDLGVPLPAAFVRRAGTVEPW
FT                   LTKAEIDGCQTLEALEQLILDRLKRLSPAR"
FT   gene            215510..216262
FT                   /locus_tag="Trad_0188"
FT   CDS_pept        215510..216262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0188"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="InterPro IPR000073:IPR019793; KEGG: dra:DR_1326
FT                   carboxymethylenebutenolidase-related protein; PFAM:
FT                   alpha/beta hydrolase fold; SPTR: Q9RUQ6
FT                   Carboxymethylenebutenolidase-related protein; PFAM:
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13329"
FT                   /db_xref="GOA:D7CXW9"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXW9"
FT                   /protein_id="ADI13329.1"
FT                   /translation="MKGFFKGVGLLALLALAFGAGYLYPILNRPPLVLHQDAVVAGVPR
FT                   EGVRVRWREEAGGFIDIVPAAGADTLLILYPGGLVRPQAYEWLGVALAPRGVRTVIPAF
FT                   PFDLAVLRPNRAAALLEAFAVDPTTRVVLGGHSLGGAMAARFAARRPDALDALVLMGAF
FT                   SAEGDDLSAAPLDVLVLAAEHDGLATLAEVRSGLGRLPPSAELVVIGGAVHSFFGRYGP
FT                   QRGDGLPTTTRSAAEAQITAALGAFLAR"
FT   sig_peptide     215510..215566
FT                   /locus_tag="Trad_0188"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            216304..216978
FT                   /locus_tag="Trad_0189"
FT   CDS_pept        216304..216978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0189"
FT                   /product="isochorismatase hydrolase"
FT                   /note="COGs: COG1335 Amidase related to nicotinamidase;
FT                   InterPro IPR000868; KEGG: dge:Dgeo_0227 isochorismatase
FT                   hydrolase; PFAM: isochorismatase hydrolase; SPTR: Q1J1V4
FT                   Isochorismatase hydrolase; PFAM: Isochorismatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13330"
FT                   /db_xref="GOA:D7CXX0"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXX0"
FT                   /protein_id="ADI13330.1"
FT                   /translation="MEASLRAQAAAHAELLSAWYSALPELELATLDPKTTALVSVDVLE
FT                   GFTRLGALASPRVTAIIPHVTELLTRLDALGVPHEHVAIIQDAHPEDAEEFNAYPPHCV
FT                   VGTPEAEAVRELRALPNWGSYRHFQKNSIASHTSEPFVAWLEGLAVDTIIAVGDVTDLC
FT                   LYTLALHLQVRTLARGLGQRVVVPERCTQTWDAPDHPGDLYHLLFLHQLARNGVEVVRA
FT                   LR"
FT   gene            217143..218909
FT                   /locus_tag="Trad_0190"
FT   CDS_pept        217143..218909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0190"
FT                   /product="TrkA-C domain protein"
FT                   /note="COGs: COG0471 Di- and tricarboxylate transporter;
FT                   InterPro IPR006037:IPR004680:IPR016040:IPR001898; KEGG:
FT                   noc:Noc_1175 TrkA-C, di- and tricarboxylate transporters;
FT                   PFAM: TrkA-C domain protein; Citrate transporter; SPTR:
FT                   Q3JBW8 TrkA-C, di-and tricarboxylate transporters; PFAM:
FT                   TrkA-C domain; Citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13331"
FT                   /db_xref="GOA:D7CXX1"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXX1"
FT                   /protein_id="ADI13331.1"
FT                   /translation="MSWEAWFSVFVILFNVGLLIFTRVGADIVLVSGVTLLLLTGILTP
FT                   SEALSGLANEGMVTVGVLYVVVAGLRETGAIGWLGTRLFGRPKSLPGAQLRMMAPITAL
FT                   SAVLNNTPLVAMMIPAVGDWAKRQNLAPSKLMIPLSYAAILGGTCSLIGTSTNLVVYGL
FT                   MTERTELRFGLFDIAWVGVPCAVVGITLVVLFHRWLLPDRRSAIGQQGDPREYTVEMLV
FT                   EEGGPLVGKTIEEAGLRSLPQLYLAEIDRGGRVIPAVGPQELLQGGDRLLFVGIVESVV
FT                   DLHKVRGLIPAPDQLFKVTTPRPRRILVEAVVSNTAPLVGKSVREGRFRSLYNAVIIAV
FT                   ARNGERINRKIGDIVLQPGDTLLLEASPEFAQAHRNSRDFFLVSRIENSNPPRHERALL
FT                   ALGILLGMVATVTLGWLSMLQAALLAAGLMLVTRCITGSVARRSVDWQVLIVIAASFGL
FT                   GRALEVTGAAETIASSLVALAGGDPYLSLVMIYLITMLFTELITNNGAAVLMFPIALAT
FT                   ATGLGANFAPFAICIMMAASASFSTPIGYQTNLMVYGPGGYKFTDYFRAGIPMNLTMAA
FT                   VTLLIAPRVWPL"
FT   sig_peptide     217143..217220
FT                   /locus_tag="Trad_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(218978..219484)
FT                   /locus_tag="Trad_0191"
FT   CDS_pept        complement(218978..219484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0191"
FT                   /product="putative 4-alpha-glucanotransferase"
FT                   /note="KEGG: sgr:SGR_4879 putative
FT                   4-alpha-glucanotransferase; SPTR: C1RN13 Uncharacterized
FT                   conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13332"
FT                   /db_xref="GOA:D7CXX2"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXX2"
FT                   /protein_id="ADI13332.1"
FT                   /translation="MTPSSLRTTLASAAACSALLASCSFAPIRVPVGDVTIPGNSSAGL
FT                   ICYAPSPITESAPSGFRGADYRADATYTSVGDGPATVRVYGRTTPPESPCVFPSDADVP
FT                   LSEPITLTPGVTQRVLIGGPNHSGALAELIAQPRYYLGASLTGGVLFSAEEWITLTNGE
FT                   VSVYY"
FT   sig_peptide     complement(219356..219484)
FT                   /locus_tag="Trad_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(219569..221962)
FT                   /locus_tag="Trad_0192"
FT   CDS_pept        complement(219569..221962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0192"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="COGs: COG0466 ATP-dependent Lon protease;
FT                   InterProIPR004815:IPR003111:IPR003959:IPR008269:IPR
FT                   001984:IPR020568:IPR003593:IPR008268; KEGG: dra:DR_1974
FT                   ATP-dependent protease La; PFAM: AAA ATPase central domain
FT                   protein; peptidase S16 lon domain protein; PRIAM:
FT                   Endopeptidase La; SMART: peptidase S16 lon domain protein;
FT                   AAA ATPase; SPTR: Q9RSZ5 ATP-dependent protease La;
FT                   TIGRFAM: ATP-dependent protease La; PFAM: ATP-dependent
FT                   protease La (LON) domain; ATPase family associated with
FT                   various cellular activities (AAA); Lon protease (S16)
FT                   C-terminal proteolytic domain; TIGRFAM: ATP-dependent
FT                   protease La"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13333"
FT                   /db_xref="GOA:D7CXX3"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXX3"
FT                   /protein_id="ADI13333.1"
FT                   /translation="MEWELPVIALRTVVVLPRTLENVDVGRPKSKRALEEAQAADNRVL
FT                   LLAQREPRIDDPSGDDLYTTGTLGVIKQVIRLPDDTLQVLVEGKERAEVIGYLPGMTLR
FT                   ARVRTLSETNTSGETRTRALVEQVKSAFGDYAQQNKNLRLDSFHLENLRSLKDPGALAD
FT                   VVTKYSTWEVADKQAVLEESDAGKRLELVYGFLSRDLERFDTEKQISARVKQQMDANQR
FT                   EYYLREQMKAIQKELGGGEDTLSEVEELRRRVSEKNMPKEAEKRALKEIERLEKMPGGS
FT                   PEATVVRTYLDTILDLPWSEVDEEHLDIAHSERILNEDHYALEEPKERILEFLAVRQLT
FT                   KDRQDSDYRAPILCFVGPPGVGKTSLGKSIARSLNRAFVRMSLGGVRDEAEIRGHRRTY
FT                   IGSLPGRIIQGMKTAGKLNPVFLLDEIDKMTSDFRGDPSSALLEVLDPEQNNTFADHYL
FT                   EIPYDLSKVMFITTANSLATIPRPLLDRMEVIQIPGYTLDEKLEIARRYRVPRQLRAHG
FT                   LEGKLALTESALRRTITEYTREAGVRNLDRTLAKLARKSAKEFLSSPWEGERVLDERAV
FT                   RKLLGVPPFRDERAEREPQVGLAHGLAYTAVGGVTLDIEAVSTPGKGKVTLTGQLGDVM
FT                   KESAQAGIAYLRTRTHDFNLPADFHEKRDLHVHVLEGATPKDGPSAGIAMATAVVSALT
FT                   GRPARGDIAMTGEITLRGRVLPIGGVKEKLLAAHQAGIAHVIIPEANEANLEDVPEAIL
FT                   NDLKVTTVRDFNEVIKIMLLDESQPDFVPPKGDEAGVSSAAQVQ"
FT   gene            complement(222104..222367)
FT                   /locus_tag="Trad_0193"
FT   CDS_pept        complement(222104..222367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0193"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddr:Deide_07260 putative ABC transporter,
FT                   ATP-binding component; SPTR: C1D160 Putative ABC
FT                   transporter, ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13334"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXX4"
FT                   /protein_id="ADI13334.1"
FT                   /translation="MAWEYLQVMMTTKPVKEGHSRLIVLGRGQEQAPIGAGTRLVDLLN
FT                   DLGAQGWELAGVLNLSSVDEPKAAHELHLTNSSLIFKRPLNP"
FT   gene            222710..223774
FT                   /locus_tag="Trad_0194"
FT   CDS_pept        222710..223774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0194"
FT                   /product="Extracellular solute-binding protein, family 7"
FT                   /note="COGs: COG4663 TRAP-type mannitol/chloroaromatic
FT                   compound transport system periplasmic component; InterPro
FT                   IPR018389; KEGG: dat:HRM2_13970 periplasmic TRAP-type
FT                   dicarboxylate transporter protein; PFAM: Extracellular
FT                   solute-binding protein, family 7; SPTR: C0Q9E2 Periplasmic
FT                   TRAP-type dicarboxylate transporter protein; PFAM:
FT                   Bacterial extracellular solute-binding protein, family 7"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13335"
FT                   /db_xref="GOA:D7CXX5"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXX5"
FT                   /protein_id="ADI13335.1"
FT                   /translation="MKRAWYRRIALTVGLASLLGVSAAQEVRWTMATSWPSSLNFHQLA
FT                   EEFAQNVERMSGGRMVIDVQPSGAIVGAFEVLDAVDSGIVEMGHSWSGYWIGRHPAAPF
FT                   FASIPMSFEAPMYMAWFYDAGGIELWNRLYQELMGLDITVMPVGVYHPETFAWSNVPIR
FT                   TLEDFQGLRYRTAGWWADILRDTGVSVVSLPAAELYPSLERGVVDAAEFSTPWADQTLS
FT                   FHEVTRYYTGPGMHQPAIVNELMINRSAWEALPEDLRAIVEAAAEAMVVRSWSRDLVRS
FT                   MEAVAFFDESGQERVEVDVETQRALREASFAYLDELATQDAFFAEVWESVQAFYDRYVE
FT                   YEAFMVPVRAEPRE"
FT   sig_peptide     222710..222778
FT                   /locus_tag="Trad_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            223861..224427
FT                   /locus_tag="Trad_0195"
FT   CDS_pept        223861..224427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0195"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="COGs: COG4665 TRAP-type mannitol/chloroaromatic
FT                   compound transport system small permease component;
FT                   InterPro IPR007387; KEGG: dat:HRM2_13980 hypothetical
FT                   protein; PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; SPTR: C0Q9E3 Putative
FT                   uncharacterized protein; PFAM: Tripartite ATP-independent
FT                   periplasmic transporters, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13336"
FT                   /db_xref="GOA:D7CXX6"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXX6"
FT                   /protein_id="ADI13336.1"
FT                   /translation="MAVLRGLLKGIDALTAAIAKVVAWLLLPLVLFIAYEVLMRYAFNR
FT                   PTLWVFDMSYFLTSLVVSLGAAYTLQRKGHVSVDVFYERFPERVRAFIDVLFYLLLFFT
FT                   TWLLIINVMVPHVINSWQRGELAATGIWRPPIYPFKTWILVGVVLLVLQGVAEFIRALF
FT                   VLLGRPLETPPPAAAEGDVRDEILL"
FT   sig_peptide     223861..223986
FT                   /locus_tag="Trad_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            224435..225760
FT                   /locus_tag="Trad_0196"
FT   CDS_pept        224435..225760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0196"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="COGs: COG4664 TRAP-type mannitol/chloroaromatic
FT                   compound transport system large permease component;
FT                   InterPro IPR004681:IPR010656:IPR001991; KEGG:
FT                   dat:HRM2_13990 hypothetical protein; PFAM: TRAP
FT                   C4-dicarboxylate transport system permease DctM subunit;
FT                   SPTR: C0Q9E4 Putative uncharacterized protein; TIGRFAM:
FT                   TRAP dicarboxylate transporter, DctM subunit; PFAM:
FT                   DctM-like transporters; TIGRFAM: TRAP transporter, DctM
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13337"
FT                   /db_xref="GOA:D7CXX7"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXX7"
FT                   /protein_id="ADI13337.1"
FT                   /translation="MSVELITFFMFASVLVCILLGFPIAFVLGGLAAVFGYLQFGPAVA
FT                   NIFMLRLFSVLQDNVLIAIPLFVLMGVVLEQTGIAGRLYDAVRLILGRLPGGLAVATVV
FT                   TATIFAAATGVVGAAVVTIGLLAVPSMLKYNYSRPLATGAICAGGTLGILIPPSILLVV
FT                   YGPIAGVSVGQLFIASIVPGLLLSAFYILYAVVLCSLRPEAGPPLSREEASVPARRKLW
FT                   LFVTSVLPVSLVILAVLGTIFFGLAAPTEAAGFGAFAALVLAALYRRLTLATLWKSVEN
FT                   TLRVSAMIYLVLIAAGFFTNVFTRIGGGRVVRDVILGLPFGELGTLVVMLLFIFVLGMF
FT                   IDWLGIIMIAVPLFTPIATSLGYDQLWFSMMIIMVLQTSFMTPPFAYSIFYLKGISPPE
FT                   VKTTDIYVGVLPFLGLQALVIVLLYFFPAIALWLPSYMQQFR"
FT   sig_peptide     224435..224530
FT                   /locus_tag="Trad_0196"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(225835..226592)
FT                   /pseudo
FT                   /locus_tag="Trad_0197"
FT   gene            complement(226501..227283)
FT                   /locus_tag="Trad_0198"
FT   CDS_pept        complement(226501..227283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0198"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccs:CCNA_00068 NAD(P)H-dependent
FT                   glycerol-3-phosphate dehydrogenase; SPTR: C1XVC1 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13338"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXX8"
FT                   /protein_id="ADI13338.1"
FT                   /translation="METRAEVVAGIEHVRAGRLHEAAALLATLHDPYAALHLGHAKRFL
FT                   GAYAAAEVHYRSALEAGERLQARPLTVAALCGLGEVALALQERQKVLVPFGRALGLTEL
FT                   GGVSVTQPLAGLAQAQGLWGNWGKAQALAARALAQAADPIGEARACLALGLVTRDSAAA
FT                   TDALQRGRRAARRAPHRPLELQLWVALLTRQPEPDALAAAHALAAAHAWALELGSVDTL
FT                   TSVDARNRYEHGRTQARPVAKNPQVSTRAPSGTCGQSA"
FT   gene            227347..227970
FT                   /locus_tag="Trad_0199"
FT   CDS_pept        227347..227970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0199"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG0300 Short-chain dehydrogenase of various
FT                   substrate specificities; InterPro
FT                   IPR002198:IPR002347:IPR016040; KEGG: ttj:TTHB094 putative
FT                   short-chain oxidoreductase; PFAM: short-chain
FT                   dehydrogenase/reductase SDR; SPTR: C1XIG3 Putative
FT                   uncharacterized protein; PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13339"
FT                   /db_xref="GOA:D7CXX9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXX9"
FT                   /protein_id="ADI13339.1"
FT                   /translation="MNALIVGATGGIGSALVTALKGSYALTLVGRDARKLQGLGGGATL
FT                   VPTDVTSELEVEALFEDLPPQDLLIYAAGAIQPAPLSRTSAEAWARVVDTNLTGLFYTL
FT                   KHAEPKLVTGARVYVLGARPELVNFRGFGAYAAAKAGVAALVKVAAAEWRRKAHLTLVL
FT                   PKAVATDFWQSVGQPPKDALSPEDVAEAIVNSLQGEPQAELRVG"
FT   sig_peptide     227347..227421
FT                   /locus_tag="Trad_0199"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(227967..228872)
FT                   /locus_tag="Trad_0200"
FT   CDS_pept        complement(227967..228872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0200"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /note="COGs: COG0491 Zn-dependent hydrolase including
FT                   glyoxylase; InterPro IPR001018; KEGG: rca:Rcas_3009
FT                   beta-lactamase domain-containing protein; SPTR: A7NND3
FT                   Beta-lactamase domain protein; PFAM: Metallo-beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13340"
FT                   /db_xref="GOA:D7CXY0"
FT                   /db_xref="InterPro:IPR001018"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXY0"
FT                   /protein_id="ADI13340.1"
FT                   /translation="MPADAPIQLSERVFYLPGSVNAALVVGDEREAVIVDTGQDKDAGR
FT                   RLKGACAHLGVTPIAILNTHAHADHYGGNDFLVRNLGLSVYAPPFEASILQNPYLEPVY
FT                   LFHGAKPPQELLSKWLMAKPSPVNQLLAPGRLELAGLALEILDTSGHAHTHYAVNVDGV
FT                   LIAADAVFGTDVLDKYPLPFGQDVARQIASAERVADVGARTVLPGHGDPTEDVAALVGA
FT                   NLAAFERAAAAVAAACTGVPTSAVLRASCRALGIVINDLPRYHLNLCVVSAYLSYLRET
FT                   GRVELSIIDNELRWTAVAPV"
FT   sig_peptide     complement(228807..228872)
FT                   /locus_tag="Trad_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(228956..230221)
FT                   /locus_tag="Trad_0201"
FT   CDS_pept        complement(228956..230221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0201"
FT                   /product="Fmu (Sun) domain protein"
FT                   /note="COGs: COG0144 tRNA and rRNA cytosine-C5-methylase;
FT                   InterPro IPR006027:IPR001678; KEGG: dge:Dgeo_1498
FT                   NusB/RsmB/TIM44; PFAM: Fmu (Sun) domain protein;
FT                   NusB/RsmB/TIM44; SPTR: Q1IY91 rRNA methyltransferase, sun
FT                   family protein; PFAM: NOL1/NOP2/sun family; NusB family;
FT                   TIGRFAM: ribosomal RNA small subunit methyltransferase
FT                   RsmB"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13341"
FT                   /db_xref="GOA:D7CXY1"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXY1"
FT                   /protein_id="ADI13341.1"
FT                   /translation="MTARETALSILRRVHRGAFAAPVLSDALARGGLSAADRGFVTHLV
FT                   YGSLRLELALDAQLRPLLQNPAKLPPGVLDALRLGAFEALYSGTPRRAVVNEWVAIVKR
FT                   RHGRLAGLVNAVLRRVEARELPPATRYGLPAWLYAEWEARFGRQRAEAVAAAMVAGEPL
FT                   WLLAYHPQATHALLEEGCEVTLGPIEGTLAVRPSKPLGELAAFRRGWVQPQNPASSLPA
FT                   RLLEVAPGERVLDLASGSGVKAAQLAALGADVTSVELHPNKLERAAANLRRLGLRARGV
FT                   VHDLRTPPDLPPAPKVLLDAPCTGTGTLRGHPELRTRVTPEATRSLAALQRELLRSAAA
FT                   VTAPGGLLVYAVCALTQAEGPEMARWFLETHPDFEAEPFLFDLPADNAPEGSSVLPLGG
FT                   LDGFFIARFKRQSSGVRTQKNS"
FT   sig_peptide     complement(230162..230221)
FT                   /locus_tag="Trad_0201"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(230299..230991)
FT                   /locus_tag="Trad_0202"
FT   CDS_pept        complement(230299..230991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0202"
FT                   /product="peptidase membrane zinc metallopeptidase
FT                   putative"
FT                   /note="COGs: COG2738 Zn-dependent protease; InterPro
FT                   IPR007395; KEGG: tth:TTC0540 hypothetical protein; PFAM:
FT                   peptidase membrane zinc metallopeptidase putative; SPTR:
FT                   C1XJI3 Predicted Zn-dependent protease; PFAM: Putative
FT                   neutral zinc metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13342"
FT                   /db_xref="GOA:D7CXY2"
FT                   /db_xref="InterPro:IPR007395"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXY2"
FT                   /protein_id="ADI13342.1"
FT                   /translation="MQGETVGVGVTGYYLIGFVAFFVSLAVSAWLRATYARWSRVQNAS
FT                   GLTGAEVAHAILRANNITNVRVERVPGQLSDHYDPIKRVVRLSDGIYGRASVAGMAVAA
FT                   HEVGHAIQHARAYAPLQWRSALAPVANIGSQFGLLAAMMGLFLGATGMLNLGILLFSAA
FT                   VLFQVITLPVEFDASRRALVQLNQLGLVTQRDTGGARSVLTAAAMTYVAAAATSIAYLL
FT                   YFIMASRR"
FT   sig_peptide     complement(230905..230991)
FT                   /locus_tag="Trad_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(231221..231508)
FT                   /locus_tag="Trad_0203"
FT   CDS_pept        complement(231221..231508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0203"
FT                   /product="Stage V sporulation protein S"
FT                   /note="COGs: COG2359 conserved hypothetical protein;
FT                   InterPro IPR007347; KEGG: ttj:TTHA0850 stage V sporulation
FT                   protein S (SpoVS) related protein; PFAM: Stage V
FT                   sporulation protein S; SPTR: Q72KE7 Stage V sporulation
FT                   protein S; manually curated; PFAM: Stage V sporulation
FT                   protein S (SpoVS)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13343"
FT                   /db_xref="GOA:D7CXY3"
FT                   /db_xref="InterPro:IPR007347"
FT                   /db_xref="InterPro:IPR036882"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXY3"
FT                   /protein_id="ADI13343.1"
FT                   /translation="METLRVSGNSRPNSVAGAIAALLRSEHEVEVQAIGPQAVNQAVKA
FT                   IAIARSYIEPDGLELTTQPSFVKLELQHEERTAVRFTVRAYALETSPESP"
FT   gene            231967..233742
FT                   /locus_tag="Trad_0204"
FT   CDS_pept        231967..233742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0204"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number="2.2.1.6"
FT                   /note="COGs: COG0028 Thiamine pyrophosphate-requiring
FT                   protein;
FT                   InterProIPR012846:IPR012001:IPR012000:IPR011766:IPR 000399;
FT                   KEGG: ttj:TTHA1213 acetolactate synthase, large subunit;
FT                   PFAM: thiamine pyrophosphate protein TPP binding domain
FT                   protein; thiamine pyrophosphate protein central region;
FT                   thiamine pyrophosphate protein domain protein TPP-binding;
FT                   SPTR: Q5SJ01 Acetolactate synthase; TIGRFAM: acetolactate
FT                   synthase, large subunit, biosynthetic type; PFAM: Thiamine
FT                   pyrophosphate enzyme, central domain; Thiamine
FT                   pyrophosphate enzyme, N-terminal TPP binding domain;
FT                   Thiamine pyrophosphate enzyme, C-terminal TPP binding
FT                   domain; TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13344"
FT                   /db_xref="GOA:D7CXY4"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXY4"
FT                   /protein_id="ADI13344.1"
FT                   /translation="MNGAAALLHALEREGVEIVFGHPGGAIMPTYDALYDSPIKHVLVR
FT                   HEQAGAHAADAYYRASGRVGVCLATSGPGATNLVTGLATAYMDSSAVVAITGNVPMSLI
FT                   GTDAFQEADVYGITLPITKHNYLVKHVNDIPRVVREAFYIAASGRPGPVLIDIPKDVQQ
FT                   APFTGSFEVALDLPGYKPTTVGHAKQLRRAAEAIRAAKRPVMMVGGGGQAAAAEIMAFA
FT                   ERTGVPVITTLMGLGAYPAGAENALGMPGMHGTVTANRAITHCDLIIGAGLRFDDRVTG
FT                   NLKRFAPNATVVHIDIDPAEISKLVRAHVPVVGDLRDVLPRLGELLEPLNIPEWWTQLS
FT                   EWKGRYPERFKKDKPLVSQEVIQMFREATGGNCVVTTEVGQHQMFAARLFPTNRPRTWI
FT                   TSGGLGTMGFGLPAAIGAAFARPGEQVVCVAGDGSVQMNIQELATIYKHQLPIIVAICN
FT                   NGMLGMVRQWQEMFHAQRYSEVYLADSNPDFAKLAEAYGLDGYNIFDRETAAQLIPEVL
FT                   AKGKPAVMNFVVYEAEKVFPMVPAGAGVDEMLIGDQEPEDLTPQQVAATEVTAAELVAA
FT                   DPSLERAPEGEKEPA"
FT   gene            233739..234269
FT                   /locus_tag="Trad_0205"
FT   CDS_pept        233739..234269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0205"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="COGs: COG0440 Acetolactate synthase small
FT                   (regulatory) subunit; InterPro
FT                   IPR004789:IPR002912:IPR019455; KEGG: dge:Dgeo_0601
FT                   acetolactate synthase, small subunit; PFAM: Acetolactate
FT                   synthase, small subunit-like; amino acid-binding ACT domain
FT                   protein; SPTR: Q1J0T1 Acetolactate synthase, small subunit;
FT                   TIGRFAM: acetolactate synthase, small subunit; PFAM: ACT
FT                   domain; Small subunit of acetolactate synthase; TIGRFAM:
FT                   acetolactate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13345"
FT                   /db_xref="GOA:D7CXY5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXY5"
FT                   /protein_id="ADI13345.1"
FT                   /translation="MSVHKHVLSVTVRDQPGVLMRIAGLFARRGFNIESLSVAQSEIPG
FT                   ISRTTFTVSGEDATIEQVQKQLQKLIDVLKVIDHSEAKFVDRELMLIKVAVRSPEERVE
FT                   LRQVAQDFRARIVDVHRDALVFEVTGDEGKMDAFIEQMRPFGILELIRTGRVALTRSAA
FT                   DSKVTGRPTVKAA"
FT   gene            234302..235300
FT                   /locus_tag="Trad_0206"
FT   CDS_pept        234302..235300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0206"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="COGs: COG0059 Ketol-acid reductoisomerase;
FT                   InterProIPR013023:IPR013116:IPR000506:IPR008927:IPR 016040;
FT                   KEGG: cya:CYA_0246 ketol-acid reductoisomerase; PFAM:
FT                   Acetohydroxy acid isomeroreductase catalytic domain
FT                   protein; acetohydroxy acid isomeroreductase; PRIAM:
FT                   Ketol-acid reductoisomerase; SPTR: Q2JXL2 Ketol-acid
FT                   reductoisomerase; TIGRFAM: ketol-acid reductoisomerase;
FT                   PFAM: Acetohydroxy acid isomeroreductase, catalytic domain;
FT                   TIGRFAM: ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13346"
FT                   /db_xref="GOA:D7CXY6"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXY6"
FT                   /protein_id="ADI13346.1"
FT                   /translation="MANIYYDTDANLAHLEGKTVAVIGYGSQGHAHALNAKESGVRVVV
FT                   GLRRGSASWAEAEGAGLEVMEVADAARAGDLVMILLPDEVQAQVYREQVAPHLEEGDAL
FT                   LFAHGFNIHFGQIRPPEHVDVFMVAPKGPGHLVRRTFTEGGGVPCLVAIHQDATGTAKA
FT                   RALAYAKAIGGTRGGVLETTFQEETETDLFGEQAVLCGGVTELMRSGFETLVAAGYQPE
FT                   VAYFECVHEMKLIVDLIYEGGFERMRHSISNTAEYGDYVTGPRLVTDETRAEMKRVLRD
FT                   IQTGKFARDFLLENQVGQPTLNAGRRATASSQVAEVGARLRKMMPFIGRKG"
FT   gene            235467..237005
FT                   /locus_tag="Trad_0207"
FT   CDS_pept        235467..237005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0207"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="COGs: COG0119
FT                   Isopropylmalate/homocitrate/citramalate synthase;
FT                   InterProIPR000891:IPR005671:IPR013709:IPR013785:IPR 002034;
FT                   KEGG: dra:DR_1482 2-isopropylmalate synthase; PFAM:
FT                   pyruvate carboxyltransferase; LeuA allosteric
FT                   (dimerisation) domain; SPTR: C1XQF8 2-isopropylmalate
FT                   synthase; TIGRFAM: 2-isopropylmalate synthase; PFAM: LeuA
FT                   allosteric (dimerisation) domain; HMGL-like; TIGRFAM:
FT                   2-isopropylmalate synthase, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13347"
FT                   /db_xref="GOA:D7CXY7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXY7"
FT                   /protein_id="ADI13347.1"
FT                   /translation="MAYIKIFDTTLRDGEQTPGVTLNTAEKVEIAKQLARLGVDIIEAG
FT                   FPITSTGDFEAVSRIAKEVSGPTICALARTARADIERAAQALEGAERARIHVFTSGSKI
FT                   HLEHMLRKTPEEVIEASVESVRLARQFTGDVEFSAQDCTRSELAFLYALYGAAIEAGAT
FT                   VINIPDTVGYGMPLEYAELIRNIRDNVPGAKEVDISTHCHDDLGLAVANSLAAIGAGAT
FT                   QVECTVNGIGERAGNTSLEEVVMALGTRRDVWGHETGINTRELYRTSRMVAMYTGVSVP
FT                   PNKAVVGDNAFAHESGIHQDGVIKALETYEIMSAETVGRDAGVLVMGKHSGRRAFRKTL
FT                   EELGYELDDEKVNVLFKQFKDLCDRKQKVTSEDIRALIDAETARVPQTYELMSVQFQSG
FT                   TGMIPVATVRLKTDTGIYEEAATGDGPVDAVYRALERVAGLPLKLESYEIRSVGSGKDA
FT                   LGEVSIRASQGERLVHGRGLSTDVIEASAQAYVDVLNKFAAGIGKASAQQVATP"
FT   gene            237019..238641
FT                   /locus_tag="Trad_0208"
FT   CDS_pept        237019..238641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0208"
FT                   /product="2-isopropylmalate synthase/homocitrate synthase
FT                   family protein"
FT                   /note="COGs: COG0119
FT                   Isopropylmalate/homocitrate/citramalate synthase;
FT                   InterProIPR000891:IPR005675:IPR013709:IPR013785:IPR 002034;
FT                   KEGG: tth:TTC0847 putative
FT                   alpha-isopropylmalate/homocitrate synthase family
FT                   transferase; PFAM: LeuA allosteric (dimerisation) domain;
FT                   pyruvate carboxyltransferase; SPTR: Q72JD1
FT                   2-isopropylmalate synthase; TIGRFAM: 2-isopropylmalate
FT                   synthase/homocitrate synthase family protein; PFAM: LeuA
FT                   allosteric (dimerisation) domain; HMGL-like; TIGRFAM:
FT                   2-isopropylmalate synthase/homocitrate synthase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13348"
FT                   /db_xref="GOA:D7CXY8"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXY8"
FT                   /protein_id="ADI13348.1"
FT                   /translation="MSVLMTAVEIYDTTLRDGTQGTGFSLTSEDKVAIARRLDAFGVDV
FT                   IEGGWPGSNPKDARFFELMRGVALTRARLAAFGSTRRKGVRPEEDANLQALLAADTPVV
FT                   TIFGKSWTLHVREALAVSLEENLAMIRDSVAFLRAQGREVFYDAEHFFDGYRADAAYAL
FT                   ATLEAACEAGASRLVLCDTNGGSLPEWVHERTAEVCARFAVPVGIHPHNDAELAVANAL
FT                   AALRSGARQVQGTIGGYGERCGNLNLVSLLPTLKLKLGFAQPQDLSGLRELARYVDERA
FT                   NMPPNVRAPYVGDAAFAHKGGVHVSAVAKNPETYEHIPPEAVGNRRQVLLSDLSGRANV
FT                   LAKSAPGDGAPEAAAAILARLKELEHRGYAFEGAEASFHLMSLKVRGRYRPYFTLHGYR
FT                   VTLDKRDGDAEPLCEASVRVEVAGQLEHTAAAGHGPVNALDRALGKALGRFYPSLAQLR
FT                   LTDYKVRVLSGAETGTASVVRVQVETTDGADTWGTVGASSDIIDASYSALIDAIEYKLH
FT                   KDAVTPQADLEGRAAGVSAEVVA"
FT   gene            238958..243511
FT                   /locus_tag="Trad_0209"
FT   CDS_pept        238958..243511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0209"
FT                   /product="Glutamate synthase (ferredoxin)"
FT                   /EC_number="1.4.7.1"
FT                   /note="COGs: COG0069 Glutamate synthase domain 2;
FT                   InterProIPR017932:IPR000583:IPR006982:IPR002932:IPR
FT                   002489:IPR013785; KEGG: chl:Chy400_3517 glutamate synthase
FT                   (ferredoxin); PFAM: ferredoxin-dependent glutamate
FT                   synthase; glutamine amidotransferase class-II; glutamate
FT                   synthase; glutamate synthase alpha subunit domain protein;
FT                   PRIAM: Glutamate synthase (ferredoxin); SPTR: B9LCZ9
FT                   Glutamate synthase (Ferredoxin); PFAM: Conserved region in
FT                   glutamate synthase; GXGXG motif; Glutamate synthase central
FT                   domain; Glutamine amidotransferases class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13349"
FT                   /db_xref="GOA:D7CXY9"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXY9"
FT                   /protein_id="ADI13349.1"
FT                   /translation="MKQPRSNLSTLAWPHERDACGVGFVADLRGRPSRAVLQHALTALN
FT                   NLSHRGAVSADGLTGDGAGVLTQLPHKLFRRDLDAWGVSLGERDLAVGVFFVDNAAPVE
FT                   RMYRLADEVIRASRLRLLGWRDVPINDDALGEEARSRRPVLRHVLLGRPEGLGDDAFER
FT                   LLYLTRKRLERRLTEANLGRFYIPSFSHRTISYKGLMVAPQLAHFYRDLADPDFETAIA
FT                   VFHQRYSTNTMPRWSLAQPFRFLAHNGEINTLQGNVNLMRAREGVLSSRVWGDAAKELL
FT                   PIIQPGGSDSAALDNAFELLTLSGRDPMHALMMLVPEAFEERAEMDAELRAFYAYHATL
FT                   MEPWDGPAALALTDGRFAVAALDRNGLRPQRYWLSKGGLVVVGSEAGMVPLDETEIIEK
FT                   GRLAPGSMLAVDTLSGRLLRNEEIKALVARKQPYGRWLDAHLVRPPEVAPDELALRAWD
FT                   EAALRRTQKAFGYHQEDYDRILEPMAAGETPVGSMGDDTPLAVLSEQPQGLFRYFKQRF
FT                   AQVTNPPIDPLRERLVMSLETVLGPRGPLLEEEERSARVVVFPSPVIDEGQMAWLRAQS
FT                   WLRPHLLRARFAVAAGPEGLEGAVEALCEEAVAAVRGGAGLLLLSDREIGPDWIPVPML
FT                   LLVSAVHHRLIEAGLRTRTALVCESGEAREDHHVACLIGYGAALVHPYLAFASARDAGA
FT                   RAKTPIPAAEASANYRYALEAGLLKIMSKMGISAVSSYRGAQIFEALGVAQEVVDRYFT
FT                   GTPSRIGGADLAVFATDALAFHAEAFGEDPALKDRGIYRFRKAGEYHALNPLVFKALHK
FT                   AVRTESFEAYNDYARLVDERPPCNLRDLLSYKKASTPLPLDEVEPVDAIVTRFTTQAMS
FT                   HGSVSRETHEVLAVAMNRLGAKSNSGEGGEDAVRFKPYERDMPELSHAPWHPKAGDWAN
FT                   SAIKQVASGRFGVTPAYLASARELEIKMAQGSKPGEGGQIPGHKVTAEIARIRRSVPGV
FT                   TLISPPPHHDIYSIEDLAQLIYDLKRVNKEARVGVKLVATAGVGTVAAGVAKGYADNIQ
FT                   ISGYDGGTGASPLSSIKHAGVPWELGLAEAQQVLIENDLRGRVTLRVDGGMKTGRDVVM
FT                   GALLGAEEYGFGTSALVAAGCTMQRACHLNTCSVGVATQREDLRKKFPGQPEHVVNFFV
FT                   YVAQQVRMILAEMGFRSLDEIIGRVDLLEPREVALPKAAHLDLGAILRDPDPSGTRARR
FT                   AQRRRNDRPEDTPPLDEIVYQEAAGVIQNPRPYRRRYAITNRERSVGARLSGEVARVHG
FT                   EAGLPPGTVQLHFTGVAGQAFGVFNGAGVQLTLEGEAQDYVGKGMAGGEIVVKPPAESR
FT                   LTPHDNTIIGNTVLYGATGGALYASGRAGERLAVRNSGARVVVEGCGDHGCEYMTGGVV
FT                   VVLGRTGRNFGAGMSGGVAYVYDPDGAFEGRYNPGMVALERLGPGLDDELLRALVSRHA
FT                   ALTGSPRATELLSAWEEARGRFWKVVPKAEAADVNGVAAGALEALVQEAQVGSVAL"
FT   gene            complement(244869..245891)
FT                   /locus_tag="Trad_0210"
FT   CDS_pept        complement(244869..245891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0210"
FT                   /product="Transketolase central region"
FT                   /note="COGs: COG0022 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dehydrogenase (E1) component eukaryotic type beta
FT                   subunit; InterPro IPR005475:IPR005476:IPR009014:IPR015941;
FT                   KEGG: ttj:TTHA0938 pyruvate dehydrogenase E1 component,
FT                   beta subunit; PFAM: Transketolase central region;
FT                   Transketolase domain protein; SPTR: C1XT03
FT                   Pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase component beta subunit; PFAM: Transketolase,
FT                   C-terminal domain; Transketolase, pyrimidine binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13350"
FT                   /db_xref="GOA:D7CXZ0"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXZ0"
FT                   /protein_id="ADI13350.1"
FT                   /translation="MSALKDPETATRSATQNLTMVQAINQALEQALENDERVLLFGEDV
FT                   GKMGGVFRASDGLQGRFGEARVFDTPLAESGIVGFAVGIALAGFRPVAEVQFAGFLYPA
FT                   LDQILSHVGRYRHRTRGRYSLPLVVRAPYGGGVHTPEQHADSPEGLLAHTPGVKVVIPS
FT                   NPERAKGLLLAAVADPDPVFFLEAIKLYRSVRAAVPTSPYTHPLGKARVVREGGAATLL
FT                   CYGGMVEVCEKAAEVAQAEGVALEVLDLETLVPLDTEAVLASVRKTGRAVVVYEAMRTG
FT                   GFGAEVAARIAEEAIDSLQAPVLRVAGWDSPYPPFSSIEHHYRPNAKRVLEAVETLLRF
FT                   "
FT   gene            complement(245878..246921)
FT                   /locus_tag="Trad_0211"
FT   CDS_pept        complement(245878..246921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0211"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="COGs: COG1071 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dehydrogenase (E1) component eukaryotic type alpha
FT                   subunit; InterPro IPR017596:IPR001017; KEGG: tth:TTC0569
FT                   pyruvate decarboxylase alpha subunit-like protein; PFAM:
FT                   dehydrogenase E1 component; PRIAM: Pyruvate dehydrogenase
FT                   (acetyl-transferring); SPTR: C1XT02 Pyruvate dehydrogenase
FT                   E1 component, alpha subunit; TIGRFAM: pyruvate
FT                   dehydrogenase (acetyl-transferring) E1 component, alpha
FT                   subunit; PFAM: Dehydrogenase E1 component; TIGRFAM:
FT                   pyruvate dehydrogenase E1 component, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13351"
FT                   /db_xref="GOA:D7CXZ1"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXZ1"
FT                   /protein_id="ADI13351.1"
FT                   /translation="METLAYLSDEGIPKGNLPFDDDDLVRGYRALRRARFWDERASVLQ
FT                   RQGKLGVYPPYRGQEAAQVGTMLAFEPSDWLVPSYRESAAALTHGLPLATLILYWRAHP
FT                   AGWRFPEGVNILPFYVPIATQLPQAVGLAHALRLRGAQNGSQPIVATFVGDGGTSEGDF
FT                   HEALNFASVFEAPAVFIVQNNGWAISVPTTRQMKTKRVAARAAGYEMPGVTVDGNDLLA
FT                   VWKVAQEAVARAREGGGPTLIEAMTYRVAPHTTSDDPSRYRTEEEAASWIGRDPVKRMR
FT                   TALAHLTLWDDAQEEALLEELRAELEAAVREADDAPTPAPEEIVEHVFETMTPDQLRAW
FT                   EVLRERA"
FT   gene            247231..248259
FT                   /locus_tag="Trad_0212"
FT   CDS_pept        247231..248259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0212"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="COGs: COG1064 Zn-dependent alcohol dehydrogenase;
FT                   InterProIPR013154:IPR013149:IPR011032:IPR016040:IPR 002328;
FT                   KEGG: ddr:Deide_03550 putative alcohol dehydrogenase,
FT                   (ADH); PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; SPTR:
FT                   C1CZS5 Putative Alcohol dehydrogenase, (ADH); PFAM: Alcohol
FT                   dehydrogenase GroES-like domain; Zinc-binding
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13352"
FT                   /db_xref="GOA:D7CXZ2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXZ2"
FT                   /protein_id="ADI13352.1"
FT                   /translation="MKAALMHAFREPLRVTDVPDPEPPAGGVVIRVGACGVCRSDWHAW
FT                   MGHDPTIRLPHVPGHELAGTVAALGAGVTHWRVGERVTVPFCCGCGRCQTCRAGYPHVC
FT                   DAEYQPGFTGWGAFAEYVALPYAEVNLVRLPDALGFVEAASLGCRFMTAFHALTAQGRV
FT                   QPGEWVAVHGCGGVGLSAVMIAAALGARVVAVDLDDAKLERARALGAEHVLRSAHPVGA
FT                   ILELTQGGAHVSLDALGSAATLRNSVRCLRKKGRHVQVGLLLGESRPTALPMGEVIAKE
FT                   LELRGSHGMPAHAYPQMLRMIAEGTLAPQRLVGKTLTLEEAGAELAAMGRFAPRGVSVI
FT                   VL"
FT   gene            complement(248313..248840)
FT                   /locus_tag="Trad_0213"
FT   CDS_pept        complement(248313..248840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sed:SeD_A1227 VasA; SPTR: C2PG08
FT                   Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13353"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXZ3"
FT                   /protein_id="ADI13353.1"
FT                   /translation="MHKRIVALLSLLALLGVAFAQEDTTVDAEVTEQGAEVVVAVEAAP
FT                   GVEFDTTQFVGAALPFPASLHYGIKDVQLFGAEPDLRFRFSGNLFTSRLGVGVDALFDI
FT                   ATLEENIQLYGGPSLDLGTIFPVQPSFAFAGFLGGEYRFNREIGFFAEIGTGIQFPFTL
FT                   DPRGALGFNYHF"
FT   sig_peptide     complement(248781..248840)
FT                   /locus_tag="Trad_0213"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(248981..249340)
FT                   /locus_tag="Trad_0214"
FT   CDS_pept        complement(248981..249340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0214"
FT                   /product="Excinuclease ABC C subunit domain protein"
FT                   /note="InterPro IPR000305; KEGG: tle:Tlet_1191 excinuclease
FT                   ABC subunit C; PFAM: Excinuclease ABC C subunit domain
FT                   protein; SPTR: C6I101 Putative uncharacterized protein;
FT                   PFAM: GIY-YIG catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13354"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXZ4"
FT                   /protein_id="ADI13354.1"
FT                   /translation="MPIAARWRRLEALPPPRGRDAMPGVYELADEAKRVIYIGQSAKDV
FT                   PNRIRQHLAGRSGAPCIAERAAYWRYRYARVPQAEEAALLAAFKERFGALPLCNRAAPL
FT                   QRGALRRYYERTRGS"
FT   gene            complement(249342..250316)
FT                   /locus_tag="Trad_0215"
FT   CDS_pept        complement(249342..250316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0215"
FT                   /product="GTP-binding protein Era"
FT                   /note="COGs: COG1159 GTPase;
FT                   InterProIPR004044:IPR005225:IPR005662:IPR002917:IPR
FT                   006073:IPR009019:IPR015946; KEGG: dge:Dgeo_1825 GTP-binding
FT                   protein Era; PFAM: GTP-binding protein HSR1-related; KH
FT                   type 2 domain protein; SPTR: Q1IXB4 GTP-binding protein era
FT                   homolog; TIGRFAM: GTP-binding protein Era; small
FT                   GTP-binding protein; PFAM: KH domain; GTPase of unknown
FT                   function; TIGRFAM: GTP-binding protein Era; small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13355"
FT                   /db_xref="GOA:D7CXZ5"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXZ5"
FT                   /protein_id="ADI13355.1"
FT                   /translation="MSDPSEITSPPLDAPAPQSSAEVPTYSGFVAILGKPNVGKSTLLN
FT                   TFLGVKVAPITPKPQTTRRGVRGVYTDRQASEVRQLVFVDTPGFHRAKDALGEFMNREV
FT                   RAAVVDVDVILWVVDLRRPPSDEDKEVARLLRGLDPSTRVYLVGNKLDAAKYPDEALEL
FT                   YGELVPNVSRTYRLSALEDPEAVYALRAELLGELAEGPLFFPEDIRSDQSRETWAAEII
FT                   RESAMTHLRQELPYAVAVQVLQWRDPEGDEPLYLMAELWVERANHRMIVLGKGGSMIRE
FT                   IGRSARKQLEVFLGHRVFLELEVVVRRAWREDPEALRELGFEG"
FT   gene            complement(250498..251028)
FT                   /locus_tag="Trad_0216"
FT   CDS_pept        complement(250498..251028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0216"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="COGs: COG2197 Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain;
FT                   InterPro IPR000792:IPR016032:IPR011991; KEGG: sgr:SGR_4042
FT                   putative two-component system response regulator; PFAM:
FT                   regulatory protein LuxR; SMART: regulatory protein LuxR;
FT                   SPTR: B4CWX5 Two component transcriptional regulator, LuxR
FT                   family; PFAM: Bacterial regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13356"
FT                   /db_xref="GOA:D7CXZ6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXZ6"
FT                   /protein_id="ADI13356.1"
FT                   /translation="MHVWVFSDVRLLQRGLIELVTHLGFTAHAIHTPEVEVALWHLKRT
FT                   APPFPPPPPLPTLALFSGTEDDVIRLLQRGYRGYLSPQDDDAQLFKALQALRRGEIWAS
FT                   RELLTRTIGSLSTPQLTEREREVLGLLAQGLSNRAIGERLGISERTVKTHVANLFDKFG
FT                   VRTRLELAAQVQP"
FT   sig_peptide     complement(250942..251028)
FT                   /locus_tag="Trad_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            251550..254480
FT                   /locus_tag="Trad_0217"
FT   CDS_pept        251550..254480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0217"
FT                   /product="PKD domain containing protein"
FT                   /note="COGs: COG2133 Glucose/sorbosone dehydrogenase;
FT                   InterPro IPR000601:IPR011041:IPR011042; KEGG: gvi:gll0556
FT                   hypothetical protein; PFAM: PKD domain containing protein;
FT                   SMART: PKD domain containing protein; SPTR: Q7NN58 Gll0556
FT                   protein; PFAM: Glucose / Sorbosone dehydrogenase; PKD
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13357"
FT                   /db_xref="GOA:D7CXZ7"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXZ7"
FT                   /protein_id="ADI13357.1"
FT                   /translation="MVRPSCPPSSSRLPPCHPPLPRSYPLCLACLCLCLLGGLLSGCWR
FT                   APPALDHAAQQLPPEGGQLTLPGGVSVTLSAGFLAAPAEVSVTRAAVPEPLPATFAAAY
FT                   AAEAIAPGVTVRFPSRALGDAGGLAVRVPATVPKLEGEERLLAEVQLFLGDGTQHFFFQ
FT                   PYARVEGPFTQPAEGSDTVTLSAAQLRPTGALREAAVRVHVRPVRLSSPLAPLSLPQGF
FT                   ALEEVVSGLNQGVAFAFAPDGRAFIAEKGGVVRVAEQGVLRREPFIDLSAQVNHYQARG
FT                   LLGFALHPRFPQHPYAYVLYTYDPPELQGRTGMAAPDNAGARVARLVRVTADAARGYAV
FT                   AVPGSERVLLGTNSTAATIGNPAARNSSVLSCGPLGRPLEDCIPSDEISHTVGGLRFGR
FT                   DGMLYVSIGDGSNFLKVDPAALRAQELDSLAGKLLRIDPETGLGLPDNPFFDGNPKSNR
FT                   SRVLSYGLRNPFRFTLHPQTGEPFIGDVGWNTWEEVNVGGGRNFGWPCFEGGNGRALQQ
FT                   GGYRALGQCAALYGSAQATAPALYAYLHGSGSSSVQVGEFYTGTRYPESYRGALFINDF
FT                   NQGRIRTLHFGPRGEVARVTEFATEPGVVQMGMGPGGELYLLNIYDGKLKRLRYTAPAA
FT                   APLRAVASGAPLQGPAPLTVALSSAGSSGQGGLTYLWDFGNGERSEQPHPSVTFAEPGR
FT                   YRVTLWVSDEGGDAARTTLEVRVGNAPPTATILSPAPGARYQVGRPVAFSGRGSDPEDG
FT                   ALPGGALSWTLNTYHNDHVHTDSLPPTTGETGAFVPEDHGDNTSLELCLTARDRHGESA
FT                   RSCVRLLPETVRYTLDTVPTGLELPWEGVMRQTPFTVSTIVGATQQLVAPERQGRYAFS
FT                   HWSDGGAAIHDVRVGATPRRFVATYRRSQRLRLTALCRDRWRVVNLSADAVPYRWRVTR
FT                   SGQAGSGTVRPHESLTLRIPAGTSTVAFYAGGGFHSTLRPSLERCR"
FT   gene            complement(254534..255631)
FT                   /locus_tag="Trad_0218"
FT   CDS_pept        complement(254534..255631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0218"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="COGs: COG0276 Protoheme ferro-lyase
FT                   (ferrochelatase); InterPro IPR001015:IPR019772; KEGG:
FT                   gau:GAU_2783 ferrochelatase; PFAM: ferrochelatase; PRIAM:
FT                   Ferrochelatase; SPTR: C1AAM7 Ferrochelatase; TIGRFAM:
FT                   ferrochelatase; PFAM: Ferrochelatase; TIGRFAM:
FT                   ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13358"
FT                   /db_xref="GOA:D7CXZ8"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXZ8"
FT                   /protein_id="ADI13358.1"
FT                   /translation="MMNLGGPKNLDEVQPFLLKLFEDREIIQLPAQNVLGPFIAKRRTK
FT                   SVQDNYRDIGGGSPILKWTREQGEGMCRRLDAMSPETAPHKFYVAFRYIDPFTEDALRA
FT                   MHEDGVTRAVAFTQYPQFSCATTGSSLNEVWRAARRLGLQSAFQWSVIDRWPTHPRFIE
FT                   AMTETVKQGLEQFSERDRDDVVIVFSAHSLPLSVINRGDAYPAEVGATTHEVMKRLGYA
FT                   YEYLISYQSEVGPVPWLGPSTETVIEELGHKKRRNVLVVGIAFTSDHIETLHELDIEYG
FT                   ELAHKVGITNYKRAPALNGLPLFQDALAEIVYEHLQSGEACSKMYGFRCPGCVNPQCRN
FT                   ILNPVAPYKRTNVTVTKETRLYRAS"
FT   gene            complement(255785..256687)
FT                   /locus_tag="Trad_0219"
FT   CDS_pept        complement(255785..256687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0219"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="COGs: COG3546 Mn-containing catalase; InterPro
FT                   IPR007760:IPR009078:IPR012347; KEGG: tro:trd_0854 probable
FT                   manganese catalase; PFAM: manganese containing catalase;
FT                   PRIAM: Catalase; SPTR: B9KZE0 Probable manganese catalase;
FT                   PFAM: Manganese containing catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13359"
FT                   /db_xref="GOA:D7CXZ9"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXZ9"
FT                   /protein_id="ADI13359.1"
FT                   /translation="MYLRIDKLQIEMPAAREADPNAAIRVQELMGGRFGEMSTLMNYTY
FT                   QSFNFRGREKLKPYYDLIANIATEELGHIELVAATVNSLLNGPERPSETPDPTGTPLGF
FT                   AKDAGNPHHFIASGQTILPANSLGQAWSGDYVFSSGNLILDLLHNFFLENGARTQKLRV
FT                   YEMTDNPVARQMLGYLFVRGGVHALAYAKALETLTGVEMSKMLPIPKLDNSLFPEARKF
FT                   EAEGSHRKLYRFSPNDYRDIAHIWQGESPDGSGPLEVVDGPPEGGHLARLDPIGESFAP
FT                   EFHPEEIFEIAQKLYNKAK"
FT   gene            256803..257717
FT                   /locus_tag="Trad_0220"
FT   CDS_pept        256803..257717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0220"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COGs: COG0583 Transcriptional regulator; InterPro
FT                   IPR000847:IPR005119:IPR011991; KEGG: sru:SRU_2406
FT                   redox-sensitive transcriptional activator OxyR; PFAM: LysR
FT                   substrate-binding; regulatory protein LysR; SPTR: Q2RZX6
FT                   Redox-sensitive transcriptional activator OxyR; PFAM:
FT                   Bacterial regulatory helix-turn-helix protein, lysR family;
FT                   LysR substrate binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13360"
FT                   /db_xref="GOA:D7CY00"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY00"
FT                   /protein_id="ADI13360.1"
FT                   /translation="MTLTQLKYLVAVAETGHFAEAAQRCGVTQPTLSMQLQKLERSLGI
FT                   VLFDRRKKPVEPTEAGATLVAQARRVLHECARLEGLAQEARGTVTGELRLGILPTLAPY
FT                   LLPLVVPRFLRRYPGVHLRVREATTAQLIGELVGNGLDLGLASDHEPHAALLSQPLFRE
FT                   PFVAFLAPEHRLAPHREIPTSALHVSDMWLLSEGHCLRDQTLRLCRGGELACGTRRSLH
FT                   FESGNLQTLVKLVKQSGGMTLLPLLATLDLSDGERRTYVRPLVPTPQREVWALTSRTSA
FT                   QRPLFRAFITTVLEALPENLAAL"
FT   gene            complement(257781..258773)
FT                   /locus_tag="Trad_0221"
FT   CDS_pept        complement(257781..258773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0221"
FT                   /product="Coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="COGs: COG0408 Coproporphyrinogen III oxidase;
FT                   InterPro IPR001260:IPR018375; KEGG: cag:Cagg_1294
FT                   coproporphyrinogen oxidase; PFAM: coproporphyrinogen III
FT                   oxidase; PRIAM: Coproporphyrinogen oxidase; SPTR: B8G823
FT                   Coproporphyrinogen oxidase; PFAM: Coproporphyrinogen III
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13361"
FT                   /db_xref="GOA:D7CY01"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY01"
FT                   /protein_id="ADI13361.1"
FT                   /translation="MPEPLTSHLAAPATTSRRERVVALMRAAQARLTAAFEALDGQATF
FT                   RPHTWERPGGGGGTAKVLEGGRVLERGGINVSAVCGDAVPPSLAATHPGTEGKPFFATG
FT                   LSMVLHPLNPYAPAFHANYRYFEVTEVSSRGHEIAPRVWWFGGGADMTPNYPFEEDVIH
FT                   FHRTLKAQCDRHDVGDYETLKRACDDYFFIRHRGEMRGVGGIFFDELSPIGQGDFERDF
FT                   AFVADGLDTILEAYLPLLARRHATPYGERERRWQLLRRGRYVEFNLVYDRGTLFGLQTG
FT                   GNIEAILMSMPPFAHWAFDYAPEPGSPEAAMLAFLQPRDWASAGSERLP"
FT   sig_peptide     complement(258705..258773)
FT                   /locus_tag="Trad_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(258766..259806)
FT                   /locus_tag="Trad_0222"
FT   CDS_pept        complement(258766..259806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0222"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="COGs: COG0407 Uroporphyrinogen-III decarboxylase;
FT                   InterPro IPR006361:IPR000257; KEGG: gme:Gmet_0016
FT                   uroporphyrinogen decarboxylase; PFAM: Uroporphyrinogen
FT                   decarboxylase (URO-D); PRIAM: Uroporphyrinogen
FT                   decarboxylase; SPTR: C1XF70 Uroporphyrinogen decarboxylase;
FT                   TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D); TIGRFAM:
FT                   uroporphyrinogen decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13362"
FT                   /db_xref="GOA:D7CY02"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY02"
FT                   /protein_id="ADI13362.1"
FT                   /translation="MSLFLEAARGQDTARAPIWIMRQAGRYLSEYRALRARYSFWEMCR
FT                   TPELAAEVTLQPLRRFDLDAAILFQDIMTPLPPMGVEIDFSPGPVLKEPVRSAQQVRAL
FT                   RVPEGGEIAPFVAEAIRLIRAESPVPLIGFGGAPLTLATYLVQGSGSKDYDEFRQFLRY
FT                   APETAHALLDKLTDLSVRYLKVQLQAGAQAVQLFDSWAGLHDARVYREFAKPYNTRIFE
FT                   ALAAFGVPRLYIAVGALHLYGEIKDLPCEVVSVDWRVPLSHVRPLLPGKTLQGNLDPAV
FT                   LLAPEGVLRAEAERVLREGLGGPHIFNLGHGIMRQTDPERLAQLVAVVREFDRRAHTTP
FT                   EELSHA"
FT   gene            complement(260004..260765)
FT                   /locus_tag="Trad_0223"
FT   CDS_pept        complement(260004..260765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0223"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterProIPR001789:IPR001867:IPR011006:IPR016032:IPR
FT                   011991; KEGG: gme:Gmet_1291 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain protein; SMART: response
FT                   regulator receiver; SPTR: C1XV31 Response regulator with
FT                   CheY-like receiver domain and winged-helix DNA-binding
FT                   domain; PFAM: Response regulator receiver domain;
FT                   Transcriptional regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13363"
FT                   /db_xref="GOA:D7CY03"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY03"
FT                   /protein_id="ADI13363.1"
FT                   /translation="MTLPTTSTRKQHTTERATILIVEDERAIAEVVADNLRDEGYRTLV
FT                   ASDGPSGLERWRAERPDLVILDVMLPQLSGFDLCRTRRTEGDATPVLFLSAKGHPEDRV
FT                   AGLRAGGDDYLPKPFHLPEFLLRVENLLRRRGWGGEHGASAAASDTALRFGGHTVDFRS
FT                   WTASLADGRTELLSERELKILQLLSSRRGEVVSRDDILDAVWGDDAFPSSRTVDNFVVR
FT                   LRRLFEPDPARPIYFHTVWGVGYRFTPEGEA"
FT   gene            complement(260762..261934)
FT                   /locus_tag="Trad_0224"
FT   CDS_pept        complement(260762..261934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0224"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR005467:IPR003661:IPR003594:IPR004358:IPR 009082;
FT                   KEGG: dal:Dalk_0313 histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SPTR: C1XF72 Sensor
FT                   protein; PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13364"
FT                   /db_xref="GOA:D7CY04"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY04"
FT                   /protein_id="ADI13364.1"
FT                   /translation="MKRLRLTSQTATRIAFGVVVVFLLAQVTWWIVFQQRYIARVTRET
FT                   LSAWQRDAATVNLLLAFDDESAVRAQIEATYPHLRLVSTPEGFVRAEVDPAQLRAFRDA
FT                   QTGHLRMFAFEGPFYVLVMLAGLYFIALSLRAERDLKRRQQNFLNAVSHEFKTPLSTLK
FT                   LLLESVLYRSLSPAKQRDYLERMNSELRRLEATSEQVLAAARLEHALAVSRLREVDLND
FT                   ALREALAPLQGGLEARGARLKVHYCPEALPVSLDPAAFAIVLNNLLDNAVKYTPEADKP
FT                   ITIRLEGQRHLAVLHVEDRGVGLREGERRRIFDPFYRVGDELTRATSGVGLGLHLVRSV
FT                   TEVMNGWVRCDAPLDPRTGRGSRFSVVLPKRVGAATPERTPSLTPQDMTR"
FT   sig_peptide     complement(261860..261934)
FT                   /locus_tag="Trad_0224"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(261979..263067)
FT                   /locus_tag="Trad_0225"
FT   CDS_pept        complement(261979..263067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0225"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="COGs: COG0113 Delta-aminolevulinic acid dehydratase;
FT                   InterPro IPR001731:IPR013785; KEGG: scl:sce0016
FT                   delta-aminolevulinic acid dehydratase; PFAM:
FT                   delta-aminolevulinic acid dehydratase; PRIAM:
FT                   Porphobilinogen synthase; SPTR: C1XV33 Delta-aminolevulinic
FT                   acid dehydratase; PFAM: Delta-aminolevulinic acid
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13365"
FT                   /db_xref="GOA:D7CY05"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY05"
FT                   /protein_id="ADI13365.1"
FT                   /translation="MTPPKPQPHAPPNTAPEPHSPLALPRRPRRLRASPALRDLVAETR
FT                   LAPSDLIAPFFVIAGSGAEEPIGALPGVSRLSVDRLLRQLERGLELGVRAAVLFGVLGA
FT                   ADKDPRGVRAADPQGPVARALREARRAFGSDLVLITDVCLCGYTDHGHCGLLKATPRGV
FT                   VIDNDSSLAALAEMAVTHAEAGADLVSPSDMMDGRVGYLRGALDRAGFTGVGILAYTVK
FT                   YASAFYGPFREAAGSAPQGGTSPDGMLPPRDRRTYQMDPRNAREGLVETALDEAEGADM
FT                   LMVKPALAYLDVLWRMRAATPLPLAAYHVSGEYAALKAAARAGALDEASAVQESLWAIK
FT                   RAGADLIITYYALEAAAKGWLG"
FT   gene            complement(263064..263798)
FT                   /locus_tag="Trad_0226"
FT   CDS_pept        complement(263064..263798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0226"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="COGs: COG1587 Uroporphyrinogen-III synthase;
FT                   InterPro IPR003754; KEGG: rrs:RoseRS_1751 uroporphyrinogen
FT                   III synthase HEM4; PFAM: Uroporphyrinogen III synthase
FT                   HEM4; SPTR: C1XV34 Uroporphyrinogen-III synthase; PFAM:
FT                   Uroporphyrinogen-III synthase HemD"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13366"
FT                   /db_xref="GOA:D7CY06"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY06"
FT                   /protein_id="ADI13366.1"
FT                   /translation="MAPTVLLTHAEGRLEGLAEALAARGFQPVHLPLIATRPLPVSARA
FT                   ARELLGCDWLLFTSRSAVAAWCALGLPLAGARPRLGAVGEATARELAAHGGRAQLVGDP
FT                   PNAEGLLARFVERVSPPARVGLPCALDALPTLPEGLARAGFAVTRLPLYETVARAWPDT
FT                   LTLGGAETTIIVLASPSAAAALPQTVGERARLVALGPSTERALAARGWRACRAPTPDVS
FT                   GVTEAVLRAALHTHPPTAERSL"
FT   gene            complement(263798..264760)
FT                   /locus_tag="Trad_0227"
FT   CDS_pept        complement(263798..264760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0227"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="COGs: COG0181 Porphobilinogen deaminase; InterPro
FT                   IPR000860; KEGG: phe:Phep_3450 porphobilinogen deaminase;
FT                   PFAM: Porphobilinogen deaminase; SPTR: C1XF75
FT                   Porphobilinogen deaminase; TIGRFAM: porphobilinogen
FT                   deaminase; PFAM: Porphobilinogen deaminase, C-terminal
FT                   domain; Porphobilinogen deaminase, dipyromethane cofactor
FT                   binding domain; TIGRFAM: porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13367"
FT                   /db_xref="GOA:D7CY07"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY07"
FT                   /protein_id="ADI13367.1"
FT                   /translation="MSRSFSPLADLPRARYTGVVRIATRKSALALWQATWVRERLAALG
FT                   VATELVPLDTQGDRTQEAGTPFRLMPGQGFFTKAVQDAVLEGRADVAVHSHKDLPSARL
FT                   AGLELAAVTEREDPRDVLLVRPGAARPESAALPLVEGAVVGTSAARRQAQLRHLRPDVR
FT                   VAELRGNVPTRVRALREGRYDAVVLAAAGLARLALDLSDLTVYPLDPKRFVPAPAQGAL
FT                   ALEIRRGDAELAALLTELHAPDAYQTVAAERGLMGMLQGGCQLALGAYAALQGGELELT
FT                   AWYEGERVTVKHRSAEGAAYLAFDALGRPAPARAAAKEP"
FT   sig_peptide     complement(264695..264760)
FT                   /locus_tag="Trad_0227"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(264753..265964)
FT                   /locus_tag="Trad_0228"
FT   CDS_pept        complement(264753..265964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0228"
FT                   /product="Glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="COGs: COG0373 Glutamyl-tRNA reductase; InterPro
FT                   IPR015895:IPR006151:IPR016040; KEGG: sti:Sthe_1800
FT                   glutamyl-tRNA reductase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Tetrapyrrole biosynthesis, glutamyl-tRNA
FT                   reductase-like; PRIAM: Glutamyl-tRNA reductase; SPTR:
FT                   C1XV36 Glutamyl-tRNA reductase; PFAM: Shikimate / quinate
FT                   5-dehydrogenase; Glutamyl-tRNAGlu reductase, N-terminal
FT                   domain; TIGRFAM: glutamyl-tRNA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13368"
FT                   /db_xref="GOA:D7CY08"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY08"
FT                   /protein_id="ADI13368.1"
FT                   /translation="MERLALIGVSHRRGGAAALEAWQAAFKPPYSELAGLGFAEWVPIV
FT                   TCNRWDVVVALPKTMDVAQARALLTPTGQLCRPYAYTGDGALEQLTRIAASLDSLNPGE
FT                   DQIMAQVRSAFAAAQAAGSTGPLTSFAFHTALRIAKKVRREVALAPLKTSLFSLARPDL
FT                   LRALPQGGSVAVLGAGEMGSLAAKTLASEPGFDLLIVNRSAPRARQLARHLGARSSSLE
FT                   AFLAAPPPVDALVCATPVRALIDPLLVQRLPELKLIIDLGVPRNVHPEVIEASRVRVLD
FT                   VDTLQAAGRTRREALQEKLAAAEVILQEALEGALEAWTERQLGPSIQRLRQLYLATTLD
FT                   ALGDGVGSEEAARLAHRFAHVPVKGLRAVARTYGLEAAQMFLAEAGLGELRLGEAYAAD
FT                   ASRE"
FT   gene            complement(266226..266528)
FT                   /locus_tag="Trad_0229"
FT   CDS_pept        complement(266226..266528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0229"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="KEGG: vap:Vapar_4473 transcriptional regulator, LysR
FT                   family; SPTR: C5CK33 Transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13369"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY09"
FT                   /protein_id="ADI13369.1"
FT                   /translation="MQRTREELEAMSHSELVGRVLELQDLLREGLEVRNALHRVLNDIL
FT                   KVKADEVGAYADTPEELLSPEEHALKEAWARARHAVSNPLGAAAAMPDISGEEPL"
FT   gene            complement(266638..268155)
FT                   /locus_tag="Trad_0230"
FT   CDS_pept        complement(266638..268155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0230"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701:IPR016196; KEGG: mxa:MXAN_3677
FT                   major facilitator family transporter; PFAM: major
FT                   facilitator superfamily MFS_1; SPTR: C1XFT0 Arabinose
FT                   efflux permease family protein; PFAM: Major Facilitator
FT                   Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13370"
FT                   /db_xref="GOA:D7CY10"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY10"
FT                   /protein_id="ADI13370.1"
FT                   /translation="MTPPRPPTDAPLQQLPTPLADAAPAASVPHGTSSPVALPTPPAAP
FT                   DASPTPLPEAARTTPVRTVQARKAPTPAQVRRTLRLSVVEGGLTQAFLNWTTGSVIVGY
FT                   ALHLGASPTEIGLIGSVPMLAQVASPLAAWGAALFGRLKLLTALTALLGRGLWLLAAFL
FT                   PLLGVPEAQRPAFIVLLVMVSSFFQASTATLWASWLGEVVPEGRRGRYFGFRTGVVGVV
FT                   GMVANLGAGWLLDRLQAPLNFQVVLGVGVGAALVGVVLLLFHYEPQTLGARPGFRETFR
FT                   TPWQHPNFRRFLLFGIYWQAAVMLAAPFVFTYFLQHLQMSFTQIALWSAIASCTALLTT
FT                   SFWGHVADRYGNKAVLAIGTTLAGTAMPLSWMLATATHLWPVWLSAVFDALAWGAIGPA
FT                   IFNLALVSAPKDNRTAFIAMYSFATGVAGFVGGTLSGPLLLALSRLEGELLGFTWTGFH
FT                   TLFLLSGALRMQAWRLLKPVEETNAWRTRDVLRQVRFAWRGIGFPWR"
FT   sig_peptide     complement(268090..268155)
FT                   /locus_tag="Trad_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            268329..269027
FT                   /locus_tag="Trad_0231"
FT   CDS_pept        268329..269027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0231"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="COGs: COG0106
FT                   Phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribonucleotide (ProFAR) isomerase; InterPro
FT                   IPR006063:IPR006062:IPR011060:IPR013785; KEGG:
FT                   ddr:Deide_20190 putative 1-(5-phosphoribosyl)-5-((5-
FT                   phosphoribosylamino)methylideneamino)imid
FT                   azole-4-carboxamide isomerase; PFAM: histidine biosynthesis
FT                   protein;
FT                   PRIAM:1-(5-phosphoribosyl)-5-((5-phosphoribosylamin
FT                   o)methylideneamino)imidazole-4-carboxamideisomerase; SPTR:
FT                   C1XP87 1-(5-phosphoribosyl)-5-[(5-
FT                   phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase; TIGRFAM:
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase; PFAM: Histidine biosynthesis protein;
FT                   TIGRFAM: hisA/hisF family protein;
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13371"
FT                   /db_xref="GOA:D7CY11"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY11"
FT                   /protein_id="ADI13371.1"
FT                   /translation="MFEIFPAVDIQGGRAVRLVEGRAEDETVYFDNPVDAARHWVDRGA
FT                   TWLHLVDLDAAFGRGDNREVIARIAKLPCKCEVGGGVRSFEAAERLLDVVERVILGTAA
FT                   VTHPELLDALLARYGAERVAVSIDAKGGLVAVKGWTETSAVAATVLAERVTAQGVRHLI
FT                   YTDVARDGTLLGVDPEPVSLMRRACPHTLVAGGGVASERDLELYESLGLNGAIVGKALY
FT                   EGRVRYPRAA"
FT   gene            269038..269841
FT                   /locus_tag="Trad_0232"
FT   CDS_pept        269038..269841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0232"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="COGs: COG0266 Formamidopyrimidine-DNA glycosylase;
FT                   InterProIPR000214:IPR012319:IPR000191:IPR015886:IPR
FT                   010663:IPR010979:IPR015887; KEGG: dra:DR_0493
FT                   formamidopyrimidine-DNA glycosylase; PFAM: DNA
FT                   glycosylase/AP lyase, H2TH DNA-binding;
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; zinc finger Fpg domain protein; PRIAM:
FT                   DNA-formamidopyrimidine glycosylase; SPTR: Q9RX22
FT                   Formamidopyrimidine-DNA glycosylase; TIGRFAM:
FT                   formamidopyrimidine-DNA glycosylase; PFAM:
FT                   Formamidopyrimidine-DNA glycosylase H2TH domain;
FT                   Formamidopyrimidine-DNA glycosylase N-terminal domain; Zinc
FT                   finger found in FPG and IleRS; TIGRFAM:
FT                   formamidopyrimidine-DNA glycosylase (fpg)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13372"
FT                   /db_xref="GOA:D7CY12"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY12"
FT                   /protein_id="ADI13372.1"
FT                   /translation="MRRELEPYVRGRVILAATLVDAPPGPKYARLERAVGQRILAVTRR
FT                   GKFLILPLSGGDDLIIHLGMTGILSPEPAPKHVRVRLELSEGGALYFRDARRFGRFLVV
FT                   PSGAYEALPTLSAMGPEPLSAAFTGDALYRALQRSRTPIKPFLLSQKPVSGVGNIYADE
FT                   ALWRARIHPLTPANEVSRAKAAQLAGAIREVLAASLRAKGTTLQDYRTVNGEVGAYALQ
FT                   LQAYGRAEKPCPRCGSPLRKVTLGGRGTHFCARCQRPPRARPGAP"
FT   gene            269887..270273
FT                   /locus_tag="Trad_0233"
FT   CDS_pept        269887..270273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0233"
FT                   /product="thioesterase superfamily protein"
FT                   /note="COGs: COG0824 thioesterase; InterPro IPR006683;
FT                   KEGG: rpi:Rpic_3629 thioesterase superfamily protein; PFAM:
FT                   thioesterase superfamily protein; SPTR: B2U748 Thioesterase
FT                   superfamily protein; PFAM: Thioesterase superfamily;
FT                   TIGRFAM: conserved hypothetical protein TIGR00051"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13373"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY13"
FT                   /protein_id="ADI13373.1"
FT                   /translation="MPHRTDIQVRFSDTDAQGHLNNTAYAVYAELARADLLDALRGPDT
FT                   YLLLAEMTLRFQSQVRFGQAVHVTTDVQEVGESSVTLEQTVYADDEAAATVTSVVVLFD
FT                   ARAQAPKAFPERVRKRLEAGEPLG"
FT   gene            270513..270914
FT                   /locus_tag="Trad_0234"
FT   CDS_pept        270513..270914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0234"
FT                   /product="thioesterase superfamily protein"
FT                   /note="COGs: COG0824 thioesterase; InterPro IPR006683;
FT                   KEGG: sde:Sde_1856 hypothetical protein; PFAM: thioesterase
FT                   superfamily protein; SPTR: Q21JL3 Thioesterase superfamily;
FT                   PFAM: Thioesterase superfamily; TIGRFAM: conserved
FT                   hypothetical protein TIGR00051"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13374"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY14"
FT                   /protein_id="ADI13374.1"
FT                   /translation="MEPFRTDIQVRFSDTDALGHLNNIAYALYAEQARVDLFNRVLPRE
FT                   GRGSVFVILAHIALDFLRQIRFGEAVYVMTRVSKLGRTSVTLDQEVYADDELAAKVRSV
FT                   VVLFDFKAQQPTPLPEALRAQLEPAKEPA"
FT   gene            complement(270898..271458)
FT                   /locus_tag="Trad_0235"
FT   CDS_pept        complement(270898..271458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0235"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="COGs: COG0212 5-formyltetrahydrofolate cyclo-ligase;
FT                   InterPro IPR002698; KEGG: ttj:TTHA1611
FT                   5-formyltetrahydrofolate cyclo-ligase family protein; PFAM:
FT                   5-formyltetrahydrofolate cyclo-ligase; SPTR: C1XHH6
FT                   5-formyltetrahydrofolate cyclo-ligase; TIGRFAM:
FT                   5-formyltetrahydrofolate cyclo-ligase; PFAM:
FT                   5-formyltetrahydrofolate cyclo-ligase family; TIGRFAM:
FT                   5,10-methenyltetrahydrofolate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13375"
FT                   /db_xref="GOA:D7CY15"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY15"
FT                   /protein_id="ADI13375.1"
FT                   /translation="MSSAQREKGRLRRWAKGVRAKLETAALSQRVVQHVLAWPTFGAAQ
FT                   HVLIYLAFGGELELGGLLEAAPHKTFYATRTGSDGALTVHPLGAGGELRRHPYGFLQPP
FT                   PSAPTPPERIDLAFVPGLAFDPQGHRLGYGKGFYDRLLPQLRPGVAIVGVVPEALVVAQ
FT                   LPAERHDRRVTHLATERGLKPVL"
FT   gene            271559..271990
FT                   /locus_tag="Trad_0236"
FT   CDS_pept        271559..271990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0236"
FT                   /product="OsmC family protein"
FT                   /note="COGs: COG1765 redox protein regulator of disulfide
FT                   bond formation; InterPro IPR003718:IPR015946; KEGG:
FT                   ttj:TTHA1373 hypothetical protein; PFAM: OsmC family
FT                   protein; SPTR: Q72IX4 Putative uncharacterized protein;
FT                   PFAM: OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13376"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY16"
FT                   /protein_id="ADI13376.1"
FT                   /translation="MATKTTTVYHLVDKRFVGITPEGQRVMIDGETHAQTGMRPMELLL
FT                   NALGACAAYDIVEMLKKRRLEVRSYHIELTGERPDATPAPYTRIHAKHVFDVPGLDEKT
FT                   ATRFVDLGMNKYCSVAASLNAAISFEVHLQAAEGVRATT"
FT   gene            272124..274211
FT                   /locus_tag="Trad_0237"
FT   CDS_pept        272124..274211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0237"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="COGs: COG0855 Polyphosphate kinase; InterPro
FT                   IPR003414; KEGG: rrs:RoseRS_3717 polyphosphate kinase;
FT                   PFAM: Polyphosphate kinase; PRIAM: Polyphosphate kinase;
FT                   SPTR: A5UZL8 Polyphosphate kinase; PFAM: Polyphosphate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13377"
FT                   /db_xref="GOA:D7CY17"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY17"
FT                   /protein_id="ADI13377.1"
FT                   /translation="MAEPDLSDPKLYFNRELSWLQFNERVLEEAEDEENPLLERLKFLA
FT                   IFSTNLDEFIMIRYAGLKEQVAAGIVERSFDGLTPAEQLRAVSEALRPLIARHRKVLRQ
FT                   DVLPALEQHGLKLLSVGELAPSDREMVDDYFDRELFPVLTPLAVDSGHPFPRLPNLSFS
FT                   LLVELFDPDRGEAKTAVVQVPSVLPRFLRLPPLDDGDRTFRFVLSEEVIRSKVTALFPG
FT                   YEVRATYDFRLTRDADFEIAEDEADDLLQVIEDEVRKRRWGEAVRLEITARMPEHWADF
FT                   LRTTLKLSENDVYRVDNHLNVGDFMELTQLDLPELRYPPFNTRLPTEYRGRSDVFAIVR
FT                   QQDVLIHHPFHSFDAVLNMIEQAADDPDVLAIKQTLYRVGGRSPVVAALARASGNGKLV
FT                   TALVELKARFDEENNIVWARELERAGVHVVYGFAGLKTHCKALLIVRREGSEIRRYVHL
FT                   GTGNYNPGTSTVYTDFALLSCDPELGADVSELFNYLTGFSKQRSWRKLWVAPATLRGEL
FT                   AAAIEREEAHARAGGEGRIIAKMNSLVDPRVIRALYRASQAGVQCDLIVRGICCLRPGV
FT                   EGVSETIRVRSIVGRFLEHSRAFYFANGGDERLYLGSADWMQRNLTRRVEAVFPVEDPA
FT                   VKKKVMQVLDLCLRDNVKARELQPDGTYVRAKRKAGQRRLDAQERLLEISARRAALMGG
FT                   R"
FT   gene            complement(274208..274459)
FT                   /locus_tag="Trad_0238"
FT   CDS_pept        complement(274208..274459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dge:Dgeo_0322 hypothetical protein; SPTR:
FT                   Q1J1K9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13378"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY18"
FT                   /protein_id="ADI13378.1"
FT                   /translation="MSKELIESFLQGMRERHAEEIEAIELPEGTEAYLENRIQAGDVAT
FT                   LTFMIKLAYLMGLHTGYAAGAGGSGTTPPPPQRGPLQA"
FT   gene            complement(274456..274881)
FT                   /locus_tag="Trad_0239"
FT   CDS_pept        complement(274456..274881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0239"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /note="COGs: COG1803 Methylglyoxal synthase; InterPro
FT                   IPR004363:IPR011607; KEGG: dge:Dgeo_0241 methylglyoxal
FT                   synthase; PFAM: MGS domain protein; PRIAM: Methylglyoxal
FT                   synthase; SPTR: C1XHI8 Methylglyoxal synthase; TIGRFAM:
FT                   methylglyoxal synthase; PFAM: MGS-like domain; TIGRFAM:
FT                   methylglyoxal synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13379"
FT                   /db_xref="GOA:D7CY19"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY19"
FT                   /protein_id="ADI13379.1"
FT                   /translation="MKSVALIAHDKKKLDLAIFAKDHAEVLRRFPLIATSTTGGVLERK
FT                   AQLKVEKLLSGPQGGDLQVGARIAADEVIAVIFFRDPLTAQPHEPDVSALMRICDVHEV
FT                   PLATNLGTAEAIMAWLERQLGEEERRAERHEGEKEAR"
FT   gene            275138..278087
FT                   /locus_tag="Trad_R0009"
FT   rRNA            275138..278087
FT                   /locus_tag="Trad_R0009"
FT                   /product="23S ribosomal RNA"
FT   gene            278139..278255
FT                   /locus_tag="Trad_R0010"
FT   rRNA            278139..278255
FT                   /locus_tag="Trad_R0010"
FT                   /product="5S ribosomal RNA"
FT   gene            278299..278374
FT                   /locus_tag="Trad_R0011"
FT   tRNA            278299..278374
FT                   /locus_tag="Trad_R0011"
FT                   /product="tRNA-Gly"
FT   gene            278608..280206
FT                   /locus_tag="Trad_0240"
FT   CDS_pept        278608..280206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0240"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="COGs: COG0815 Apolipoprotein N-acyltransferase;
FT                   InterPro IPR003010:IPR004563; KEGG: ttj:TTHA0484
FT                   apolipoprotein N-acyltransferase; PFAM: Nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase; SPTR:
FT                   C1XLY3 Apolipoprotein N-acyltransferase; TIGRFAM:
FT                   apolipoprotein N-acyltransferase; PFAM: Carbon-nitrogen
FT                   hydrolase; TIGRFAM: apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13380"
FT                   /db_xref="GOA:D7CY20"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY20"
FT                   /protein_id="ADI13380.1"
FT                   /translation="MFWVRALLVLACGSLLSAAFPPLGLWPFVVSLGPVLLLSANAPRK
FT                   RDAFWAGFFCAVGFFFLHLLWLPQSFAPYSGGLFWLLYPPLIAVLGCFWGIVTFAARAL
FT                   GGRGAGALWLLPALWVLMEWARTQGVFAFPWGALGYVWVGTPLVQLADLAGVYGVSLVT
FT                   LVALALSVSPFAYRRPRATRGRRARQPVWRPRVGIAAALLGALALPVAGYGYGTHRLRT
FT                   WDVAVDRRALLVQGSTDPYGRALELEGELELYTRLTREGVGEGPAPDLVVWPEGVTLEL
FT                   LASGLDLVHWGAQAVRDEIQAAAGGAPVITGGGAIDGREAFSASNSAFSLEGGNVTDRY
FT                   DKVYLVPFGEFFPLIDVLTPVYRTVFGWFGYPLLQSRPPGQEIRPLTLQEVVAAAYICY
FT                   ESVFPQVPRTMVARGAEVLVNISNDAWFGFGGGAEQHFAMGTVRAIETRRHLLRAGNDG
FT                   ITAVVDPLGRVGARLPRGERGSLEVSYSAADVITPYVRFGDLLILVLGGYVALFSGARA
FT                   VKAQASRTAVIVVRT"
FT   sig_peptide     278608..278727
FT                   /locus_tag="Trad_0240"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(280250..280921)
FT                   /locus_tag="Trad_0241"
FT   CDS_pept        complement(280250..280921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0241"
FT                   /product="TrkA-N domain protein"
FT                   /note="COGs: COG0569 K+ transport systems NAD-binding
FT                   component; InterPro IPR003148:IPR006037:IPR016040; KEGG:
FT                   dge:Dgeo_1584 TrkA-N; PFAM: TrkA-N domain protein; TrkA-C
FT                   domain protein; SPTR: Q1IY05 K+ transport system,
FT                   NAD-binding component; PFAM: TrkA-N domain; TrkA-C domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13381"
FT                   /db_xref="GOA:D7CY21"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY21"
FT                   /protein_id="ADI13381.1"
FT                   /translation="MKAKQFLVIGAGRFGSALATTLYEFGHEVVVVDRSEERVERIMDR
FT                   VTHAVILDATDEEALAKLGLNTFDRVVVAIGNNLEASILSIVAAKNRGASYVISKATSE
FT                   IAARVMLKVGADQVVRPEHDMGVRVAKTLATPSIVDAFPLGENYEVIEFQAQRNLCGKL
FT                   RDLKLANRFGVEVIAVNRNGKLELRPGPDFVVSPGDNVVLIGETRALKRLRDHFARVSA
FT                   A"
FT   sig_peptide     complement(280865..280921)
FT                   /locus_tag="Trad_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(280997..282355)
FT                   /locus_tag="Trad_0242"
FT   CDS_pept        complement(280997..282355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0242"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /EC_number="3.6.3.14"
FT                   /note="COGs: COG0168 Trk-type K+ transport systems membrane
FT                   components; InterPro IPR004772:IPR003445; KEGG:
FT                   dge:Dgeo_1583 K+ transporter trk; PFAM: cation transporter;
FT                   PRIAM: H(+)-transporting two-sector ATPase; SPTR: Q1IY06 K+
FT                   transporter Trk; TIGRFAM: potassium uptake protein, TrkH
FT                   family; PFAM: Cation transport protein; TIGRFAM: potassium
FT                   uptake protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13382"
FT                   /db_xref="GOA:D7CY22"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY22"
FT                   /protein_id="ADI13382.1"
FT                   /translation="MVDRGSIRPPRRAAPSPAKIIALYFVSAIAVGTLLLWLPISHAPG
FT                   AEIGLLEALFTATSALCVTGLVVVDTATAWSIFGKVVIMLLIQVGGLGIVTLGTLVALL
FT                   LGRRVGFRERLRAAAQVNALQTGGIVKLVRTIFLISLGFEAVGALLLYPTFAALHGPGM
FT                   GAFYAFFHAVSAFNNAGFALYSENLTGFVRDPTVNLVLAALFITGGLGFLVHLNLWARL
FT                   RHGSHFQLTLQSRFVLLTSLGLGLLGWVAVCLFEWTNPQTLGALPWPSRLLAGFFQGVT
FT                   PRTAGFNTLDYAQVREPTLLVTMALMFIGGSPGSTAGGIKTVTFAVLAASAWSMVRGRG
FT                   ELTAFGRRVTTETVVKAGSVALLSLGIVFGAMLLLSISETVPLVPLMFEAFSAFGTVGL
FT                   SLNLTPELSAPGQLIVTLLMYLGRIGPLTFAVALVQEPRDSPITYPDEGVMIG"
FT   sig_peptide     complement(282221..282355)
FT                   /locus_tag="Trad_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(282573..283340)
FT                   /locus_tag="Trad_0243"
FT   CDS_pept        complement(282573..283340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0243"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR002198:IPR002347:IPR016040;
FT                   KEGG: hma:rrnAC3004 3-ketoacyl-(acyl-carrier-protein)
FT                   reductase; PFAM: short-chain dehydrogenase/reductase SDR;
FT                   SPTR: C0G1P3 Short-chain dehydrogenase/reductase SDR; PFAM:
FT                   short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13383"
FT                   /db_xref="GOA:D7CY23"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY23"
FT                   /protein_id="ADI13383.1"
FT                   /translation="MDKLLAGKVALITGGSSGIGRSIALRFAEHGASVVIADLQAEPRE
FT                   GGTPVHEEVQARGARAAFVRCDVTALGELEAAVDAADAFGGLDVMVNNAGIFRGKDVLE
FT                   VTEDEFDTMMAINVKGVFFGSQLAAKRMIRKGGGSIINLSSVAGLQGTAQYVPYCASKG
FT                   AVRLMSYALADELGPKGIRVNNIHPGLIETTMTTGDVALFGAESGEQMLQSIPLGRGGK
FT                   PEDVADVALYLASDLSRYVTGASLVVDGGLSRF"
FT   gene            283475..284830
FT                   /locus_tag="Trad_0244"
FT   CDS_pept        283475..284830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0244"
FT                   /product="TrkA-N domain protein"
FT                   /note="COGs: COG0569 K+ transport systems NAD-binding
FT                   component; InterPro
FT                   IPR003148:IPR006037:IPR006036:IPR016040; KEGG: ttj:TTHA1174
FT                   potassium transporter peripheral membrane component; PFAM:
FT                   TrkA-N domain protein; TrkA-C domain protein; SPTR: C1XSR7
FT                   K+ transport system, NAD-binding component; PFAM: TrkA-N
FT                   domain; TrkA-C domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13384"
FT                   /db_xref="GOA:D7CY24"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY24"
FT                   /protein_id="ADI13384.1"
FT                   /translation="MLGRMNVVIVGGGEIGSQIAEALQHSHNITIVDTDPDRAAAFEAM
FT                   DVRFVHGNGADPEDLRTAQAGRADAFIACTINDDVNVLACLAAKGLGAKETMAFVTRKR
FT                   YVEAFAETGSMKTVGLVIDRLLWPQRTLAKQMVDIVRVPRAVISTAFADGRVRLLEYKL
FT                   EPGDPFLHQPLAEVRLPANVLVAGAIQGDAFVIPSGRTVLAPGDKAIFMGTANSMRAFE
FT                   ARFARRKRHPNVVIIGGGNVGFMVAEELQGDGAHLTVIEQDEARCERLAKWLPGVLVLR
FT                   GDGTDLELLESERIEDADALLALTDDDAKNLLVSLLGKQLGIPKVITRVGRSRNRRLFE
FT                   RVGIDIPLTPRTAAVQEVLNWLHLDNVEHLASIEDRAEVMDVVYPPSCKVGRIRDLGAP
FT                   PRSLIGAVLRGDEVIIPTGETTLRHGDHLYIVTTPDNVGAVQRWLGQLQSVY"
FT   gene            284849..286315
FT                   /locus_tag="Trad_0245"
FT   CDS_pept        284849..286315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0245"
FT                   /product="cation transporter"
FT                   /note="COGs: COG0168 Trk-type K+ transport systems membrane
FT                   components; InterPro IPR003445; KEGG: ttj:TTHA1173 trk
FT                   system potassium uptake protein (TrkG); PFAM: cation
FT                   transporter; SPTR: B7A9Q5 Cation transporter; PFAM: Cation
FT                   transport protein; TIGRFAM: potassium uptake protein, TrkH
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13385"
FT                   /db_xref="GOA:D7CY25"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY25"
FT                   /protein_id="ADI13385.1"
FT                   /translation="MRGRFTPFVVGVGLLGLALLNLVFALYALLIGDPTLGFVWTVAFA
FT                   LLVGAPLTVIGRQDARPARREALIGVSLLWLSLTFVGAVPYVVNGGMGWIDAFFESSSG
FT                   FTATGATALNVFEGFAPSMFMYRAVSQWLGGVGIILLFIAVLPQLAIAGRQLFFAELPG
FT                   PTEEKLTPRLSQTASAVLFIYLSLTLLCTLAYRGAGMGWFDALAHTFTTVSAAGFSPYA
FT                   NSFEGFDAPVEWVAIVFMFFAGISFALYQRLLQGRTWFFWHDVELRAYVAIIAAVSALV
FT                   TLGLLELYEPLEAVRYATFQVLSILTTTGYASADFAAWPERTQALLVMLMFVGGSAGSA
FT                   AGGVKIVRWLMVGQSTVREIRRTLHPRVVMPIYLGRVTIPEEVMRAVSAFVALFFGTVG
FT                   FSTLVLAWLGADLVTAFTASVACLGNVGPGLAGVGPMSDFSHLHPVSRVLLSLMMIAGR
FT                   LELLTMLVIFDRRFWILPRRRPRGRATHSW"
FT   sig_peptide     284849..284923
FT                   /locus_tag="Trad_0245"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            286372..288231
FT                   /locus_tag="Trad_0246"
FT   CDS_pept        286372..288231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0246"
FT                   /product="putative CBS domain and cyclic
FT                   nucleotide-regulated nucleotidyltransferase"
FT                   /note="COGs: COG2905 signal-transduction protein containing
FT                   cAMP-binding and CBS domains;
FT                   InterProIPR000595:IPR000644:IPR005105:IPR018821:IPR
FT                   018490:IPR014710:IPR013785; KEGG: mgm:Mmc1_1043 cyclic
FT                   nucleotide-binding protein; PFAM: protein of unknown
FT                   function DUF294 nucleotidyltransferase putative; CBS domain
FT                   containing protein; cyclic nucleotide-binding; Domain of
FT                   unknown function DUF294, putative nucleotidyltransferase
FT                   substrate-binding; SMART: cyclic nucleotide-binding; CBS
FT                   domain containing protein; SPTR: C5SA68 Cyclic
FT                   nucleotide-binding protein; PFAM: Putative
FT                   nucleotidyltransferase substrate binding domain; CBS
FT                   domain; Cyclic nucleotide-binding domain; Putative
FT                   nucleotidyltransferase DUF294"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13386"
FT                   /db_xref="GOA:D7CY26"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY26"
FT                   /protein_id="ADI13386.1"
FT                   /translation="MDAELAEVRDFLRAHAPFDALPEAALARLPSKLSVRYFRRGTRIL
FT                   TCGDPNDALFVVRSGAVELRDAEGALEARLGAGEVFGYPSLLSDGRAKTTATAIEDTLL
FT                   YDLPGGVFRALMEESEAFAQFFAEARTLRLQRALRGLHRSTELPLLNVRVSDLALRPPV
FT                   TVTPEVSVQRAAEVMYEHLISSVVVLEEGRVVGILTDRDLRGRVVAQGRPYSTPVREVM
FT                   TPAPRTVDQGAYAFEALLTMTRFNIHHLPVTGGGRLLGLVSSTDLMRLQTSSPVYLVGD
FT                   LLKQTTVAGLAEVSARLPETVRRLVEADATADEVGRLVTTVADTLEGRLLELAEAALGP
FT                   PPVPYAWVVLGSRARLEATVGSDQDNALVLADEVTPAQDAYFAELARFVSDALAACGFP
FT                   YCPGGVMATNPAWRQPLGAWRRRFRGWLEQPEPEALLHSTIFFDMRALRGEDALAEALL
FT                   SEVAARAPQHGAFLAHLAKNALQHGPPLGFFRQFVLEGGGEHAQTLDLKHKGIAPIVDL
FT                   ARVYALASGRREVSTRARLRAAAATGVLSDEGARDLEDALEFIAYLRLRHQGQQVRAGQ
FT                   RPDHFVSPAELSPFERRHLKDAFSIVRGMQSALATRFQTRFVA"
FT   gene            288241..288915
FT                   /locus_tag="Trad_0247"
FT   CDS_pept        288241..288915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0247"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="COGs: COG0847 DNA polymerase III epsilon subunit and
FT                   related 3'-5' exonuclease; InterPro
FT                   IPR013520:IPR012337:IPR006055; KEGG: cef:CE1385 putative
FT                   DNA polymerase III epsilon subunit; PFAM: Exonuclease RNase
FT                   T and DNA polymerase III; SMART: Exonuclease; SPTR: C5SA67
FT                   Exonuclease RNase T and DNA polymerase III; PFAM:
FT                   Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13387"
FT                   /db_xref="GOA:D7CY27"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY27"
FT                   /protein_id="ADI13387.1"
FT                   /translation="MWDWVLEARRRWWRRRRVAPPLQRFLAHALPDPRGSCRDAEYVAV
FT                   DLETTGLRPRWDAPLSVGWVLVRAGAIELATARYAVLRAKREVAQSATVHGLTDDAVAD
FT                   GEDAAAVLAELLAVLAGRVLVAHHAAIELRFLDRLCREHFGGPLLVRVVDTLALAARSA
FT                   ERHGAVDENALRLHAVRARYGLPRYAAHSALSDALATAELLLALTAEREGSGGLPLRRL
FT                   LR"
FT   sig_peptide     288241..288327
FT                   /locus_tag="Trad_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(288989..291532)
FT                   /locus_tag="Trad_0248"
FT   CDS_pept        complement(288989..291532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0248"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="COGs: COG1404 Subtilisin-like serine protease;
FT                   InterPro IPR000209:IPR003137:IPR010435; KEGG: scl:sce3689
FT                   subtilisin like protease; PFAM: peptidase S8 and S53
FT                   subtilisin kexin sedolisin; protease-associated PA domain
FT                   protein; protein of unknown function DUF1034; SPTR: C1YHR1
FT                   Subtilisin-like serine protease; PFAM: PA domain; Fn3-like
FT                   domain (DUF1034); Peptidase inhibitor I9; Subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13388"
FT                   /db_xref="GOA:D7CY28"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR010435"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034187"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY28"
FT                   /protein_id="ADI13388.1"
FT                   /translation="MRKTLVTLVVGVCVALSACANVQRDTLESVEPQASEVRPTNPLPK
FT                   PPSGIIDETPRYWFVQFAGPPTARGGNAATLRQQRAAFRSAAAGEGISYSERYNFERLF
FT                   NGLSVRATASELGKLSRLPNVTAVYPVIDVPRPEPRAVSEPDMQFALAMTGADTAQNEL
FT                   GLTGRGVKVGVIDSGVAVNHPEFRGRIVAGYDFVGDAFNGSNTPQPDPNPDDCGGHGTH
FT                   VAGIIGAAGERVRGVAPEVSLGAYRVFGCEGSTTADIIILALERALADGMDVVNMSLGA
FT                   AYQWPQYPSAQAADNLVDAGVVVVASIGNSGATGVYSAGAPGVGHKVIGVASYDNAAVE
FT                   LNLMTVAGRSIGYSPMSGAAAPPTSGSAEIVWVGRACNGDALASDPSGKVALIVRGDCT
FT                   FAEKALNAQNAGAIAAVVHNNVAGNFAGSVSGNVTIPVVSISQADGLFIRERAPTTLTW
FT                   ENARGVFPNPTGGLISSFSSYGLAPDLTLKPDLGAPGGSITSTYPLHLGGYATLSGTSM
FT                   SAPHVAGAVALLLQARPNTRAADVRGLLQNTAQPKPWGLNPNIGFLDAVHRQGAGMINI
FT                   PAAIQGATTVSPSKLSLGESQGGAFSTTLTVRNTSSATMSYTLRNRGNTIATGGNTYTP
FT                   SFFASSPNVTFSQNTLTVPAGGSATVNVTITPNPALPDLSVYGGYLELVTADGAVAASV
FT                   PYSGFKGDYQAIRVLEPTRFGFPWLAKRQDGAYVHQPSNTTFTMQGDDIAYVVAHFEHQ
FT                   SRVVKLEVVPLRQVGGARDLTVFESEFFGRNSTPEGIFAFSWDGSAKVNGRRTPLPMGD
FT                   YQLKLTVQKALGDPNNPNHFETWTSPVITISRSGR"
FT   sig_peptide     complement(291473..291532)
FT                   /locus_tag="Trad_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            291891..292769
FT                   /locus_tag="Trad_0249"
FT   CDS_pept        291891..292769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0249"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: dra:DR_2393 hypothetical
FT                   protein; PFAM: protein of unknown function DUF6
FT                   transmembrane; SPTR: C1XGC7 Predicted permease, DMT
FT                   superfamily; PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13389"
FT                   /db_xref="GOA:D7CY29"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY29"
FT                   /protein_id="ADI13389.1"
FT                   /translation="MSAPLSPRLGLVLLVVITLIWGSTFVIVKETLATLSPALLLALRF
FT                   SVAALLLVWVPLPRAVWRAGLVLGVLSFLGFATQTVGMTMTTASKAAFITGFSVVLTPL
FT                   LSALWFRLRVPARAYVAALTALAGLGLMTSTGPVGVSAGDFWVLGTALAYALYIIYTGE
FT                   AAQRHGALALSAAQLWPMAALAWAWAWPQLGDLRGITPGAAFSVLYLAAVATALVAVMQ
FT                   IAAQRVVAAHVAALVFVLEPVFAAGFAYVLLGESLGFWGWVGAALVGAAMLLSELRVRA
FT                   EEPLPAPPTPH"
FT   sig_peptide     291891..291989
FT                   /locus_tag="Trad_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(292766..293422)
FT                   /locus_tag="Trad_0250"
FT   CDS_pept        complement(292766..293422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0250"
FT                   /product="MOSC domain containing protein"
FT                   /note="COGs: COG2258 conserved hypothetical protein;
FT                   InterPro IPR005302:IPR011037:IPR015808; KEGG: dra:DR_1051
FT                   hypothetical protein; PFAM: MOSC domain containing protein;
FT                   SPTR: C1XRA3 Uncharacterized conserved protein; PFAM: MOSC
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13390"
FT                   /db_xref="GOA:D7CY30"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY30"
FT                   /protein_id="ADI13390.1"
FT                   /translation="MQLLSVNVGQARAIVAKSGRSGIFKRATTERVRVTRDGLLGDTIC
FT                   DTENHGGPDQAVYLYGAPDYAWWSEQLGRTLAPGTFGENLTVSGLESATLQVGDRFRVG
FT                   EVVLEVTAPRIPCVTLAVRMGDPAFVKRFRHAERPGVYCRVLHEGDVWAGAEVRLEPYT
FT                   GATVGVLELFRDFFRPERDEKTLRRHLAAPIASRDRAAKEAALAALRERGDPHAP"
FT   sig_peptide     complement(293342..293422)
FT                   /locus_tag="Trad_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(293689..294282)
FT                   /locus_tag="Trad_0251"
FT   CDS_pept        complement(293689..294282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0251"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbb:CLD_2728 mannitol operon repressor; SPTR:
FT                   B1IMR2 Probable mannitol operon repressor; manually
FT                   curated; PFAM: Mannitol repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13391"
FT                   /db_xref="InterPro:IPR007761"
FT                   /db_xref="InterPro:IPR038026"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY31"
FT                   /protein_id="ADI13391.1"
FT                   /translation="MSQAKLPEYAAQAKKRVDAFRASLEEESDRGLVLVGGAFLEEELK
FT                   ELLRVYFALQRRLLNPASQSAQELENTVKSLFSFQGGGPLSTFAGKSNLAYALGLLEKY
FT                   EFRSLGSFSKLRNKFAHNIESNTLQSPQVVDLVKNFLDSKKVERDAVADRVAKLAYQLI
FT                   ARTVILSQDDLPAETTLQLLGFARGDPYGLSQKT"
FT   gene            complement(294346..296295)
FT                   /locus_tag="Trad_0252"
FT   CDS_pept        complement(294346..296295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0252"
FT                   /product="acetate/CoA ligase"
FT                   /EC_number="6.2.1.1"
FT                   /note="COGs: COG0365 Acyl-coenzyme A synthetase/AMP-(fatty)
FT                   acid ligase; InterPro IPR011904:IPR000873:IPR020845; KEGG:
FT                   ttj:TTHA1248 acetyl-coenzyme A synthetase; PFAM:
FT                   AMP-dependent synthetase and ligase; SPTR: C1XFH2
FT                   Acetyl-coenzyme A synthetase; TIGRFAM: acetate/CoA ligase;
FT                   PFAM: Domain of unknown function (DUF3448); AMP-binding
FT                   enzyme; TIGRFAM: acetate--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13392"
FT                   /db_xref="GOA:D7CY32"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY32"
FT                   /protein_id="ADI13392.1"
FT                   /translation="MASIESVMQEGRRFRPPESFRARAKLKDAADYERLYRQSLDDPEG
FT                   FWGAVANELHWFKPWERVLEWEEPFVKWFVGGQTNLSYNCLDLQVERGRGDKKAILWEG
FT                   EPGDTRTYTYRELLAEVSKLANTLKGLGVGKGDKVAIYLPMIPQAVIAMLACARIGAVH
FT                   SVVFGGFSSAALADRVNDARAKVIITADGGYRRGSVFALKPLVDEALERCESVEHVIVV
FT                   RRGENDVQMQPGRDRWYHELIESASDVCPAEPMDAEDPLFILYTSGSTGKPKGVLHTTG
FT                   GYQTYTYLTVKYIFDLRDDDLYWCPADVGWITGHSYIVYGPLLNGVTQLMYEGVPTHPA
FT                   PDRHWEMVARYGVTIYYYAPTAIRAFMKAGEEYPKKHDLSSLRLLGTVGEPINPEAWMW
FT                   YHRVIGGERCPIVDTWWQTETGGIMITTLPGVHDTKPGSAGKPFFGVDAAVMDLEGNEQ
FT                   EAGSGGYLVIKRPWPSMLRTVYGDDDRYRAQYWSEIPHVYFAGDGARRDDEGYFWIMGR
FT                   VDDVVNVSGHRLGTAEIESALVSHPAVAEAAVVGRPDEVKGQAIVAFVTLEGKREGSEA
FT                   LYQELRAHVTKEIGAIARPDDIRFADALPKTRSGKIMRRLLRNIAAGEEASGDISTLED
FT                   KGVVEKLLRPGVSR"
FT   sig_peptide     complement(296230..296295)
FT                   /locus_tag="Trad_0252"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            296741..298630
FT                   /locus_tag="Trad_0253"
FT   CDS_pept        296741..298630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0253"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.1"
FT                   /note="COGs: COG0365 Acyl-coenzyme A synthetase/AMP-(fatty)
FT                   acid ligase; InterPro IPR000873:IPR020845; KEGG:
FT                   tth:TTC0886 acetyl-coenzyme A synthetase; PFAM:
FT                   AMP-dependent synthetase and ligase; SPTR: Q72J93
FT                   Acetyl-coenzyme A synthetase; PFAM: Domain of unknown
FT                   function (DUF3448); AMP-binding enzyme; TIGRFAM:
FT                   acetate--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13393"
FT                   /db_xref="GOA:D7CY33"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY33"
FT                   /protein_id="ADI13393.1"
FT                   /translation="MAKLETLAAHQDEVAPPRAVRERATLQDYEAQYRRSLGDPEGYWA
FT                   EVAEAFSWVTPWQRVLEWDGVHHRWFVGATTNITLNALDRHVAAGKKNKLAYLWLGEDG
FT                   RERALTYGMLLAQVSRVANGLRRLGVVKGDRVLIYMPLTLEGVIAMLACARIGAVHSVV
FT                   YAGFAAGALRARIEDAQAKVVITGDVGYRRGKRVDLLTIARSAVRPLEFVEHVVVFRRE
FT                   AREAAQGEAPLEGLEVPWERLLEEPPHCDAEVVDAEHPLYILYTSGTTGKPKGVVHVHG
FT                   GYMVGTAHQLRTFYDLDEDDVFWNMSDIGWAVGHSYIAYAPLVNGLTTIFREGAPDTPH
FT                   PGAAWEIVERYGVTAILTAPTVVRMWMRYGEEPLRGRHLDTLRLLAVAGEPLNPEAFRW
FT                   AQTHLMGDHGMVRDNWWQTETGAPTLGTFPTQAYRPGFVGRPVLGVEAAVLSETGERLP
FT                   PNEGGLLALTRPFPNLLRTIHGAPERYEAAWLEFPGYYLTGDVAVCDEAGRFSVLGRAD
FT                   DVLSVAGHRIGTADVESALVSHPAVAEAAVIGVPDELKGEAIVAFVVLRSGQTASPEAL
FT                   TEHVRNELGAIAAPAEVHLVETLPKTRSGKIMRRLLRAQALGQDPGDTSTLES"
FT   gene            298705..299070
FT                   /locus_tag="Trad_0254"
FT   CDS_pept        298705..299070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0254"
FT                   /product="putative solute symporter protein"
FT                   /note="COGs: COG4327 membrane protein; InterPro IPR019886;
FT                   KEGG: ttj:TTHA0820 hypothetical protein; SPTR: Q72K59 RNA
FT                   polymerase sigma-32 factor; TIGRFAM: putative solute
FT                   symporter protein; PFAM: Protein of unknown function,
FT                   DUF485; TIGRFAM: probable solute:sodium symporter small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13394"
FT                   /db_xref="GOA:D7CY34"
FT                   /db_xref="InterPro:IPR019886"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY34"
FT                   /protein_id="ADI13394.1"
FT                   /translation="MSSKKMSDKKRRASRVVVRPESSPKTSRPASKGPAPRADQATLDA
FT                   YWRRNLSLTLTLLAIWFIAGYVLAIIFAPALNAYTFLGAPLGFWIAQNGAIYVFVLLIL
FT                   IYAVRMNRLDDEFDVGE"
FT   gene            299074..300741
FT                   /locus_tag="Trad_0255"
FT   CDS_pept        299074..300741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0255"
FT                   /product="putative sodium symporter protein"
FT                   /note="COGs: COG4147 symporter; InterPro
FT                   IPR001734:IPR019899:IPR019900:IPR018212; KEGG:
FT                   cts:Ctha_1886 Na+/solute symporter; PFAM: Na+/solute
FT                   symporter; SPTR: Q1NXB2 Na+/solute symporter; TIGRFAM:
FT                   putative sodium symporter protein; SSS sodium solute
FT                   transporter superfamily; PFAM: Sodium:solute symporter
FT                   family; TIGRFAM: probable sodium:solute symporter, VC_2705
FT                   subfamily; SSS sodium solute transporter superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13395"
FT                   /db_xref="GOA:D7CY35"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR019899"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY35"
FT                   /protein_id="ADI13395.1"
FT                   /translation="MTNVQLWTLVFIVLTFGLYIGIAIWSRVSTTSGFYVAGQGVPSVF
FT                   NGMATAADWMSAASFISMAGLISFLGFDGAIYLLGWTGGYVLLALLLAPYLRKFGKFTV
FT                   PEFIGDRYYSGTARVVAALCAIVISFVYVAGQMSGVGIAFSRFLQVDLAIGVIVGMVIV
FT                   ALYAVLGGMKGITYTQVAQYLVLIIAYTIPAVAIALTLTGNPVPQLAFGEIASRLDGIE
FT                   VDLGFGEYTSPFTNISGLNVFLITASLMCGTAGLPHVIIRFYTSKSVRGARWTGFFALL
FT                   FIAILYTSAPAVAAFARYNLIQTVSGQPYADLPEWVRNWEATGLLTFNDLDGDGIVTYT
FT                   AGPDNELTINPDIIVLANPEIAGLPGWVIGIVVAGGLAAALSTASGLLLVIGSSFSHDI
FT                   YKRFINPNASEANELIVARISVLLGILVAGYLGINPPGFVGEVVAFAFGLAAASFFPAI
FT                   VLGIFDKRTNKQGAIAGMLVGIIFTATYIILTAPRILGMEPFLFGITAQGIGPVGMALS
FT                   FLVTYIVSRMTAPPPVELQEFVENIRYPRGAGAAHAHD"
FT   sig_peptide     299074..299148
FT                   /locus_tag="Trad_0255"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(301045..301548)
FT                   /locus_tag="Trad_0256"
FT   CDS_pept        complement(301045..301548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0256"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pjd:Pjdr2_0568 hypothetical protein; SPTR:
FT                   C6CRG5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13396"
FT                   /db_xref="GOA:D7CY36"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY36"
FT                   /protein_id="ADI13396.1"
FT                   /translation="MPAAHPHAVGRAVRVRLTRDDVMYYTWVQALARPVLPFLLYSFVL
FT                   LTFASILGLWPAGRAFALAALVPLLGYLLWVWLVGRGLWSKYPQLRAPRTYRFDEAGYT
FT                   IQTPENTVKVRYDELSRLVSSRRALYLVRRDGSADILPRSALPEGLEGWLQAKVPETER
FT                   SSFL"
FT   gene            301637..302107
FT                   /locus_tag="Trad_0257"
FT   CDS_pept        301637..302107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0257"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="COGs: COG0245 2C-methyl-D-erythritol 2
FT                   4-cyclodiphosphate synthase; InterPro IPR003526:IPR020555;
FT                   KEGG: ddr:Deide_02620 putative 2-C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase, (MECPS, MECDP-synthase);
FT                   PFAM: MECDP-synthase; PRIAM: 2-C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; SPTR: C1CZ33
FT                   2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase;
FT                   TIGRFAM: 2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase; PFAM: YgbB family; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13397"
FT                   /db_xref="GOA:D7CY37"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY37"
FT                   /protein_id="ADI13397.1"
FT                   /translation="MVTLRIGFGEDAHRLAPGRPLVLGGVELPSPRGAVAHSDGDALLH
FT                   ALADALLSSFALGDIGDFFPPSDPAFSDLDSREIVRRALAEVRARGGELVNAALTVTLD
FT                   APKLGPHRAAITGRVAALLGLPEDRVGVGFKTSEGLAPDHVQARATVLVAAT"
FT   gene            complement(302123..303241)
FT                   /locus_tag="Trad_0258"
FT   CDS_pept        complement(302123..303241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0258"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amr:AM1_3977 heat shock protein HtpX; SPTR:
FT                   B0C9E9 Probable protease htpX homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13398"
FT                   /db_xref="GOA:D7CY38"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY38"
FT                   /protein_id="ADI13398.1"
FT                   /translation="MSYARARLYLGISCVGMWTVLSLFLLGFRVPERVFSVSTLPSWSD
FT                   LTQLVGATFVYAFLQGAFDLFGGYVLPKEYGRSDEALSTFMLRWFRGAALHGALLVLFG
FT                   LALLNASRLGGFALALALFLALSALLVWGQVPLAKLVGGLSAAPHRAPQGALVLRAPQR
FT                   HFTGGVAGPPRRSRVVLPEAWGRDPGGAAYDALVRRKEALLARGAYARGLLLALGWNTV
FT                   GFALAYAAAGGAAHVAGLVSLSLWSTLWAFIGLLLLPTPSRVGVFAADRYALEAGVDRA
FT                   ALASALVRLERDQDDEPSRPKGVETIFHPIPATQRRLAALAASGPAPAEHWAPWHPARL
FT                   ALFLAWANLSLLSRAVHCNIGRPEVWVFLPSD"
FT   sig_peptide     complement(303134..303241)
FT                   /locus_tag="Trad_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(303539..304684)
FT                   /locus_tag="Trad_0259"
FT   CDS_pept        complement(303539..304684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0259"
FT                   /product="S-layer domain protein"
FT                   /note="InterPro IPR001119:IPR005474; KEGG: dge:Dgeo_1597
FT                   S-layer-like protein region; PFAM: S-layer domain protein;
FT                   SPTR: Q1IXZ2 S-layer-like protein region; PFAM: S-layer
FT                   homology domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13399"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY39"
FT                   /protein_id="ADI13399.1"
FT                   /translation="MKKLALALGTTLVVGGALAQTSFPDVPEDNFAAEAVAELVELGIL
FT                   TGFPDGTFRGNEAFTRYQAAIVISRLLDVLEENAAAASALSEEDLATLNNAVQELSTGL
FT                   DELFARVEALEAAAPDADATALSEEVSALGERLGALEAAGPDTALAEQLAALEERVAAL
FT                   EAAGAEAPAVDVAALQEQVTALNAQVNDLQARLEAAPAPEAELDVTEAAPEEPAVDLTA
FT                   PVAAPAAVTAPERGKFFLGLGSFYETDSADIGSRFRPRVTLGLDDLVAGFGLRATADYG
FT                   RQTLIEAGSLAFSGHLTYTLGVSAVSAYLGVGGGYQFPDLLFVTNTFEGPFAGALLGAE
FT                   FGTGPVTFFVEGTADYYLDGAPAEGYNQLYPTIAAGLNLRP"
FT   sig_peptide     complement(304628..304684)
FT                   /locus_tag="Trad_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(304851..305168)
FT                   /locus_tag="Trad_0260"
FT   CDS_pept        complement(304851..305168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0260"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain protein"
FT                   /note="COGs: COG2146 Ferredoxin subunits of nitrite
FT                   reductase and ring-hydroxylating dioxygenase; InterPro
FT                   IPR017941; KEGG: ddr:Deide_16700 putative benzene
FT                   1,2-dioxygenase system ferredoxin subunit; PFAM: Rieske
FT                   [2Fe-2S] iron-sulphur domain; SPTR: C1CWS4 Putative benzene
FT                   1,2-dioxygenase system ferredoxin subunit; PFAM: Rieske
FT                   [2Fe-2S] domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13400"
FT                   /db_xref="GOA:D7CY40"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY40"
FT                   /protein_id="ADI13400.1"
FT                   /translation="MTENLIDVGAASDFPDNTMHPLELAGRSVLLVHQGGRFYALENRC
FT                   THKAYPLHTGELLEGAVKCEWHGAKFNLETGKPTLPAVKKVRLYDVRVQDGRVLVAIQE
FT                   A"
FT   gene            complement(305238..306551)
FT                   /locus_tag="Trad_0261"
FT   CDS_pept        complement(305238..306551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0261"
FT                   /product="FeS assembly protein SufD"
FT                   /note="COGs: COG0719 ABC-type transport system involved in
FT                   Fe-S cluster assembly permease component; InterPro
FT                   IPR011542:IPR000825; KEGG: dge:Dgeo_0472 FeS assembly
FT                   protein SufD; PFAM: SufBD protein; SPTR: Q1J160 FeS
FT                   assembly protein SufD; TIGRFAM: FeS assembly protein SufD;
FT                   PFAM: Uncharacterized protein family (UPF0051); TIGRFAM:
FT                   FeS assembly protein SufD, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13401"
FT                   /db_xref="GOA:D7CY41"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY41"
FT                   /protein_id="ADI13401.1"
FT                   /translation="MSLTDTLSPELVEGIIQQHEEPAWLASERRAAWRTFEALPWPTNR
FT                   DEAWRYTQLERFSLAGLELVTAPRDRAVSERITMRITDSDAEGALVYKGGEAIYRDSKL
FT                   KEAGVIFTDLRTALKEHEALVRAHLYSVVNATQSKYAALSAALWQNGTFLFVPKNTEVK
FT                   LPLGAFHTADAGGLTAPRTLIVLEPNAHATFIDEYTSDEFGERLFASGSVEIILQDGAK
FT                   LRYVSLQNWSRTVAHVSRIRAHLERNSRLESLTVSLGADAARAEVECVMAGPGSESEML
FT                   GLYFADKGQHFNQYTLQHHAADHAHSDLLFKGALRDASTAVYSGLIQVDEGAQKTDAYQ
FT                   TNRNLLLDAASEAVSIPQLEIGANDVRCSHGSTVSPVPEDQRFYLMSRGLRPEVAEHVL
FT                   VTGFLHEVTSRVTLPKVAEYVERVVQAKLGVPGVDEKL"
FT   gene            complement(306645..306950)
FT                   /locus_tag="Trad_0262"
FT   CDS_pept        complement(306645..306950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0262"
FT                   /product="plasmid stabilization system"
FT                   /note="InterPro IPR007712; KEGG: pph:Ppha_1705 plasmid
FT                   stabilization system; PFAM: plasmid stabilization system;
FT                   SPTR: B0BFV1 Putative integron gene cassette protein; PFAM:
FT                   Plasmid stabilisation system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13402"
FT                   /db_xref="GOA:D7CY42"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY42"
FT                   /protein_id="ADI13402.1"
FT                   /translation="MFETFREAYTEAALEELLEIEAYLEAQSSGLGKTFRSEFSATVDL
FT                   LLEFPEAAPVVSPRGIRRRLLPRFPYAILYVLTKDLLLILAVAHTSRAPDYGKDRF"
FT   gene            complement(306931..307152)
FT                   /locus_tag="Trad_0263"
FT   CDS_pept        complement(306931..307152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0263"
FT                   /product="Putative addiction module component CHP02574
FT                   family protein"
FT                   /note="InterPro IPR013406; KEGG: cli:Clim_0591 addiction
FT                   module component, TIGR02574 family; PFAM: Putative
FT                   addiction module component CHP02574 family protein; SPTR:
FT                   Q0YUM6 Putative uncharacterized protein; PFAM: Putative
FT                   addiction module component"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13403"
FT                   /db_xref="InterPro:IPR013406"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY43"
FT                   /protein_id="ADI13403.1"
FT                   /translation="MSFEDVKTQALTLPLKERAALAEALLKTLAAPSQEELAALWVEEA
FT                   ERRLRLVEEGNLPVVMGEEARGRVRDVP"
FT   gene            complement(307238..308647)
FT                   /locus_tag="Trad_0264"
FT   CDS_pept        complement(307238..308647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0264"
FT                   /product="FeS assembly protein SufB"
FT                   /note="COGs: COG0719 ABC-type transport system involved in
FT                   Fe-S cluster assembly permease component; InterPro
FT                   IPR010231:IPR000825; KEGG: dge:Dgeo_0473 FeS assembly
FT                   protein SufB; PFAM: SufBD protein; SPTR: Q1J159 FeS
FT                   assembly protein SufB; TIGRFAM: FeS assembly protein SufB;
FT                   PFAM: Uncharacterized protein family (UPF0051); TIGRFAM:
FT                   FeS assembly protein SufB"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13404"
FT                   /db_xref="GOA:D7CR04"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR04"
FT                   /protein_id="ADI13404.1"
FT                   /translation="MSDATSLQGMQHERQYEFSLPENYFFRSEKGLNRRVIEQISYHKN
FT                   EPQWMLDFRLRALEIAEKKGRPKWGPDLSALNFDDIYFYIRPQDRKGTNSWDDVPEEVR
FT                   ETYRRLGIPEAEQKALAGVGAQYESEMVYHSLKEEWEKKGVIFVDTDTGLQEYPELFRE
FT                   YFATVVPPEDNYFAAVNSAVWSGGSFVYVPAGVEIEVPLQAYFLINAQSMGQFERTLII
FT                   GEEGSKFHYIEGCTAPTYNSDSFHSGVIEIICKEGSQVRYSTIQNWSHNVYNLVTQRAL
FT                   VHKDASMGWLDGNLGSKVTMKYPSCYLLEEGAKGEVLSIAFAGKGQHQDAGAKMIHAAP
FT                   YTSSSVVSKSISKDGGRSSYRGLVEIHEGATNARSNVECDALLLDERAKTDTYPYIEIN
FT                   EKTAHVGHEATVSKMNDEQIFYLQSRGLEEDEAAALIVRGFLEPVAKELPLEYAVELNR
FT                   LIELEMEGSVG"
FT   gene            complement(308666..309418)
FT                   /locus_tag="Trad_0265"
FT   CDS_pept        complement(308666..309418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0265"
FT                   /product="FeS assembly ATPase SufC"
FT                   /note="COGs: COG0396 ABC-type transport system involved in
FT                   Fe-S cluster assembly ATPase component; InterPro
FT                   IPR003439:IPR010230:IPR003593; KEGG: dge:Dgeo_0474 FeS
FT                   assembly ATPase SufC; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: B7A613 FeS assembly ATPase SufC; TIGRFAM:
FT                   FeS assembly ATPase SufC; PFAM: ABC transporter; TIGRFAM:
FT                   FeS assembly ATPase SufC"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13405"
FT                   /db_xref="GOA:D7CR05"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR05"
FT                   /protein_id="ADI13405.1"
FT                   /translation="MNALEIRNLHASIGGEPILRGVNLIVPRGEVHALMGPNGSGKSTL
FT                   SKVIAGDPTYEVTEGDVLVDGESILELEPDERARKGLYLAFQYPVEVPGVSMANFLRLA
FT                   LNARRAEGDEVGVMEFYNKVQRAVKELNWDENILERYLNEGFSGGEKKRSEVLQMLVLE
FT                   PKYALLDETDSGLDVDALKVVSQGVNAARGPEFGALVITHYQRLLNYIVPDKVHVMYKG
FT                   QIIREGPKELAVELDQRGYDWIREEVAA"
FT   gene            complement(309623..310570)
FT                   /locus_tag="Trad_0266"
FT   CDS_pept        complement(309623..310570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0266"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterProIPR000719:IPR017442:IPR011009:IPR020635:IPR
FT                   002290:IPR017441:IPR008271; KEGG: dra:DR_1213
FT                   serine/threonine protein kinase, putative; PFAM:
FT                   Serine/threonine-protein kinase-like domain; SMART:
FT                   serine/threonine protein kinase; Tyrosine-protein kinase,
FT                   subgroup, catalytic domain; SPTR: Q9RV17 Serine/threonine
FT                   protein kinase, putative; PFAM: Protein kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13406"
FT                   /db_xref="GOA:D7CR06"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR06"
FT                   /protein_id="ADI13406.1"
FT                   /translation="MSAPPDHPLGYRLRRLVGSGRTAHVYEAESPLYGTVALKLPRDEL
FT                   ERDPVLRRMFENEVQMTLALSHPRIVAALAGYPTGAGAHLALEFCEGSLDAALGEPLPL
FT                   ASAYRLALDVAQGLAHSHERGIVHRDVKPANVFVKAGRAKLGDFGTGFFIGDAFSGEAQ
FT                   RARVGTAFYMAPETFRGASASPKTDLYSLGVLAYELIAGRRPFTGETADELMLAHTSGV
FT                   PLSLRHHRPEVSPEVSRVVATAMAYDPEKRYESVRAFVLAFAAATGLPPDDPPPALGRS
FT                   SRRPHLPLQPGGADAPPEEPLPKGRFGWLGRRRS"
FT   gene            complement(310577..311251)
FT                   /locus_tag="Trad_0267"
FT   CDS_pept        complement(310577..311251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG2220 Zn-dependent hydrolase of the
FT                   beta-lactamase fold; KEGG: ttj:TTHA1283 hypothetical
FT                   protein; SPTR: B7A647 Beta-lactamase domain protein; PFAM:
FT                   Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13407"
FT                   /db_xref="GOA:D7CR07"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022877"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR07"
FT                   /protein_id="ADI13407.1"
FT                   /translation="MTLTFLGQSGFHVQIGEHSLLIDPFLSGNPLAQAKPDDFSPTHIL
FT                   LTHGHADHYGDTETIAARSGATVVSSFEIAQYAARKGLDAHGMNVGGAYAFPFGRVKFT
FT                   PAWHSNSLPDGSYGGMPMGLVLEAAGKRVYHAGDTALFGDMALLGRGGLDVALLPIGDN
FT                   YTMGPDDATEAIKLLKPKRVVPIHYNTFPPIEQDAEAFKRRAEAETDAEVVVLRPGEAL
FT                   EL"
FT   sig_peptide     complement(311150..311251)
FT                   /locus_tag="Trad_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(311346..312665)
FT                   /locus_tag="Trad_0268"
FT   CDS_pept        complement(311346..312665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0268"
FT                   /product="GTP cyclohydrolase II"
FT                   /note="COGs: COG0807 GTP cyclohydrolase II; InterPro
FT                   IPR000422:IPR000926:IPR016299:IPR017945; KEGG: tth:TTC0697
FT                   GTP cyclohydrolase II/3,4-dihydroxy-2-butanone-4-phosphate
FT                   synthase; PFAM: GTP cyclohydrolase II;
FT                   34-dihydroxy-2-butanone 4-phosphate synthase; SPTR: C1XFM3
FT                   GTP cyclohydrolase II; 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase; TIGRFAM: GTP cyclohydrolase II;
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase; PFAM: GTP
FT                   cyclohydrolase II; 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase; TIGRFAM: GTP cyclohydrolase II;
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13408"
FT                   /db_xref="GOA:D7CR08"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR08"
FT                   /protein_id="ADI13408.1"
FT                   /translation="MSAEPMPATHPDDLRAQLATVPELLNELRAGRPVIIVDDPDRENE
FT                   GDLVIPAEKVTPELMAFTIKHTGGVVCLAMTNALADHLELPLMVKHNTAKRETAYTISI
FT                   EAREGVTTGISARDRATTILTVVKDGVQASDLAHPGHVFPLRARDGGVLRRAGHTEAAV
FT                   DLCRLAGFKPVGAISELIHDNGEMMRLPALLQFAAEHGLKVGTIADLIAYRLGHDSFVK
FT                   RVASAKLPTPWAEFTVVGYKDELNNNEHVALVLGDVARDEAVLVRMHSECLTGDALHSL
FT                   RCDCGFQRDAALKMIADAGCGVLVYLRQEGRGIGLLNKIRAYALQDAGADTVEANVQLG
FT                   FAPDLRDYGIGAQILHDLGVRQLKLLTNNPRKVVALEGFGIAIAERVPLHVGKNPYNER
FT                   YLATKRDKLGHLAESSAAEAGHAGQLAHPDALAAKGGAGS"
FT   gene            complement(312662..313324)
FT                   /locus_tag="Trad_0269"
FT   CDS_pept        complement(312662..313324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0269"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number="2.5.1.9"
FT                   /note="COGs: COG0307 Riboflavin synthase alpha chain;
FT                   InterPro IPR001783:IPR017938; KEGG: dra:DR_0154 riboflavin
FT                   synthase subunit alpha; PFAM: Lumazine-binding protein;
FT                   PRIAM: Riboflavin synthase; SPTR: Q9RY00 Riboflavin
FT                   synthase, alpha subunit; TIGRFAM: riboflavin synthase,
FT                   alpha subunit; PFAM: Lumazine binding domain; TIGRFAM:
FT                   riboflavin synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13409"
FT                   /db_xref="GOA:D7CR09"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR09"
FT                   /protein_id="ADI13409.1"
FT                   /translation="MFTGIVEEVGRVVHTEPTEGAGGDLRVVIAARAVLEGLELGDSVA
FT                   VSGCCLTAVALAEGAFTVELSKETLAKTAPRWHPGARVNLERALQLSGRLGGHLVSGHV
FT                   EGVGEVRRVRREPGAYVLTVRAPEALAKYLIPKGSVTVDGVSLTVVDVGGPGGSSPELA
FT                   PTDFTLWLIPHTLELTTLGELEVGSRVNLEADLIAKYVERLTLMGGASLTPPAEEHA"
FT   gene            complement(313325..314506)
FT                   /locus_tag="Trad_0270"
FT   CDS_pept        complement(313325..314506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0270"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="3.5.4.26"
FT                   /EC_number="1.1.1.193"
FT                   /note="COGs: COG0117 Pyrimidine deaminase;
FT                   InterProIPR004794:IPR011549:IPR002125:IPR002734:IPR
FT                   016193:IPR016192; KEGG: ttj:TTHA1064
FT                   diaminohydroxyphosphoriboxylaminopyrimidine deaminase +
FT                   5-amino-6-(5-phosphoribosylamino)uracil reductase (RibD);
FT                   PFAM: bifunctional deaminase-reductase domain protein;
FT                   CMP/dCMP deaminase zinc-binding; PRIAM:
FT                   Diaminohydroxyphosphoribosylaminopyrimidine deaminase.,
FT                   5-amino-6-(5-phosphoribosylamino)uracil reductase; SPTR:
FT                   C1XFM1 5-amino-6-(5-phosphoribosylamino)uracil reductase;
FT                   diaminohydroxyphosphoribosylaminopyrimidine deaminase;
FT                   TIGRFAM: riboflavin biosynthesis protein RibD; PFAM: RibD
FT                   C-terminal domain; Cytidine and deoxycytidylate deaminase
FT                   zinc-binding region; TIGRFAM: riboflavin-specific deaminase
FT                   C-terminal domain; riboflavin biosynthesis protein RibD"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13410"
FT                   /db_xref="GOA:D7CR10"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR10"
FT                   /protein_id="ADI13410.1"
FT                   /translation="MSGAATEPLAEHERYMSRALELAERGRGSTAPNPMVGCVIVRDDE
FT                   IIGEGWHERAGEAHAEVRALQDARSRGARVRGATLYVTLEPCNHTGRTPPCTEAILEAG
FT                   VRRVVIAALDPDPRVDGSGVARLQAAGVEVVTGVLAAEAEAQNEVFRTVHLRGRPWVLY
FT                   KTAMTLDGKIATRTGRSRWITGPAARERVQRWRAHLSAVAVGVNTVLLDDPLLTCRVPG
FT                   GHTPHKVVFDTVARTPPTAQLFHPDPQGEAARVTLFVTERAPAARVAALRYRGAEVVVL
FT                   PETRGRADVRSALAHLKEVGVQTLLLEGGGTLAWSFFEVQAVDRVAVFIGPKLLGGGGA
FT                   SPLGGLGVTEMERAITLSGLTTEEVGGDLLVTGRVHYPEPADTPERELAREGA"
FT   gene            314993..316585
FT                   /locus_tag="Trad_0271"
FT   CDS_pept        314993..316585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0271"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG4585 Signal transduction histidine kinase;
FT                   InterProIPR005467:IPR000014:IPR000700:IPR013767:IPR
FT                   011712:IPR003594:IPR001610; KEGG: hla:Hlac_3597 PAS/PAC
FT                   sensor signal transduction histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   dimerisation and phosphoacceptor region; PAS fold domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   PAC repeat-containing protein; PAS domain containing
FT                   protein; SPTR: B9LXB3 Sensor protein; TIGRFAM: PAS sensor
FT                   protein; PFAM: Histidine kinase; Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase; PAS fold; TIGRFAM: PAS
FT                   domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13411"
FT                   /db_xref="GOA:D7CR11"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR11"
FT                   /protein_id="ADI13411.1"
FT                   /translation="MGKASERSGSRREGEASGAEVEAPGGALGRPDGSLEELAARVRLL
FT                   ERENAALRRSLGDRGWLLDALDATNNTVIVTDPNQEDNPIIYVNRGFEQLTGYTREEAL
FT                   GRNCRFLQGDDTDQEALPALREAVREGRDIRVVLRNYRKDGSLFWNELYVTAVWRDGVL
FT                   AYFFGVQNDITPLVEAQRQLKLLEAAVEQADESIVITGAELERPGPQIRYVNRAFERLS
FT                   GYRRDEVLGKTPRVLQGPKTDPQVLAHLRQRLLGGEVFRGETVNYRKDGSAFVNEWHIA
FT                   PIRSGAGEITHWVATQRDVTERRQLERLVAEAATREQQRVARDLHDTLGQHLAGTAFLA
FT                   RNLATRLRGAGAPYADEAARVAELVQEAVAQTRSLARGLFPVALQEGGLRDALEALGRS
FT                   AHEVFGAPCTVHVAEDVAVSSEEAEQLYRIVQEALSNALRHGGAQRVDITLQTRRGARV
FT                   LTVSDDGVGFPPEVLGAQHGAGMGLRIMRYRAQLIGASLGLANEGLPRGDGRGARVTCA
FT                   LLGRPPTEEPARG"
FT   gene            316615..317844
FT                   /locus_tag="Trad_0272"
FT   CDS_pept        316615..317844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0272"
FT                   /product="peptidase M29 aminopeptidase II"
FT                   /note="COGs: COG2309 Leucyl aminopeptidase (aminopeptidase
FT                   T); InterPro IPR000787; KEGG: mes:Meso_3021 aminopeptidase
FT                   T; PFAM: peptidase M29 aminopeptidase II; SPTR: Q11DY2
FT                   Aminopeptidase T. Metallo peptidase. MEROPS family M29;
FT                   PFAM: Thermophilic metalloprotease (M29)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13412"
FT                   /db_xref="GOA:D7CR12"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR12"
FT                   /protein_id="ADI13412.1"
FT                   /translation="MTFDDKLSAYAELITHVGLNLRAGQQLLATAPVEASPLLAKVAEA
FT                   AYKRGVRYVHPVYNDDGVTLARFRYAPRDSFDLYPSWLARGMLETLEADGARLSVTGND
FT                   PDLLKDQDPELIATAQRRAQTELRPFMAKVMNDAVNWCVVAAATPAWAAKVFPDAPEGE
FT                   RLGRLWDAIFRAVRADGPDPVGTWEAHLAALQRRREHLNARRYRALRYRGPGTDLTLGL
FT                   ADGHIWKGGASQSAAGTRFVANLPTEEVFTAPHRARVDGVVASSKPLSYAGQLIEDFSL
FT                   TFEAGRVVSAKAARGQEALDRLLDTDEGARRLGEVALVPHSSPISQSGLLFYNTLFDEN
FT                   AASHLALGRAYRFCVEGGTTMSDDEAQGVGLNDSLTHVDFMIGSSEMDVDGVREDGAEE
FT                   PVMRAGEWAF"
FT   sig_peptide     316615..316749
FT                   /locus_tag="Trad_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            317976..319772
FT                   /locus_tag="Trad_0273"
FT   CDS_pept        317976..319772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0273"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="COGs: COG0514 Superfamily II DNA helicase;
FT                   InterProIPR002121:IPR014021:IPR001650:IPR006293:IPR
FT                   018329:IPR011545:IPR018982:IPR010997:IPR014001; KEGG:
FT                   tgr:Tgr7_1931 ATP-dependent DNA helicase RecQ; PFAM: RQC
FT                   domain; DEAD/DEAH box helicase domain protein; helicase
FT                   domain protein; HRDC domain protein; SMART: DEAD-like
FT                   helicase ; helicase domain protein; HRDC domain protein;
FT                   SPTR: C5S9E9 ATP-dependent DNA helicase RecQ; TIGRFAM:
FT                   ATP-dependent DNA helicase RecQ; ATP-dependent DNA
FT                   helicase, RecQ family; PFAM: Helicase conserved C-terminal
FT                   domain; RQC domain; HRDC domain; DEAD/DEAH box helicase;
FT                   TIGRFAM: ATP-dependent DNA helicase RecQ; ATP-dependent DNA
FT                   helicase, RecQ family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13413"
FT                   /db_xref="GOA:D7CR13"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR13"
FT                   /protein_id="ADI13413.1"
FT                   /translation="MLERAQHVLQTVFGYPAFRGLQAQVIERVARGGDALVLMPTGGGK
FT                   SLCYQIPALLRPGVGVVVSPLIALMKDQVDALLQLGVRAAYLNSSLSSQEAAAVERALL
FT                   AGELKLLYVAPERLLTPRFLSLLARAQLALFAVDEAHCVSQWGHDFRPEYLGLSVLAER
FT                   FPGVPRVALTATADEATRREMVERLSLQRAQPFVSSFDRPNLRYTVVPKAGAKGQFLSF
FT                   YRARHQGGAGIVYCLSRRSVEETAAWLVKAGVEALPYHAGLSAAVRQEHQERFLREDAL
FT                   VMVATIAFGMGIDKPDVRFVAHLELPKSLEGYYQETGRAGRDGDPADAFMTYGLEDVVT
FT                   LRRLLAQSNAPEAVKRLEARKLEALLGYCETARCRRQVLLAYFGETLAEPCGNCDTCLA
FT                   PVDTFDGTVAAQKALSTVVRTGQRFGAGHVTDVLLGKLTPRVRSLGHHELSTFGIGGEL
FT                   SERAWRSVLRQLVAAGYLATDAEGYGTLKLTPRSTPLLKGQETLRLRRDPTAAKAKAAV
FT                   KGGQAAPADPALFERLRALRARLARAQGVPAYIVFDDKTLRTMTELRPRTLAELRRVPG
FT                   VGEVKLARYGEAFLEVLRAPPS"
FT   gene            complement(319769..321736)
FT                   /locus_tag="Trad_0274"
FT   CDS_pept        complement(319769..321736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0274"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="COGs: COG0143 Methionyl-tRNA synthetase;
FT                   InterProIPR002547:IPR002304:IPR004495:IPR015413:IPR
FT                   014758:IPR009080:IPR016027:IPR014729:IPR012340; KEGG:
FT                   tth:TTC0931 methionyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class I (M); t-RNA-binding domain protein; SPTR:
FT                   B7A6F5 Methionyl-tRNA synthetase; TIGRFAM: methionyl-tRNA
FT                   synthetase; methionyl-tRNA synthetase, beta subunit; PFAM:
FT                   tRNA synthetases class I (M); Putative tRNA binding domain;
FT                   TIGRFAM: methionyl-tRNA synthetase C-terminal region/beta
FT                   chain; methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13414"
FT                   /db_xref="GOA:D7CR14"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR14"
FT                   /protein_id="ADI13414.1"
FT                   /translation="MGKDTPAPTERPQTTGAGARTAEAQTRGVYYATTPIFYVNAEPHI
FT                   GHAYTTTLVDVVTRFHRLKGDDTLFLTGTDEHGEKIQKAADAAGLSPQAYTDRVAKKFQ
FT                   DTWNSLGIAYDEFIRTTEARHQAVVHEVLTRVYEAGDIIFGEYGGLYCVGCERYYTDKE
FT                   LEGGKCPQHDIPLEYRSEENYFFRMERYRPWLRETLEENPELIRPERYRNEVLSILREP
FT                   IGDLSISRPRSRVPWGIPLPWDENHVTYVWFDALINYYSALKSRDAVERYWPFVEHFIA
FT                   KDILKPHGVFWPTMLKSAGLPLYRHLNVHGYWLVDGGKMSKSKGNVVRPLDLKDKYGND
FT                   AFRYYLLRDMTFGLDASFSEVGLAERINADLANDLGNLLNRTLGMLGKYRGGVVPAPGP
FT                   LEPIDEALRDAFVGLPERMTELFDALQFDRAIESVLEAVRKANKYIAETQPWVLAKEGA
FT                   AGRLDTVLYGCVEALRCASILLSPVIPTKAAELQQQLGLKGDYTLQDAATWGLTPAGTP
FT                   TAPGAPLFPRVDLAALNDSLEPKETALEHLPEVTLDDFAKLELRVAEILKAEAHPKADK
FT                   LLVLTVKLGPEERTVVSGIREWYTPAELVGKKVVLVANLKPVKLRGVLSQGMILAAEDS
FT                   EGNLSVSVLDRDLASGSVVR"
FT   gene            322037..322471
FT                   /locus_tag="Trad_0275"
FT   CDS_pept        322037..322471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0275"
FT                   /product="UspA domain protein"
FT                   /note="COGs: COG0589 Universal stress protein UspA and
FT                   related nucleotide-binding protein; InterPro
FT                   IPR006016:IPR006015:IPR014729; KEGG: sil:SPO2371 universal
FT                   stress protein family protein; PFAM: UspA domain protein;
FT                   SPTR: A3VZ57 Universal stress protein family protein; PFAM:
FT                   Universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13415"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR15"
FT                   /protein_id="ADI13415.1"
FT                   /translation="MAELFIVGVDGSDGARRAAAFAAKRARCVGAKVLLLGVIEWSRYA
FT                   FYTPEELETRGRDKQRATERAEREVLRPLAESLQGEGLEVSCLVRHGHAAEVIQALAEE
FT                   RGASEVFVGREGRSPFVGALFGSVTHRIVSTSNVPVTVVP"
FT   gene            322605..323993
FT                   /locus_tag="Trad_0276"
FT   CDS_pept        322605..323993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0276"
FT                   /product="amino acid carrier protein"
FT                   /note="COGs: COG1115 Na+/alanine symporter; InterPro
FT                   IPR001463; KEGG: vvy:VV2044 sodium/alanine symporter; PFAM:
FT                   sodium:alanine symporter; SPTR: C9NUH2 Na(+)-linked
FT                   D-alanine glycine permease; TIGRFAM: amino acid carrier
FT                   protein; PFAM: Sodium:alanine symporter family; TIGRFAM:
FT                   amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13416"
FT                   /db_xref="GOA:D7CR16"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR16"
FT                   /protein_id="ADI13416.1"
FT                   /translation="MPVGEAQLPLIVVWLIVAALFFTFYFNFINFRGFRHGFRLIRGDY
FT                   DDPESAGEVTHFQALATALSGTVGLGNIAGVAVAVSVGGPGATFWMILAGLLGMASKFV
FT                   ECTLGVMYRTEYPDGRVSGGPMHYLRKGLAERNLGGLGRALAAFFAVMCIGGSLGGGNM
FT                   FQSNQAYQQVVNVTGGDASFFAGRAWVFGLLAALAVGAVIIGGIKSIARVTEKIVPFMA
FT                   VTYISAALVILVANAAQIPAAFGAIIDGAFSPEGVTGGFIGVLIQGFQRAAFSNEAGIG
FT                   SAAIAHSAVKTKHPVTEGIVALNEPFVDTVVVCTMTALVIVITGTYTQAGLSGVELTSA
FT                   AFAQNIAWFPYVLALAVVLFAFSTMISWSYYGVKAATYLFGESALTETLFKVVFCTFTL
FT                   IGAVMQLDAVIAFSDSMIFAMSLANVVGLYILAPEVKRALGAYWRDIESGAIRSRRELA
FT                   RTGD"
FT   sig_peptide     322605..322661
FT                   /locus_tag="Trad_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            324093..324935
FT                   /locus_tag="Trad_0277"
FT   CDS_pept        324093..324935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0277"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="COGs: COG0605 Superoxide dismutase;
FT                   InterProIPR017909:IPR006311:IPR019831:IPR019832:IPR
FT                   001189:IPR019833; KEGG: rmr:Rmar_0920 superoxide dismutase;
FT                   PFAM: Manganese/iron superoxide dismutase-like; PRIAM:
FT                   Superoxide dismutase; SPTR: D0MH29 Superoxide dismutase;
FT                   PFAM: Iron/manganese superoxide dismutases, alpha-hairpin
FT                   domain; Iron/manganese superoxide dismutases, C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13417"
FT                   /db_xref="GOA:D7CR17"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR17"
FT                   /protein_id="ADI13417.1"
FT                   /translation="MADHQSDLLARARVGGAPSHLALSRRRFLQFGAGALAALGLSGLR
FT                   VGRAQTLARAASAPARPLPAYAEDLGRYPFSLPELGYAYGALEPVIDAETMTLHHQEHH
FT                   QSYVDALNAALADYPELQGRTLGELLTTLPELPEEVRQDVQNQGGGHLNHALWWRWVAP
FT                   GGSREPVGRSAERIAETFGDLEGLKEPFNAAADARFGSGWAWLVVDESGRLSVLSTPNQ
FT                   DHPISQGLVPLLGLDVWEHAYYLSYRNRRPEYINAFWEVVNWDAVEEQHGVAAALFGF"
FT   gene            complement(324942..325346)
FT                   /locus_tag="Trad_0278"
FT   CDS_pept        complement(324942..325346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0278"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_5025 hypothetical protein; SPTR:
FT                   A5ELI4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13418"
FT                   /db_xref="GOA:D7CR18"
FT                   /db_xref="InterPro:IPR025356"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR18"
FT                   /protein_id="ADI13418.1"
FT                   /translation="MTPTALKASKPRQLLLPPLLLRAEAATELAVLLALYARFGGGWWL
FT                   FAALFLAPDLGILAYLAGPRVGAMGYNLLHTYPLPAALALIGVAFSAPVALHVALIWAA
FT                   HIALDRLLGYGLKFPEAFGETHLGRVGDGR"
FT   sig_peptide     complement(325272..325346)
FT                   /locus_tag="Trad_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            325441..325983
FT                   /locus_tag="Trad_0279"
FT   CDS_pept        325441..325983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0279"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647:IPR009057:IPR012287; KEGG:
FT                   dra:DR_0720 TetR family transcriptional regulator; PFAM:
FT                   regulatory protein TetR; SPTR: Q9RWE9 Transcriptional
FT                   regulator, TetR family; PFAM: Bacterial regulatory
FT                   proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13419"
FT                   /db_xref="GOA:D7CR19"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR19"
FT                   /protein_id="ADI13419.1"
FT                   /translation="MPYPAKTTSERVLAAALELLERGGEGALSMRALAASLGLSASSLY
FT                   RHFPNREALLNALGDESTRLLHAALARASAGRDPRGALVGVAHGYLEFARAHPALYDLV
FT                   MAPRATPGPGKDVWTFLLGVLGGVTGRSDDTAAAVALWSFLHGFVTLERAGLFGPSGPQ
FT                   GGLERGLAALLAGLERT"
FT   gene            326067..326474
FT                   /locus_tag="Trad_0280"
FT   CDS_pept        326067..326474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0280"
FT                   /product="transcriptional repressor, CopY family"
FT                   /note="COGs: COG3682 transcriptional regulator protein;
FT                   InterPro IPR005650:IPR011991; KEGG: mxa:MXAN_4242 putative
FT                   transcriptional regulator; PFAM: Penicillinase repressor;
FT                   SPTR: Q1D4K6 Putative transcriptional regulator; PFAM:
FT                   Penicillinase repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13420"
FT                   /db_xref="GOA:D7CR20"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR20"
FT                   /protein_id="ADI13420.1"
FT                   /translation="MSSPSTPPRPTDAELAILRVLWQRGPSTVREVHDALTGTGDGKAV
FT                   RYTTTLKQLQVMTDKGLVRRDERSRTHVYEAASSEEETQGALLEHLLRSAFGGSAQQLF
FT                   LRALSRKVASAEELDELRRLLDERGRGDGER"
FT   gene            326464..329673
FT                   /locus_tag="Trad_0281"
FT   CDS_pept        326464..329673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0281"
FT                   /product="peptidase M56 BlaR1"
FT                   /note="COGs: COG4219 Antirepressor regulating drug
FT                   resistance predicted signal transduction N-terminal
FT                   membrane component;
FT                   InterProIPR008756:IPR013784:IPR008969:IPR008957:IPR 018062;
FT                   KEGG: sus:Acid_0899 peptidase M56, BlaR1; PFAM: peptidase
FT                   M56 BlaR1; SPTR: Q09BI6 TonB domain/peptidase M56 domain
FT                   protein; PFAM: BlaR1 peptidase M56"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13421"
FT                   /db_xref="GOA:D7CR21"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR21"
FT                   /protein_id="ADI13421.1"
FT                   /translation="MSARALLEHPLAEAVGWALLHSLWQGALVGALVALGLFALRRPQH
FT                   RYALGCGALLLMVVLPLLTGVLHYRDLTAPLAASGELGPSSFIPSGGLVGDAAPSVAPP
FT                   ASSSSSSAIPTGTPSAASSSVAQVWGRVSHTLTSSAPWFTGLWLVGVALSLLRLLGSAL
FT                   YAARFGARHRTPAPEAWQQTFRTLAGRLGLRRVPRLVLSSDVDTPLVLGVLRPLVVLPV
FT                   SALTGVPAAQLSAVLLHELAHIRRYDPLVNLLQCLLETLLFYHPAVWWISRAVRREREA
FT                   CCDDLAVAVCGDARLYARALVGLEALRQREPALALAATDKPLLERVRRLLGMESDVRSA
FT                   PSLLTVLLVVTLSLGVGLFLTLQPAVAQEEAPSTSLQVAEDETVVTGRVLWQGEPVAGV
FT                   RLELHSRLELDDDGVCCREPRVLASTTSDEDGTYTFRVSAARAFTIWAYPPTSDYLPVG
FT                   YDHVSTPGIPFQANVQLMKAIKELEPALTYGVNLTPTLSWQPLPEAARYGVSITKLNET
FT                   DTVMENYQYTAEPQFTVETPLEENALYYWVVEAYDETGTTLAYGESTFSTSSAQARVPV
FT                   ELTDVGVRTVLPAGWQLVGAGAFEQVTEGGERRRLTFERLPGDDPEAVLRARNESSSAP
FT                   TESAYGDQTWLWQAGSDRDGRRFVQATTVGGNVYLITAEATDESPVELYAFVLPLVLEN
FT                   FEVIGADEGDNGAGAAPPGTSQHLPALALRRSDNRDAEVFTPAPETGTVAGTVRWHHTP
FT                   LAGVRVSLRTPRERLEDGSCCVGEQETLQTVSTDENGTYRFEGVTPGEYEVEAEAPSSL
FT                   YWEFMSSSVNVSAAFEVREDFRLQKVMEVVSPHGEMGVPLSPTLRWKPFPGAARYQTYI
FT                   HSERTGNQVRSLPSESTEVTLNAPLEPNELYQWSVTAYAEDGTEIAYYSAAHFSTAPAK
FT                   EQVSVTLPDLGLQMMLFEDWQQVTSNTFEWAHEGGTTYTLAFQTLPGDDAEAALLELGA
FT                   TEEQVHASSYEGKTWWTGVFNGVVRLATELEGQVYLIAADSSPDGTAEFSYAAEVEALG
FT                   FTLPLVARTLERVGAVAEGRA"
FT   gene            complement(329748..330020)
FT                   /locus_tag="Trad_0282"
FT   CDS_pept        complement(329748..330020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_1545 cobalamin biosynthesis protein
FT                   CbiM; SPTR: C5DAM9 Cobalamin biosynthesis protein CbiM"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13422"
FT                   /db_xref="GOA:D7CR22"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR22"
FT                   /protein_id="ADI13422.1"
FT                   /translation="MQKKLLKIYPYVMGGYTLITLVGALYIATEGAFILAATFTSLAVG
FT                   TGILSWGSFRFGNKHNIPQPWLRVATFFSFLALVLFLTSVASTRY"
FT   sig_peptide     complement(329949..330020)
FT                   /locus_tag="Trad_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            330699..331787
FT                   /locus_tag="Trad_0283"
FT   CDS_pept        330699..331787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0283"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1533 DNA repair photolyase; InterPro
FT                   IPR007197; KEGG: npu:Npun_F6062 spore photoproduct lyase;
FT                   PFAM: Radical SAM domain protein; SPTR: B2IUV8 Spore
FT                   photoproduct lyase; TIGRFAM: spore photoproduct lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13423"
FT                   /db_xref="GOA:D7CR23"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR23"
FT                   /protein_id="ADI13423.1"
FT                   /translation="MPLELPMARPHPAPVSQPRPKPPSPKLWRPKRVLFTPDALEQPFG
FT                   QRLLERMQSLGLDITLLRSNRLTGLRGKDARETYRLAKQTLAVVNAPPSLLALQPIPPS
FT                   ADLQFHLAKGCPAHCQYCYLAGSLAGPPVTRVYANLPEILGALARYERPGHVTTFEVSC
FT                   YTDPLALEHLTGSLSECVRYFGTREGARLRFVSKFDAVAPLLTLPHGGRTQARVSVNAA
FT                   PISLRLEGGVAPVAARLGGLRQLAAAGYPVGVVVAPIMPVEGWREHYGALLDEVARAVG
FT                   DVRELTFELITHRFTPGSKEVLLDWYPNTALDMDEQTRAVKRNKFGGLKYVYGKDTMSE
FT                   LRGFFETELARRFPQARVLYWT"
FT   gene            331829..332881
FT                   /locus_tag="Trad_0284"
FT   CDS_pept        331829..332881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0284"
FT                   /product="radical SAM domain-containing protein"
FT                   /note="COGs: COG1533 DNA repair photolyase; KEGG:
FT                   mch:Mchl_3457 radical SAM domain-containing protein; SPTR:
FT                   B7KUP8 Radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13424"
FT                   /db_xref="InterPro:IPR023805"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR24"
FT                   /protein_id="ADI13424.1"
FT                   /translation="MLRVSRIFLEREALAYPRAHDHDILARFPDAERVEVASHWNIPGL
FT                   HGNEGLVRDWVRVKRTVLVLGVRKTFPVRPNGRSADFIAPGFASGCAMACAYCYVPRRK
FT                   GFANPISTFVNLEAIHRAVGRHAAKQGPKKPAQTDPAAWVYDIGENSDVSVDALVSDNV
FT                   RDTVAFFRTLPGAKASFATKYVNRALLSYDPQGRTRVRFSLMPQRVAKTVDVRTSPVGE
FT                   RIGAINDFVAAGYEVHLNFSPVILYEGWRRDYAELFEQLDDVLSDEAKAQLKAEVIFLT
FT                   HNALLHEVNLGWHPKAEALLWTPETQEAKTSQMGGENVRYRHGFKGKQVAALRDLLARK
FT                   MPYCAVRYAF"
FT   gene            complement(332886..334025)
FT                   /locus_tag="Trad_0285"
FT   CDS_pept        complement(332886..334025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0285"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="InterPro IPR001910; KEGG: pdi:BDI_1655 putative
FT                   nucleoside hydrolase; PFAM: Inosine/uridine-preferring
FT                   nucleoside hydrolase; SPTR: B7B871 Putative uncharacterized
FT                   protein; PFAM: Inosine-uridine preferring nucleoside
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13425"
FT                   /db_xref="GOA:D7CR25"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR25"
FT                   /protein_id="ADI13425.1"
FT                   /translation="MKHTPLRKALALTLPLFFLAACGEVDDLLTPDPPPVEEPSDPTPP
FT                   DPIDEPGEPEEPPAGGVRVIYDTDYGIDVDDVGALAVLHALADMDEVTILGVVSNVADP
FT                   FAPPAIDVVNTYYGRPDIPIGLTDRPYYAEAYPYWREHDPRFIEDMALRFPHNTPMDGS
FT                   VPTATEVYRELLAAQPDNSVTIVSVGFLQNLSDLLNSGPDEHSPLDGRTLIQQKVRELS
FT                   LMGGHYPSSNNDLYLSGGREMDSRYAIDVIENWPTVINFNTGPTCHEVLNGATLTATTP
FT                   ETNPVRFAYEQFFDGPSRNRNAWDLCSVLYAVRGLWGPEGQYFDVIETEQLTLTTTGFN
FT                   EWIDEDDPRHHRLIRVMPEDELSAILEALLTQPPANPGP"
FT   sig_peptide     complement(333957..334025)
FT                   /locus_tag="Trad_0285"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            334631..335239
FT                   /locus_tag="Trad_0286"
FT   CDS_pept        334631..335239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0286"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="COGs: COG1999 Uncharacterized protein SCO1/SenC/PrrC
FT                   involved in biogenesis of respiratory and photosynthetic
FT                   systems; InterPro IPR017936:IPR003782:IPR012336:IPR012335;
FT                   KEGG: sti:Sthe_0241 electron transport protein SCO1/SenC;
FT                   PFAM: electron transport protein SCO1/SenC; SPTR: D1C6E2
FT                   Electron transport protein SCO1/SenC; PFAM: SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13426"
FT                   /db_xref="GOA:D7CR26"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR26"
FT                   /protein_id="ADI13426.1"
FT                   /translation="MKHPSQKRFWWLAALGVVAALVAAFSWGQLRADAAPTLHGTALDN
FT                   PPLVAPFELTNARGERVTLEAWRGELLLVFFGFTSCPDVCPLTLGRLAKIYEDLGEPED
FT                   VQVVMITVDPEHDTPEVTQRYAEAFHPDFVGLSGSTADIAEAAKRFYVGYRELGERSFL
FT                   HTDTVALLDREGRLRLVYGQDKVARIGSDLKTILAQRRW"
FT   sig_peptide     334631..334732
FT                   /locus_tag="Trad_0286"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(335492..336427)
FT                   /locus_tag="Trad_0287"
FT   CDS_pept        complement(335492..336427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0287"
FT                   /product="domain of unknown function DUF1731"
FT                   /note="COGs: COG1090 nucleoside-diphosphate sugar
FT                   epimerase; InterPro
FT                   IPR010099:IPR001509:IPR013549:IPR016040; KEGG:
FT                   rxy:Rxyl_0724 hypothetical protein; PFAM: domain of unknown
FT                   function DUF1731; NAD-dependent epimerase/dehydratase;
FT                   SPTR: Q1AY35 Putative uncharacterized protein; PFAM: NAD
FT                   dependent epimerase/dehydratase family; Domain of unknown
FT                   function (DUF1731); TIGRFAM: conserved hypothetical protein
FT                   TIGR01777"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13427"
FT                   /db_xref="GOA:D7CR27"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR27"
FT                   /protein_id="ADI13427.1"
FT                   /translation="MTPPDSPPVLVISGASGLVGRALVRAAAGRYALRLLTRDPAKHRF
FT                   PAGQAVGWDPAAARKGDERALETLGGALEGAYAIINLAGASIADGRLGREHQQRVLSSR
FT                   LESAQTLLAAARRCSAPPQVWFQASATGYYGDRGDAELGEEAPSGEGVLAEICRRWEAA
FT                   PEDAAGARLVLGRIGVVFAREAPAWRKLLLPIKLGLGGPLGSGQQWLSWIHLEDLAEAI
FT                   LFLLERGHGPYNLTAPGSVRQLELSRAAAARLRRPALFPTPAPLLRLALGKLADELLLA
FT                   SAKVRPARLLEEGFAFRYPTLERALDELVG"
FT   sig_peptide     complement(336347..336427)
FT                   /locus_tag="Trad_0287"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(336490..336747)
FT                   /locus_tag="Trad_0288"
FT   CDS_pept        complement(336490..336747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dra:DR_0650 hypothetical protein; SPTR: C1XMZ9
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13428"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR28"
FT                   /protein_id="ADI13428.1"
FT                   /translation="MDWTDWHALEAAIPLDELPAFHRAFLAHHRPGEADWEGAFLRQVQ
FT                   GKVQATLKGLQREGRARLEGGTLWVSCEAIPEAFRRYADR"
FT   gene            336821..337846
FT                   /locus_tag="Trad_0289"
FT   CDS_pept        336821..337846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0289"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="COGs: COG0136 Aspartate-semialdehyde dehydrogenase;
FT                   InterProIPR005986:IPR012080:IPR000534:IPR012280:IPR 016040;
FT                   KEGG: syf:Synpcc7942_1848 aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase
FT                   dimerisation region; Semialdehyde dehydrogenase NAD -
FT                   binding; PRIAM: Aspartate-semialdehyde dehydrogenase; SPTR:
FT                   B4W096 Aspartate-semialdehyde dehydrogenase; TIGRFAM:
FT                   aspartate-semialdehyde dehydrogenase; PFAM: Semialdehyde
FT                   dehydrogenase, dimerisation domain; Semialdehyde
FT                   dehydrogenase, NAD binding domain; TIGRFAM:
FT                   aspartate-semialdehyde dehydrogenase (peptidoglycan
FT                   organisms)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13429"
FT                   /db_xref="GOA:D7CR29"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR29"
FT                   /protein_id="ADI13429.1"
FT                   /translation="MRVAIVGATGAVGQELLALLAERDFPVTELTLYASSRSAGKTLTV
FT                   GDETYTLRALPEDGNLRADVVFSSAGGSVSKAHAWRWAEHGALVIDNTSAWRMDPRVPL
FT                   VVPEVNAEAALSHRGVIANPNCSTIIALLALAPLHRAFGLTRATVATYQAVSGAGAAGI
FT                   DELRAQTEAVLAGEAPTPQKFAHPIAFNLFSHDSAVGEDGYNVEERKLLLESRKILDAP
FT                   ELMLSATCVRVPVFRAHSEAIHAEFARAVTLEGALAVLRAAPGVRVVDDRPNNHFPMPL
FT                   EASGRDEVLVGRLREDASRPGALALFVSGDQIRKGAALNAVQIAEHLARQGALRARELS
FT                   A"
FT   sig_peptide     336821..336874
FT                   /locus_tag="Trad_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            337992..338471
FT                   /locus_tag="Trad_0290"
FT   CDS_pept        337992..338471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0290"
FT                   /product="membrane protein AbrB duplication"
FT                   /note="COGs: COG3180 Putative ammonia monooxygenase;
FT                   InterPro IPR017516; KEGG: bra:BRADO6545 hypothetical
FT                   protein; SPTR: A4Z1X7 Putative uncharacterized protein;
FT                   TIGRFAM: membrane protein AbrB duplication; PFAM: Putative
FT                   ammonia monooxygenase; TIGRFAM: membrane protein AbrB
FT                   duplication"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13430"
FT                   /db_xref="GOA:D7CR30"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR30"
FT                   /protein_id="ADI13430.1"
FT                   /translation="MSMLLAGFAGGALAQWLRLPGGAAIGAMLATAAVSVLLGERAAAL
FT                   PPGLPFVALVLVGVSVGSTVQRETLAHAGHLLLPALLILLSFSVFGVALALLMQRVFGF
FT                   DLTTALFATAPGGMSNMAILAQEAGGNGFAVALIHMVRVMGIFLLLPLLTVLFGR"
FT   sig_peptide     337992..338123
FT                   /locus_tag="Trad_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            338505..338705
FT                   /locus_tag="Trad_0291"
FT   CDS_pept        338505..338705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0291"
FT                   /product="phage shock protein C, PspC"
FT                   /note="COGs: COG1983 Putative stress-responsive
FT                   transcriptional regulator protein; InterPro IPR007168;
FT                   KEGG: kol:Kole_0955 phage shock protein C, PspC; PFAM: PspC
FT                   domain protein; SPTR: C5CGZ9 Phage shock protein C, PspC;
FT                   PFAM: PspC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13431"
FT                   /db_xref="GOA:D7CR31"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR31"
FT                   /protein_id="ADI13431.1"
FT                   /translation="MSQEKRLTRSQRDKKIGGVCAGLAEYLGIDATIIRLIFVVLLFTG
FT                   GPGLILYLALWLILPQGPSYS"
FT   gene            complement(338752..339819)
FT                   /locus_tag="Trad_0292"
FT   CDS_pept        complement(338752..339819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0292"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="COGs: COG1087 UDP-glucose 4-epimerase; InterPro
FT                   IPR001509:IPR008089:IPR016040; KEGG: app:CAP2UW1_3278
FT                   NAD-dependent epimerase/dehydratase; PFAM: NAD-dependent
FT                   epimerase/dehydratase; SPTR: C7RIG9 NAD-dependent
FT                   epimerase/dehydratase; PFAM: NAD dependent
FT                   epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13432"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR32"
FT                   /protein_id="ADI13432.1"
FT                   /translation="MERVMTTTTTYHLLQERLRRAPRTWLVTGAAGFIGSHLLETLLKL
FT                   EQRVVGLDNFATGHRHNLDEVQRAVGEAAWSRLRFIEGDISDLATCREALAGVDAVLHQ
FT                   AAFVSVPGSIEDPLLNHRSNVTGFLNLLVAAQERGLKRFVYASSSAVYGNAETLPAREE
FT                   AVGDALSPYAASKAMDELYAGVFTRLHGLEAIGLRYFNIFGPRQDPNGAYAAVIPKWTA
FT                   RLLSGQRGVIFGDGSATRDFCFVGNVVQANVLAATTENPAAFGEVFNVGNGGATTTRAL
FT                   YETLRDRLAEVTGREDLRRLEPRFDPPRPGDIAHSRADISRAQRLLGFEPDVSVEEGLR
FT                   RTLAWYAARAQTPAR"
FT   gene            340057..340797
FT                   /locus_tag="Trad_0293"
FT   CDS_pept        340057..340797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0293"
FT                   /product="stationary-phase survival protein SurE"
FT                   /note="COGs: COG0496 acid phosphatase; InterPro IPR002828;
FT                   KEGG: cpi:Cpin_2160 stationary-phase survival protein SurE;
FT                   PFAM: Survival protein SurE; SPTR: C1XMF5
FT                   Exopolyphosphatase; 5'-nucleotidase; 3'-nucleotidase;
FT                   TIGRFAM: stationary-phase survival protein SurE; PFAM:
FT                   Survival protein SurE; TIGRFAM: 5'/3'-nucleotidase SurE"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13433"
FT                   /db_xref="GOA:D7CR33"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR33"
FT                   /protein_id="ADI13433.1"
FT                   /translation="MRILVSNDDGIYSPGIRALAEVAKEFGEVRVVAPDVEQSAMGHAI
FT                   TISRPLTYHATAINGLEGYRVNGTPADCVALGAHLWQEVDLVLSGINLGLNLGHNVWHS
FT                   GTVAAAKQAAFLDIQAIAFSAPYEGTPPDYEVLKPFVKDIIARLIEDPLPLVNVNLPYN
FT                   PKGVRWTRQSVRHYEGSVVPGEDPMGRSHFWFAAYPRTGAEKGTDRWAIEHDYVSLTPL
FT                   RLDLTDEGLLADAVTKAKEAQVGK"
FT   gene            complement(340861..341616)
FT                   /locus_tag="Trad_0294"
FT   CDS_pept        complement(340861..341616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0294"
FT                   /product="Stf0 sulfotransferase"
FT                   /note="COGs: COG4424 conserved hypothetical protein;
FT                   InterPro IPR015124; KEGG: rxy:Rxyl_2350 hypothetical
FT                   protein; PFAM: Stf0 sulphotransferase; SPTR: Q1ATK0
FT                   Putative uncharacterized protein; PFAM: Stf0
FT                   sulphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13434"
FT                   /db_xref="GOA:D7CR34"
FT                   /db_xref="InterPro:IPR015124"
FT                   /db_xref="InterPro:IPR024628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR34"
FT                   /protein_id="ADI13434.1"
FT                   /translation="MTPPNPTYWLCTTPRSGSSALGDALSATGVAGRPTEYFNRRFWPE
FT                   LFARFGLAGRAEEAEAVPDYLRALVFQTASPNGVFGVKAMLDADMAPFFAGLRTLRGCA
FT                   AHSEAELIRTVFPGVRFVYLTRRNKVRQAVSFWRAQQSGVWERYHGDAVREGARAHFDF
FT                   AALSGLVQELSLREARWQELFDALEATPYTVVYEDYVRDPEGTVRGILDFLELAPPPGW
FT                   SLPRLTMERLADETSDAWVARYLAEAEGA"
FT   gene            complement(341613..342017)
FT                   /locus_tag="Trad_0295"
FT   CDS_pept        complement(341613..342017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1897 hypothetical protein; SPTR:
FT                   Q8YQL8 Alr3803 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13435"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR35"
FT                   /protein_id="ADI13435.1"
FT                   /translation="MTGTPEPTPKQVAELLTFLPIFENRYYQPSRIDVSVSLFCPHLWD
FT                   EQLSEFVERLYTFGLIMPGFNWPEWQREAERYDLEPERLQTAPLDDVLKLLTLHVRKDR
FT                   FCDGHLPLMVSKGHIAALLHRLAVLYGEGA"
FT   gene            complement(342014..342880)
FT                   /locus_tag="Trad_0296"
FT   CDS_pept        complement(342014..342880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0296"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0395 ABC-type sugar transport system
FT                   permease component; InterPro IPR000515; KEGG: dge:Dgeo_0907
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: C1XNE2 Mannose ABC
FT                   transporter membrane protein; glucose ABC transporter
FT                   membrane protein; PFAM: Binding-protein-dependent transport
FT                   system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13436"
FT                   /db_xref="GOA:D7CR36"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR36"
FT                   /protein_id="ADI13436.1"
FT                   /translation="MTTVRTYTAPEAHTRPKRSARGRWLVYALLVLASLFYLLPVYLVV
FT                   ITSLKTPAEITLANTWRLPETPNWRSFADAWNAFAPTLRNSLVLTVVATLGSALLGSLN
FT                   GYVLSKWRFPGANIVFPLILFGMFIPYQSVLIPLFRFLSDIGLYGSLWGLILTHIVYGL
FT                   PITTLIFRNFYAEIPDEMLEAGKIDGAGFFGLYWRVVFPLSVSGFVVVIIWQFTQIWNE
FT                   FLFAVTLTSQRSQPITVALANLAGGQAVAWNLPMAGAILAALPTLLIYVILGRYFIRGL
FT                   LAGSVKG"
FT   gene            complement(342877..343995)
FT                   /locus_tag="Trad_0297"
FT   CDS_pept        complement(342877..343995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0297"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG: tth:TTC0327
FT                   glucose transport system permease protein; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: C1XNE1 Mannose ABC transporter membrane
FT                   protein; glucose ABC transporter membrane protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13437"
FT                   /db_xref="GOA:D7CR37"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR37"
FT                   /protein_id="ADI13437.1"
FT                   /translation="MRFSRDRLTAVLMLLPSLVLLGIFVYGFIGQTFWVSLTNWGKDPL
FT                   QALALEPQLEFIGFENYRQLFTAPSEARFRQDLVNTFFFTLFFLAGCLGLGLGLAVLLE
FT                   QNVRGEGLFRTVFLFPMALAFIVTGTIWRWLLQPQGGLNVLPTLVGLPPGDFRWLASRT
FT                   QVWQFNWQDLPFFTGLLVSLIFALLFVRALRRGDRTRTLAFGVITLGLVAWTFTGARRT
FT                   VILPFPETHGFNLAFIGIILAAVWQMSGYTMALYLAGLRGIPDELREAARSDGASEWQL
FT                   YRHVILPLLAPITLSAMIILGHISLKIFDLVFAMAGADNATTDVPALLMYLRAFRANQF
FT                   AEGAAIAIVLLILVAAVIIPYLYSSLKTEVRR"
FT   sig_peptide     complement(343915..343995)
FT                   /locus_tag="Trad_0297"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(344102..345337)
FT                   /locus_tag="Trad_0298"
FT   CDS_pept        complement(344102..345337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0298"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   ttj:TTHA0688 sugar ABC transporter, substrate-binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   1; SPTR: Q5SKF5 Sugar ABC transporter, substrate-binding
FT                   protein; PFAM: Bacterial extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13438"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR38"
FT                   /protein_id="ADI13438.1"
FT                   /translation="MVKRLCIGALLGASSLSVAQAQQLEIFSWWAGDEGPALEALIDLY
FT                   EERYPGTEVVNATVTGGAGVNARAVLTTRMLGGDPPDTFQVHAGQELIGTWVAAGRMED
FT                   LTPLFEEEGWNEVFPEGLLELSSTDEGIWSVPVNVHRSNVMWYVPANLEGWGIEVPTSW
FT                   EAFLEVCPTLQEQGVTPLVLGENWTQQHLWESVALAVLGPDNYDALWSGELAFDSPEAV
FT                   GVWETFGEIMACTNDDAAGLSWQQATDRLVAGEAAFNIMGDWAAGYMTTTLGLEPETDF
FT                   GWAASPGTDGVFMLLADAFGLPVGAPNREATLNWLRLVGSREGQDVFNPLKGSISPRLD
FT                   SDISLYNAYLQSAYEDYSTDRQVGSLVHGAAANQTFMSEFANVLETYLSSGDAQQAGAA
FT                   AQELATRTGIGG"
FT   sig_peptide     complement(345275..345337)
FT                   /locus_tag="Trad_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(345460..346686)
FT                   /locus_tag="Trad_0299"
FT   CDS_pept        complement(345460..346686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0299"
FT                   /product="putative phytochrome sensor protein"
FT                   /note="COGs: COG3284 Transcriptional activator of
FT                   acetoin/glycerol metabolism; InterPro IPR003018:IPR001867;
FT                   KEGG: nca:Noca_3971 transcriptional regulator
FT                   domain-containing protein; PFAM: transcriptional regulator
FT                   domain protein; GAF domain protein; SPTR: A3THM0 Putative
FT                   uncharacterized protein; manually curated; PFAM:
FT                   Transcriptional regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13439"
FT                   /db_xref="GOA:D7CR39"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR39"
FT                   /protein_id="ADI13439.1"
FT                   /translation="MRRRLERAWASYIHDQVQPEAPRDIVTSWQRSRRAVSPLRAAAPV
FT                   DDPDETLREWQSSLLYAAAKPLLAEMKRAAEDQDLIVGVADASGKLLWTHSSRHMQRRA
FT                   EGLHFVPGGHWDERSVGTNALALALRTAKPSRVFSAEHFLQAVHDWVCYSAPIRDPRTG
FT                   LPIGVLDFSTTWQKANGLGLVTATALARYIEARLEGYGYAAVFGPPTPLAPAPLQLTLC
FT                   GEAAAYASNRRLELTPRRLEILAILALCPQGLTLDALHAHLYGDQPVSLSTLKAEVSGL
FT                   RKQLGGGVASRPYRLTTPCAVDALEVERRLQAGDVAGALAHYGGPLFCTSESPFLSEWR
FT                   DYLASAVQAAVASSDDAELMWRYTLKGAQAPGDFEVLLRLTQLLPARDPRLALVKARLE
FT                   RLLGESGGV"
FT   repeat_region   347049..348385
FT                   /note="CRISPR"
FT   gene            348719..351007
FT                   /locus_tag="Trad_0300"
FT   CDS_pept        348719..351007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0300"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="COGs: COG1200 RecG-like helicase;
FT                   InterProIPR014021:IPR001650:IPR004609:IPR004365:IPR
FT                   011545:IPR016027:IPR014001; KEGG: ddr:Deide_09960 putative
FT                   ATP-dependent DNA helicase; PFAM: DEAD/DEAH box helicase
FT                   domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; helicase domain protein; SMART:
FT                   DEAD-like helicase ; helicase domain protein; SPTR: C1XID6
FT                   ATP-dependent DNA helicase RecG; TIGRFAM: ATP-dependent DNA
FT                   helicase RecG; PFAM: Helicase conserved C-terminal domain;
FT                   DEAD/DEAH box helicase; OB-fold nucleic acid binding
FT                   domain; TIGRFAM: ATP-dependent DNA helicase RecG"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13440"
FT                   /db_xref="GOA:D7CR40"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR40"
FT                   /protein_id="ADI13440.1"
FT                   /translation="MGGLEKLLETVGQPFADVRELMAGYGALSPEVRAERIARALELLE
FT                   APAPEAPSPGRAVRVAEVLDEDAETSSAPFSSAELDATLESRRLDLGAQAPKKLAPLGL
FT                   KTYRDLLFYYPKRYEDRRALPHFGALREQESATVVGTITGRKATKSRSGMVVTRAFLED
FT                   AHGGRLTAVWFNQPWLEKSLFPGQRVIVTGKVKRRGRLVELSVAHFEIDDDSESLSAGR
FT                   IVGVYAATQGLSQAYVRRAVHRLLGALGVIPDHLPRSVVERFGLLPLDAALREVHFPTS
FT                   EEGLAAALRRLKFDEFLFLELRVLLNRDTTLLGKRFTVKRSDLERFAASLPFALTGAQR
FT                   RVLDEILGDMAAPKQMARLLQGDVGSGKTAVAAAAIYVAVQNGYQAALMAPTEILARQH
FT                   YLNLIQYLYPLGVECDLFIGSAGSRERREARERLSASQTDLAVGTHALIQEGVTFRNLG
FT                   LAVIDEEHRFGVEQRRRLLSGNPDVLVMSATPIPRSLALTYYGDLELSVIDELPPGRKG
FT                   VQTRLVSDARRRDVYRFAWSEIKKGRQVYLVTPLIEESEAEVMSEIVSATKMFEDLQAL
FT                   MPEACRLGLLHGKMTGPEKDEVMERFRRHEFDLLVSTTVIEVGVDIPNASVMIIENAER
FT                   FGLSQLHQLRGRVGRGEHESFCILVAGDRSKRTQHRLSVIEKHTDGFVIAEKDLELRGP
FT                   GELKGTRQSGMPDLVLGDLSKDTELIERSRELAKKMLAADPKLEAPWATRLREELKRRS
FT                   RAVAFREII"
FT   gene            351113..351577
FT                   /locus_tag="Trad_0301"
FT   CDS_pept        351113..351577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0301"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_3738 hypothetical protein; SPTR:
FT                   Q01NA9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13441"
FT                   /db_xref="GOA:D7CR41"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR41"
FT                   /protein_id="ADI13441.1"
FT                   /translation="MQLFWRFSVFILIAGFIGGWWLRLRIGGDYLAALVRVIFIPWLLH
FT                   LLYALAHVVRREGITELWMLTAILNFAFGTSLLVFAGFFYRARPRLAAVVPLTLGLVHL
FT                   ALLGFYQSFSVHGIVFPTLPNLYFVAAVLFTVAGLLGYTWRAGRWLARRP"
FT   sig_peptide     351113..351169
FT                   /locus_tag="Trad_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            351731..353305
FT                   /locus_tag="Trad_0302"
FT   CDS_pept        351731..353305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0302"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /note="COGs: COG0111 Phosphoglycerate dehydrogenase and
FT                   related dehydrogenase;
FT                   InterProIPR006236:IPR006139:IPR006140:IPR002912:IPR 016040;
FT                   KEGG: ttj:TTHA0952 D-3-phosphoglycerate dehydrogenase;
FT                   PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; amino acid-binding ACT domain protein;
FT                   SPTR: B7A719 D-3-phosphoglycerate dehydrogenase; TIGRFAM:
FT                   D-3-phosphoglycerate dehydrogenase; PFAM: D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD binding domain; ACT
FT                   domain; D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic domain; TIGRFAM: D-3-phosphoglycerate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13442"
FT                   /db_xref="GOA:D7CR42"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR42"
FT                   /protein_id="ADI13442.1"
FT                   /translation="MAFKVLVTDTMQLGDKTYPHLEVDYREGIAREELLEIVAHYDAII
FT                   TRSRTQVDETLIRAAARLKVIGRGGVGVDNIDIAAASRRGILVLNAPESNNVSAAELTI
FT                   ALMLCAARGVSRSDRLIRAGKWDRKFLGREVKGATLGIIGLGRIGSLVSRRAQGLGMQV
FT                   LAYDPYISRQRAVDLKVELFDDLAEMLRRANFLTVHTPLTEETSGMIGDAELALLPEGA
FT                   VVVNAARGGIIQEEALVRALDAGKLFAAGLDVFVLEPPAADHPLLGRDDVVLTAHLGAN
FT                   TAEAQARVGAEILERTALALNGDLSRGAVNAPALAPEVMSALGPYLKLGEALGKLVAQL
FT                   AHGRMRELQVEFSGTFPMDPDPVAVAVTKGLLEPILDEPPNYINAPSIAKERDIRVSKV
FT                   MASRSRGYTAHVLVTLVTNEGRFSVGGSVLGTEPRIVSVDEYPIELRPEGTMLICTNYD
FT                   RPGAVGKVGTVLGDAGVNISGMQLSRVGENGLALFALGLDQEPPESVLEVLRSLPNVLV
FT                   SLKLVRL"
FT   gene            353305..354441
FT                   /locus_tag="Trad_0303"
FT   CDS_pept        353305..354441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0303"
FT                   /product="aminotransferase class V"
FT                   /note="COGs: COG0075 Serine-pyruvate aminotransferase/
FT                   aspartate aminotransferase; InterPro
FT                   IPR000192:IPR015424:IPR015421; KEGG: ddr:Deide_09840
FT                   putative aminotransferase class-V; PFAM: aminotransferase
FT                   class V; SPTR: C1CUJ8 Putative Aminotransferase class-V;
FT                   PFAM: Aminotransferase class-V"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13443"
FT                   /db_xref="GOA:D7CR43"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR43"
FT                   /protein_id="ADI13443.1"
FT                   /translation="MFRPRLYAPGPVEVPPQVLEATARPVLHHRTQAFRELFARTRARL
FT                   AEVACVPGDDVIILAGSGTAGFEAGLLACVPRGAKVVGVNAGKFGERWVKLARHYGCEV
FT                   VELKLPWGEAVDPEAVRALLREHPDVQAVMSTHSETSTGVLHDVQALAQVVRETAPEAL
FT                   VLIDAVTSLGVAELRPKAWGLDGVFSGSQKGLMTPPGLAFAWLSERAWARSEGLNPTFY
FT                   LDLRKERAQQRAGQTAYTPAVSLVAGLEVALGLLLDEGLEALWRRRERLNGAVLAGAAA
FT                   LGCRPYAARVSPAVAALYAPERVSAPAIVKGFAARGMRIAGGQDDAKEHLFRPSVMGYA
FT                   DRYDALTIVAALEEVLLELGQPVALGQGVSAALRVLAG"
FT   gene            354431..354874
FT                   /locus_tag="Trad_0304"
FT   CDS_pept        354431..354874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0304"
FT                   /product="HEPN domain protein"
FT                   /note="COGs: COG2250 conserved hypothetical protein related
FT                   to C-terminal domain of eukaryotic chaperone SACSIN;
FT                   InterPro IPR007842; KEGG: tth:TT_P0020 hypothetical
FT                   protein; PFAM: HEPN domain protein; SMART: HEPN domain
FT                   protein; SPTR: Q746N3 Hypothetical conserved protein;
FT                   manually curated; PFAM: HEPN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13444"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR44"
FT                   /protein_id="ADI13444.1"
FT                   /translation="MQADRLGFVERSLDWWSQARRDLSHARADVDAAYYEWACFSAQQA
FT                   AEKGLKAVFQALGAVVWGHSVADLLRELGKHQRVPPELDDAALELDKAYIPTRYPDAHP
FT                   SGYPGGRYVKTEALRLVAHAEAILEFCSGFLPSVDGGDADRDA"
FT   gene            354798..355160
FT                   /locus_tag="Trad_0305"
FT   CDS_pept        354798..355160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ttj:TTHB064 hypothetical protein; SPTR: Q746N2
FT                   Hypothetical conserved protein; manually curated; PFAM:
FT                   Nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13445"
FT                   /db_xref="GOA:D7CR45"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR45"
FT                   /protein_id="ADI13445.1"
FT                   /translation="MRRLSLSSVQVFYPAWTAATLTETLKQRVAQLHEVLPLKQAVLFG
FT                   SWSKGRATVASDIDVLLVYRGEAREGCYALAWRTLAVPGIELHLYSEAEAAEHEKLLSE
FT                   MTAGGITLFEPPQGPL"
FT   sig_peptide     354798..354854
FT                   /locus_tag="Trad_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            355177..355626
FT                   /locus_tag="Trad_0306"
FT   CDS_pept        355177..355626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_1165 hypothetical protein; SPTR:
FT                   Q1K2R9 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF2721)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13446"
FT                   /db_xref="GOA:D7CR46"
FT                   /db_xref="InterPro:IPR021279"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR46"
FT                   /protein_id="ADI13446.1"
FT                   /translation="MRLDLTTPALLFPAISLLLLAYTSRFLTLATLIRELHKRYLEGEG
FT                   AAVLGQISNLRRRVQLIRAMQALGVLSFFGCVFSMFLLFIGAETLGQGVFGLSLLLLMV
FT                   SLALSVWEIQMSVGALDLQLQDLEDEEGRLHRRPRKRTPRSRARR"
FT   sig_peptide     355177..355239
FT                   /locus_tag="Trad_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(355623..356933)
FT                   /pseudo
FT                   /locus_tag="Trad_0307"
FT   gene            357059..358312
FT                   /locus_tag="Trad_0308"
FT   CDS_pept        357059..358312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0308"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: vap:Vapar_0761 glycosyl transferase group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: C6MPC9
FT                   Glycosyl transferase group 1; PFAM: Glycosyl transferases
FT                   group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13447"
FT                   /db_xref="GOA:D7CR47"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR47"
FT                   /protein_id="ADI13447.1"
FT                   /translation="MPPTLPPDRLTLAFYTLDYPPGRFVSSIGLYTQKLAAALAARGHR
FT                   VFVLSRSEEGERVERDGEVTVLRLGPPRVAVPARVTLFSASSRALTGLRDEVRFRRRLA
FT                   DKLSELVAREGVDLIEAADSAAEAGFYRPQRHPRVPLVIRLHGPTAVAELFDRNVPEFG
FT                   RRLIRRAERALFVKATHLTTPSEVSRRLFAAELGLHDRPIAVFPNIPTVDPTRITPADP
FT                   AAADPDTVLYVGRSTKQKGLQVLVKAIPGVLEAHPSARFVFVGPDGPSASGHPSFQAYL
FT                   LSQVPERYRGALHFVGYRDHAALRCFYERAALCVFPSLFESFGYTCLEAMTYGKAIIAS
FT                   PTGGMGEMLAEGRCGLLYTPPDADELRRHILTLLQDAPLRERLGRAARERALSCYHPEV
FT                   IVAETERFYYRAVAECAR"
FT   gene            complement(358309..359079)
FT                   /locus_tag="Trad_0309"
FT   CDS_pept        complement(358309..359079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0309"
FT                   /product="Methyltransferase type 12"
FT                   /note="InterPro IPR013217; KEGG: dge:Dgeo_1186
FT                   methyltransferase type 11; PFAM: Methyltransferase type 12;
FT                   SPTR: Q1IZ51 Methyltransferase type 11; PFAM:
FT                   Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13448"
FT                   /db_xref="GOA:D7CR48"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR48"
FT                   /protein_id="ADI13448.1"
FT                   /translation="MNYDPLAELYDLQYAHYRDDLPFYTRLAHDYGGPVLELGAGTGRV
FT                   AAALARAGFEVVALEPAEQMILRGRARLAREGLEERVTYVPGDMRSVRLGRRFPLVIAP
FT                   FNTLMHAYTLKDQDATLETVRAHLEAGGRFAFDLYTPRFGQLGVLRREAEWAHVGAAGA
FT                   LERGGAGELFLLQEHDPDAQLITSHYFFDRTDAAGRLTRQRYRLTQRYFTRFELERALL
FT                   QAGFANVRLYGGFDRTRVSATAPHLVGIAAAAAP"
FT   gene            complement(359085..360725)
FT                   /locus_tag="Trad_0310"
FT   CDS_pept        complement(359085..360725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0310"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1132 ABC-type multidrug transport system
FT                   ATPase and permease components;
FT                   InterProIPR017871:IPR001140:IPR003439:IPR017940:IPR
FT                   011527:IPR003593; KEGG: met:M446_4330 lipid ABC transporter
FT                   ATPase/inner membrane protein; PFAM: ABC transporter
FT                   related; ABC transporter transmembrane region; SMART: AAA
FT                   ATPase; SPTR: C1XSC5 ABC-type multidrug transport system,
FT                   ATPase and permease component; PFAM: ABC transporter; ABC
FT                   transporter transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13449"
FT                   /db_xref="GOA:D7CR49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR49"
FT                   /protein_id="ADI13449.1"
FT                   /translation="MTLPPLLLPRSPLALLGFLAATLNALVRVAVAPLLVAPLFDRVFV
FT                   QGDFDALGGVLALGGAALLTGALALWAQDALLGTLAARTSERWRAGLYEALLKRPLTRA
FT                   ESSGGLAGRLLADLREVETYVQFGLGTLVAESLTLLGSLAYLFYVNPEATLVLLGAALP
FT                   LALTLTVVGRRIEASTARAQAHLEAVSAHVQEGLAQGEVGRAFGLGGFLLGRFGPANRG
FT                   AARAQTERALWAALQTPLAQLLGFAALALLLFVLTRSVRAGAMSLGEVTAFITLLALLS
FT                   TPAQLLPRGYALLQGARAAAARLHALRALPPAPLPPPSASSPPPRAPVLQLDGVSWRSE
FT                   GRTVLHELNLTLRGPALVALTGESGSGKTTLLRLALGLLEPSAGRVLLAGAPLGAFPEA
FT                   ELRRRLAYVPQHVTLFRGSVRDNLLLGRELPESALWEVLEAVALAGALRPRGLGAPLAE
FT                   GGAGLSGGQRQRLAVARALLSDPDVLVLDEPSANLDEASEAVLARVLQAQARSRLVLVV
FT                   AHRPALVRAAHQVLVLRGGKLAPAEPLNV"
FT   sig_peptide     complement(360636..360725)
FT                   /locus_tag="Trad_0310"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(360722..361945)
FT                   /locus_tag="Trad_0311"
FT   CDS_pept        complement(360722..361945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0311"
FT                   /product="glycosyl transferase family 19"
FT                   /note="InterPro IPR003835; KEGG: cyh:Cyan8802_2729
FT                   hypothetical protein; PFAM: glycosyl transferase family 19;
FT                   SPTR: C1XSC3 Lipid A disaccharide synthetase; PFAM:
FT                   Lipid-A-disaccharide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13450"
FT                   /db_xref="GOA:D7CRG0"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRG0"
FT                   /protein_id="ADI13450.1"
FT                   /translation="MTPHPTPPHPTLHPPSQLVLVSNGPGELYTWVRPVLRELRRQAPA
FT                   VRAAISLVPCQFASGSEARIAATFGADAVTTPGDFVRFMAGGALPGVGAGEGAVLGLGG
FT                   GPGLTLKLAQRLRFRAFRYAFVPYWHPSLTALFVDSPRTAQRARLLGAPASRLEVVGNL
FT                   VADAVEDAEPAAEPGSPHLLLFCGSRDAFAVHLIPLMLAVADALHHALPRARFVWPVSR
FT                   LLSAEALAAGIAGAHKDTLGGLAGRRDGDSVLTPGGARVELVPEEARYAHMRVADLALT
FT                   LPGTNTLELGVAGVPAVVVLPLNKPEVIPLEGPGHWLSLVPLVGTALKRHAVRLAAPHL
FT                   PVSLPNHLSGEDLMLELKGVLTHEHVAQAALALLGDDAERHRRRARLLATMPRPGAAAR
FT                   LVSRVLER"
FT   gene            complement(362070..362849)
FT                   /locus_tag="Trad_0312"
FT   CDS_pept        complement(362070..362849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0312"
FT                   /product="acyl-(acyl-carrier-protein)--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="COGs: COG1043 Acyl-(acyl carrier protein); InterPro
FT                   IPR001451:IPR010137:IPR011004; KEGG: noc:Noc_1752
FT                   UDP-N-acetylglucosamine acyltransferase; PFAM: transferase
FT                   hexapeptide repeat containing protein;
FT                   PRIAM:Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc
FT                   osamineO-acyltransferase; SPTR: C1XSC2
FT                   Acyl-(Acyl-carrier-protein)--UDP-N-acetylglucosamine
FT                   O-acyltransferase;
FT                   TIGRFAM:acyl-[acyl-carrier-protein]--UDP-N-acetylgl
FT                   ucosamineO-acyltransferase; TIGRFAM:
FT                   acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13451"
FT                   /db_xref="GOA:D7CRG1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRG1"
FT                   /protein_id="ADI13451.1"
FT                   /translation="MNPEPAPPEVHPSAVVHDGATLGPGCRVGPFVVVEADVTVGAQSV
FT                   LEAGTVLQRGSRVGARCRLGPYATVGGEPMDTKFRGEPSYAVLEDEVVLREFASVHRAS
FT                   GEGQATRVGRKTLVMAYAHVSHNVQVGQGCVLTTQVQLGGHSEVGDFAVLGSAALLHQG
FT                   CRVGAYAMYGAGSAANQDILPYSMARGNPARHYRLNRVGLTRHGVTGERYRALERAVRA
FT                   FRRRDWALLEALALESAEVRTMLDFRARSKRGLCGFV"
FT   gene            complement(362883..363341)
FT                   /locus_tag="Trad_0313"
FT   CDS_pept        complement(362883..363341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0313"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /note="COGs: COG0764
FT                   3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
FT                   dehydratase; InterPro IPR013114:IPR010084; KEGG:
FT                   ttj:TTHA1815 (3R)-hydroxymyristoyl-acyl carrier protein
FT                   dehydratase; PFAM: Beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA/FabZ; SPTR: C7IF99
FT                   Beta-hydroxyacyl-(Acyl-carrier-protein) dehydratase FabZ;
FT                   TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ; PFAM: FabA-like domain; TIGRFAM:
FT                   beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13452"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRG2"
FT                   /protein_id="ADI13452.1"
FT                   /translation="MSDAQETPIDIRALLPHRYPFLFVDAFVSQEGDTFECRKNVSHGE
FT                   PFFQGHFPQEPVMPGVLILEALAQAAGVGLAVREGWHRRPRGDAPIGYLAGVDNAKFKR
FT                   KVVPGDVLRLTGTITLFRRRLCRVAARALVGEEVAAEAELSFVFADQP"
FT   gene            complement(363355..364341)
FT                   /locus_tag="Trad_0314"
FT   CDS_pept        complement(363355..364341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0314"
FT                   /product="oxidoreductase domain protein"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR000683:IPR004104:IPR016040; KEGG: tai:Taci_0947
FT                   oxidoreductase domain protein; PFAM: oxidoreductase domain
FT                   protein; Oxidoreductase domain; SPTR: C1XSC0 Predicted
FT                   dehydrogenase; PFAM: Oxidoreductase family, C-terminal
FT                   alpha/beta domain; Oxidoreductase family, NAD-binding
FT                   Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13453"
FT                   /db_xref="GOA:D7CRG3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRG3"
FT                   /protein_id="ADI13453.1"
FT                   /translation="MKRLKVAVVGFGVMGRNHAGVYAVLPHTDLVAVVDPSEERRAEAA
FT                   QRFAVQTFPDVGAMLARLGGQLDAVSVAAPTSYHYPLTETLLKAGLHVLVEKPVATNVQ
FT                   HAERLVALSRRLGLTLQVGHITRFYQAVELLGKRITCPYLIEARRLTPNARIKDVGVIL
FT                   DLMIHDIDIVLGIVPGPITGVSVAGHVLNGDPHEDVAAAQITFQNGCIARFLASRVAPD
FT                   AERTLVVAEPQQTLRVDFGKEPHTEVSVYRPIAEAQGRSEVRLDRVVVHEDNPLRRELE
FT                   HFLARIRRSAPPIGTLDDDLRSLKLATQLIEQLKVQRYERGAVPVLA"
FT   sig_peptide     complement(364285..364341)
FT                   /locus_tag="Trad_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(364482..365264)
FT                   /locus_tag="Trad_0315"
FT   CDS_pept        complement(364482..365264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0315"
FT                   /product="UDP-3-0-acyl N-acetylglucosamine deacetylase"
FT                   /note="COGs: COG0774 UDP-3-O-acyl-N-acetylglucosamine
FT                   deacetylase; InterPro
FT                   IPR004463:IPR020568:IPR015870:IPR011334; KEGG:
FT                   sfu:Sfum_1931 UDP-3-O-[3-hydroxymyristoyl]
FT                   N-acetylglucosamine deacetylase; PFAM: UDP-3-0-acyl
FT                   N-acetylglucosamine deacetylase; SPTR: C1XSB9
FT                   UDP-3-O-acyl-N-acetylglucosamine deacetylase; PFAM:
FT                   UDP-3-O-acyl N-acetylglycosamine deacetylase; TIGRFAM:
FT                   UDP-3-0-acyl N-acetylglucosamine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13454"
FT                   /db_xref="GOA:D7CRG4"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRG4"
FT                   /protein_id="ADI13454.1"
FT                   /translation="MISGHGLHTGAPSWVRLYREAGPVRFRRGGATIPAHVDFVVDTRR
FT                   STTLGTAGGRVATVEHLLAALYASGWWEGLVIEVSADELPILDGSAAPWLELLGDLGPP
FT                   PPPPQGLVVENAFSLRHAHSTLRVHPGPARLCAEIHFAHPAIGKQRWCGGPQRFGELLE
FT                   ARTFGFLSDLEALRAQGLATAASLQNAIVYGSEGPLSPLRFPDEPVRHKALDALGDLYL
FT                   LGRPLLGCVEVIRGSHSAHVAFAQALLREAMLLSLRPS"
FT   gene            complement(365342..368206)
FT                   /locus_tag="Trad_0316"
FT   CDS_pept        complement(365342..368206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0316"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl) glucosamine
FT                   N-acyltransferase"
FT                   /note="COGs: COG1044 UDP-3-O-(3-hydroxymyristoyl); InterPro
FT                   IPR018357:IPR001451:IPR011004:IPR007691; KEGG:
FT                   mrd:Mrad2831_3438 UDP-3-O-(3-hydroxymyristoyl) glucosamine
FT                   N-acyltransferase; PFAM: transferase hexapeptide repeat
FT                   containing protein; SPTR: C1XGQ5
FT                   UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase;
FT                   TIGRFAM: UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase; TIGRFAM: UDP-3-O-[3-hydroxymyristoyl]
FT                   glucosamine N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13455"
FT                   /db_xref="GOA:D7CRG5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR008763"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRG5"
FT                   /protein_id="ADI13455.1"
FT                   /translation="MRPALRRLALLGALLLPTALAQGAAAPPPPAERAGDTPLFPLGAL
FT                   EAGARGYALTTGANNRPERLEVEVIALQYDLGTAFPLVLVETSGPLVERAGGIAAGMSG
FT                   SPVYLPYGGEDALLGAIGFTFPDGSGGLGLVTPIGAMRQAEAPEARPAAFGPPFDPRAA
FT                   APVRTPLLLEGLSGRAARLLGPLLAAQGLPATLQVPTRLQVQGRAGAPPHADADAAFEP
FT                   APGGAVSVQLVRGDLTVAAVGTLTLVEGGRFWAFGHPLLNQGEVSFALAPAYVTAVVPN
FT                   RTLPFKLADSGRRVLGAVTQDRPAALSGTLGEAPQFVPVTLTLQRGEAQASAHLEVTAL
FT                   EALFAPLLATASLQLLDDFLAETRGGTAELAWEIALRGGRTLRLLAQTTDPADIALVTA
FT                   ALAAEPLALLAENPFRAPGLGRVALHVALERDARVAEIADVVLEDAVVPAGGSVGVNVR
FT                   LQPFRQDPVVQRLSVPLPEALAGEVELTVRGGLSPLEADDAGAPPLSFEEFLAGLERSV
FT                   QARELVVEAFVGGELQLLTRQLLPHLVSGSVTRSVTVEGPADAADPAADTETDPETGGA
FT                   APPRRRHPTPRGAPLGRSPPHPAAGGPAVRPHPITAAQLAAQLGGRLEGDDRPVTALAD
FT                   PTAALPDSAVVVTSAAALEALSTQPVAAQLGALVLPDALCPAPRVACPIIWVRDVRLAL
FT                   ARLSALFAPPPPRPQLSDGAVVAPDATLGEAVSVGAGAVIGAGAVIGAGSRVGPGCVLG
FT                   EGVTLGPDCVLHANVTLYPGTALGARVIVHSGAVLGADGFGYAFGPQGAVKIHHLGGVV
FT                   IEDDVEVGANTCIDRGTLLDTRVGARTKIDNLCQIGHNVQIGPDCVIAGGSAIGGSTVL
FT                   ERGVLLGGAVAVTDHVRLGAGARVGGRSSVTKSVPAGETWAGYPAKPQRKWVRELYLIG
FT                   KLEAIWASVRAQGRPVSGARTGDD"
FT   sig_peptide     complement(368105..368206)
FT                   /locus_tag="Trad_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(368211..369320)
FT                   /locus_tag="Trad_0317"
FT   CDS_pept        complement(368211..369320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0317"
FT                   /product="cell shape determining protein MreB/Mrl"
FT                   /note="COGs: COG1077 Actin-like ATPase involved in cell
FT                   morphogenesis; InterPro IPR004753; KEGG: mta:Moth_2371 rod
FT                   shape-determining protein Mbl; PFAM: cell shape determining
FT                   protein MreB/Mrl; SPTR: Q2RFY6 Rod shape-determining
FT                   protein MreB; PFAM: MreB/Mbl protein; TIGRFAM: cell shape
FT                   determining protein, MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13456"
FT                   /db_xref="GOA:D7CRG6"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRG6"
FT                   /protein_id="ADI13456.1"
FT                   /translation="MVYCPLLWLRSTLHVALWGALPPGEPVFRGARVGIDVGTTAVRVC
FT                   VKGRGVILREPTVVALDKATGTPRAVGRAALQLLGEAPGDVIPVRPLQDGLITEEALLE
FT                   EVLREVLRRLVSAPRRLLRGALGPSVALCLPAAATPAQTRAALATVQDGGARAVELVDP
FT                   PLAAALGAGLPVTEAAGCFVADLGGGSTDLAVIALGGVVVGETLRVAGGTFDEAVVRAV
FT                   RRHHGVLIGERSGEELKRRIGSVSSEAEKAAADETLEVRGRDVARGLPKTVTVSRAEVG
FT                   EALQEGAARLASAVRRLLETAPAELTADIVRSGLVLTGGGSYLRGLDSYLQTHTGLPVT
FT                   RAPSAEDCTAVGALRALSCPEPLRAAPRT"
FT   sig_peptide     complement(369228..369320)
FT                   /locus_tag="Trad_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(369374..369961)
FT                   /locus_tag="Trad_0318"
FT   CDS_pept        complement(369374..369961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0318"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="COGs: COG1214 Inactive homolog of metal-dependent
FT                   protease putative molecular chaperone; InterPro IPR000905;
FT                   KEGG: dge:Dgeo_1525 peptidase M22, glycoprotease; PFAM:
FT                   peptidase M22 glycoprotease; SPTR: Q1YFE7 Putative
FT                   protease, peptidase M22 family; PFAM: Glycoprotease family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13457"
FT                   /db_xref="GOA:D7CRG7"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRG7"
FT                   /protein_id="ADI13457.1"
FT                   /translation="MTDPATNLTGTPLYLGLDTASAFLALALWSPHGGLVAACCEEVGR
FT                   EHARRLPRALDEVFERAGRTPRDLAGVAVGVGPGSYTGLRVGVAAAQGLARGLGVPLRG
FT                   ETSLAAQAASVLGPDLPAALVALDARRGNVYAGVYRYAPQGPVLAGDIVKASRDALRAA
FT                   HPLPYFENLAPDAGYLARCAQRGASALRPLYL"
FT   sig_peptide     complement(369851..369961)
FT                   /locus_tag="Trad_0318"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(370194..370430)
FT                   /locus_tag="Trad_0319"
FT   CDS_pept        complement(370194..370430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0319"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: B8A0H0 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13458"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRG8"
FT                   /protein_id="ADI13458.1"
FT                   /translation="MQTPPPTPERASREEYGREVERIRKLIEHIHAQAERLQRAAEALP
FT                   DELGERLEEKADELLHKADELRDEAKELEAGAS"
FT   gene            complement(370511..370951)
FT                   /locus_tag="Trad_0320"
FT   CDS_pept        complement(370511..370951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0320"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="COGs: COG0802 ATPase or kinase; InterPro IPR003442;
FT                   KEGG: ddr:Deide_23210 hypothetical protein; PFAM: protein
FT                   of unknown function UPF0079; SPTR: C1XUT3 Conserved
FT                   hypothetical nucleotide-binding protein; PFAM:
FT                   Uncharacterised P-loop hydrolase UPF0079; TIGRFAM:
FT                   conserved hypothetical nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13459"
FT                   /db_xref="GOA:D7CRG9"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRG9"
FT                   /protein_id="ADI13459.1"
FT                   /translation="MPLLLPTLDATAAFAGELAQSAPAGTLLVLLGPLGVGKTTLVQQL
FT                   GRALGSTAQITSPTYTLIHEYPTPAGPLVHLDAYRLGGDASAAQTLFDLGLDDYLARAR
FT                   LVAAEWGAGLVEVVPEAWVVQLEPAAGDARRVTVTQRGRVLF"
FT   sig_peptide     complement(370907..370951)
FT                   /locus_tag="Trad_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(371016..372968)
FT                   /locus_tag="Trad_0321"
FT   CDS_pept        complement(371016..372968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0321"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dge:Dgeo_0054 hypothetical protein; SPTR:
FT                   Q1J2C7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13460"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRH0"
FT                   /protein_id="ADI13460.1"
FT                   /translation="MSADYCRLVRELKTLLPPRRAAQLLASGLQARGLTPASATPNDLG
FT                   AVIEAHVLPSLRLSLGPEAAQEAARRLRAQLPSPETPPEPPDQLRAQARAIEVLARSLE
FT                   GTHLLLEWGEVGRLRALLALIAAEHALGRDASAPLAEAQEVHAQLLRKLEARLAAQAGE
FT                   LTALEARLAALTEAGGEARLRRLRALLKLVRRAHEGRELADAELERAHALASELEADLE
FT                   AARARRSRQLAAEAREIAALQERFATLLALEPETARHLAAAEAQLRAGEPLGEALQALP
FT                   AQLSAAQSALQTALRLEVEEVLTRETAEAAPDEEVLRDLTLTLKVLDTTLPSPTDIQRV
FT                   RDYARTAGDRRALRALHRLESDAAPYRDLPGEAAQTLRTALEAAREHFGAHGAPPDLSA
FT                   ARSALERAQEESRALSETLEGRLQAAERALEALGAPSDEQALELRWRLRRLRAQLEAAG
FT                   RGSLHVCHDLAAEIADVEARLGELQGGARATREVAAQLVQSTVLDDLLGPPRTPASPPP
FT                   EAGALAPLKAWLEARCAAPSVAGAALFADTPADAAHPTPALAAGTLQADLQALQRAARL
FT                   CRRRAAALGAELGVGAARGLTIETPTHALLLSFPTPQLTLALTTPAPTWSSAARQLLEA
FT                   SLPELQRRLQTLFGP"
FT   sig_peptide     complement(372852..372968)
FT                   /locus_tag="Trad_0321"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(372971..374245)
FT                   /locus_tag="Trad_0322"
FT   CDS_pept        complement(372971..374245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddr:Deide_00510 conserved hypothetical
FT                   protein, precursor; putative membrane protein; SPTR: C1CXP3
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13461"
FT                   /db_xref="GOA:D7CRH1"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRH1"
FT                   /protein_id="ADI13461.1"
FT                   /translation="MISPPTAPPPLARTRRLAALVCAACLLLNAALARATPGELLGAYE
FT                   RAQGALSQSLALLESEGGEAALRSLRRAEAAFPALAETLSPSLRAGLEATAKRAEAALA
FT                   SGSATDFAVQRAVLGGALGRALYERALEEAAQGRAEEAAALFAALERAHGLAAAPEGDR
FT                   GDPQRAFEHRLAAHGLEALGGLPTGDRDRDYRTLAERYGELLLVQGSPRLPAATTDALL
FT                   AAIDQVVAGGSPEEPLAALREGLAAFAAASAPPARAPTQAPAAPELEAAATRHEGPAPP
FT                   ATLPPTPAPAAPPTSAFSDHALQALWVLLGLLALVALVQALALALAGQQPLHHLAVALL
FT                   LLPASLEGLAALAPLSGWPALAPLARLSLQSAALQRLWVLLVAVAVLCLAVSWRRTKAP
FT                   ADGTPRPAPAPPRLASTELDWDEDF"
FT   sig_peptide     complement(374147..374245)
FT                   /locus_tag="Trad_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            374460..375080
FT                   /locus_tag="Trad_0323"
FT   CDS_pept        374460..375080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0323"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="COGs: COG0194 Guanylate kinase; InterPro
FT                   IPR008144:IPR017665:IPR008145; KEGG: ttj:TTHA1562 guanylate
FT                   kinase; PFAM: guanylate kinase; PRIAM: Guanylate kinase;
FT                   SMART: guanylate kinase/L-type calcium channel region;
FT                   SPTR: Q5SI18 Guanylate kinase; TIGRFAM: guanylate kinase;
FT                   PFAM: Guanylate kinase; Uncharacterised conserved protein
FT                   (DUF2315); TIGRFAM: guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13462"
FT                   /db_xref="GOA:D7CRH2"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRH2"
FT                   /protein_id="ADI13462.1"
FT                   /translation="MSAKRSGILFVMTGASGVGKDTIRQAALPDLDNLFFSISATTRAR
FT                   RPGEVHGKQYFFYDKAAFEALLREDALLEYAEYVGDYYGTPAAPVHEALASGQDVLLEL
FT                   ELVGAREVKRRLPEAIMIFIAPPSLSELERRLRGRGTDSESRIQKRLARAREEIRAVKE
FT                   FDYVVVNDTLSTAVRDFCSIIHAERARTKHLSARDIANFLREL"
FT   sig_peptide     374460..374537
FT                   /locus_tag="Trad_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            375212..375520
FT                   /locus_tag="Trad_0324"
FT   CDS_pept        375212..375520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0324"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /note="InterPro IPR006110:IPR003716; KEGG: dge:Dgeo_0252
FT                   DNA-directed RNA polymerase subunit omega; PFAM: RNA
FT                   polymerase Rpb6; SPTR: Q1J1S9 DNA-directed RNA polymerase
FT                   subunit omega; TIGRFAM: DNA-directed RNA polymerase, omega
FT                   subunit; PFAM: RNA polymerase Rpb6; TIGRFAM: DNA-directed
FT                   RNA polymerase, omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13463"
FT                   /db_xref="GOA:D7CRH3"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRH3"
FT                   /protein_id="ADI13463.1"
FT                   /translation="MAQEGFDTLMALTDSRYTLSMIVARRAAQLKLGLPSVLPKEELPV
FT                   TRNTVTIAMKELERGAALRWGRDLPSTEELRALVERERREESPAYSVSRRPAAEDDL"
FT   gene            375587..376774
FT                   /locus_tag="Trad_0325"
FT   CDS_pept        375587..376774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0325"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase"
FT                   /EC_number="6.3.2.5"
FT                   /note="COGs: COG0452 Phosphopantothenoylcysteine
FT                   synthetase/decarboxylase; InterPro
FT                   IPR003382:IPR007085:IPR005252; KEGG: ttj:TTHA1560
FT                   DNA/pantothenate metabolism flavoprotein; PFAM:
FT                   DNA/pantothenate metabolism flavoprotein domain protein;
FT                   flavoprotein; PRIAM: Phosphopantothenate--cysteine ligase;
FT                   SPTR: Q5SI20 DNA/pantothenate metabolism flavoprotein;
FT                   TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase; PFAM:
FT                   DNA / pantothenate metabolism flavoprotein; Flavoprotein;
FT                   TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase,
FT                   prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13464"
FT                   /db_xref="GOA:D7CRH4"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRH4"
FT                   /protein_id="ADI13464.1"
FT                   /translation="MRLLVAASGGVAAIKTPSLLRRLREAGHEVRAVATDDALQFVTKL
FT                   SLAVAAGGEVFDRAAWFAPDGRARHLELARWADALLVAPATADALASAATGRADDVVSA
FT                   LVLGGVRRVFWVPAMNTAMWTHPLVQANVRTLQALGHRFLGPDEGPLAAQGEGSGVGRM
FT                   LEPEAVVAALGFPGDLAGRRVLVSAGPTREYLDPVRFLSNPSSGRMGYAVAEAARDRGA
FT                   EVVLVSGPTALPAPAGVHFEAVETAEEMLGALLKHFAWSELLVMSAAVADWRAAHPKGE
FT                   KEAKSGERQTLELVRTPDILETLAARRRNQVLVGFAMETHAGVARAADKARRKGLAFIC
FT                   LNYPTREGTAFGGSENEVTLVTQAGDAEPLPRMPKRELADRILDRAKPLLPPPTP"
FT   sig_peptide     375587..375625
FT                   /locus_tag="Trad_0325"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            376837..377295
FT                   /locus_tag="Trad_0326"
FT   CDS_pept        376837..377295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0326"
FT                   /product="arginine repressor, ArgR"
FT                   /note="COGs: COG1438 Arginine repressor; InterPro
FT                   IPR001669:IPR011991; KEGG: dge:Dgeo_2316 arginine
FT                   repressor, ArgR; PFAM: arginine repressor; SPTR: Q1IVX6
FT                   Arginine repressor, ArgR; TIGRFAM: arginine repressor;
FT                   PFAM: Arginine repressor, C-terminal domain; Arginine
FT                   repressor, DNA binding domain; TIGRFAM: arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13465"
FT                   /db_xref="GOA:D7CRH5"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRH5"
FT                   /protein_id="ADI13465.1"
FT                   /translation="MPSKEYRQRLIEELVETEFISTQSELAEHLAARGVKVTQATISRD
FT                   VNELRLVRLPAGNGQHRYRSTPLAAQEDVLGELKQRFRLFVRDLKRGENIIVINTDEGH
FT                   AVGIAYVIDKLDRDEIIGSLAGQNTIMVVTRSSGEAEKVLHELEALLE"
FT   gene            377337..379676
FT                   /locus_tag="Trad_0327"
FT   CDS_pept        377337..379676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0327"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /note="InterPro IPR011717:IPR013026:IPR011990:IPR019734;
FT                   KEGG: ttj:TTHA0421 hypothetical protein; PFAM:
FT                   Tetratricopeptide TPR_4; SPTR: B7A850 Tetratricopeptide
FT                   TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13466"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRH6"
FT                   /protein_id="ADI13466.1"
FT                   /translation="MIPINTPYRYFRCWLLLGALLALSLAHAQPRLAVFPFAATDARLG
FT                   VAVADRVAQGVAAPKIAPELALTLVPPYIVQEGRFLSPLTLLGGTESRHAARVLQGALG
FT                   VEVAVTGAVRLAADGLELTLHVARDDGARSFRFRAPESAPGRLVAAARAAIWATTDLPP
FT                   RRAPAHIDLASPYGDFVRGLVLLGQGRAAEAAELLERAARAPGAEARFENRRRALRAAL
FT                   AGDPASPPLLRAALALGAQPLDVGGARRAFADAERHAALPLAQLWRALLAVQAGEGAPE
FT                   LEALARGWASYPFGAVQAALEAAVREGSLSAAARAELAATEASAALLGGVLLAQVLADP
FT                   ALEAALASRLGRRLPTFAYPFERVSQLALAADDPLAAAQALRTATRLEPAGPQSDLYWT
FT                   NLGWAYYLLGVLGESEAASRRALELNPGATVARYNLALVQTISGRLGEALASYEAATER
FT                   DLAATGTVDAAAIEDLRAARARFPQVAGIDYALATLLEASGEDAAAARALGRFVARAGP
FT                   RDAPFVAAAEARRAALRAPAPPLELSPPTVGLGPERLAVARFLPGDRVQLLTELSTPGA
FT                   QLPRRVTLELALRAPSGEVLVRERRTERLALPPQSVAVVLEDLALTLPAGLSPGPYTLL
FT                   VRAREGGQAAAQVTLEVGEGRASLARQLVASGVVLRDLRTQRPLYAAGPAITPDDPEVA
FT                   DARLLNRLLAELARSAAVAEALPDVTQGRFVGLAGAEVFAASGADDVRDFLTFLLLSGE
FT                   AVDAPFAELYARWAVAGAPRAPLASP"
FT   sig_peptide     377337..377450
FT                   /locus_tag="Trad_0327"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(379673..380788)
FT                   /locus_tag="Trad_0328"
FT   CDS_pept        complement(379673..380788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0328"
FT                   /product="glutamate 5-kinase"
FT                   /note="COGs: COG0263 Glutamate 5-kinase;
FT                   InterProIPR019797:IPR001057:IPR001048:IPR002478:IPR
FT                   011529:IPR015947:IPR005715; KEGG: tpd:Teth39_1082
FT                   gamma-glutamyl kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; PUA domain containing protein; SMART: PUA domain
FT                   containing protein; SPTR: A1HNY5 Glutamate 5-kinase;
FT                   TIGRFAM: glutamate 5-kinase; PFAM: Amino acid kinase
FT                   family; PUA domain; TIGRFAM: glutamate 5-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13467"
FT                   /db_xref="GOA:D7CRH7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRH7"
FT                   /protein_id="ADI13467.1"
FT                   /translation="MTSAERAGGATPAWRRIVIKVGTSSLTDERGRIYPPLLWALARGV
FT                   ERLQRATRGKVVLVSSGAGAAGREQLRLSLPLTVPDKQAAAAVGQTLLMLEWARAFAPQ
FT                   PVAQLLLTAADIQDRERYVNAKNTLLASLKLGALPVINENDSVATSELRFGDNDTLSAW
FT                   VAHLVGADVLVILTDVPGLYDADPRTHPDAKRLDTVEDVGAVMHLAGSEGTKRGTGGMV
FT                   TKLRAAALATGAGTETLIIGGGGAALEALAEGELWGTRLLAQAPIAARKSWLARQPTRG
FT                   ALEIDAGALAALRAGRSLLPRGVTAVAGDFAFGDAVAVTHGGVRVGQGLCNYSSHALAA
FT                   IRGRHTREIVGVLGYKDYDEVIHRDNLVLTP"
FT   gene            complement(380959..381477)
FT                   /locus_tag="Trad_0329"
FT   CDS_pept        complement(380959..381477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0329"
FT                   /product="putative phosphohistidine phosphatase, SixA"
FT                   /note="COGs: COG2062 Phosphohistidine phosphatase SixA;
FT                   InterPro IPR013078; KEGG: hoh:Hoch_3490 phosphohistidine
FT                   phosphatase, SixA; PFAM: Phosphoglycerate mutase; SPTR:
FT                   C1XXV3 Phosphohistidine phosphatase SixA; PFAM:
FT                   Phosphoglycerate mutase family; TIGRFAM: phosphohistidine
FT                   phosphatase SixA"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13468"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRH8"
FT                   /protein_id="ADI13468.1"
FT                   /translation="MPDAQHLTLYLVRHAHAGQGDPNDPNDHLRPLSAKGRAQAAALRG
FT                   ALAALEVRFDRLFSSPYTRAAETAAPLAPHAKGGRAEPLSALTHDDYPGLLGTLAATLG
FT                   PSDRCVALVGHEPYLGELAAYLLTGDASGMALRMRKGMLVRLEGSLGPGRMALHTALPP
FT                   KLVRRIAPR"
FT   sig_peptide     complement(381427..381477)
FT                   /locus_tag="Trad_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(381479..382138)
FT                   /locus_tag="Trad_0330"
FT   CDS_pept        complement(381479..382138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0330"
FT                   /product="adenylate cyclase"
FT                   /note="COGs: COG3025 conserved hypothetical protein;
FT                   InterPro IPR008172; KEGG: rca:Rcas_3586 CHAD
FT                   domain-containing protein; PFAM: adenylate cyclase; SPTR:
FT                   A7NPY9 CHAD domain containing protein; PFAM: CYTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13469"
FT                   /db_xref="GOA:D7CRH9"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRH9"
FT                   /protein_id="ADI13469.1"
FT                   /translation="MVEREYKWLVEPAFPPLEALQGALRSCGLVPEPLGERHQEDLYYD
FT                   LPGEVLRRRGVALRVRRFAGQQLVTLKAPGRVRGGFHEREELELPLATAAEDAVAWPAA
FT                   IRTRLAALGGLAAEDDLAALTPLLRIATHRRRVGLHPPQPGARGLAELSFDTVRARRPH
FT                   ASAPAQTVQFLELELEAAPDAPAGALEAVAAALAAHAALTPHRHDKVTHALMLLGA"
FT   gene            382323..382937
FT                   /locus_tag="Trad_0331"
FT   CDS_pept        382323..382937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0331"
FT                   /product="transcriptional repressor, LexA family"
FT                   /note="COGs: COG1974 SOS-response transcriptional
FT                   repressors (RecA-mediated autopeptidase); InterPro
FT                   IPR006199:IPR019759:IPR015927:IPR011056; KEGG:
FT                   cyc:PCC7424_5333 SOS-response transcriptional repressor,
FT                   LexA; PFAM: Peptidase S24/S26A/S26B, conserved region; LexA
FT                   DNA-binding domain protein; SPTR: B7KJK3 SOS-response
FT                   transcriptional repressor, LexA; PFAM: LexA DNA binding
FT                   domain; Peptidase S24-like; TIGRFAM: SOS regulatory protein
FT                   LexA"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13470"
FT                   /db_xref="GOA:D7CRI0"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRI0"
FT                   /protein_id="ADI13470.1"
FT                   /translation="MNELPKMQRKVYERLCEYKERTGRSPELSVFARDLNIHYVSLRQH
FT                   LEALHRKGYVIFESRGRGQSPRLELPARATGVPVLGSIPAGPLSEALAEPEGFLPLTGA
FT                   RQQFALRVSGDSMADLIQDGDIVLFRKGMPTRSGEICAVRVGNSEVTLKYVDHHEPQTV
FT                   TLRPHNPQYPTVAVPATEVHIEGVYLGLVRGELIGALYEAL"
FT   gene            383059..383415
FT                   /locus_tag="Trad_0332"
FT   CDS_pept        383059..383415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0332"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_8573 formylmethionine deformylase;
FT                   SPTR: A5CQB1 Putative carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13471"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRI1"
FT                   /protein_id="ADI13471.1"
FT                   /translation="MNHPALLFRALSSAWQHDAASPHVDLLAADLAAAVGRSRHPLCVG
FT                   LVRKEAIAKLYGLVYLLDGYGVTLRQRYRDGGGAFVYAERRGEVPSEFAGAVVLEHRLA
FT                   VLSAPPAPALAEAA"
FT   sig_peptide     383059..383118
FT                   /locus_tag="Trad_0332"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            383417..384352
FT                   /locus_tag="Trad_0333"
FT   CDS_pept        383417..384352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG4712 conserved hypothetical protein; KEGG:
FT                   hau:Haur_0535 hypothetical protein; SPTR: A9AVA5 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13472"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRI2"
FT                   /protein_id="ADI13472.1"
FT                   /translation="MAPQERSEALLGAGYLTWPELLAQLAEPFPVEAISWRAGSVSRDK
FT                   KRAQALPYAEPRVYEDRLNALCPGLWSVAFRPWGERIICELTIGAVGPDGAILYATRAS
FT                   TGEPGDSPAAVAGTAAEAQAFKRACSKFGLGRYLYDVPITWVDYDDASRKLLQTPSLPQ
FT                   SRPLGRRLEPLTERSLRATSYSRPLGRRLEPLTEARFVPEAQPAAKTPRASREGTQAPP
FT                   QSTPASAPGARLLPPPETAPPAAALTPARAEAMHRELEKLGLSRSAQQRLAKSVLGRDV
FT                   AAFDQLLESEALEVWNAAKRAQTPRRAVGF"
FT   sig_peptide     383417..383515
FT                   /locus_tag="Trad_0333"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            384504..384743
FT                   /locus_tag="Trad_0334"
FT   CDS_pept        384504..384743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ote:Oter_2486 Sel1 domain-containing protein;
FT                   SPTR: C1DYE5 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13473"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRI3"
FT                   /protein_id="ADI13473.1"
FT                   /translation="MRAPPEPSLPELHPVACPACGGDGYTLVAGSGEDEVGCAACGGFG
FT                   VVEVCSGCGAVPALEGGYEVCRCTEAALPERRAA"
FT   gene            complement(384766..385620)
FT                   /locus_tag="Trad_0335"
FT   CDS_pept        complement(384766..385620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0335"
FT                   /product="Hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /note="COGs: COG0181 Porphobilinogen deaminase; InterPro
FT                   IPR000860; KEGG: ttj:TTHA0345 porphobilinogen deaminase;
FT                   PFAM: Porphobilinogen deaminase; PRIAM: Hydroxymethylbilane
FT                   synthase; SPTR: C1XR62 Hydroxymethylbilane synthase; PFAM:
FT                   Porphobilinogen deaminase, C-terminal domain;
FT                   Porphobilinogen deaminase, dipyromethane cofactor binding
FT                   domain; TIGRFAM: porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13474"
FT                   /db_xref="GOA:D7CRI4"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRI4"
FT                   /protein_id="ADI13474.1"
FT                   /translation="MPRIVLGNRTGAPALAQARAVLAELSEGWPDVSISQRTLQSRGGA
FT                   DELLHALQGGRIHIAVQSLDTLPLTLPDGLSVAAVTKRLEPRSALLARGAKSLGDLPKG
FT                   AEVGVPTLRDRAFVLAARRDLKVRVFTGELEDALALLSAQELGALVWPSAPFIQLGQRE
FT                   RVTTLLEPQQLPPAPGQGALALVVRDDDDLASDLAYTLQHRPSFDRACAERAFARQMSS
FT                   SAHHIGAFASVTADGELHLLGAAARDEGDWMIQAEVTGDAAEAEELGRELAQDVLEQLK
FT                   ARA"
FT   sig_peptide     complement(385552..385620)
FT                   /locus_tag="Trad_0335"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(385780..386982)
FT                   /locus_tag="Trad_0336"
FT   CDS_pept        complement(385780..386982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0336"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COGs: COG0192 S-adenosylmethionine synthetase;
FT                   InterPro IPR002133; KEGG: ttj:TTHA1642 S-adenosylmethionine
FT                   synthetase; PFAM: S-adenosylmethionine synthetase; PRIAM:
FT                   Methionine adenosyltransferase; SPTR: Q5SHT8
FT                   S-adenosylmethionine synthetase; TIGRFAM:
FT                   S-adenosylmethionine synthetase; PFAM: S-adenosylmethionine
FT                   synthetase, C-terminal domain; S-adenosylmethionine
FT                   synthetase, central domain; S-adenosylmethionine
FT                   synthetase, N-terminal domain; TIGRFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13475"
FT                   /db_xref="GOA:D7CRI5"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRI5"
FT                   /protein_id="ADI13475.1"
FT                   /translation="MRLVTSESVTEGHPDKLADRISDSVLDAMLQIDPQARVAVETILT
FT                   KGLALIAGEVTCNGYVDLQRIVRDTVREVGYTDAAYGFDADHAAVLIALTEQSPDIAQG
FT                   VSRAQEAPSGDRFDQLGAGDQGMMFGYATDETPELMPLPITLAHALTRRLAAVRREGLL
FT                   PYLRPDGKAQVTVAYDGDRPTAVTAVVLSAQHDPDVDEATLHEDLYTHVIRAALPEAYL
FT                   RDDTAFYINPTGRFVIGGPEGDAGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKVDRSAA
FT                   YYARYMAKNLVGAGLARRALVQLAYAIGVAHPVGIYVDTFGTAALSDDDLSRLLRTVFD
FT                   ARPAAIIAQLGLNRPMYKATSAYGHFGRPELPWERLDKVTQLRAEAAKLAPAALEAAEP
FT                   A"
FT   gene            387154..387678
FT                   /locus_tag="Trad_0337"
FT   CDS_pept        387154..387678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0337"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COGs: COG1670 Acetyltransferase including
FT                   N-acetylase of ribosomal protein; InterPro
FT                   IPR000182:IPR016181; KEGG: tte:TTE0782 histone
FT                   acetyltransferase HPA2-like acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase; SPTR: Q8RBN4 Histone
FT                   acetyltransferase HPA2 and related acetyltransferases;
FT                   PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13476"
FT                   /db_xref="GOA:D7CRI6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRI6"
FT                   /protein_id="ADI13476.1"
FT                   /translation="MPRDSELRLELRPARPADAPALAALQRTIYAEGRWFVGDGAPSAE
FT                   ALAHRLRRLEAARSLVLLAYAADPAEGLALGGWLELHRLRPARMSHVAVLTLAVAPTFR
FT                   QRGVASRLLAEAYRWARAVGVRKVQLSVREHNRAALALYEREGFTLEGRERCQVFDAGR
FT                   FEDNLLMAKFL"
FT   gene            387818..388414
FT                   /locus_tag="Trad_0338"
FT   CDS_pept        387818..388414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0338"
FT                   /product="protein of unknown function DUF88"
FT                   /note="COGs: COG1432 conserved hypothetical protein;
FT                   InterPro IPR002790; KEGG: ttj:TTHA1057 hypothetical
FT                   protein; PFAM: protein of unknown function DUF88; SPTR:
FT                   B7A7J0 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13477"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRI7"
FT                   /protein_id="ADI13477.1"
FT                   /translation="MTQRDPLDEDRLQPTKPAANHRFDPNAARIGEWPEQRVGLFVDTQ
FT                   NLYYAARDIYSRHVDYAVMLKLSERSRHLVHATAYVVEREGEATAYGFVTKLSALGYRV
FT                   RRRKVRVHRADSGGRPVLEGDWDMGIAADIVRAWDYLDVIVLASGDGDFAPMLELAQQR
FT                   GKRVEVLAFREAASQNLLDLADAFMGLADVPDIFV"
FT   gene            complement(388496..389371)
FT                   /locus_tag="Trad_0339"
FT   CDS_pept        complement(388496..389371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0339"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: afw:Anae109_2816
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF6 transmembrane; SPTR: B9ZPL5 Putative uncharacterized
FT                   protein; PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13478"
FT                   /db_xref="GOA:D7CRI8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRI8"
FT                   /protein_id="ADI13478.1"
FT                   /translation="MAVIFALSTALAFGIGDFLGGFAAKRVPALVVSLLSQAAALFVFG
FT                   FVALFVRDELPGGAVLAWGVAAGLALGLGHLYYYRGLSLGQMGIVATDTAVWSALVPVA
FT                   AGLLLGERPSLLALWGIGTVIVALGLVSRSDGQGGGDTQFTRRVGISAWRASQPGRLEG
FT                   ILAGVGYGLFFIGLDQTGTGNPLWPQLAAVAGSLVVLGLAALVVRPPLRTGFAQWPLLV
FT                   AIGVIQATGFVTFILATQTGLLSIVAVLAALSPLPTMILARLVLAQRLTRIQLLGVVMA
FT                   LVGIALVTVA"
FT   sig_peptide     complement(389324..389371)
FT                   /locus_tag="Trad_0339"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            389576..389926
FT                   /locus_tag="Trad_0340"
FT   CDS_pept        389576..389926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0340"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="COGs: COG1733 transcriptional regulator protein;
FT                   InterPro IPR002577; KEGG: lsp:Bsph_2646 putative HTH-type
FT                   transcriptional regulator; PFAM: helix-turn-helix HxlR
FT                   type; SPTR: A3I669 Putative uncharacterized protein; PFAM:
FT                   HxlR-like helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13479"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRI9"
FT                   /protein_id="ADI13479.1"
FT                   /translation="MARSLIKDKYHCAMEVTLELIGGKWKPLLLYYLFGGTRRFGELKR
FT                   LLPDVTQRMLTRQLRELEGAGLVHREVFKEVPPRVEYSLTELGWSLKPLIEGMDAWGEV
FT                   YVTKIVSQSNVE"
FT   gene            complement(390380..391810)
FT                   /locus_tag="Trad_0341"
FT   CDS_pept        complement(390380..391810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0341"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="COGs: COG0064 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase B subunit (PET112 homolog);
FT                   InterProIPR017958:IPR006075:IPR006107:IPR018027:IPR
FT                   003789:IPR004413; KEGG: dge:Dgeo_0414
FT                   aspartyl/glutamyl-tRNA amidotransferase subunit B; PFAM:
FT                   GatB region; GatB central domain protein; Asn/Gln
FT                   amidotransferase; SPTR: C1XTX1
FT                   Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B;
FT                   TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B subunit;
FT                   PFAM: GatB/GatE catalytic domain; GatB domain; TIGRFAM:
FT                   glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)
FT                   amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13480"
FT                   /db_xref="GOA:D7CRJ0"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRJ0"
FT                   /protein_id="ADI13480.1"
FT                   /translation="MFEPVIGLEVHLALKTRTKLFCACAAETFGSPPNTHTCPVCLGLP
FT                   GSLPTVNREAVQKTLTFALALGCEIPAVTQFHRKNYFYPDAPKNYQISQYDHPFGERGA
FT                   LELPSGRRVGITRCHLEEDAGRLQHPVYADYSLVDLNRAGAPLIEMVTEPDLRTPEEAR
FT                   EFLVRVRALARALEVSDANPEEGKMRADVNVSVRRPGEAFGTKVEVKNLNSFRSVQRAL
FT                   EFEIKRQSRILEDGGDVHQATLGWDEGGQKTYLMRTKEEEADYRYFPEPDLPPIHLTKG
FT                   WLDAVRAAMPELPAAKEARYTALGVRPDDAATLAYDRELARFFDAALAAYNGPVQTLAN
FT                   WLLSEVTGHLNAQKGTLETAKLTPQGLTALIALVDAGTISGKIAKDLLPEVIAGADPEA
FT                   LVEERGLTQLSDSAALEVLVDEVMAQNPKVVAQARENPKAINALLGRVMGASKGTANPE
FT                   RVRSLLEGKLKANASVPK"
FT   sig_peptide     complement(391736..391810)
FT                   /locus_tag="Trad_0341"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(391853..392710)
FT                   /locus_tag="Trad_0342"
FT   CDS_pept        complement(391853..392710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0342"
FT                   /product="protein of unknown function DUF114"
FT                   /note="COGs: COG0616 Periplasmic serine protease (ClpP
FT                   class); InterPro IPR002825; KEGG: ttj:TTHA1475 hypothetical
FT                   protein; PFAM: protein of unknown function DUF114; SPTR:
FT                   C1XR10 ClpP class periplasmic serine protease; PFAM: Serine
FT                   dehydrogenase proteinase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13481"
FT                   /db_xref="GOA:D7CRJ1"
FT                   /db_xref="InterPro:IPR002825"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRJ1"
FT                   /protein_id="ADI13481.1"
FT                   /translation="MDVFFQLFWLFFIFSSLTPYFQQQTLFATRARRLRQLEEKRKSRA
FT                   ITLIHRQEAINLLGVPISRYINIDDSEHVLRAIRLTDKSVPIDLVLHTPGGLVLAAEQI
FT                   AEALLRHPAKVTVFVPHYAMSGGTLIALAADEIVMDENAVLGPVDPQLGQYPAASLLKV
FT                   LERKDPKDIDDQTLIFADVAQKALAQVYQTVVDLLRHKGWDTAKVERVARQLSQGTWTH
FT                   DYPISVTEARELGLPIVTDMPYEVYDLISLYPQPRGNKPSVQYHPEPYRGDRSPVRRSQ
FT                   RNDN"
FT   sig_peptide     complement(392654..392710)
FT                   /locus_tag="Trad_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(392720..393397)
FT                   /locus_tag="Trad_0343"
FT   CDS_pept        complement(392720..393397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0343"
FT                   /product="Rhomboid family protein"
FT                   /note="COGs: COG0705 membrane protein; InterPro IPR002610;
FT                   KEGG: ttj:TTHA1474 hypothetical protein; PFAM: Rhomboid
FT                   family protein; SPTR: C1XR09 Uncharacterized membrane
FT                   protein; PFAM: Rhomboid family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13482"
FT                   /db_xref="GOA:D7CRJ2"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRJ2"
FT                   /protein_id="ADI13482.1"
FT                   /translation="MLPLRDSVAHHGPAFVTKLLLWLNILVFFWQVSGGARAFEASILR
FT                   YGFVPALFFNAPLEQSHRLVTSMFLHGSVGHLLGNLWFLWVFGPALEGRLGGGRYVILY
FT                   LLAGVGAAFTQGLAMPDAQLPMVGASGAISGVLGGYLVFFSRAWVLTMVWFVLPFFFWF
FT                   PVATYIAYWVLFQFLYGLLGLPGVAWWAHLGGFAVGLLLAKHLCYHPPYRSQPSYQQGF
FT                   DFD"
FT   sig_peptide     complement(393284..393397)
FT                   /locus_tag="Trad_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            393486..393923
FT                   /locus_tag="Trad_0344"
FT   CDS_pept        393486..393923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0344"
FT                   /product="protein of unknown function DUF151"
FT                   /note="COGs: COG1259 conserved hypothetical protein;
FT                   InterPro IPR003729; KEGG: ttj:TTHA1615 hypothetical
FT                   protein; PFAM: protein of unknown function DUF151; SPTR:
FT                   Q72I81 Putative uncharacterized protein; PFAM:
FT                   Uncharacterised ACR, COG1259"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13483"
FT                   /db_xref="GOA:D7CRJ3"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRJ3"
FT                   /protein_id="ADI13483.1"
FT                   /translation="MDGMVRAVLEDIAVAGSGEFFVMLLKTAKGEFVPITIGHLEAMSI
FT                   LAGRSKERLPRPLSHDLMLSALELLGARIVRVEVTDLVTTDEGGTFYARLVLENRGIEL
FT                   ELDARPSDALALAVRVDAPLWVAERVVERAGLSDFTGGAEA"
FT   gene            complement(394004..394813)
FT                   /locus_tag="Trad_0345"
FT   CDS_pept        complement(394004..394813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0345"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1120 ABC-type cobalamin/Fe3+-siderophores
FT                   transport systems ATPase components; InterPro
FT                   IPR017871:IPR003439:IPR003593; KEGG: bbe:BBR47_56970
FT                   probable ABC transporter ATP binding protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: C0Z8P7
FT                   Probable ABC transporter ATP binding protein; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13484"
FT                   /db_xref="GOA:D7CRJ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRJ4"
FT                   /protein_id="ADI13484.1"
FT                   /translation="MPTLHTQHLSLGYLEQLIVPDLSLAIPEGQITALVGANGSGKSTI
FT                   LKALARILKPRSGAAYLDGKAIHRLSTKQVAKALAILPQNPEAPEGLTVHELVSYGRFP
FT                   HQRGLGGLNRDDHRAIHKALALTGMTVFAERPVGSLSGGQRQRAWIAMALAQGTDVLLL
FT                   DEPTTFLDMAHQLEVLQLLERLNREEGRTIVMVVHDLNHASRYAQHMVAIVRGEVAVAG
FT                   TPAEVMTPENLRRVFAIEADIVTDPRSGVPLCIPYGLRPRDNPSIGL"
FT   sig_peptide     complement(394739..394813)
FT                   /locus_tag="Trad_0345"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(394959..396197)
FT                   /locus_tag="Trad_0346"
FT   CDS_pept        complement(394959..396197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0346"
FT                   /product="Citrate transporter"
FT                   /note="COGs: COG1055 Na+/H+ antiporter NhaD and related
FT                   arsenite permease; InterPro IPR000802:IPR004680; KEGG:
FT                   ote:Oter_0890 citrate transporter; PFAM: Citrate
FT                   transporter; SPTR: B1ZWQ1 Citrate transporter; PFAM:
FT                   Citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13485"
FT                   /db_xref="GOA:D7CRJ5"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRJ5"
FT                   /protein_id="ADI13485.1"
FT                   /translation="MPPLTPDQTLTLATASVTLLGVAFGRLPGLHLNRATIALVGAGVL
FT                   VAAGVLELREAWALIDGEILTLLFALMVVNAALTHVGLFRLLTRLAVSRARSALGLLVV
FT                   LCFTAGVISAFFLNDTVVLMFTPLVLRVCLELGLKPVPYLVALAASANVGSVATLTGNP
FT                   QNLVVGVQGGIGYLAFARALAPVALVGLVVVVALVALSHPREFRRPVTPNPSALPDDLK
FT                   APREGSRWRIGGVVAGMLAAFALGAPVAEAALLAATALLLVGGIPADKLLAELDWNLLL
FT                   LFAGLFVTVGALGASGASAPLFAPVQPLLDAGLASLVAAVALLSNVLSNVPTVLLIAPV
FT                   VPRLSDPQTAWLAVAMASTLAGNLTLAGAVANLIVAERARREGVKVSFWAFFKLGAPIT
FT                   LLTLLFGWWWLAS"
FT   sig_peptide     complement(396123..396197)
FT                   /locus_tag="Trad_0346"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(396247..396630)
FT                   /locus_tag="Trad_0347"
FT   CDS_pept        complement(396247..396630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0347"
FT                   /product="ferric uptake regulation protein"
FT                   /note="COGs: COG0735 Fe2+/Zn2+ uptake regulation protein;
FT                   KEGG: bbr:BB0215 ferric uptake regulation protein; SPTR:
FT                   C9Z1V9 Fe regulatory protein; PFAM: Ferric uptake regulator
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13486"
FT                   /db_xref="GOA:D7CRJ6"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRJ6"
FT                   /protein_id="ADI13486.1"
FT                   /translation="MRSGAPGALLEVLPRLGPTTAEGVQRALAEDGLPLALSSIYTALG
FT                   ALERRGLVRALRAPGCSTLFVRAEAAGVYLLCRRCGGVVPLTLPTAYVDALRARSAAHG
FT                   WQLFEPHAVLTGRCGRCRAAASP"
FT   sig_peptide     complement(396568..396630)
FT                   /locus_tag="Trad_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(396773..397267)
FT                   /locus_tag="Trad_0348"
FT   CDS_pept        complement(396773..397267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ote:Oter_2987 hypothetical protein; SPTR:
FT                   C0ABY9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13487"
FT                   /db_xref="GOA:D7CRJ7"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRJ7"
FT                   /protein_id="ADI13487.1"
FT                   /translation="MELMFWLEVLSHVVTIVGLPFALVVFILEQRKARRNEEDALYQSL
FT                   AEAYTEFMALVLEHADLKLLTRHGTPTLDDEQRERQRALFDTLLGLFEQAFMLVYDGPM
FT                   TARRARLWQTWEDYLRGWCRREDFREALPSLLEGEDRAFRDYVLRLLHEETVQRASPRA
FT                   P"
FT   gene            complement(397360..398553)
FT                   /locus_tag="Trad_0349"
FT   CDS_pept        complement(397360..398553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0349"
FT                   /product="Threonyl/alanyl tRNA synthetase SAD"
FT                   /note="COGs: COG2872 metal-dependent hydrolase related to
FT                   alanyl-tRNA synthetase HxxxH domain;
FT                   InterProIPR018164:IPR012947:IPR003156:IPR018165:IPR 018163;
FT                   KEGG: ttj:TTHA0146 alanyl-tRNA synthetase-related protein;
FT                   PFAM: Threonyl/alanyl tRNA synthetase SAD; Alanyl-tRNA
FT                   synthetase, class IIc-like; phosphoesterase DHHA1; SPTR:
FT                   C1XW66 Predicted metal-dependent hydrolase related to
FT                   alanyl-tRNA synthetase HxxxH domain; PFAM: Threonyl and
FT                   Alanyl tRNA synthetase second additional domain; tRNA
FT                   synthetases class II (A)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13488"
FT                   /db_xref="GOA:D7CRJ8"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRJ8"
FT                   /protein_id="ADI13488.1"
FT                   /translation="MQLYQRNSYQRTFASAVLDVRPAPGATGQSWVRLEDTLFYPTSGG
FT                   QPHDTGTLGGAAVTDVKLEGDAVWHLVAGRPEVGARVEGALDWSRRYRHMQRHSAQHLL
FT                   SQAFYRLAPAFETRAVSLAGSVCTLDLAGAPSAEDAAQAETLALEAMYAALAVTTFEVD
FT                   EGELSRYPLRRPPKVTGRVRLVQMGDFELSACGGTHVRCTGEALPLKVLKLERIRGALT
FT                   RVHFAAGWEAQADYGVKHQLVSDLAARFSARPSDLSARVGALQAALHDLQRDLEAARAR
FT                   LAAGLAAELGRSASGGVVCYALREDQADLLEPLAGQLTERGLTALLAAPREGRAQLLFA
FT                   RPAAGEGDLRAALRAALPYLRGRGGGTPARAQGSGPETARVPEALEAASRALTPPPA"
FT   gene            398636..399253
FT                   /locus_tag="Trad_0350"
FT   CDS_pept        398636..399253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0350"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="COGs: COG0302 GTP cyclohydrolase I; InterPro
FT                   IPR018234:IPR020602:IPR001474; KEGG: tth:TTC1517 GTP
FT                   cyclohydrolase I; PFAM: GTP cyclohydrolase I/Nitrile
FT                   oxidoreductase; PRIAM: GTP cyclohydrolase I; SPTR: B7A8L3
FT                   GTP cyclohydrolase I; TIGRFAM: GTP cyclohydrolase I; PFAM:
FT                   GTP cyclohydrolase I; TIGRFAM: GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13489"
FT                   /db_xref="GOA:D7CRJ9"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRJ9"
FT                   /protein_id="ADI13489.1"
FT                   /translation="MHQIPPPAPSPLELDDPSPLPEAQALEATVARLIAQLGEDVTREG
FT                   LQRTPARVARSLRFLTSGYAQDAQSVVRGALFRAEGAELVVVKGLEFYSLCEHHLLPFF
FT                   GRVHIGYVPGEHILGLSKFARVVDVFARRLQVQERLTVQVADALEGVLRPRGVGVVVEA
FT                   SHLCMMMRGVQQQGSSTRTSVLRGVLGDPGVREEFLRAINTP"
FT   gene            complement(399507..399872)
FT                   /locus_tag="Trad_0351"
FT   CDS_pept        complement(399507..399872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0351"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_0172 beta-ketoacyl synthase; SPTR:
FT                   Q6W5Q3 FscA"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13490"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRK0"
FT                   /protein_id="ADI13490.1"
FT                   /translation="MDHTARNTAATNRTRYALLCDRRRALFELHKLAEAVRAHPNYATA
FT                   ARTVAGLEGMVAEQLEATSCNLCRAGKADPEALQRDVCRLYGGLSSLAKVWVYLEDGRD
FT                   LEPLVQAHYDALFAGDA"
FT   gene            complement(400148..400651)
FT                   /locus_tag="Trad_0352"
FT   CDS_pept        complement(400148..400651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0352"
FT                   /product="Ferritin Dps family protein"
FT                   /note="COGs: COG0783 DNA-binding ferritin-like protein
FT                   (oxidative damage protectant); InterPro
FT                   IPR002177:IPR008331:IPR009078:IPR012347; KEGG:
FT                   chl:Chy400_3219 ferritin Dps family protein; PFAM: Ferritin
FT                   Dps family protein; SPTR: B9LB24 Ferritin Dps family
FT                   protein; PFAM: Ferritin-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13491"
FT                   /db_xref="GOA:D7CRK1"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRK1"
FT                   /protein_id="ADI13491.1"
FT                   /translation="MTKTTQQLTFSTRIDIEEGVRKELIDILNQQLADATDLFTQTKQA
FT                   HWNVKGMDFFQLHELFDDLAKRARNFADLLAERVTALGGAALGTVRMAAEATTLPEYPL
FT                   ETVQGHEVVDLMVERWAAYAASTRAAIRRSGELDEPTTEDLLTEISREVDESLYFLEAH
FT                   VQRQ"
FT   gene            complement(400743..401039)
FT                   /locus_tag="Trad_0353"
FT   CDS_pept        complement(400743..401039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0353"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0483 HAD-superfamily hydrolase,
FT                   subfamily IIB; SPTR: B4UB75 HAD-superfamily hydrolase,
FT                   subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13492"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRK2"
FT                   /protein_id="ADI13492.1"
FT                   /translation="MTSTQLSYDDPERQHHHQEARRALQHMQALLPVYRDLCGEAPYLY
FT                   AASEVERLERELGDAAPTAPDDLVWVAQHITLQLQGLALAIRKAKGRGVELDA"
FT   gene            complement(401219..402001)
FT                   /locus_tag="Trad_0354"
FT   CDS_pept        complement(401219..402001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0354"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="COGs: COG0561 hydrolase of the HAD superfamily;
FT                   InterPro IPR013200:IPR006379; KEGG: ddr:Deide_3p01661
FT                   putative hydrolase; PFAM: Haloacid dehalogenase domain
FT                   protein hydrolase type 3; SPTR: C1D3N1 Putative hydrolase;
FT                   TIGRFAM: HAD-superfamily hydrolase, subfamily IIB; PFAM:
FT                   haloacid dehalogenase-like hydrolase; TIGRFAM: Cof
FT                   subfamily of IIB subfamily of haloacid dehalogenase
FT                   superfamily; HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13493"
FT                   /db_xref="GOA:D7CRK3"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRK3"
FT                   /protein_id="ADI13493.1"
FT                   /translation="MLLAFDLDNTVVTRGNEIPDPIVRAVAAARRAGHLVTVLTGRPKA
FT                   STLPFLDTLGVAGPYAVNHGAIVFGEDDAVLSRSLIAAPVVDRLVHRYGVDEGLEYAFM
FT                   FDDDIYVRDPEDPRWSWAHTLNRNVLAFHKDRVRDADKIVFSADAAGPRMLLEIRDEHP
FT                   ELMRYLWPDGFLEVTGPGAHKGAALAHICRVLGVAQRDTVAFGDGINDVTMLEWAGHAV
FT                   AVGDAHPDVLAVADERIEEPEALGVATWLEAHVQGVLS"
FT   gene            402203..402562
FT                   /locus_tag="Trad_0355"
FT   CDS_pept        402203..402562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0355"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /note="InterPro IPR014314; KEGG: dge:Dgeo_0889 succinate
FT                   dehydrogenase, cytochrome b subunit; SPTR: C1XVW6 Succinate
FT                   dehydrogenase subunit C; TIGRFAM: succinate dehydrogenase,
FT                   cytochrome b556 subunit; PFAM: Succinate
FT                   dehydrogenase/Fumarate reductase transmembrane subunit;
FT                   TIGRFAM: succinate dehydrogenase, cytochrome b556 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13494"
FT                   /db_xref="GOA:D7CRK4"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="InterPro:IPR039023"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRK4"
FT                   /protein_id="ADI13494.1"
FT                   /translation="MYRGREGQWAFILHRLSGLAVFFYLMIHVVNISLASFGPQVSGPV
FT                   LSFFHQGVFRIGLVLVMAGVVYHAFNGLRIILMDFTTWGTKYHRQLWYGVLAATVAIGI
FT                   PVLWVVVPQIVADLS"
FT   sig_peptide     402203..402307
FT                   /locus_tag="Trad_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            402562..403020
FT                   /locus_tag="Trad_0356"
FT   CDS_pept        402562..403020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0356"
FT                   /product="succinate dehydrogenase, membrane subunit (SdhD)"
FT                   /note="COGs: COG2142 Succinate dehydrogenase hydrophobic
FT                   anchor subunit; KEGG: ttj:TTHA1455 succinate dehydrogenase,
FT                   membrane subunit (SdhD); SPTR: C1XVW5 Succinate
FT                   dehydrogenase subunit D; PFAM: Succinate
FT                   dehydrogenase/Fumarate reductase transmembrane subunit;
FT                   TIGRFAM: succinate dehydrogenase, hydrophobic membrane
FT                   anchor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13495"
FT                   /db_xref="GOA:D7CRK5"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRK5"
FT                   /protein_id="ADI13495.1"
FT                   /translation="MAVRAPRTLRDARATYTTNGELAWWVFMRVSGLALIFLTFGHLYM
FT                   SNIVIDAGQIDFSYVARRLSITWVKIYDTLLLGLAVLHGVNGARYSIEDYARHPGWRFG
FT                   IKMGLYSATVLVMIIGIISLWAVDYTQYLNLPPDAMPGAAPGAVAPGH"
FT   gene            403088..404827
FT                   /locus_tag="Trad_0357"
FT   CDS_pept        403088..404827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0357"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="COGs: COG1053 Succinate dehydrogenase/fumarate
FT                   reductase flavoprotein subunit;
FT                   InterProIPR003952:IPR013027:IPR003953:IPR004112:IPR
FT                   015939:IPR011281:IPR014006; KEGG: ttj:TTHA1454 succinate
FT                   dehydrogenase flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; SPTR: Q5SIC0 Succinate dehydrogenase, flavoprotein
FT                   subunit; TIGRFAM: succinate dehydrogenase, flavoprotein
FT                   subunit; succinate dehydrogenase or fumarate reductase,
FT                   flavoprotein subunit; PFAM: domain; FAD binding domain;
FT                   TIGRFAM: succinate dehydrogenase, flavoprotein subunit, E.
FT                   coli/mitochondrial subgroup; succinate dehydrogenase or
FT                   fumarate reductase, flavoprotein
FT                   subunitGram-negative/mitochondrial subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13496"
FT                   /db_xref="GOA:D7CRK6"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRK6"
FT                   /protein_id="ADI13496.1"
FT                   /translation="MARAHKYDVIVVGAGGAGLMAARYAAQHPGVSVAVISKLYPTRSH
FT                   TGAAQGGVGAALGNVSEDHPEWHAFDTIKGGDYLTDQDVAEMFAHEVVEAVYELEHMGL
FT                   PFSRTPDGKIAQRKFGGHTREFGKSAVERACYAADRTGHMILQTLYQQSIKDNVVFFNE
FT                   FHVLDILIEGGECVGVVAYELATGQLHTFHAKATVIASGGNGRMFKVTSNAHALTGDLM
FT                   SVVYRRGIPLEDPEFYQFHPTGLYKIGVLLTEGARGEGGILRNKDGERFMERYAPTIKD
FT                   LAPRDMVSRAMYMEIREGRGAGPDNDYIHLDLTHIDAHIIETRLPDITEFARIYLGVDP
FT                   VKELVPIQPTAHYAMGGIPTTINTEVIRDGDNTIVPGLYAAGEVACASLHGANRLGTNS
FT                   LGDLIVFGRRAGIYAARYAAETSYKDLPRDEQDFSRALIDRALNGPGWERVSRIRQDLQ
FT                   ESMQDNASVFRTEETLTKQVEVLKELKERYQKIGVEDQGEQYNTELMEALELGFLLDNA
FT                   EALVHAALNRKESRGAHSREDFKERDDEAWLKHTLVYKDGEGVRIDYKPVTLGKYEPKP
FT                   RVY"
FT   sig_peptide     403088..403162
FT                   /locus_tag="Trad_0357"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            404916..405641
FT                   /locus_tag="Trad_0358"
FT   CDS_pept        404916..405641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0358"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /note="COGs: COG0479 Succinate dehydrogenase/fumarate
FT                   reductase Fe-S protein subunit;
FT                   InterProIPR017900:IPR017896:IPR009051:IPR001041:IPR
FT                   012675:IPR012285:IPR004489; KEGG: tth:TTC1089 succinate
FT                   dehydrogenase iron-sulfur subunit; PRIAM: Succinate
FT                   dehydrogenase; SPTR: Q72IP3 Succinate dehydrogenase
FT                   iron-sulfur protein; TIGRFAM: succinate dehydrogenase and
FT                   fumarate reductase iron-sulfur protein; TIGRFAM: succinate
FT                   dehydrogenase and fumarate reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13497"
FT                   /db_xref="GOA:D7CRK7"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRK7"
FT                   /protein_id="ADI13497.1"
FT                   /translation="MATAPANLERQIRVRIKRFNPEQDKRPYWAEYNVTARTTDRVLDV
FT                   LHQIKWEMDGTLSFRRSCAHGICGSDAMLINGVNRLACKVLVKDLGDTISVEPIRGLRV
FT                   IKDMIVDMEPFFDSYKAVLPYFINDTPAPSGERYQSPEDREIFDATTKCILCAACTTSC
FT                   PVFWANGSYIGPAAIVNAHRFIFDSRDEGTADRLEVLGKANGLWRCRTAYNCTEACPRG
FT                   IPVTQAIEDVKRELLWRRT"
FT   gene            406103..407482
FT                   /locus_tag="Trad_0359"
FT   CDS_pept        406103..407482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0359"
FT                   /product="magnesium transporter"
FT                   /note="COGs: COG2239 Mg/Co/Ni transporter MgtE (contains
FT                   CBS domain); InterPro
FT                   IPR006668:IPR000644:IPR006667:IPR006669; KEGG:
FT                   swo:Swol_1082 divalent cation transporter; PFAM: MgtE
FT                   integral membrane region; MgtE intracellular region; CBS
FT                   domain containing protein; SMART: CBS domain containing
FT                   protein; SPTR: Q0AY12 Divalent cation transporter; TIGRFAM:
FT                   magnesium transporter; PFAM: MgtE intracellular N domain;
FT                   Divalent cation transporter; CBS domain; TIGRFAM: Mg2+
FT                   transporter (mgtE)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13498"
FT                   /db_xref="GOA:D7CRK8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRK8"
FT                   /protein_id="ADI13498.1"
FT                   /translation="MSVSVHPTPTSALPEDIHRLIDEHRWQELAARKAAWPEPDAVAPE
FT                   LAERLLELSKPDRVLLFRALPREVAAEVFTWLEGESRDALLRDLTDAETRTLLAEMSPD
FT                   DRTELLGELPGNVTQRLLNLLGPDDLREARDLLGYPEESVGRLMTPDYLAVRPEWTVAE
FT                   ALEHIRARGHESETANEIYVTDERWRLLDALPLQRFVLARPETRVRDIMDNKYVALPAT
FT                   ADREEAVREMGRYDLVALPVVDSSGTLVGIVTVDDVLDVAEQEVTEDFHKTSAMAPLRQ
FT                   SYWETGKRFLFRNRIGWLAILVLINLVSSGIIAAFEETLEAVVALAFFIPLIIDTGGNA
FT                   GAQSATLMIRAISTGDVKLSEWFRAFLKEAVVGLSIGVALGLMGMALGFFRGGPEIGII
FT                   VLLTMITMLFLTNLIGLLLPFVLTRLKLDPALASGPLITSIADAVGLIIYFSYAVWILG
FT                   L"
FT   gene            complement(407616..408104)
FT                   /locus_tag="Trad_0360"
FT   CDS_pept        complement(407616..408104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0360"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol-like protein ENS-3; SPTR: C1XP23 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13499"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRK9"
FT                   /protein_id="ADI13499.1"
FT                   /translation="MVQFIEEGVRQSVITFPTRDGRTLIIGYGEGFETATFDLQVTDFQ
FT                   ADELDTSLLLDYVNPFPSCGSPPAPGAKFARIVGWEREDRNEDGYLDLVINVSTLSVEV
FT                   FPCDATQAFYKATLQPHNVEQVVFLFDGQAFTATPEAERLKAFSQAPQGATRQLPFKP"
FT   gene            complement(409039..409809)
FT                   /locus_tag="Trad_0361"
FT   CDS_pept        complement(409039..409809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0361"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR011042; KEGG: amf:AMF_178 TolB protein
FT                   precursor (TolB); SPTR: B9KHU7 TOLB protein (TolB)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13500"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRL0"
FT                   /protein_id="ADI13500.1"
FT                   /translation="MKRMNLVLTSMVLVLLAASCTNISHELEAPFQSYFTFDEFEGIRT
FT                   VSKTVTLEDGTVTTDGRVYLQDVISGKVTLLTTPERFGEHFYAEGGIFSPDGKTVFVNI
FT                   DTENNWAIYAISLNSSKVTLIAEDRSVLDGALIGILGRSLAISPDGHQLAFRASRTVSL
FT                   MNLDTASRKGVLSPFTTEHDLYILDVPSNLGTQATTPLVSQATRRGEAAALYPRLHRME
FT                   RLNRLKQSLTGSIRKYAASKPSRVLQHSAFPILE"
FT   sig_peptide     complement(409753..409809)
FT                   /locus_tag="Trad_0361"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(410026..410574)
FT                   /locus_tag="Trad_0362"
FT   CDS_pept        complement(410026..410574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0362"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="InterPro IPR010916:IPR000792:IPR016032:IPR011991;
FT                   KEGG: dge:Dgeo_2791 LuxR family transcriptional regulator;
FT                   PFAM: regulatory protein LuxR; SMART: regulatory protein
FT                   LuxR; SPTR: Q1J2R1 Transcriptional regulator, LuxR family;
FT                   PFAM: Bacterial regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13501"
FT                   /db_xref="GOA:D7CRL1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRL1"
FT                   /protein_id="ADI13501.1"
FT                   /translation="MRTRYRVLAGLEALAVGLAEGLRAFGVAIDAAARDTLLVDAPWGW
FT                   APPRLRHLCPAQMVVVSDNPCPEYRLHLLEHRPRALLHNVSIEQLAEHLQDPCLAQPSP
FT                   RSSLTPAEQFTLRLLAHGRSPKQVAHHREVSEGRVKNTVSAIYQKLGLKSQAHLTLYYF
FT                   GLWHVLMESGWEPPRRKRD"
FT   sig_peptide     complement(410476..410574)
FT                   /locus_tag="Trad_0362"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            410707..411537
FT                   /locus_tag="Trad_0363"
FT   CDS_pept        410707..411537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0363"
FT                   /product="Bacitracin resistance protein BacA"
FT                   /note="COGs: COG1968 Uncharacterized bacitracin resistance
FT                   protein; InterPro IPR003824; KEGG: bcl:ABC1776 undecaprenyl
FT                   pyrophosphate phosphatase; PFAM: Bacitracin resistance
FT                   protein BacA; SPTR: B1C6D3 Putative uncharacterized
FT                   protein; PFAM: Bacitracin resistance protein BacA; TIGRFAM:
FT                   undecaprenyl-diphosphatase UppP"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13502"
FT                   /db_xref="GOA:D7CRL2"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRL2"
FT                   /protein_id="ADI13502.1"
FT                   /translation="MTFFEAILLGIIQGVTEFLPISSSGHLVVIRDWFGITEAALSFDA
FT                   VIHLGSLLAVMVAFHSELRAIVRGLTGARDDEAKEGRKLLRYLVLATLPLVVAALFFRD
FT                   TVALAFESTLFTALMLYFTGALLLYAEKRPPPRIELVPSRRHVLAMGFAQILALLPGLS
FT                   RSGMTIGAGMLAGLSRVQAARFSFLMSIPAILGASLFELTHVARASAGPGGLPGEELAQ
FT                   TISTGALITGTVTSLIASYLSIVVLLRFLKSGRLVGFAIYTWVLATLLLVLEVF"
FT   gene            complement(411607..411999)
FT                   /locus_tag="Trad_0364"
FT   CDS_pept        complement(411607..411999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0364"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="COGs: COG0251 Putative translation initiation
FT                   inhibitor yjgF family; InterPro
FT                   IPR019897:IPR006175:IPR013813:IPR006056; KEGG:
FT                   rrs:RoseRS_2960 putative endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; SPTR: A5UXH2 Endoribonuclease
FT                   L-PSP; TIGRFAM: endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; TIGRFAM: endoribonuclease L-PSP,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13503"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRL3"
FT                   /protein_id="ADI13503.1"
FT                   /translation="MTPQKTPIQTDAAPAAIGPYTQAVRVGNLVFTSGQIPLKPDGTLL
FT                   EGDIRAQTEQVLHNLSAVLHAAGSGLEHVVKCTCFLKDMNDFSAMNEVYGRFFGAVPPA
FT                   RSAVEVARLPRDVRVEIEAVALIPQT"
FT   gene            complement(412103..413065)
FT                   /locus_tag="Trad_0365"
FT   CDS_pept        complement(412103..413065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0365"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="COGs: COG0631 Serine/threonine protein phosphatase;
FT                   InterPro IPR014045:IPR001932; KEGG: ttj:TTHA0187 putative
FT                   protein phosphatase; PFAM: Protein phosphatase 2C-like;
FT                   SMART: protein phosphatase 2C domain protein; SPTR: C1XL98
FT                   Serine/threonine protein phosphatase; PFAM: Protein
FT                   phosphatase 2C"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13504"
FT                   /db_xref="GOA:D7CRL4"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRL4"
FT                   /protein_id="ADI13504.1"
FT                   /translation="MTRTAPPPTERRFAAKSDVGEVRAVNQDAVYAGATPNGALVLVAD
FT                   GMGGHQSGEIASQRARDTLVQALARPQPRLPSALARAVQRANLDLHAYASANPESFGMG
FT                   TTLTFVLLDDPIALIGHVGDSRAYLIRDGAITQLTRDHSWVADRLRQGLLSPEEAKRHG
FT                   WRNVLTNALGPNPTVTLELSHLHVAPGDRLLVCSDGLSGVLGDAALLEAATLSPAEAAV
FT                   EALIGRAKARGSPDNITAALLVVGAVEPRPKRYTLPAERTLSVTLGAGPEGLYTVEDAF
FT                   GEGGALARLRRQAWWPLRFWLLGCAVLVVLFVVFALYRP"
FT   gene            413165..414637
FT                   /locus_tag="Trad_0366"
FT   CDS_pept        413165..414637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0366"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /note="COGs: COG0154 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase A subunit and related amidase; InterPro
FT                   IPR020556:IPR000120:IPR004412; KEGG: dra:DR_1856
FT                   aspartyl/glutamyl-tRNA amidotransferase subunit A; PFAM:
FT                   Amidase; SPTR: Q9RTA9 Glutamyl-tRNA(Gln) amidotransferase
FT                   subunit A; TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; PFAM: Amidase; TIGRFAM: glutamyl-tRNA(Gln) and/or
FT                   aspartyl-tRNA(Asn) amidotransferase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13505"
FT                   /db_xref="GOA:D7CRL5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRL5"
FT                   /protein_id="ADI13505.1"
FT                   /translation="MARYAARVTLACDIAEAVGSGRERAETVVRRALSRADRVQRETNA
FT                   FITLCGEAALARARALDARLAAGEAPPPLAGVPVAVKDNLCTRGVRTTAGSRSLEHFVP
FT                   PFDATVVARLEAAGAVVIGKTNLDEFGMGSTNEHSAFGPVRNPWDLERVPGGSSGGSAV
FT                   AVAAGVVPLALGTDTGGSVRQPASFTGVLGFKPTYGVLSRSGVIAFASSLDQVGVFGRS
FT                   ARDLALALTAMAGPDPLDATSLEAPPLSADLGTGTELSGLRVGLIKELSGAGNSPEVRE
FT                   ALGRTTAALRDLGAEVSEVSLPHAPYGTAAYYIVAPAEASSNLARFDGMVYSRRVGESR
FT                   LGQGEVMRRSRGALFGPEVRRRILVGTYALSAGYYEAFYGKALKVRRLIADEVRRAFGR
FT                   FDLLLTPTAPSPAYRLGEVADPLRMYLGDVDTVLANLVGCGAVSVPAPTPGLPCGVQFL
FT                   APPLEDARLLRVAGALEAAAAGAFAPLAPAYR"
FT   gene            414806..414949
FT                   /locus_tag="Trad_0367"
FT   CDS_pept        414806..414949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0367"
FT                   /product="ribosomal protein L34"
FT                   /note="InterPro IPR000271; KEGG: dge:Dgeo_1568 50S
FT                   ribosomal protein L34; PFAM: ribosomal protein L34; SPTR:
FT                   Q1IY21 50S ribosomal protein L34; TIGRFAM: ribosomal
FT                   protein L34; PFAM: Ribosomal protein L34; TIGRFAM:
FT                   ribosomal protein L34, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13506"
FT                   /db_xref="GOA:D7CRL6"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRL6"
FT                   /protein_id="ADI13506.1"
FT                   /translation="MKRTYQPNRRKRAKTHGFRARMKTAAGRNVIRRRRAKGRAKLSVS
FT                   DE"
FT   gene            414955..415347
FT                   /locus_tag="Trad_0368"
FT   CDS_pept        414955..415347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0368"
FT                   /product="ribonuclease P protein component"
FT                   /note="InterPro IPR020539:IPR000100:IPR020568:IPR014721;
FT                   KEGG: tth:TTC0077 ribonuclease P protein subunit; PFAM:
FT                   ribonuclease P protein; SPTR: C1XNH4 Ribonuclease P protein
FT                   component; TIGRFAM: ribonuclease P protein component; PFAM:
FT                   Ribonuclease P; TIGRFAM: ribonuclease P protein component,
FT                   eubacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13507"
FT                   /db_xref="GOA:D7CRL7"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRL7"
FT                   /protein_id="ADI13507.1"
FT                   /translation="MPVIQSLKGDRAFQRLRRGRAGHAKLLSLRWRPLRPPSGAPAGAP
FT                   VSTAFVGIVVSKKVGKAVLRNRVRRRLREALRAVLACAEARANPAQGLRHPAFELVIIA
FT                   RPDAAEADYGQLRSALEHALRKGQLL"
FT   gene            415344..415607
FT                   /locus_tag="Trad_0369"
FT   CDS_pept        415344..415607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0369"
FT                   /product="protein of unknown function DUF37"
FT                   /note="COGs: COG0759 conserved hypothetical protein;
FT                   InterPro IPR002696; KEGG: sep:SE1462 hypothetical protein;
FT                   PFAM: protein of unknown function DUF37; SPTR: C5QY28
FT                   Alpha-hemolysin; PFAM: Domain of unknown function DUF37;
FT                   TIGRFAM: conserved hypothetical protein TIGR00278"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13508"
FT                   /db_xref="GOA:D7CRL8"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRL8"
FT                   /protein_id="ADI13508.1"
FT                   /translation="MSGGAKLSLAQRLVLAPITFYQRYVSPLKPSPSCRFSPTCSRYTA
FT                   EAVRVHGVLRGLLLGARRLLKCHPFHPGGFDPVPPARPSEEL"
FT   gene            415604..417292
FT                   /locus_tag="Trad_0370"
FT   CDS_pept        415604..417292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0370"
FT                   /product="membrane protein insertase, YidC/Oxa1 family"
FT                   /note="COGs: COG0706 Preprotein translocase subunit YidC;
FT                   InterPro IPR001708:IPR020001; KEGG: tth:TTC0075
FT                   hypothetical protein; PFAM: 60 kDa inner membrane insertion
FT                   protein; SPTR: C1XUM9 Preprotein translocase subunit YidC;
FT                   TIGRFAM: membrane protein insertase, YidC/Oxa1 family;
FT                   PFAM: 60Kd inner membrane protein; TIGRFAM: membrane
FT                   protein insertase, YidC/Oxa1 family, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13509"
FT                   /db_xref="GOA:D7CRL9"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRL9"
FT                   /protein_id="ADI13509.1"
FT                   /translation="MNVKLVFLLALLLLGSASARVTFGVSEFSAADLRNPQLLDELCAG
FT                   ESASFWCEARDATLQLITTKGADYLFNDVGEIVALYAKQQRGQDFRGNYALDNNQNLIP
FT                   HTAPHPGGAVLFDGVYHPRSGVSSTWEETTLAGAPALRGTFSYTVGEIAEVTKVVTVSS
FT                   VLSSMDVSVEVTRLGAGEEAAVQYAFPGIARQNQPALKVGQGESFTLNPPAQAFPAANY
FT                   ISLQSNNRNTGFALVLRPHPEVPGAGDELAAFPLSANQIALGRTLGAEAGATAGLELQA
FT                   YGGPNEMVRFAQEGYLDLPGLFRPNLLGRLSLGIIVVLEAIYGVVGSWGLAIILLTLLF
FT                   RALVWPLISAQTKSMVGMQKIQPKMQELQKKYKNDREKLTQETMKLYQEAGVNPAGGCL
FT                   PILVQMPIFIILWRVFINFEFNEGFLWIPDLGLSDPFYLLPILYVAVMVGQSVVASKGN
FT                   TQMLRQQLLISGVFVFFIFGFPAGVTLYLITSMLIQVLQQWLIQRNMDAAPATLATGVT
FT                   PVPSPPSATAIETAAQNPATREASGKATGTGAKGGKPRTKKARAK"
FT   sig_peptide     415604..415690
FT                   /locus_tag="Trad_0370"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            417296..417877
FT                   /locus_tag="Trad_0371"
FT   CDS_pept        417296..417877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0371"
FT                   /product="single-stranded nucleic acid binding R3H domain
FT                   protein"
FT                   /note="COGs: COG1847 RNA-binding protein; InterPro
FT                   IPR001374; KEGG: ddr:Deide_01680 putative Jag-related
FT                   protein, RNA binding protein; PFAM: single-stranded nucleic
FT                   acid binding R3H domain protein; SMART: single-stranded
FT                   nucleic acid binding R3H domain protein; SPTR: C1XUN0
FT                   Predicted RNA-binding protein; PFAM: R3H domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13510"
FT                   /db_xref="GOA:D7CRM0"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRM0"
FT                   /protein_id="ADI13510.1"
FT                   /translation="MASDLDKYLSDLGIDTEDEAQPKLPTAPQAAAAEPAPSAAAEGSA
FT                   AERLEAFLVGLLLHLDPGYAVEVTPAGERELRAEVVGGDPGKIIGRGGRTLAALEYLAN
FT                   AVLNRDEGAPHVRASLDVGGYRARRDERLRGVALKAAARARKTGLAVELEPMSAAERRV
FT                   IHMTLADDPSVESASSGEGRERRVVVRPVG"
FT   gene            418161..419309
FT                   /locus_tag="Trad_0372"
FT   CDS_pept        418161..419309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4088 hypothetical protein; SPTR:
FT                   B4B2X0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13511"
FT                   /db_xref="InterPro:IPR041289"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRM1"
FT                   /protein_id="ADI13511.1"
FT                   /translation="MDIPTKEDLTALSEQGEGYAVSIYMPTHKAGKDTRENPIRFKNRL
FT                   QEAEEQLRRHGLKGDDIDALLAPARKLDDYRFWQNQREGLAVFVQGGSERHFLLPYAPD
FT                   ELTVVARRTHLKPLLPLLTGDGRFFILAMSLGGARLLEATRYSVTEVPVEGVPTSLEEA
FT                   LQYDDPEPFHEHYTVTAANRGGEALVQGQGAGEDERKTNILRFFRAFDNGLRALLAPQG
FT                   DRIPVVFAGDKGLFPIYQEANHYNGLLDRAVEGNPEGLREEELHARAWEVVEPHFRAQR
FT                   ERDAAAFGEALGTGRAGTALEEVLWAALDARIATLFVPLGERAWGTFDAEARRLERTDE
FT                   GPESYDLYDAAATYTLLYGGTVYAVAPDEVPGDGPLAAVYRF"
FT   gene            419338..419799
FT                   /locus_tag="Trad_0373"
FT   CDS_pept        419338..419799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0373"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="COGs: COG0590 Cytosine/adenosine deaminase; InterPro
FT                   IPR002125:IPR016193; KEGG: npu:Npun_R2274 CMP/dCMP
FT                   deaminase, zinc-binding; PFAM: CMP/dCMP deaminase
FT                   zinc-binding; SPTR: Q8YND2 Alr4634 protein; PFAM: Cytidine
FT                   and deoxycytidylate deaminase zinc-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13512"
FT                   /db_xref="GOA:D7CRM2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRM2"
FT                   /protein_id="ADI13512.1"
FT                   /translation="MTPTTPPPARPPEAWMRLAAEVAERGQTMFGAVLVRGGALLAEAA
FT                   NTVAKDRDPSAHAELSLIRRACRELVTTDLDGCTLYTTVEPCPMCAAACVWSGVSGVVF
FT                   GASIAEVAELGVPQIALSCEELFGRVQHAPTLRGGVERERCLELCQRFW"
FT   gene            419799..420752
FT                   /locus_tag="Trad_0374"
FT   CDS_pept        419799..420752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0374"
FT                   /product="Protein of unknown function DUF2419"
FT                   /note="InterPro IPR019438; KEGG: tro:trd_1774 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2419; SPTR:
FT                   B9L162 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF2419)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13513"
FT                   /db_xref="InterPro:IPR019438"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRM3"
FT                   /protein_id="ADI13513.1"
FT                   /translation="MLAEIRAACAEVARRSRWVRLDEGGLARFAETLELASVTAPRYDA
FT                   AHHYVGDPEAMLAFNLTLDAVNFGSGYFPHLRKRPGKSGYFTVALALKEHFEAHGPLAP
FT                   RELVALTPPRTAALFGQDLGDPVRAELMRHFTEALHQLGSYLVERFGGSFAALVAAAQG
FT                   RAERLAELLAEMPYFRDVARYGELRVPLYKRAQIAPSDLALAFDGQGYGHFSDLEQLTI
FT                   FADNLVPHVLRVDGVLVYDPALVARLEAGALIPAGSEEEVEIRAVALHAAERLVAQLRA
FT                   AGEAVSARQLDVYLWNRGQQERYKAAPRHRTRSVFY"
FT   gene            complement(420856..421908)
FT                   /locus_tag="Trad_0375"
FT   CDS_pept        complement(420856..421908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0375"
FT                   /product="nicotinate-nucleotide/dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /note="COGs: COG2038 NaMN:DMB phosphoribosyltransferase;
FT                   InterPro IPR000169:IPR003200:IPR017846; KEGG:
FT                   rrs:RoseRS_0559
FT                   nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase; PFAM:
FT                   Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase; PRIAM:
FT                   Nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase; SPTR: A5UQS8
FT                   Nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase;
FT                   TIGRFAM:nicotinate-nucleotide/dimethylbenzimidazole
FT                   phosphoribosyltransferase; PFAM: Phosphoribosyltransferase;
FT                   TIGRFAM: nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13514"
FT                   /db_xref="GOA:D7CRM4"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRM4"
FT                   /protein_id="ADI13514.1"
FT                   /translation="MTAEATFRGALARVHRVDEKLYQRALARHAALTKPPGSLGALEPL
FT                   GARLAAVLGTLKPRPEGRAVAVFAADHGVAAAGVSAYPQSVTAGMVRNFLAGGAAVNAL
FT                   AAAAGAKLLIVDVGVAADVDDHPALWSRKVARGTRNMLHGPAMTRAELFAACAAGVEAA
FT                   EHLAARGAVLLAGGEMGIGNTTAAAALTAHLTGAPARAVTGRGSGLDDAGLARKVAVVE
FT                   QVLERHGEQATEPLEALRRFGGLEIAALTGFYVGAAALRAPVVLDGFIATAAALVAAAL
FT                   APAVRDYLFAAHRSQEPGHAVQLQHLGLTPLFDLGLRLGEGSGAVLAFGLLEGAAAVLR
FT                   DMATFEEAGL"
FT   gene            complement(421905..423953)
FT                   /locus_tag="Trad_0376"
FT   CDS_pept        complement(421905..423953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0376"
FT                   /product="cobyric acid synthase CobQ"
FT                   /EC_number="2.7.7.62"
FT                   /note="COGs: COG1492 Cobyric acid synthase;
FT                   InterProIPR002586:IPR011698:IPR003203:IPR017929:IPR 004459;
FT                   KEGG: dge:Dgeo_2874 cobyric acid synthase CobQ; PFAM:
FT                   CobB/CobQ domain protein glutamine amidotransferase;
FT                   Cobyrinic acid ac-diamide synthase; cobalbumin biosynthesis
FT                   protein; PRIAM: Adenosylcobinamide-phosphate
FT                   guanylyltransferase; SPTR: Q1J2I1 Cobyric acid synthase
FT                   CobQ; TIGRFAM: cobyric acid synthase CobQ; PFAM: Cobinamide
FT                   kinase / cobinamide phosphate guanyltransferase;
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain;
FT                   CobB/CobQ-like glutamine amidotransferase domain; TIGRFAM:
FT                   cobyric acid synthase CobQ"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13515"
FT                   /db_xref="GOA:D7CRM5"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRM5"
FT                   /protein_id="ADI13515.1"
FT                   /translation="MVQGCSSGAGKSYLTAALCRLYARRGVRVAPFKAQNMSNNAGVTP
FT                   DGLEMSRAQLVQARAARVVPDVRMNPVLLKPEGDRRSQVVLLGRADPALSRLPWEARKA
FT                   RLWPHVAASLRGLLEAFELVILEGAGSPAEVNLKAGDIVNMRAALEADAKVLLVADIDR
FT                   GGAFAHLLGTWACLEAAERETLLGFVLNKFRGDPALLGDATAWLAARTGRPTLGVVPYL
FT                   PLALPEEDAQDLPPAGAAAREAPVRVAALRFPTVSNFDEFGPLARHPAVALSWVEAPSA
FT                   LAAADLIVLPGSKHLTTDAAWLQRTGLGAAVQERAESGALVLGICGGMQLLGRVIHDPH
FT                   GLEGAAGTVTGLGLLDLETTLAPIKVTRNVQSTLLATGETVTGYEIHHGRTRAGGRAQP
FT                   LLADGLGFRQGRVLGVYPHGLLEDAAFVRYLLGALGVSAAQLDPEAGLEAALDRLADHV
FT                   EAHLDVSAIDDALFRGRAPRRPPRLVLVTGGARSGKSRYAEALVRRFLEPGEGALYLAT
FT                   LRASDPEMARRVARHRARRPVSWRTLETPLAPAEALAAAPERVVLLDCLSGYVANLLLS
FT                   RYAAGEQSEAEAAAQAGDEAIAAALAGVDALLGAVRRAGKTVVVVTNEVGSGVVPAYAL
FT                   GRLFRDALGLANARVAAAADAVALCVVGLPQLLKGTLPEVTLDEGDA"
FT   gene            complement(423968..424627)
FT                   /locus_tag="Trad_0377"
FT   CDS_pept        complement(423968..424627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0377"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="COGs: COG0406 Fructose-2 6-bisphosphatase; InterPro
FT                   IPR001345:IPR013078; KEGG: dra:DR_0278 phosphoglycerate
FT                   mutase, putative; PFAM: Phosphoglycerate mutase; SPTR:
FT                   Q9RXN2 Phosphoglycerate mutase, putative; PFAM:
FT                   Phosphoglycerate mutase family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13516"
FT                   /db_xref="GOA:D7CRM6"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRM6"
FT                   /protein_id="ADI13516.1"
FT                   /translation="MREHATEHAGGLELWLVRHGESLWNLEGRVQGQGDPALSDRGREA
FT                   ARRLRPRLQRAAFDAVFTSDLARARETARLALPGRSAVPDARLRELAFGRWEGRRWQEV
FT                   AASDGTALGAWYDDPYAHAPTGGERYEALLARVTAWRRELGARGRVLAFTHGGPILALL
FT                   YSLTGTPQGGRWRFAVPPASLSKLVLGDRGAILQTVGDVAHLEDLPPEDARAQGPA"
FT   gene            complement(424620..425696)
FT                   /locus_tag="Trad_0378"
FT   CDS_pept        complement(424620..425696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0378"
FT                   /product="aminotransferase class I and II"
FT                   /note="COGs: COG0079 Histidinol-phosphate/aromatic
FT                   aminotransferase and cobyric acid decarboxylase; InterPro
FT                   IPR004839:IPR015424:IPR015421; KEGG: rxy:Rxyl_0650
FT                   L-threonine O-3-phosphate decarboxylase; PFAM:
FT                   aminotransferase class I and II; SPTR: Q1AYA8 L-threonine
FT                   O-3-phosphate decarboxylase; PFAM: Aminotransferase class I
FT                   and II"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13517"
FT                   /db_xref="GOA:D7CRM7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRM7"
FT                   /protein_id="ADI13517.1"
FT                   /translation="MPEPKPWLHLPPLPHGGPDGTAVGEGRDFSVNSNPFGPPPELLEH
FT                   LRELALASYPDPSYKEARAAAAAHHGAPLERVTLGSAAELIYRLAACYLRPNDAVLVAT
FT                   PTFGEYARASQLQGARVATCAVYRRGAPPDAAALARAVESVRPALVWLCHPNNPTGHAW
FT                   EAGALHELAERCAARGALLVLDAAYLELSERASAPAELPEGAVQLHALTKTFAVAGLRA
FT                   GYALAPAEVAEVLRRAAPPWSVSTPAAAAVRWCRSPAAAAFVRHSVPRLLAERRALQRG
FT                   LCALGLEVWESATSFFLVEVGSASAVSARARAAGFRLRDASSLGLDSCVRLAAGRPEDN
FT                   HRLLAAFPRFLGPGGSDA"
FT   gene            complement(425683..426630)
FT                   /locus_tag="Trad_0379"
FT   CDS_pept        complement(425683..426630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0379"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="COGs: COG1270 Cobalamin biosynthesis protein
FT                   CobD/CbiB; InterPro IPR004485; KEGG: gau:GAU_0492 cobalamin
FT                   biosynthesis protein CobD; PFAM: cobalamin biosynthesis
FT                   protein CbiB; SPTR: C1A5M4 Cobalamin biosynthesis protein
FT                   CobD; TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   CobD/Cbib protein; TIGRFAM: cobalamin biosynthesis protein
FT                   CobD"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13518"
FT                   /db_xref="GOA:D7CRM8"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRM8"
FT                   /protein_id="ADI13518.1"
FT                   /translation="MAPVGVPFGAALLSLALDLCFGEPPARLHPVVAMGRYLNLKGALL
FT                   ARARRPRARLAAGFGFVALGAALSGGLAWGVQRGAQRLPDPARRPLLACALAPLFSVRA
FT                   LLTAGGAVRDALAAGDLTAARRLLGWHLVSRETAGLTPSEVAGAAVASLAENLTDSITA
FT                   PLLYAAAFGLPGAAVYRFVNTADAVLGYRTPALEHFGRAAARADDLLSFVPARLSGGLL
FT                   LLALTLAGGDARAAWRGLKRDARRTPSPNGGVTMALAAAGLGVRLEKRGVYVLNAAGRA
FT                   PTAADIGRAQQLVGAALGLGMLGWWLLGSARARA"
FT   sig_peptide     complement(426565..426630)
FT                   /locus_tag="Trad_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(426630..427196)
FT                   /locus_tag="Trad_0380"
FT   CDS_pept        complement(426630..427196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0380"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="COGs: COG2109 ATP:corrinoid adenosyltransferase;
FT                   InterPro IPR003724; KEGG: tth:TT_P0002 cob(I)alamin
FT                   adenosyltransferase; PFAM: ATP:corrinoid
FT                   adenosyltransferase BtuR/CobO/CobP; PRIAM: Cob(I)yrinic
FT                   acid a,c-diamide adenosyltransferase; SPTR: B7AB23
FT                   Cob(I)alamin adenosyltransferase; TIGRFAM: cob(I)alamin
FT                   adenosyltransferase; PFAM: ATP:corrinoid
FT                   adenosyltransferase BtuR/CobO/CobP; TIGRFAM: cob(I)alamin
FT                   adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13519"
FT                   /db_xref="GOA:D7CRM9"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRM9"
FT                   /protein_id="ADI13519.1"
FT                   /translation="MAKTPPTTYTTPKPQGERRGLVIVYTGHGKGKTTAALGLLLRAHG
FT                   RGLKTRLFQFIKHEGASFGEHRALAALGVPYEGLGDGFSWRSRDLEASRALAVAGWERA
FT                   KAAILSGAYDLVVLDEVTYPVSWGWLEVDDVIATLRARPPKMHVVLTGRDAHERLLAVA
FT                   DTVTEMHKVKHAFDAGVPAQRGVEH"
FT   gene            complement(427189..427899)
FT                   /locus_tag="Trad_0381"
FT   CDS_pept        complement(427189..427899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0381"
FT                   /product="protein of unknown function DUF105"
FT                   /note="COGs: COG1865 conserved hypothetical protein;
FT                   InterPro IPR002808; KEGG: pth:PTH_1477 hypothetical
FT                   protein; PFAM: protein of unknown function DUF105; SPTR:
FT                   A5D257 Uncharacterized conserved protein; PFAM:
FT                   Adenosylcobinamide amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13520"
FT                   /db_xref="InterPro:IPR002808"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRN0"
FT                   /protein_id="ADI13520.1"
FT                   /translation="MSGPRGERLPFGAPGVTLRRTLPSARAWRHHLLLELPGRCAALSS
FT                   APLGGGFSRPRFVLSCSVERGWCSDDPAGELRRYARALDLPPAETLGLLTAVSMAELET
FT                   ASAARAGWRVHALVTAGVGNAAAAGGRDPLGAGAAGAGTVNLIVLLEGALEPAALVGAV
FT                   QSATEAKTAALRDANVRTPFGELATGTTTDTVSVVSLAPAPRSPYAGLATAPGFLVADT
FT                   AYTALARALRRLDG"
FT   gene            complement(427896..428621)
FT                   /locus_tag="Trad_0382"
FT   CDS_pept        complement(427896..428621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0382"
FT                   /product="cobalamin-5-phosphate synthase CobS"
FT                   /note="COGs: COG0368 Cobalamin-5-phosphate synthase;
FT                   InterPro IPR003805; KEGG: ddr:Deide_2p01460 putative
FT                   cobalamin synthase; PFAM: cobalamin-5-phosphate synthase
FT                   CobS; SPTR: C1XZH5 Cobalamin-5'-phosphate synthase; PFAM:
FT                   Cobalamin-5-phosphate synthase; TIGRFAM: cobalamin
FT                   5'-phosphate synthase/cobalamin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13521"
FT                   /db_xref="GOA:D7CRN1"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRN1"
FT                   /protein_id="ADI13521.1"
FT                   /translation="MLRALRVALAFLTTLPLPPLAWREDDLRRGVRAYPLAGLVLGALL
FT                   YLTGWLLRGLPEPLSGALLVGAWLLFTGALHFDGFCDLADAALASRPPAERQQIARDPH
FT                   LGAFALAAGGVLLLVKAAAAGAAPLTALLFAPLVSRTTVVLPMALAPLGAGSRLGRLAR
FT                   PNPRDVPLPLLLGLGLGGALAWRVGALSLFALLFAVSLLCTLLLAAWLARRLAGLGGDA
FT                   YGAMIEASETLMLVAAVAA"
FT   sig_peptide     complement(428550..428621)
FT                   /locus_tag="Trad_0382"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(428628..429533)
FT                   /locus_tag="Trad_0383"
FT   CDS_pept        complement(428628..429533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0383"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG0614 ABC-type Fe3+-hydroxamate transport
FT                   system periplasmic component; InterPro IPR002491; KEGG:
FT                   dge:Dgeo_2363 periplasmic binding protein; PFAM:
FT                   periplasmic binding protein; SPTR: Q1J3Y0 ABC-type
FT                   Fe3+-hydroxamate transport system, periplasmic component;
FT                   PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13522"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRN2"
FT                   /protein_id="ADI13522.1"
FT                   /translation="MKVSVPLTAWWLTLASAALAAPYPLSVTDDLGVTVTLEREPERVV
FT                   AMMPSHTETLCALDACDKLVGVDDFTNYPPETDDLPRLGGAFSPNIEAILALEPDLVLA
FT                   DESSDLAAALRNAGVTVYAGTAQTFDEAFEKFAVLGQLVNRELEAALLVERVRGEIEAI
FT                   AAQTEALEGVSVYYEIDPTPFSVGPGSFIGVLLAKAGGENIVTEDLGDFPQLDPEYVIA
FT                   ADPEVIIVSEEDAGALPERPGWAGISAVQQGRVVTTDAVTRDAISRPGPRMVEAVRFFA
FT                   RALHPEVFGEPEAVRGAASR"
FT   sig_peptide     complement(429474..429533)
FT                   /locus_tag="Trad_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            429975..430817
FT                   /locus_tag="Trad_0384"
FT   CDS_pept        429975..430817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0384"
FT                   /product="protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /note="COGs: COG2890 Methylase of polypeptide chain release
FT                   factors; InterPro IPR002052:IPR007848:IPR004556:IPR019874;
FT                   KEGG: dge:Dgeo_0068 HemK family modification methylase;
FT                   PFAM: methyltransferase small; SPTR: Q1J2B3 Modification
FT                   methylase, HemK family; TIGRFAM: protein-(glutamine-N5)
FT                   methyltransferase, release factor-specific; modification
FT                   methylase, HemK family; PFAM: Methyltransferase small
FT                   domain; TIGRFAM: HemK family putative methylases;
FT                   protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13523"
FT                   /db_xref="GOA:D7CRN3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRN3"
FT                   /protein_id="ADI13523.1"
FT                   /translation="MTTLAQALEDTTRRLERAGVESAASEAYALLEALLALSRSELLLA
FT                   RQRPLSVPQRRRLEAWVRRREAREPLQHILGVAPFYGLTLRVTPQVLVPRPETERLVEL
FT                   ALAHLRGRARPHVLDVGTGSGAVALALQAERPDAVVLASDLSGAALAVARENARRLGLP
FT                   VRFRRADLLADPAVRAFARRAELVVSNPPYLPEGDREAVSPEVQADPATALYAGPDGLA
FT                   VFRRLEREAFSALQPGAALFVELDARNVARALAESRGWARGAVHDDLVGRPRFLQLVR"
FT   gene            complement(431022..431543)
FT                   /locus_tag="Trad_0385"
FT   CDS_pept        complement(431022..431543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0385"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /note="COGs: COG0597 Lipoprotein signal peptidase; InterPro
FT                   IPR001872; KEGG: fph:Fphi_0398 lipoprotein signal peptidase
FT                   II; PFAM: peptidase A8 signal peptidase II; PRIAM: Signal
FT                   peptidase II; SPTR: B9ZMY6 Lipoprotein signal peptidase;
FT                   TIGRFAM: lipoprotein signal peptidase; PFAM: Signal
FT                   peptidase (SPase) II; TIGRFAM: lipoprotein signal
FT                   peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13524"
FT                   /db_xref="GOA:D7CRN4"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRN4"
FT                   /protein_id="ADI13524.1"
FT                   /translation="MYLLVAAALVALDQLTKVWAANTFPLGGPGVPIGLGFHFTYTRNI
FT                   GAAFGILQHGPTTTLLLGVLSAAVSLALLIYLLRRAPTLSRLQLSAFTLILAGAVGNMI
FT                   DRFYLGYVRDFIHFHLPNFNFPVFNVADMCVVIGAGLLILASLTEGSHEGQPRAAPPDE
FT                   LGGTRPEADR"
FT   sig_peptide     complement(431484..431543)
FT                   /locus_tag="Trad_0385"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            431743..436596
FT                   /locus_tag="Trad_0386"
FT   CDS_pept        431743..436596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0386"
FT                   /product="NAD-glutamate dehydrogenase"
FT                   /note="COGs: COG2902 NAD-specific glutamate dehydrogenase;
FT                   InterPro IPR020539:IPR007780:IPR016040; KEGG: rxy:Rxyl_2529
FT                   glutamate dehydrogenase (NAD); PFAM: NAD-glutamate
FT                   dehydrogenase; SPTR: Q1AT32 Glutamate dehydrogenase (NAD);
FT                   PFAM: Bacterial NAD-glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13525"
FT                   /db_xref="GOA:D7CRN5"
FT                   /db_xref="InterPro:IPR007780"
FT                   /db_xref="InterPro:IPR028971"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRN5"
FT                   /protein_id="ADI13525.1"
FT                   /translation="MPATQNHLQEFVAQSRGAKALERQLIGLLFEEAPPDLLEAFSAES
FT                   LTALGRRARDFIGVRTHPSEVRLRVYNPTLENDGWSVPYTVLELSLGDRPFIVDSVRAE
FT                   LRRHNVDVLHLLHPILEVHRDADGKLLGFGEGGVPEAYELYFLALEPREAARRALAKAV
FT                   ENILQDVVLATDDYGPMRAQAKALSRYLAELAQAERRIERADELAEYAEFMRWLTQDNY
FT                   VFLGYREYDLLEPETPGGDLRLQVTPDSGLGVLRKVSSAYNTPVPLSRLPEGLRERVVG
FT                   GQVLTVTKTNAEATVHRPARMDYIGIKKVVRGVFRGEHRFVGLFTSKALSTPVDEIPIL
FT                   RRKLRLVLALDHAKPGSHDFKRIISVFNSIPRDELFWSDPERLHRDIRTVMAMADEGGV
FT                   RLTVRPDPLARGFAVMVVMPRDRFNAEVRRAIQAYLTNAFRATHVDYQLAIGEDEAQVR
FT                   FHFFFTTDLDPHTLELSVLERRVAELTRTWDDHLGELLEATYGPARGRHLAARYARFFD
FT                   ERYRADTRPETAVHDVAAFEELEHTPFVVRFRNPEGPDRAQGGAEPAPDGAPNDTHLEV
FT                   YHRERTLVLSEVLPILENLGFRVLEQVSYFVSLAEGPVPVRGLDVFRVQGAQGERLELA
FT                   AVGERLQEALVALLRGQAENDRLNRLVLYGGLRVRQVALLRTLQALYAQLSAGTSRRFV
FT                   NDTLLKHPALAGLIYRAFEAKFAPDPPGGPARGREAREAALAEVRADFNEGLAEVASLA
FT                   EDGTLQGLFNLVEAAVRTNFFLDKPFISLKLESARVTHMPEPRPLYEIFVSAPTVEGVH
FT                   LRGGRVARGGLRWSDRPDDVRTEVLGLMKTQMTKNAVIVPVGSKGGFVLKGEPSDPEAL
FT                   RPFVREAYQTYLRGLLDLTDNLVEGRVVHPEGVVVFDDPDPYLVVAADKGTATFSDLAN
FT                   QTAAEYGFWLGDAFASGGSYGYDHKKEGITARGAWECVARHFRELGLDVHRDTFTAFGI
FT                   GDMSGDVFGNGMLYTPKLKLLAAFNHQHIFLDPDPDPEASYRERRRLFELPRSTWADYD
FT                   PAVISAGGGVYSRFAKSIPLSEPVRRVLDLEAEALSGQDLIRAILKMPVDLFWNGGVGT
FT                   YVKASTETHAEAGDSANNAVRVDACELRARVVGEGGNLGFTQRARIEYALAGGRINTDA
FT                   VDNSAGVDMSDHEVNLKILLQPLVTAGRLSFDERNALLKEMTAEVSALVLRDNYRQSLA
FT                   LSLAQRRASRDVSPFVSLQAYLAERGTLRPDVEALPDAKTALARGVTRPELAVLLAYTK
FT                   MGLYRRLLETDFPDEPFFAHYLVEYFPEALQARFRDDILAHPLRREITATQFTNTVVDL
FT                   LGMSFVHRNVRDTGASPVEVVRGALLALEILEAPALLERLFALDGAVAADAQYAMLERF
FT                   VAAVEGVVAWLLLNDIPVASVGTFVETYKAPLSALREGLAALLPAAERARYEGTLQEIV
FT                   ALGFEGPLAAELASLEYLPSSVGVVDVSRNTATPLETAARLFYALGERFSLGALRDALA
FT                   ALEARSKWDKIALNGLVMDLRRAQLGLTEQLLVEGGDASDPAAAVEGFLARHPRLLRRF
FT                   DAALAEIRQEDALGLASGGVLSRLLWQMLEETRRQAAA"
FT   gene            complement(436593..437735)
FT                   /locus_tag="Trad_0387"
FT   CDS_pept        complement(436593..437735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0387"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /note="COGs: COG0635 Coproporphyrinogen III oxidase and
FT                   related Fe-S oxidoreductase; InterPro
FT                   IPR007197:IPR010723:IPR004559:IPR006638; KEGG: dra:DR_0130
FT                   coproporphyrinogen III oxidase, putative; PFAM: Radical SAM
FT                   domain protein; HemN domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; SPTR: Q9RY22 Coproporphyrinogen III
FT                   oxidase, putative; TIGRFAM: oxygen-independent
FT                   coproporphyrinogen III oxidase; PFAM: Radical SAM
FT                   superfamily; HemN C-terminal region; TIGRFAM: putative
FT                   oxygen-independent coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13526"
FT                   /db_xref="GOA:D7CRN6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRN6"
FT                   /protein_id="ADI13526.1"
FT                   /translation="MLPPPRALYLHVPFCPKVCPYCDFHKMRRHEGLVAAYLERLQGEA
FT                   RALYAAFPGPLDTLYFGGGTPSHLTDDELAHLTRTLEATWGFPAALETTLEADPKTFDR
FT                   GRLETFRALGFDRLSIGVQSTQDAVLAFLGRQHTGREGLEAVEMALAAGFTVSADLITA
FT                   VPGQDAAADLHALAQTGVAHLSVYTLTIEPYTPFARRGVTVDEDKEAEDYALASEVLGA
FT                   YGLVRYEVSSHARPGFEAKHNSVYWRGDPFLALGPAAAAFVPVSHGGLLGERRTNPPIK
FT                   AWLAGAPPEVLPVGSAAYVQDVLMTGLRTARGLDLAALSARAGFDVAAHYQGVLARLER
FT                   VGLLERAGGFLRATEAGLLQLNGVTRALFAVAPPAHPPHA"
FT   gene            437859..438866
FT                   /locus_tag="Trad_0388"
FT   CDS_pept        437859..438866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0388"
FT                   /product="putative RNA methylase"
FT                   /note="COGs: COG0116 N6-adenine-specific DNA methylase;
FT                   InterPro IPR002052:IPR000241; KEGG: rrs:RoseRS_2276
FT                   putative RNA methylase; PFAM: putative RNA methylase; SPTR:
FT                   A5UVK2 Putative RNA methylase; PFAM: Putative RNA methylase
FT                   family UPF0020"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13527"
FT                   /db_xref="GOA:D7CRN7"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRN7"
FT                   /protein_id="ADI13527.1"
FT                   /translation="MLPGLEPFAAAELRALRGVREPRAAAGAVRFAFAGPWAALHALRT
FT                   VVAVYAVVPFAVPRPKALLGHEHLTRLLAAIAAVRRGAPAGERFASFRLGAAGEGSSVL
FT                   MRLAETLARETGLAFEPETGELLLRLRRAPHQEGWEALLRLTPRPLSARRWRVCNLPGG
FT                   LNAGVAAAMLALAEVRASDRLLNAMCGSGTLAIEQALTLPPARLLACDTSAAALACTRD
FT                   NARAAGVTLELLQADATALPLPDASVSVVVADPPWGDAVGTHGRNRALYPAFLLEAARV
FT                   TAPGGRLVILTHELRLFDEVLAQPAVRARWDSVRSVQVFHGGHRPRLWLLRRLA"
FT   sig_peptide     437859..437960
FT                   /locus_tag="Trad_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            438916..439143
FT                   /locus_tag="Trad_0389"
FT   CDS_pept        438916..439143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0389"
FT                   /product="ribosomal protein L28"
FT                   /note="InterPro IPR001383; KEGG: dge:Dgeo_2250 ribosomal
FT                   protein L28; SPTR: Q1IW40 Ribosomal protein L28; TIGRFAM:
FT                   ribosomal protein L28; PFAM: Ribosomal L28 family; TIGRFAM:
FT                   ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13528"
FT                   /db_xref="GOA:D7CRN8"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRN8"
FT                   /protein_id="ADI13528.1"
FT                   /translation="MAKVCDICGKKPVIRNQLVQSGKAKREGGVGRKTTGITKTWRLPN
FT                   LQRVTSHVGGQSRRIRACTACIRAGKTLGL"
FT   gene            439293..440735
FT                   /locus_tag="Trad_0390"
FT   CDS_pept        439293..440735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0390"
FT                   /product="type III restriction protein res subunit"
FT                   /note="COGs: COG1061 DNA or RNA helicase of superfamily II;
FT                   InterPro IPR006935:IPR001650:IPR014021:IPR014001; KEGG:
FT                   amr:AM1_2461 type III restriction enzyme, res subunit;
FT                   PFAM: type III restriction protein res subunit; helicase
FT                   domain protein; SMART: DEAD-like helicase ; helicase domain
FT                   protein; SPTR: B0C478 Type III restriction enzyme, res
FT                   subunit; PFAM: Helicase conserved C-terminal domain; Type
FT                   III restriction enzyme, res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13529"
FT                   /db_xref="GOA:D7CRN9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040699"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRN9"
FT                   /protein_id="ADI13529.1"
FT                   /translation="MPQPSRLTFDRGTLILHLPPAGHSWVQFATWDDRIERFRLPALAY
FT                   RPFLEAMRAEGVAVVDKARAFGALQLTPATEVTPFAHQLEALRAWKRSGRRGVVVLPTG
FT                   SGKTYLAQLAMQATPRSTLVVVPTLDLMHQWYAHLRAAFPDVEVGLLGGGSKDRTPLLI
FT                   ATYDSAAMHAETLGNRYGLLVFDECHHLPGAFYRAVAEYALAPYRLGLSATLERSDGKH
FT                   ADLERLIGPVVLRRTPAELAGGALAEHRVVQIRVKLSAAERARYDALIGTRNAFLAQQG
FT                   ISLGTLSGWGRFVRASARSKAGRAAMLAHREARAIAFGTEGKLRVLADLLRRHFPERTL
FT                   VFTDDNATVYRVSQDFLIPAITHQTKVKERHEILARFRSGAYPVLVTSRVLNEGVDVPA
FT                   AKVAVVLSGTGSTREYVQRLGRILRRGEGKLAVLYEVVAEGTSEEGVSRRRRGERPEAP
FT                   PRFERIGDEETVTLDDLGAPGP"
FT   gene            440735..441951
FT                   /pseudo
FT                   /locus_tag="Trad_0391"
FT   gene            442008..442430
FT                   /locus_tag="Trad_0392"
FT   CDS_pept        442008..442430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0392"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /EC_number="1.8.4.12"
FT                   /note="COGs: COG0229 Conserved domain frequently associated
FT                   with peptide methionine sulfoxide reductase; InterPro
FT                   IPR002579:IPR011057; KEGG: syd:Syncc9605_0016 methionine
FT                   sulfoxide reductase B; PFAM: Methionine sulfoxide reductase
FT                   B; PRIAM: Peptide-methionine (R)-S-oxide reductase; SPTR:
FT                   Q3ANN4 Methionine sulfoxide reductase B; TIGRFAM:
FT                   methionine-R-sulfoxide reductase; PFAM: SelR domain;
FT                   TIGRFAM: methionine-R-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13530"
FT                   /db_xref="GOA:D7CRP0"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRP0"
FT                   /protein_id="ADI13530.1"
FT                   /translation="MDSQKRDENAPQQNPNLTPEQIYVLRHEGTERPGSSPLNYEKRPG
FT                   TYYCAGCGAPLFTSATKYDSGSGWPSFYAPIEGSIETKVDYKLLVPRTEYHCARCGGHQ
FT                   GHVFGDGPEPTGLRYCNNGVALTFVPDDPEDTAAER"
FT   gene            442451..443935
FT                   /locus_tag="Trad_0393"
FT   CDS_pept        442451..443935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0393"
FT                   /product="peptidase S10 serine carboxypeptidase"
FT                   /note="COGs: COG2939 Carboxypeptidase C (cathepsin A);
FT                   InterPro IPR001563; KEGG: cag:Cagg_1649 peptidase S10
FT                   serine carboxypeptidase; PFAM: peptidase S10 serine
FT                   carboxypeptidase; SPTR: C1XWK7 Carboxypeptidase C
FT                   (Cathepsin A); PFAM: Serine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13531"
FT                   /db_xref="GOA:D7CRP1"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRP1"
FT                   /protein_id="ADI13531.1"
FT                   /translation="MTQEPAPQTPAQPSAAALQDHLVVTHHTLTVGGAELRYTATAGTL
FT                   VLREERHKDGVWEGDKPKATVFVVAYSKDGADPGRRPVTFAFNGGPGSSSVWLHLGALG
FT                   PKRVLMDELGHPTPPPYRLIDNAHTLLDVTDLVFIDPVSTGYSRAAPGEKPADFHAFNE
FT                   DIASVGDVIRLYTSRYGRWSSPKFLIGESYGTTRAAGLAGYLQERHGMYLSGLMLVSSV
FT                   LDFQTLLFEAGNDLPYSLFLPAYTATAWYHSRLPEALQRRPLREVLREVEAFALGEYAL
FT                   ALLQGANLEAERRAEVARTLARYTGLSEAYVERCDLRLEIGRFTKELLRDAGRTVGRLD
FT                   SRFTGFDRDAAGERPLYDPSYATIQGPYTATLNDYVRRELGFASDLPYEILTNLYETWS
FT                   YKAFENRFVSVSDTLRKAMSINPHLKVHVASGVFDLATPYFATAYTLSHLGLAPELRGN
FT                   LSTSTYEAGHMMYVHEASLAKLKGELGRFILTSQAT"
FT   gene            443984..444682
FT                   /locus_tag="Trad_0394"
FT   CDS_pept        443984..444682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chu:CHU_2164 M48 family peptidase; SPTR:
FT                   A1ZMN2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13532"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRP2"
FT                   /protein_id="ADI13532.1"
FT                   /translation="MDLRNLIVNKVDNANSLLSQHPIAKGLVEGGVSLIPFLGTAITGT
FT                   LNTRAALLFERNTTLLTNELKTQVHRLSENKIDREFLDSDEFTFLILDVLAKNAYTYEE
FT                   VKTQLFAQILINSTLKGTSSTPYKEGFVRIVSDLSAQHIQIFTAVFRKAQTFTGQHQIN
FT                   NEDYVKAQEIAGEAELTQSRTIAYCEELIRYGLLSDWSVGRWEYQRGLYSVTDYGAEFA
FT                   SFLMSHVSES"
FT   gene            444666..445598
FT                   /locus_tag="Trad_0395"
FT   CDS_pept        444666..445598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0395"
FT                   /product="aminotransferase class IV"
FT                   /note="COGs: COG0115 Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase; InterPro
FT                   IPR001544; KEGG: vap:Vapar_5244 aminotransferase class IV;
FT                   PFAM: aminotransferase class IV; SPTR: A0Z4Z3
FT                   Branched-chain amino acid aminotransferase, putative; PFAM:
FT                   Aminotransferase class IV; TIGRFAM: D-amino acid
FT                   aminotransferase; branched-chain amino acid
FT                   aminotransferase, group I"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13533"
FT                   /db_xref="GOA:D7CRP3"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRP3"
FT                   /protein_id="ADI13533.1"
FT                   /translation="MSVRARQFVRGTHASLPDPRNESVFVYINGAFFPRHEAKISVFDS
FT                   GFLVGDGVWEGVRLHEGAFAFLDLHLERLFEGARAIGLDIGKTKAELEAALYDTVRKNA
FT                   MHTDVHVRLMVTRGTKKTPSQDPRLVEGGPNIVIIAEHKRADPEVTAAGVRLLTSTVRR
FT                   PPPDTLDQKLNCHSKLHEVVALVQALHAGADEALMLDPEGFVATCNATNFFIVRRGEVW
FT                   TSTGQYCLNGITRRIVLALCREAGIVALEKPFSLTEVYSADEAFVTGTFGGLTPVIEVD
FT                   GRRIGDAQRGPVTARLTALYQAAVAEAAR"
FT   gene            445595..446326
FT                   /locus_tag="Trad_0396"
FT   CDS_pept        445595..446326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0396"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GSVIVT00022872001; hypothetical protein
FT                   LOC100264940; SPTR: D0DA48 Branched chain amino acid
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13534"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRP4"
FT                   /protein_id="ADI13534.1"
FT                   /translation="MTRPLRLSVWSGPRNVSTALMYSFRERADTTVVDEPLYGHYLRVS
FT                   GAPHPGRDEVLASMDTDGERVVREVLLGDYAAPVVMFKNMAHHLVGLERAFLGELTNVL
FT                   LTRDPYDMLPSLAQRLPEPTLRDTGLTEQVALLEFVLERGQEPVVIDAKALLQDPEGVL
FT                   RAVCRRLGLPFDPAMLAWPAGPKPEDGVWARHWYANVHRSSTFAPYTPKADPLPAHLTP
FT                   LLEVCAPLYERLAAYAVSPER"
FT   sig_peptide     445595..445678
FT                   /locus_tag="Trad_0396"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            446510..447280
FT                   /locus_tag="Trad_0397"
FT   CDS_pept        446510..447280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0397"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: A8Q4L8 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13535"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRP5"
FT                   /protein_id="ADI13535.1"
FT                   /translation="MKRTSLLALTTALSLTLAACGEPQTAPPTTPTPPTDPTPPTDPTP
FT                   PTPPTYPTPPTDPTPPTDPARVDFTFTAVPNLTLRERQWDTEFDFDTTDWEAVYAFYDA
FT                   DLQAQGWQKVSEDIESGDVDAEYAKDGLELDLSVDLEDGNYVEVQIDIDESASAITAGT
FT                   FGLYTLPGLTINLYPDANVLQREWDYDFDYDTTDVAAVFAHYDGLLRQQGWTEVSREDE
FT                   FDVTYQLNGVTFRLDVDLEDGDYVEVEISVDQNN"
FT   gene            447542..448144
FT                   /locus_tag="Trad_0398"
FT   CDS_pept        447542..448144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0398"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: COL4A4; collagen, type IV, alpha 4; K06237
FT                   collagen, type IV, alpha; SPTR: C1E8K9 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13536"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRP6"
FT                   /protein_id="ADI13536.1"
FT                   /translation="MQAPRRPWRQPPLLPLLFLTACAGVAGEVSDRLSVLATQSCVGTA
FT                   RATERVAPGVTLHYDNAFFCSDAPVRERYTFTVRVTNPASSTVSATLQGLELRLSTPRP
FT                   RGRGPEVTGAASGLPLTLAPGESGSFVVSGLYELVRTDEGGKANAHFHVRGGAGNPFHL
FT                   GLNAHFRGASGREAAPPAGRPGGPPRRPGPPPRPGPG"
FT   sig_peptide     447542..447622
FT                   /locus_tag="Trad_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(448147..448869)
FT                   /locus_tag="Trad_0399"
FT   CDS_pept        complement(448147..448869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0399"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="COGs: COG2302 conserved hypothetical protein
FT                   contains S4-like domain; InterPro IPR002942; KEGG:
FT                   dra:DR_0787 hypothetical protein; PFAM: RNA-binding S4
FT                   domain protein; SPTR: Q9RW82 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13537"
FT                   /db_xref="GOA:D7CRP7"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRP7"
FT                   /protein_id="ADI13537.1"
FT                   /translation="MPPHPGETLSDTSARLRAAAAGGRVAHTGFLEPDEAAALARELRA
FT                   AGVGVALSGGVTGARRRVVTAFPEHIPSADAPLAALYVAGVPSEGELLAALAAAGVPRS
FT                   SVGDTVPHQDGLSVVLLKSAKEAALALRDVAGRPVTPQEVPLGRLERGGRKAVQVIVPS
FT                   LRVDVLGAKAFRVSRSYFSKGVAGGQVSVNGRAASKASSAEPGDEVNASGLGRFTVVQV
FT                   QGETKRGNLKVLLEVERA"
FT   gene            complement(448881..449510)
FT                   /locus_tag="Trad_0400"
FT   CDS_pept        complement(448881..449510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0400"
FT                   /product="CBS domain containing protein"
FT                   /note="COGs: COG0517 FOG: CBS domain; InterPro
FT                   IPR000644:IPR013785; KEGG: ttj:TTHA0829 putative acetoin
FT                   utilization protein, acetoin dehydrogenase; PFAM: CBS
FT                   domain containing protein; SMART: CBS domain containing
FT                   protein; SPTR: C1XQK5 CBS domain-containing protein; PFAM:
FT                   CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13538"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRP8"
FT                   /protein_id="ADI13538.1"
FT                   /translation="MFVSEWMTATPQTVSSKTPVMEAMQLLRKGGYRRLPVVDGDKLVG
FT                   IVTDRDLKEATPSKATTLSVYELNYLLSKLTVHDVMVTPVITVAPEEPVENAALLMEEH
FT                   KISGLPVVSGGTLQGIFTITDMLRAIVAMLGLKEGGTRVTVSLPDEPGVLARAASAAAP
FT                   SNIIAVVTAGVQAGHKRELVLRVTGEGAESFPERLRAGGLEVTDVR"
FT   gene            449625..450941
FT                   /locus_tag="Trad_0401"
FT   CDS_pept        449625..450941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0401"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="COGs: COG0743 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; InterPro
FT                   IPR013512:IPR013644:IPR003821:IPR016040; KEGG: tth:TTC0504
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase; PFAM:
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase domain
FT                   protein; PRIAM: 1-deoxy-D-xylulose-5-phosphate
FT                   reductoisomerase; SPTR: C1XT38 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase; TIGRFAM: 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase; PFAM: 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase; 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase C-terminal; TIGRFAM:
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13539"
FT                   /db_xref="GOA:D7CRP9"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRP9"
FT                   /protein_id="ADI13539.1"
FT                   /translation="MQADYTETPPAGAACTGAYRVGAYGVGACWAARAWLRAGGRLAPA
FT                   RRKGHNGRMTPPYDAPTPDAPPKRLSVLGSTGSIGTQALQVARWRGYEVVALAAGRNAA
FT                   RLIEQVRTFRPQLVSCDAAVADEVRAALPAGTQLAVGEPAAVAAHPADVVVAAIPGYAG
FT                   LEPTLAALREGRHVALANKEAMVVAGPLVWETARAHGARLTPVDSELSALFQCLQGEPR
FT                   EAVAALVLTASGGPFRLAPEDLSGVSPAAALKHPTWNMGHKVTIDSATLFNKGLEVLES
FT                   HFFFDWPLERIEVVIHPQSLVHSLVRFKDGNLKAQIGSHDMRLPIQVALEAPDRPPTPL
FT                   APLPLVGVWEFYEPDTARFPSLALAYEAGRRGGTAPAALNAADEVAVEAFLAGRIGFMD
FT                   IPRALEHALTQVPHAALSWEAIPEADREARRAVRALFRL"
FT   gene            451026..452183
FT                   /locus_tag="Trad_0402"
FT   CDS_pept        451026..452183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0402"
FT                   /product="peptidase M50"
FT                   /note="COGs: COG1994 Zn-dependent protease; InterPro
FT                   IPR008915:IPR000644:IPR016483:IPR013785; KEGG:
FT                   hla:Hlac_2601 peptidase M50; PFAM: peptidase M50; CBS
FT                   domain containing protein; SMART: CBS domain containing
FT                   protein; SPTR: C1XPA8 Zn-dependent protease; PFAM: CBS
FT                   domain; Peptidase family M50"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13540"
FT                   /db_xref="GOA:D7CRQ0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRQ0"
FT                   /protein_id="ADI13540.1"
FT                   /translation="MFRNAYTLPFRLLGIPVRLDLSFLLILLLFTWMIGLQVGVFTRLF
FT                   NALLGLTIDLRPLVRGGTPFLLGFLSTLGLFVGVALHELGHAVVARRFGVQVKDITLMF
FT                   LGGVVQFDEMPRQRGAEALVAIAGPITSLLIAGVCWFVLQAVPTGFDATLFVLAFLTFQ
FT                   NVVLALFNLLPALPLDGGRVLRSLLALRLPYLQATEISAAISRIIALLLGFYGVLNLNL
FT                   LLVILAFFIYTAVRGETQYAQTSELLAGLQVRDLMTREVISVEPDWPVSQLMQLMLIRK
FT                   HLGYPVLEDGRLVGFVKLQHVRDLDEGTTVRDIMAREVSTIAPEASAVEAFRRISERDL
FT                   GRLVVVDARGEMVGILSKTDLIRTLQVRLVGSEVRPSPSSSPGGA"
FT   sig_peptide     451026..451130
FT                   /locus_tag="Trad_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(452161..453036)
FT                   /locus_tag="Trad_0403"
FT   CDS_pept        complement(452161..453036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0403"
FT                   /product="spermidine synthase"
FT                   /EC_number="2.5.1.16"
FT                   /note="COGs: COG0421 Spermidine synthase; InterPro
FT                   IPR001045; KEGG: rmr:Rmar_2353 spermidine synthase; PFAM:
FT                   Spermine synthase; SPTR: D0MEK3 Spermidine synthase;
FT                   TIGRFAM: spermidine synthase; PFAM: Spermine/spermidine
FT                   synthase; TIGRFAM: spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13541"
FT                   /db_xref="GOA:D7CRQ1"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRQ1"
FT                   /protein_id="ADI13541.1"
FT                   /translation="MAAETASAAARHGLSHQEVWIGRTGLSFGVERVLFQERSPYQEVA
FT                   VLQTDAFGRLLTLDGVVMLTEHDEFVYHEMIAHPALAARGDAKRVLIIGGGDGGTAREV
FT                   LRHGSVETLDLVEIDGLVVEAAKRFFPHLSSSFADPRLKLHLADGVAFVRDAPPETYDL
FT                   IIVDSTDPIGIAEGLFTRDFYTDCVAALHHRGLLVVQSESPFDPTQAHVVREVRRLFEA
FT                   LLPCARTYLACIPTYPLGLWSFTVGAKTPMTLEEPAAAPPFAHELRYYTPAVHRAAFAL
FT                   PAFVTHLLES"
FT   gene            complement(453040..453435)
FT                   /locus_tag="Trad_0404"
FT   CDS_pept        complement(453040..453435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0404"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /note="COGs: COG1586 S-adenosylmethionine decarboxylase;
FT                   InterPro IPR003826:IPR016067:IPR017716; KEGG: rmr:Rmar_2354
FT                   S-adenosylmethionine decarboxylase proenzyme; PFAM:
FT                   S-adenosylmethionine decarboxylase related; SPTR: D0MEK4
FT                   S-adenosylmethionine decarboxylase proenzyme; TIGRFAM:
FT                   S-adenosylmethionine decarboxylase proenzyme; PFAM:
FT                   S-adenosylmethionine decarboxylase; TIGRFAM:
FT                   S-adenosylmethionine decarboxylase proenzyme, Bacillus
FT                   form"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13542"
FT                   /db_xref="GOA:D7CRQ2"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRQ2"
FT                   /protein_id="ADI13542.1"
FT                   /translation="MHALGRQILVEFYGCKERVLNDTEHLRQVLLEGTRKSGATIVSDT
FT                   FHTFSPHGVSGVVVIAESHVTVHTWPEYGYAAVDIFTCGETIDPWAIMHHLEAELGANN
FT                   ISSTELKRGLFPQKKLHKVVVKDAVGV"
FT   gene            453767..454861
FT                   /locus_tag="Trad_0405"
FT   CDS_pept        453767..454861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0405"
FT                   /product="peptidase M50"
FT                   /note="COGs: COG0750 membrane-associated Zn-dependent
FT                   protease 1; InterPro IPR008915:IPR001478; KEGG:
FT                   ddr:Deide_13240 putative membrane-associated zinc
FT                   metalloproteases; putative membrane protein; PFAM:
FT                   peptidase M50; SMART: PDZ/DHR/GLGF domain protein; SPTR:
FT                   C1XT39 RIP metalloprotease RseP; PFAM: Peptidase family
FT                   M50; PDZ domain (Also known as DHR or GLGF); TIGRFAM: RIP
FT                   metalloprotease RseP"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13543"
FT                   /db_xref="GOA:D7CRQ3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRQ3"
FT                   /protein_id="ADI13543.1"
FT                   /translation="MLTAVVFLLVLTVSVVVHELAHYLNARMVGVPVRAFSVGMGPVLL
FT                   RKRWRGTEWRLSLLPLGGYVDLKGLAPEQAEDGTLRYPDEGFMQKSFLQKTWVLVGGVI
FT                   ANFILAVLLLATVMTVEPNTAVRSLITGEVPSESGTVFQEVLPGTPAEALGIEPGDRVL
FT                   SFNGVADPSRSEVQRLTRTATSLEIVLERGGERLTVRSDWPPPDAGDPPRLGVTLAPVE
FT                   ISPLPPLSFPEAAWRSASFFVRIVPESVAGFARGFGQTFAGQRSAEIVGPVGIVGIAGE
FT                   AARGGLVAVLTFAGLINFSLALFNALPIPGLDGGRILLAAVVALRGKPFKPGQEEFVNF
FT                   LGLAFLVLFVVLISFGEVGDLFRR"
FT   sig_peptide     453767..453844
FT                   /locus_tag="Trad_0405"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            454935..455564
FT                   /locus_tag="Trad_0406"
FT   CDS_pept        454935..455564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0406"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: ttj:TTHA0854
FT                   glycosyltransferase; PFAM: glycosyl transferase family 2;
FT                   SPTR: B7A6B6 Glycosyl transferase family 2; PFAM: Glycosyl
FT                   transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13544"
FT                   /db_xref="GOA:D7CRQ4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRQ4"
FT                   /protein_id="ADI13544.1"
FT                   /translation="MLIPAFNEAANVPSVVRVALEAALGPVLVVDDGSGDATALAAERA
FT                   GATVLRLPRNEGKGGALFAGARALSSDVVVLVDADLLGLRPEHLRDLALPVLRGEVEMT
FT                   RGVFAGGRWRTTAAQRLTPQLNGQRALKRELLLSVPGLKSSRYGVEIAITEHAKRSGWR
FT                   VRDVPLAGVSQVMKEEKRGFWQGVAMRLKMYAEILWELVRSALRAP"
FT   gene            455573..456205
FT                   /locus_tag="Trad_0407"
FT   CDS_pept        455573..456205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0407"
FT                   /product="beta-lactamase-like protein"
FT                   /note="COGs: COG0491 Zn-dependent hydrolase including
FT                   glyoxylase; KEGG: dge:Dgeo_2261 beta-lactamase-like
FT                   protein; SPTR: Q1IW29 Beta-lactamase-like protein; PFAM:
FT                   Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13545"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRQ5"
FT                   /protein_id="ADI13545.1"
FT                   /translation="MLSLSGFCVGPLQENTYLLADTETLEAVLVDPGDEAERLLAALAG
FT                   FKLTAIWLTHAHFDHVGALAAVHEAHPVPVYLHPADRPLLAQAAASAALFGLPLRQPEL
FT                   PTLPLAHAQQLQVGAYRARCLHTPGHAPGHVAFYLAEAGVLLAGDALFRGSIGRTDLPG
FT                   GDLETLLRSLRDEVLTLPDETRVLPGHGPETTVGSERRRNPFLQGLA"
FT   gene            456215..456694
FT                   /locus_tag="Trad_0408"
FT   CDS_pept        456215..456694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0408"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="COGs: COG0622 phosphoesterase; InterPro
FT                   IPR004843:IPR000979; KEGG: pap:PSPA7_0444 hypothetical
FT                   protein; PFAM: metallophosphoesterase; SPTR: A6UYF4
FT                   Putative uncharacterized protein; TIGRFAM:
FT                   phosphodiesterase, MJ0936 family; TIGRFAM: phosphoesterase,
FT                   MJ0936 family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13546"
FT                   /db_xref="GOA:D7CRQ6"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRQ6"
FT                   /protein_id="ADI13546.1"
FT                   /translation="MTARAEVQSHTVGLIADTHGLLRPEALEALRGVSLIVHAGDIGDR
FT                   GILEVLGRLAPVCAVRGNTDREAWALRLPRYELVNVGALTLYVHHGHEPLDLEPRAAGC
FT                   GVVVSGHTHVPKIETRDGVLYVNPGSAGPKRFDLPVTVARLWVRGQEAEAKLLPL"
FT   gene            complement(456691..458304)
FT                   /locus_tag="Trad_0409"
FT   CDS_pept        complement(456691..458304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0409"
FT                   /product="Amidohydrolase 3"
FT                   /note="COGs: COG1574 metal-dependent hydrolase with the
FT                   TIM-barrel fold; InterPro IPR013108:IPR011059; KEGG:
FT                   mlo:mll2891 hypothetical protein; PFAM: Amidohydrolase 3;
FT                   SPTR: C8STV8 Amidohydrolase 3; PFAM: Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13547"
FT                   /db_xref="GOA:D7CRQ7"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRQ7"
FT                   /protein_id="ADI13547.1"
FT                   /translation="MPPLDAAADLIITNARAWTLDKSNPRADTVAVKGERILYVGSERE
FT                   AAPLRGPATEIIDGEGRTLLPGLIDSHFHLLWGSLRLDDLQLGGVRGLEALGEAIRGYA
FT                   AAHPESPWLRAQGLAYDVLPGERLTRQHLDALEPHRPMVLTCFDFHTAWCNTAALRAAG
FT                   ILHGAEVPSNAEVVLGDDGLATGELREFEAMELVYRLLPEPSPAEVRDLLRRGMRLANA
FT                   YGITSVHNMNGDLDEFAHYRALDEAGELSLRLYVPFRMYPHTPLSAIEGEAVAMRAYRS
FT                   AKLRAGALKLFMDGVVESYTAFLTEPYAGAAGCGEAIFSAEHAREIAVRAERAGLQVAV
FT                   HAVGDAAVRRALDAFAAARRANGPRDTRHRIEHIELLHPDDVPRFAELGVTASMQPFHC
FT                   TRPERDYLPSWLACIPAARYADAFPWETLRAAGAHLCFGSDWPVVSMNPFLGFDAAVNR
FT                   QPWAEGLPAQAQTLEATLEAYTKGAAFAEFGERDKGQLKAGMLADLALLSADVFALPAE
FT                   RLSTLTAALTVCGGEVVHRG"
FT   gene            complement(458383..458964)
FT                   /locus_tag="Trad_0410"
FT   CDS_pept        complement(458383..458964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0410"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain protein"
FT                   /note="COGs: COG0723 Rieske Fe-S protein; InterPro
FT                   IPR005805:IPR017941; KEGG: dge:Dgeo_1251 Rieske (2Fe-2S)
FT                   region; PFAM: Rieske [2Fe-2S] iron-sulphur domain; SPTR:
FT                   Q1IYY7 Rieske (2Fe-2S) region; PFAM: Rieske [2Fe-2S]
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13548"
FT                   /db_xref="GOA:D7CRQ8"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRQ8"
FT                   /protein_id="ADI13548.1"
FT                   /translation="MTETPQTTPTPDAPDATRRRLITWLWRLPVLAAVGATGWGVWEAY
FT                   RVHFSKVTPDDAPTFTPHPPERIGSVADFPEVWSALEFTFAGTAALALRLPEPVPGGLS
FT                   VSGVHLAAFSRLCTHLGCPVSLNRNLEAVAVAFNHRTDQPVLTCPCHLSVFAPLQAGRA
FT                   VSGPARDPLPRVQLSPQGDELFAVGLEAPA"
FT   sig_peptide     complement(458869..458964)
FT                   /locus_tag="Trad_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(458974..460425)
FT                   /locus_tag="Trad_0411"
FT   CDS_pept        complement(458974..460425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0411"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="InterPro IPR013105:IPR019734:IPR013026:IPR011990;
FT                   KEGG: tth:TTC1035 hypothetical protein; PFAM:
FT                   Tetratricopeptide TPR_2 repeat protein; SPTR: C1XSK0
FT                   Cytochrome c biogenesis factor"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13549"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRQ9"
FT                   /protein_id="ADI13549.1"
FT                   /translation="MNLLFVLLLAALLFAYLAIPLLFPRQSDPLPDLRDPVTQDLEEER
FT                   DALLRAIRELDARTDLPEARRAALRGRYEAKAAKVLRALDERQREAPPEPPAAPPRGLA
FT                   AVALTLLAGVLVGATFVTNNLPPEVRSVDGGPPAITGRELQRLERAAARDPSAANLLAL
FT                   ADGYWRADNGDAAEALYVRITQEVSPPPAVALQRLGFLRLQVNLAEAVQYLELARNADP
FT                   EDLETLYILGEVHYASRNMEAAIEAWEAYLEAPGGAGDAEVAARLQLARTFAALLAAAE
FT                   ADPSAENLAALADAHWESGERDRAVDVYFRLLTEADPHHATALSRVGQQLSLGGRFDDA
FT                   AAVLERALALDPQDHATRLYLGSARFAAGDYAAAADAWEVYARAAAGDERVAELIATAR
FT                   ERAAEDALPPTQEELQDLPAELFAEAAGAGAAAAPAAPAASSAVPDDTLAHPTEDAGTP
FT                   ERGAETAPVAPAETTAAPGTTYTTP"
FT   sig_peptide     complement(460345..460425)
FT                   /locus_tag="Trad_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(460422..460880)
FT                   /locus_tag="Trad_0412"
FT   CDS_pept        complement(460422..460880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0412"
FT                   /product="cytochrome C biogenesis protein"
FT                   /note="COGs: COG3088 Uncharacterized protein involved in
FT                   biosynthesis of c-type cytochromes; InterPro IPR005616;
FT                   KEGG: ttj:TTHA1402 cytochrome c-type biogenesis protein;
FT                   PFAM: cytochrome C biogenesis protein; SPTR: Q5SIG7
FT                   Cytochrome c-type biogenesis protein; PFAM: Cytochrome C
FT                   biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13550"
FT                   /db_xref="GOA:D7CRR0"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRR0"
FT                   /protein_id="ADI13550.1"
FT                   /translation="MRRTLLLILSLLGAAFAQHVELEQEVFAIARELRCPVCRAESAAD
FT                   SNATTSVEFRGIIRELLAEGHSREEILAYFTARYGDWILLEPPRRGIHLVVWVLPILAV
FT                   LAGVTLLALLVRRWTRAAAAPIEVDAEGLERVQRELTAGPEHAPEGAP"
FT   sig_peptide     complement(460830..460880)
FT                   /locus_tag="Trad_0412"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(460892..461467)
FT                   /locus_tag="Trad_0413"
FT   CDS_pept        complement(460892..461467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0413"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="COGs: COG0526 Thiol-disulfide isomerase and
FT                   thioredoxins;
FT                   InterProIPR017937:IPR000866:IPR017936:IPR012336:IPR 012335;
FT                   KEGG: ttj:TTHA1728 hypothetical protein; PFAM: alkyl
FT                   hydroperoxide reductase/ Thiol specific antioxidant/ Mal
FT                   allergen; SPTR: Q5SHK2 Putative uncharacterized protein
FT                   TTHA1728; PFAM: Redoxin; TIGRFAM: periplasmic protein
FT                   thiol:disulfide oxidoreductases, DsbE subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13551"
FT                   /db_xref="GOA:D7CRR1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRR1"
FT                   /protein_id="ADI13551.1"
FT                   /translation="MSAPAKERPAGGARRLAWVLLGVAALAALLTFGLFRDPTRRDDIP
FT                   SALIESPAPAFTMPLFARYTDPYGPTFDLADYRGTPIVLNFWASWCGPCRVEMPILEAS
FT                   WQEYGDEVLFVGVNTQERSQRGAQELLDEFSISYPNGLDADNRINIDYGLFGLPETFFI
FT                   RADGTLSYRHAGEISRETLDAQIRALLE"
FT   gene            complement(461464..463497)
FT                   /locus_tag="Trad_0414"
FT   CDS_pept        complement(461464..463497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0414"
FT                   /product="cytochrome c assembly protein"
FT                   /note="COGs: COG1138 Cytochrome c biogenesis factor;
FT                   InterPro IPR003567:IPR003568:IPR002541; KEGG: dra:DR_0346
FT                   cytochrome c-type biogenesis protein CcmF; PFAM: cytochrome
FT                   c assembly protein; SPTR: Q9RXG7 Cytochrome c-type
FT                   biogenesis protein CcmF; PFAM: Cytochrome C assembly
FT                   protein; TIGRFAM: c-type cytochrome biogenesis protein
FT                   CcmF"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13552"
FT                   /db_xref="GOA:D7CRR2"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRR2"
FT                   /protein_id="ADI13552.1"
FT                   /translation="MFDPTQLSLAYLGSGSVLLALGLALYAVLVGALGAARHDARLQTS
FT                   ARYAAVGIFFAMTAAVVVMQTALLTDDFSVKYVAEHSISTSPTWVKVATMWAALEGSIL
FT                   LWAWFAAGYTALLALVAPNDALRPWALVVMNAVNVFFISVNGLVANPFIALATPPLEGP
FT                   GPNPLLQNHWMMAVHPILIYLGYVGLTVPFAYAMSALITKRPGSEWMTQTRTWTLVGWG
FT                   FLGLGKVAGGWWSYEVLGWGGYWAWDPVENVSILPWLTATAFIHSVQVQERRRMLKAWN
FT                   LLLIILTFALTILGTFIIRAGVISSVHAFGDGPVGPYFLGFFLLVSAVSFGLLALRWDQ
FT                   VRDRADLDSVVSREGSFLLGNVLFLAMTFAVLLGTLFPLLVEAVTGEKVTVGAPFFNQV
FT                   SFPLWLGILALMGIGPLLPWRKAEEQSLRRNLAWMLGGALVAGALAYLFGVRKFYPLMT
FT                   VALCAYNLVSLGLLLSGALVPRLRLSSQGPLRVFVQYATESRRRFGSMIVHFGVVVIAL
FT                   GIAGSGGYRVDQQLRVTLGESVPFQGYELRAIDRFMEQTPGRISAGAVVEVWRDGRFVA
FT                   TLRPRVNVFGGGDTQPVPTPDVLYTAWHDVYLNVAGPVRPDQDFIVLRAVQSPLIAWIW
FT                   IGTAILAFGTAYTLLPAPRRQKRRVTAAAAEGVPETVPGARV"
FT   sig_peptide     complement(463402..463497)
FT                   /locus_tag="Trad_0414"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(463506..463943)
FT                   /locus_tag="Trad_0415"
FT   CDS_pept        complement(463506..463943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0415"
FT                   /product="CcmE/CycJ protein"
FT                   /note="COGs: COG2332 Cytochrome c-type biogenesis protein
FT                   CcmE; InterPro IPR004329:IPR012340; KEGG: tth:TTC1039
FT                   cytochrome c-type biogenesis protein CcmE; PFAM: CcmE/CycJ
FT                   protein; SPTR: B7A5K9 CcmE/CycJ protein; manually curated;
FT                   PFAM: CcmE"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13553"
FT                   /db_xref="GOA:D7CRR3"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRR3"
FT                   /protein_id="ADI13553.1"
FT                   /translation="MGGAAIKRLIYSVAGVALLGVAGTFLYQALANSLVYFILPSEYAS
FT                   APESYSGRIRLGGLVEKGTLTFDSDALQLAFDITDSVQSFPVRYGGAPPELLRENTGVV
FT                   VVGSFEDGTFMGDEVLVKHTEVYEPAEGEEIDLDELKEALR"
FT   sig_peptide     complement(463851..463943)
FT                   /locus_tag="Trad_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(463916..464053)
FT                   /locus_tag="Trad_0416"
FT   CDS_pept        complement(463916..464053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0416"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bac:BamMC406_0420 type VI secretion protein
FT                   IcmF; SPTR: Q0BIS1 ImcF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13554"
FT                   /db_xref="GOA:D7CRR4"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRR4"
FT                   /protein_id="ADI13554.1"
FT                   /translation="MFDVTTWGHWHWVTLAWAQVLVTYGGYGLFVRWRLKRLEERLSND
FT                   "
FT   sig_peptide     complement(463970..464053)
FT                   /locus_tag="Trad_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(464046..464804)
FT                   /locus_tag="Trad_0417"
FT   CDS_pept        complement(464046..464804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0417"
FT                   /product="cytochrome c assembly protein"
FT                   /note="COGs: COG0755 ABC-type transport system involved in
FT                   cytochrome c biogenesis permease component; InterPro
FT                   IPR003557:IPR002541; KEGG: tth:TTC1041 heme exporter
FT                   protein C; PFAM: cytochrome c assembly protein; SPTR:
FT                   B7A5K7 Cytochrome c assembly protein; PFAM: Cytochrome C
FT                   assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13555"
FT                   /db_xref="GOA:D7CRR5"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRR5"
FT                   /protein_id="ADI13555.1"
FT                   /translation="MTRPVASTPRRAPRVPPRPKWLNLLGLAALALFGVGLYLALVTSP
FT                   ADINQGDLIRVMYAHVSVAWICFLAVFLTALFGSLFLWSGRRSFDVWALANAELALVFA
FT                   ALTLVGGMTYSRPTLNTWWTWDAKLTLTALLFALLVGYFIVRGMLEDPDRRGRVSAVVS
FT                   IIAAASLPFNYFAANWFRTLHPAKSIRLDGGGVTMDGSMLQALLVNVAAAALIYLFFMV
FT                   ERARVGRLEAQLETEREKTLQSAPQEVIHV"
FT   sig_peptide     complement(464667..464804)
FT                   /locus_tag="Trad_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(464820..465551)
FT                   /locus_tag="Trad_0418"
FT   CDS_pept        complement(464820..465551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0418"
FT                   /product="cytochrome c-type biogenesis protein CcmB"
FT                   /note="COGs: COG2386 ABC-type transport system involved in
FT                   cytochrome c biogenesis permease component; InterPro
FT                   IPR003544; KEGG: dra:DR_0407 cytochrome c-type biogenesis
FT                   protein, heme exporter protein B; PFAM: cytochrome c-type
FT                   biogenesis protein CcmB; SPTR: Q9RXA8 Cytochrome c-type
FT                   biogenesis protein, heme exporter protein B; PFAM: CcmB
FT                   protein; TIGRFAM: heme exporter protein CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13556"
FT                   /db_xref="GOA:D7CRR6"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRR6"
FT                   /protein_id="ADI13556.1"
FT                   /translation="MVKARTKVASRPASGSTPWGDAVAVWAVARKDLLLELRSKEVTVA
FT                   TLFFSGLVLGILALALGPDDRTLREAAAGAFWVALAFAGVISAAQSYASELEEGAFEHL
FT                   LLYPVPRATLFLGKLLANWLFLALLGALLLPVSAAVFDASLTRHLPWLLLTVALGTFGF
FT                   ALIATFYAALTANLRARESLLPVLIFPVIAPVIVGAVRSSASVMLAGDPSASLSWIQLL
FT                   AGFNLAYLVVCSAIFPFVVEE"
FT   sig_peptide     complement(465480..465551)
FT                   /locus_tag="Trad_0418"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(465544..466236)
FT                   /locus_tag="Trad_0419"
FT   CDS_pept        complement(465544..466236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0419"
FT                   /product="heme exporter protein CcmA"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro
FT                   IPR017871:IPR003439:IPR005895:IPR003593; KEGG: dra:DR_0406
FT                   ABC transporter, ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: Q9RXA9 ABC transporter,
FT                   ATP-binding protein; TIGRFAM: heme exporter protein CcmA;
FT                   PFAM: ABC transporter; TIGRFAM: heme ABC exporter,
FT                   ATP-binding protein CcmA"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13557"
FT                   /db_xref="GOA:D7CRR7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRR7"
FT                   /protein_id="ADI13557.1"
FT                   /translation="MSTVPAVALTNLGRRYGASFVLRGVNLQVAPGRTVVLKGGNGAGK
FT                   TTLLRVLSTRLRPSLGSGRVFGFDLVKQGHAVRERVAYLSVFGGSYGGLTPLENLALAA
FT                   QLYNRAPAPGELAALLERVGLGGAQHKLVRSFSSGMKKRLGLARLLLSEADLWLLDEPY
FT                   AALDEAGKGLVDGLVLEAKAQGKTVLMASHDLERSAPLADSVLELRDGALSVVFTGDAA
FT                   KTRGAAHG"
FT   gene            complement(466233..466940)
FT                   /locus_tag="Trad_0420"
FT   CDS_pept        complement(466233..466940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0420"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="COGs: COG0785 Cytochrome c biogenesis protein;
FT                   InterPro IPR003834; KEGG: gau:GAU_0930 cytochrome c-type
FT                   biogenesis protein CcdA; PFAM: cytochrome c biogenesis
FT                   protein transmembrane region; SPTR: C1XWX4 Cytochrome c
FT                   biogenesis protein; PFAM: Cytochrome C biogenesis protein
FT                   transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13558"
FT                   /db_xref="GOA:D7CRR8"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRR8"
FT                   /protein_id="ADI13558.1"
FT                   /translation="MTPTLPLAFVAGVLSFLSPCVLPLVPSYLAYVGGSHARSGARWAI
FT                   LSRSLLFVLGFSLIFVALGASASALGSLLSAYRYELSRLGGLLILGFGLFMLGLRLPWL
FT                   QRDVRLRFQGETRTPVGAVLLGMAFAAGWTPCIGPVLGAALTVAGASGTLGLGVTLLAF
FT                   YALGLAVPFVLAALMLESFSRFSLRFRRYLPWVERTSGAILVAAGVLMLTGSYTVLNSY
FT                   LVQFTPDWLWSRL"
FT   sig_peptide     complement(466830..466940)
FT                   /locus_tag="Trad_0420"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            467149..467224
FT                   /locus_tag="Trad_R0012"
FT   tRNA            467149..467224
FT                   /locus_tag="Trad_R0012"
FT                   /product="tRNA-Lys"
FT   gene            467229..467303
FT                   /locus_tag="Trad_R0013"
FT   tRNA            467229..467303
FT                   /locus_tag="Trad_R0013"
FT                   /product="tRNA-Glu"
FT   gene            467359..467434
FT                   /locus_tag="Trad_R0014"
FT   tRNA            467359..467434
FT                   /locus_tag="Trad_R0014"
FT                   /product="tRNA-Val"
FT   gene            complement(467527..468551)
FT                   /pseudo
FT                   /locus_tag="Trad_0421"
FT   gene            complement(468552..468680)
FT                   /locus_tag="Trad_0422"
FT   CDS_pept        complement(468552..468680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0422"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2026 integrase family protein; SPTR:
FT                   Q855R3 Gp50"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13559"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRR9"
FT                   /protein_id="ADI13559.1"
FT                   /translation="MPKRKRNTKRGKGEGSVFELPNGTWRGKVTVGYDEAGKQRFR"
FT   gene            complement(468684..468992)
FT                   /locus_tag="Trad_0423"
FT   CDS_pept        complement(468684..468992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0423"
FT                   /product="plasmid stabilization system"
FT                   /note="InterPro IPR007712; KEGG: mar:MAE_07940 hypothetical
FT                   protein; PFAM: plasmid stabilization system; SPTR: Q4C7V8
FT                   Plasmid stabilization system; PFAM: Plasmid stabilisation
FT                   system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13560"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS28"
FT                   /protein_id="ADI13560.1"
FT                   /translation="MRFSIILTADAQADLDGISDTRTYEAIERKIDELTTDPDKRGKAL
FT                   ADDLRDYRSVRAAGQRYRIVYQVGMLEGVVTVVVIGIRKEGDKRDVYRVASKRLRKG"
FT   gene            complement(468993..469337)
FT                   /locus_tag="Trad_0424"
FT   CDS_pept        complement(468993..469337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0424"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="InterPro IPR001387; KEGG: dge:Dgeo_2718 hypothetical
FT                   protein; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; SPTR: Q1J2Y3 XRE-family
FT                   like protein, component of toxin-antitoxin system; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13561"
FT                   /db_xref="GOA:D7CS29"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS29"
FT                   /protein_id="ADI13561.1"
FT                   /translation="MRWTLKEYLNRHGLTAYQLAKASGLSVNTIYPLARGEAQRVSLDT
FT                   LQTVLDTLDKLTGQRVNVTDVLEREVEEHEFSDGVPDDLRERIGRFERGEVKLIPWEQV
FT                   KAEQRAKRGL"
FT   gene            complement(469490..469729)
FT                   /locus_tag="Trad_0425"
FT   CDS_pept        complement(469490..469729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0425"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyh:Cyan8802_3582 cell envelope-related
FT                   transcriptional attenuator; SPTR: C7QM94 Cell
FT                   envelope-related transcriptional attenuator"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13562"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS30"
FT                   /protein_id="ADI13562.1"
FT                   /translation="MPKHRVHVRQLEHLVPHPVPDATRGALEGLRGREDDFMALQAGHE
FT                   AVVLVPVSVRDEGVDVAGVGRDGGDDAEAFDGGA"
FT   gene            complement(470028..470222)
FT                   /locus_tag="Trad_0426"
FT   CDS_pept        complement(470028..470222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0426"
FT                   /product="YcfA family protein"
FT                   /note="InterPro IPR012933; KEGG: tth:TTC1885 hypothetical
FT                   protein; PFAM: YcfA family protein; SPTR: C1XMY5 YcfA-like
FT                   protein; PFAM: YcfA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13563"
FT                   /db_xref="GOA:D7CS31"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS31"
FT                   /protein_id="ADI13563.1"
FT                   /translation="MADYAPQLKRLLKEAGCSFHRQGKGDHEVWYSPLSKHYFPVDSKI
FT                   KSHHTANGVLKQAGLPKAF"
FT   gene            complement(470251..470493)
FT                   /locus_tag="Trad_0427"
FT   CDS_pept        complement(470251..470493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0427"
FT                   /product="Domain of unknown function DUF1902"
FT                   /note="InterPro IPR015066; KEGG: ttj:TTHA1013 hypothetical
FT                   protein; PFAM: Domain of unknown function DUF1902; SPTR:
FT                   A0ZK26 Putative uncharacterized protein; PFAM: Domain of
FT                   unknown function (DUF1902)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13564"
FT                   /db_xref="InterPro:IPR015066"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS32"
FT                   /protein_id="ADI13564.1"
FT                   /translation="MVADRAIEVHAFWDEEAGVWVAESDHVPGLVTEAETVEQLAAKLE
FT                   HLIPELLELNAPELLGAPTVNLKAERTLVRAPARP"
FT   repeat_region   470705..471350
FT                   /note="CRISPR"
FT   gene            complement(471667..471936)
FT                   /locus_tag="Trad_0428"
FT   CDS_pept        complement(471667..471936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0428"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="COGs: COG1343 Uncharacterized protein predicted to
FT                   be involved in DNA repair; InterPro IPR003799; KEGG:
FT                   tth:TT_P0101 hypothetical protein; PFAM: protein of unknown
FT                   function DUF196; SPTR: C1XW87 CRISPR-associated protein
FT                   Cas2; TIGRFAM: CRISPR-associated protein Cas2; PFAM: CRISPR
FT                   associated protein Cas2; TIGRFAM: CRISPR-associated protein
FT                   Cas2"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13565"
FT                   /db_xref="GOA:D7CS33"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS33"
FT                   /protein_id="ADI13565.1"
FT                   /translation="MAGLYTVSYDIPNDNRRVKLANVLKSFGERVQYSVFECWLEPREL
FT                   RELRQKLEARLNEREDSVRIYPVGSPVEVLGSGSPTEDARLFMF"
FT   gene            complement(471957..472949)
FT                   /locus_tag="Trad_0429"
FT   CDS_pept        complement(471957..472949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0429"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="COGs: COG1518 Uncharacterized protein predicted to
FT                   be involved in DNA repair; InterPro IPR018254:IPR002729;
FT                   KEGG: ttj:TTHB145 hypothetical protein; PFAM: protein of
FT                   unknown function DUF48; SPTR: C1XW88 CRISPR-associated
FT                   protein Cas1; TIGRFAM: CRISPR-associated protein Cas1;
FT                   PFAM: CRISPR associated protein Cas1; TIGRFAM:
FT                   CRISPR-associated protein Cas1"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13566"
FT                   /db_xref="GOA:D7CS34"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS34"
FT                   /protein_id="ADI13566.1"
FT                   /translation="MAVLHLLEQGATARLRAGRICVELDGHALGEVPARKVRQVALHGN
FT                   VRLTTPALQFFLGNGVPVLYVSLKGALHGVASSCALAPPARLRAQFAAATSAVGAGIAQ
FT                   LFVLAKLRSSLAVLTAFRRTRPELAAAAAQLHALGGKVAACTELERLRGFEGLCARLYY
FT                   AALQRPLAAYGFTGRNRRPPRDPVNAALSYGYALLLAQVQLATLSAGLHPEVGLLHAES
FT                   RRNPAMSLDLMEEFRVPVVDLTVFRAFLSGALHPTQHFRDEAGGIYLSDAGRKVLVPLL
FT                   EARLDAEAKPPEGGACPYRTLIERQARRLAAALEGRRPYSPFYLSARPT"
FT   gene            complement(472954..474417)
FT                   /locus_tag="Trad_0430"
FT   CDS_pept        complement(472954..474417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0430"
FT                   /product="CRISPR-associated protein, TIGR02710 family"
FT                   /note="InterPro IPR014082; KEGG: tth:TT_P0107 hypothetical
FT                   protein; PFAM: CRISPR-associated protein Cas02710; SPTR:
FT                   B7A9Z0 CRISPR-associated protein, TIGR02710 family;
FT                   TIGRFAM: CRISPR-associated protein, TIGR02710 family; PFAM:
FT                   CRISPR-associated protein (Cas_Cas02710); TIGRFAM:
FT                   CRISPR-associated protein, TIGR02710 family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13567"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014082"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS35"
FT                   /protein_id="ADI13567.1"
FT                   /translation="MAEVVEPVELNDLWQQFKEMHASQGLEAANDFYDQHVWPSLLLRW
FT                   RAQDHGPRCNLSLHTLGTSPEALILAATALRSEQIYIFYTDESEKYLDRVEAELGKRVW
FT                   AYNVSKDDPTTIYQRFQDVLQRYPHADIAVDITSGTKPMVTGLGAAAFSAMTFGYKLRV
FT                   FYVNGEFDPAARRPRAGSEALIQINDPLGAFGDLEYQTAKALYNAQEYTLAAREFIRIA
FT                   DRTGDVRRFSPYAKLSEAYAAWLSNRFESAAHAFEGLFSELDKPGFQTHPLREQLPVLK
FT                   QQHDGVLLLTKLVDAYDDPAKRVATLSDAALVLWLLASLELMQSRFAEAGNFTAAGLLC
FT                   YRSLEVTSQHRLATYRFDSLAANYPALPVPQDVLQDAYTAAWQKVASKKQAASPRPLPP
FT                   QGQPVPLFESYLLLGALEDPLVKALVHRQNDLMGLAELRNQSLWIHGYKPISEKAYRKL
FT                   ASLLSPLHEALLQLEGRSERCPASAVPLP"
FT   gene            complement(474402..475607)
FT                   /locus_tag="Trad_0431"
FT   CDS_pept        complement(474402..475607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0431"
FT                   /product="CRISPR-associated protein, TIGR02710 family"
FT                   /note="InterPro IPR014082; KEGG: ttj:TTHB144 hypothetical
FT                   protein; PFAM: CRISPR-associated protein Cas02710; SPTR:
FT                   C1XW86 CRISPR-associated protein, TIGR02710 family;
FT                   TIGRFAM: CRISPR-associated protein, TIGR02710 family; PFAM:
FT                   CRISPR-associated protein (Cas_Cas02710); TIGRFAM:
FT                   CRISPR-associated protein, TIGR02710 family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13568"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014082"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS36"
FT                   /protein_id="ADI13568.1"
FT                   /translation="MPASGVAQVLIATVGATPEPIVTAALEHAPERAVFIASQETQQVA
FT                   AQVKEALGLEVYTILLDDAESLSEAYEAAQRALAKALEWEARAITADLTGGTKPMVAGL
FT                   ALALTGQGVTFSYVGGSARDAYGRVQSGSERLRLLEDPTARFFVREWEAFTRAWNGWRF
FT                   REAQSIVALICAQPLSASNARFFRHLSGVCAGLNAWDSFHHDEALGLLQTHLEPALSIA
FT                   EAWRHGAKVRVLGALFARQGELQALTQRQRPTRALLGDLLANAERRAFAGRFDDALARL
FT                   YRGVELAAEVDIAERYGFHLKVAATWPELSPELKRRAGTLLGLKETLDLASDIDLFFGK
FT                   NGTLAQRLRDDYPKQLKPLLARRHESVLAHGLRSVGAGDYEALRAYLEAQGLRAAEGWP
FT                   RW"
FT   sig_peptide     complement(475536..475607)
FT                   /locus_tag="Trad_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   repeat_region   476285..477081
FT                   /note="CRISPR"
FT   gene            complement(477309..478052)
FT                   /locus_tag="Trad_0432"
FT   CDS_pept        complement(477309..478052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0432"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /note="COGs: COG5551 conserved hypothetical protein;
FT                   InterPro IPR019267:IPR010156; KEGG: tth:TTC1927
FT                   hypothetical protein; PFAM: Protein of unknown function
FT                   DUF2276; SPTR: B7A9Z1 CRISPR-associated protein Cas6;
FT                   TIGRFAM: CRISPR-associated protein Cas6; PFAM:
FT                   Uncharacterized conserved protein (DUF2276); TIGRFAM:
FT                   CRISPR-associated protein Cas6"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13569"
FT                   /db_xref="GOA:D7CS37"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="InterPro:IPR019267"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS37"
FT                   /protein_id="ADI13569.1"
FT                   /translation="MSLVALVLPLTGAQKPEAVHVRGALYALLKEHAPELHDRQDLKPF
FT                   TVSVGGAAKDHPPFIRLTFLSEPLYTALAPALHDLPRRPLSLGDRTYTVTDVLQEGHPW
FT                   AGATTYPRLFQTPGDADLSLHFATPTVFRRHGANYPLPEPRLVLGSLIERWNLYAPLAV
FT                   PSEVASRLTEGCVPRFFELRSRTVYAHDPFTGFLGRVTFHLRGASADEAHWLAILGRFA
FT                   FYSGVGAKTTLGFGQVRPYRPTPGA"
FT   sig_peptide     complement(478014..478052)
FT                   /locus_tag="Trad_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(478075..479034)
FT                   /locus_tag="Trad_0433"
FT   CDS_pept        complement(478075..479034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0433"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR008960:IPR015922; KEGG: ttj:TTHA0317
FT                   hypothetical protein; SPTR: C1XR88 Putative uncharacterized
FT                   protein; PFAM: Domain of unknown function (DUF2223)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13570"
FT                   /db_xref="InterPro:IPR019248"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS38"
FT                   /protein_id="ADI13570.1"
FT                   /translation="MLAFVLASLLTLQDPAGDAVGNGTLAAPTASAFRSTDPFDLTRIT
FT                   VPDADTFGVTLEYALIPPADAFPQAITELYVHDADAAARGEPGRAALLPGSGMRLPEGR
FT                   GWHLAFRFVGERVWAFSPEGPAAEDAFPRDVTAALGARVRREGNTLTLTTAAPTPRRFS
FT                   LYGMTGVYDPFSETGWRALRTEPAPWSFSSTEQTVNVLDVLTDAYAQQRAAIDQGVLPE
FT                   IRAPVIREGWLLVAGAGVVVALLGLAARLSVRPDAPTEAPTDTPTDTPTPPTPARVRPR
FT                   VLVVRRPEAPAPQPPPTADTPDEPAAELEEAHAEPQAV"
FT   sig_peptide     complement(478978..479034)
FT                   /locus_tag="Trad_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(479036..480358)
FT                   /locus_tag="Trad_0434"
FT   CDS_pept        complement(479036..480358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0434"
FT                   /product="protein of unknown function UPF0052 and CofD"
FT                   /note="COGs: COG0391 conserved hypothetical protein;
FT                   InterPro IPR002882:IPR010119; KEGG: dge:Dgeo_0722
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   UPF0052 and CofD; SPTR: B7A8D5 Putative uncharacterized
FT                   protein; PFAM: Uncharacterised protein family UPF0052;
FT                   TIGRFAM: conserved hypothetical protein, cofD-related"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13571"
FT                   /db_xref="GOA:D7CS39"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS39"
FT                   /protein_id="ADI13571.1"
FT                   /translation="MARLDFRRISTARLWLTPGMGVKRHVVVVALGLCVLMTGASLGVL
FT                   WLRSDGAYPYRVLRPLEAVLRASWWNAWGGWVALALLTVGLVLAVWAIVRLNRSLLSNW
FT                   MPKPKDAAILLHRRVSLAKGPRIVAFGGGSGLSNLLRGLRHYTSNITAVVSVSDDGGSS
FT                   GRLREAFGIPAPGDLTDCLAALSDNELHVSRLLEHRYARGEELRGHTFGNLLITTLTEV
FT                   EGDFAQAVRVLNSLLNICGAVYPVTTAATVLKVRKRSGAVVCGESNVRNVPGAVAEVTI
FT                   EPADPELVPDVGLAISAADLIVLGPGSLFTSTLPPLLVPGSRAAVLAATAPVVYVCNVM
FT                   TEAGETDGFSAWDHVEAIYRHLGRYPDWVVVNTAPVNAERLERYRAEGAEVVAFDPAPF
FT                   EAAGIQVAALDLLSGGAQAGHDSERLARWLYAFSKNLKITA"
FT   sig_peptide     complement(480296..480358)
FT                   /locus_tag="Trad_0434"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(480351..481274)
FT                   /locus_tag="Trad_0435"
FT   CDS_pept        complement(480351..481274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1660 P-loop-containing kinase; InterPro
FT                   IPR005337; KEGG: ddr:Deide_09390 hypothetical protein;
FT                   PFAM: conserved hypothetical protein; SPTR: C1D1U3 UPF0042
FT                   nucleotide-binding protein Deide_09390; PFAM: P-loop ATPase
FT                   protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13572"
FT                   /db_xref="GOA:D7CS40"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS40"
FT                   /protein_id="ADI13572.1"
FT                   /translation="MRFVVLTGLSGAGRTTALAALEDLGYFTADNLPPALWSALVEQAQ
FT                   TRGREGEAARLAVGVGIRTEAFLDRLPEALAQLQARGIRPEIVFLDASNETLIRRYNFT
FT                   RRTHPLGYAPLIQDIAKEREVLGELRSVADTVLDTSNFSARALTEELWARFGADRRFRL
FT                   RLTSFGFKRGVPIDADNVFDLRSLPNPYYDPALRVKDGRDADVAAYVFSAEGMAFYTEL
FT                   REFVRLLAGRALVTGRSSYTVALGCTGGQHRSVAFAERLKHDLAEAFATYAEHRDLAQA
FT                   LAEHAPAAGAPESGAQGADTAQVNRG"
FT   sig_peptide     complement(481218..481274)
FT                   /locus_tag="Trad_0435"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(481324..481986)
FT                   /locus_tag="Trad_0436"
FT   CDS_pept        complement(481324..481986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0436"
FT                   /product="Sporulation domain protein"
FT                   /note="InterPro IPR007730; KEGG: mxa:MXAN_3502 adventurous
FT                   gliding motility protein AgmI; PFAM: Sporulation domain
FT                   protein; SPTR: Q1D6M7 Cell division protein; PFAM:
FT                   Sporulation related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13573"
FT                   /db_xref="GOA:D7CS41"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS41"
FT                   /protein_id="ADI13573.1"
FT                   /translation="MRAALCCFCFALGLAWAQPPSGAFALQVFAFGDPAHAQRVAERLR
FT                   TYGFDAYTETPPGSRWVQVRIGCFGARADAEGLLADVRARVSADALIVPFSPGAGASVC
FT                   AVRELGFIPPPRWELAHSGAERVSFRVGDPPRYLVFDGRWRVAQSDAETHAPSAGLPAG
FT                   TLHAHYRATRSRGRPLVRADLAGGSLLIAAGELLWTSRGAAVVQLGQEVFALRLVLP"
FT   sig_peptide     complement(481897..481986)
FT                   /locus_tag="Trad_0436"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(482038..482691)
FT                   /locus_tag="Trad_0437"
FT   CDS_pept        complement(482038..482691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0437"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="COGs: COG0118 Glutamine amidotransferase; InterPro
FT                   IPR000991:IPR016226:IPR017926:IPR010139; KEGG: dra:DR_0426
FT                   imidazole glycerol phosphate synthase subunit HisH; PFAM:
FT                   glutamine amidotransferase class-I; SPTR: Q9RX89 Imidazole
FT                   glycerol phosphate synthase subunit hisH; TIGRFAM:
FT                   imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit; PFAM: Glutamine amidotransferase
FT                   class-I; TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13574"
FT                   /db_xref="GOA:D7CS42"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS42"
FT                   /protein_id="ADI13574.1"
FT                   /translation="MLRLALIDYGAGNLHSVHKALAHAGATSSVPVAVEITSDPEVAAR
FT                   ADALVLPGQGHFRQVMEAFLASGFEPVVRRHLGAERPFLGICVGLQLLMRTSEEAPGVP
FT                   GLGVLAGDVRRFPKGVSVPQMGWNQITKEGDPPLLASVPDGAFVYFANSYYVAFDDPSV
FT                   PGARTHYGGVSFKSAVSHAHLHATQFHPEKSQEVGIRVLRNFCALAARAHRGAP"
FT   gene            complement(482691..483290)
FT                   /locus_tag="Trad_0438"
FT   CDS_pept        complement(482691..483290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0438"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="COGs: COG0131 Imidazoleglycerol-phosphate
FT                   dehydratase; InterPro IPR020565:IPR000807:IPR020568; KEGG:
FT                   dra:DR_0424 imidazoleglycerol-phosphate dehydratase; PFAM:
FT                   imidazoleglycerol-phosphate dehydratase; PRIAM:
FT                   Imidazoleglycerol-phosphate dehydratase; SPTR: Q9RX91
FT                   Imidazoleglycerol-phosphate dehydratase; PFAM:
FT                   Imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13575"
FT                   /db_xref="GOA:D7CS43"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS43"
FT                   /protein_id="ADI13575.1"
FT                   /translation="MAEPAETHRSADVERRTAETHLRVRLDLDAPAGGRAATGHGFLDH
FT                   MLEQLVRHGSFALEITGEGDLHIDPHHLAEDTGITLGQAFARALGDRRGVQRYADAWVP
FT                   MDETLAHVVVDLSGRPYLMFEPGGFEGDAGGFNVHHLRELLRGFCNHAGVTMHVRVLSG
FT                   LEVHHVCEAVVKAFARALREATRVVSDTLPSTKGVL"
FT   gene            complement(483283..484374)
FT                   /locus_tag="Trad_0439"
FT   CDS_pept        complement(483283..484374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0439"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="COGs: COG0079 Histidinol-phosphate/aromatic
FT                   aminotransferase and cobyric acid decarboxylase;
FT                   InterProIPR001917:IPR004839:IPR015424:IPR015421:IPR 005861;
FT                   KEGG: dge:Dgeo_0118 aminotransferase, class I and II; PFAM:
FT                   aminotransferase class I and II; SPTR: Q1J263
FT                   Aminotransferase, class I and II; TIGRFAM:
FT                   histidinol-phosphate aminotransferase; PFAM:
FT                   Aminotransferase class I and II; TIGRFAM:
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13576"
FT                   /db_xref="GOA:D7CS44"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS44"
FT                   /protein_id="ADI13576.1"
FT                   /translation="MSVRPEVRAARSYHFTPRPAPIKLDQNESPYDLPEALKARALARL
FT                   AELPWNRYPELGAESLRAALAAYHGWDEAGVVVAGGSNVLIQAFVAACGLTQRVLSVAP
FT                   TFSVYSDQARLLGAPLTEVPLAAGFALPVEALRRELQRGPGVLFLANPAAPTGNAFAEA
FT                   DVRALFEAAGTWTVVLDEAYHQFAERDLLPLVRAHPNAASLRTLSKAFGLGGVRLGYAL
FT                   TSPDLAREVQKLLLPFSVSALQLAVGLTVLEAPEYVAARAKEVRLERERLQRGLEALPG
FT                   VEVFPSQTNFLLFRVGDAAAFFDHLLGAGVLVRRQDHLPGLAGCLRVSVGTPAENGAFL
FT                   AAARAAAAALGHPAEAALEGTRG"
FT   gene            complement(484465..486687)
FT                   /locus_tag="Trad_0440"
FT   CDS_pept        complement(484465..486687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0440"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="InterProIPR013105:IPR001440:IPR019734:IPR013026:IPR
FT                   011990; KEGG: cyp:PCC8801_1300 TPR repeat-containing
FT                   protein; PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; SPTR: B7K3M3 TPR
FT                   repeat-containing protein; PFAM: Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13577"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS45"
FT                   /protein_id="ADI13577.1"
FT                   /translation="MKRAPLLQLFALLALAAPLAWAQPPAHEGAVDRLVVLAFDADETD
FT                   SPYRLGLATGLQRALNVIDGVYAPPVGDTLLVAQRAEAQGTLDTATFAEAFGARALVSG
FT                   LVGLSGDGEGLVIDLVFAGPDDAVRRVPVSGPADNPAALLASVVEAVVTELELTLSADD
FT                   EAQVAAVVAQTPSLASLGAVGEAALGLEARDTPELQAAAERDAGSSWVLSERAEALAAA
FT                   GELEPALAASLAAIEAAPEDVEALVKRGVVLAAAGDAATAREAFAAALALNPAHAVALA
FT                   GSARFAEPEAARAALTRALKAYPRYAAAYLELAALQRRTDDAEGALITLREAVERVPES
FT                   ASLHAALIGELVRRGEGDEALAVLEARLAADPDPSAYALASALGEAQSARALEILREGR
FT                   QRYPQDAALALAEAEVLRGTGNLEAAEAVLQEALDAAPTNPELANQLAITQAQAGRTDE
FT                   ARATLEAALAQNPQARGVLERNLAQLLLEAGQNEAAIGVLEPLLARDAGDPELYTLYGL
FT                   ALGGAGRFDQALNALDEALRLAPTSQDAQNARRLVEQNQRLTGAERLAFDPDVAAVFGA
FT                   GLSALQADELAAAQREFDRAAELQADVADEAGAEAGTIAFYQGYARQLQGDLRGAVEHY
FT                   ERALEGLPESATVLNNAGFAYFRLGRFDRALDYLTRATQADPDNSEAQLNLGLVLFDLG
FT                   RFAQAVAPLERALERNPDLAELRVDPGDGEPLLLPELVDQARQSAQ"
FT   sig_peptide     complement(486622..486687)
FT                   /locus_tag="Trad_0440"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(486808..487215)
FT                   /locus_tag="Trad_0441"
FT   CDS_pept        complement(486808..487215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0441"
FT                   /product="cytidine deaminase"
FT                   /note="COGs: COG0295 Cytidine deaminase; InterPro
FT                   IPR016192:IPR002125:IPR016193:IPR006262; KEGG:
FT                   dge:Dgeo_1286 cytidine deaminase, homotetrameric; PFAM:
FT                   CMP/dCMP deaminase zinc-binding; SPTR: Q1IYV2 Cytidine
FT                   deaminase, homotetrameric; TIGRFAM: cytidine deaminase;
FT                   PFAM: Cytidine and deoxycytidylate deaminase zinc-binding
FT                   region; TIGRFAM: cytidine deaminase, homotetrameric"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13578"
FT                   /db_xref="GOA:D7CS46"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS46"
FT                   /protein_id="ADI13578.1"
FT                   /translation="MNLPPEPPADLLEAARRAHASAYAPYSGFHVGAALRAPSGAIYAG
FT                   ANVENASYGLSRCAEQSAVQALVSAGERTFSELVVYTTAPEPASPCGACRQVLFEFSED
FT                   ATVYLVNDRGTVRRWRVAELLPGGFRLRAPR"
FT   gene            complement(487236..487547)
FT                   /locus_tag="Trad_0442"
FT   CDS_pept        complement(487236..487547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0442"
FT                   /product="diacylglycerol kinase"
FT                   /note="COGs: COG0818 Diacylglycerol kinase; InterPro
FT                   IPR000829; KEGG: dge:Dgeo_1274 diacylglycerol kinase; PFAM:
FT                   diacylglycerol kinase; SPTR: Q1IYW4 Diacylglycerol kinase;
FT                   PFAM: Prokaryotic diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13579"
FT                   /db_xref="GOA:D7CS47"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033717"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS47"
FT                   /protein_id="ADI13579.1"
FT                   /translation="MGAVWRTEGNFRIQVLGAALALGVGLAVGAELVPLFLVCALVLAL
FT                   ELVNSALESTLDLVSPEFHPLVKRAKDAAAGAVLVAALFAVLVGLWVLGPPLWRVVFG"
FT   sig_peptide     complement(487458..487547)
FT                   /locus_tag="Trad_0442"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(487577..488020)
FT                   /locus_tag="Trad_0443"
FT   CDS_pept        complement(487577..488020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0443"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="COGs: COG0319 metal-dependent hydrolase; InterPro
FT                   IPR020549:IPR002036; KEGG: dge:Dgeo_1273 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0054; SPTR:
FT                   C1XQ66 Putative uncharacterized protein; PFAM:
FT                   Uncharacterized protein family UPF0054; TIGRFAM: conserved
FT                   hypothetical protein TIGR00043"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13580"
FT                   /db_xref="GOA:D7CS48"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS48"
FT                   /protein_id="ADI13580.1"
FT                   /translation="MIEILAERPYPFRKRLQAVVTALKAELGAGDKELTIVLVDDPKIR
FT                   ELNRAHRGEDAPTDVLSYPLAEPDDAGFPEVPHLGDIVISLDTAARQAAAQGHTLELEV
FT                   VTLAAHGLTHLLGFDHPTEEAWTTFRQNQARAAALLERSRERA"
FT   gene            complement(487980..489953)
FT                   /locus_tag="Trad_0444"
FT   CDS_pept        complement(487980..489953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0444"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG1480 membrane-associated HD superfamily
FT                   hydrolase; InterPro IPR006674:IPR006675:IPR003607; KEGG:
FT                   aac:Aaci_1984 7TM receptor with intracellular metal
FT                   dependent phosphohydrolase; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region; SPTR: C8WY34 7TM receptor with
FT                   intracellular metal dependent phosphohydrolase; TIGRFAM:
FT                   metal dependent phophohydrolase; PFAM: 7TM-HD
FT                   extracellular; HD domain; 7TM receptor with intracellular
FT                   HD hydrolase; TIGRFAM: uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13581"
FT                   /db_xref="GOA:D7CS49"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR011621"
FT                   /db_xref="InterPro:IPR011624"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS49"
FT                   /protein_id="ADI13581.1"
FT                   /translation="MTATSAPKAPRRPRRDLPPRRLFWSALLFAATLAGLLYSVYGSSP
FT                   APALRVGDPSPQTFRAPFDLVAVDRVATERARSAARAQIGVLYSTSPERQRLVLSELAA
FT                   AELPERVRRFLTEAYSHPDGVSEAELPNLIREAAALAGDGEAVAATLQRLLISTTEPSA
FT                   RLTEAARAAAAESVEPVMRVLEAGDVIVRRGDPLTDDALRVLEAAGLYTPRSDRLEQSL
FT                   VLALVCALLALFLTLPLLHFYRSLRARLTVGQLAFLVLLWALGLVLQRLAFLASPYLLF
FT                   IAFLPLLVAVLTSERAAFVLAVWLAVITALLSPSDTPFHPLAALTGGTTAALFARTFHA
FT                   RPALLITGLLSGAVAAVTFALGSALVGGLGNLGALGALAWLLGGGVLAGMLALAALPLA
FT                   ESNLGFLTEFRLLELTSPSNPLLQKLLLEAPGTYQHSLIISNLVAQAVANIGGDPLLAR
FT                   VGALYHDVGKLRRPQFFTENQFAGENPHDRISPHLSYLIITSHVRDGVELLREYGLPAA
FT                   LEPFVTEHHGTTVLAYFYKRALESSERVDELNFRYAGPRPQSRETAVLMLADAVESASR
FT                   SLAEPTQGSVRAMIDRLIEQRLQDDQLAQSPLNFHDLEVIASTFERLLTAVLHRRVSYP
FT                   SGEELDRLKRDRDSRRASVPLP"
FT   sig_peptide     complement(489828..489953)
FT                   /locus_tag="Trad_0444"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(490119..491009)
FT                   /locus_tag="Trad_0445"
FT   CDS_pept        complement(490119..491009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0445"
FT                   /product="PhoH family protein"
FT                   /note="COGs: COG1702 Phosphate starvation-inducible protein
FT                   PhoH predicted ATPase; InterPro IPR003714; KEGG:
FT                   tth:TTC0684 PhoH protein; PFAM: PhoH family protein; SPTR:
FT                   C1XJH1 Phosphate starvation-inducible protein PhoH,
FT                   predicted ATPase; manually curated; PFAM: PhoH-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13582"
FT                   /db_xref="GOA:D7CS50"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS50"
FT                   /protein_id="ADI13582.1"
FT                   /translation="MMLFGHNDENLKLLRSKLSAKVVARGDELRLSGEELAVAEAERTF
FT                   SALLASIRRGEKISLTELEHTPLETLVSDAGPVPEGAAERLPRRARPKTAGQRAYVSAI
FT                   EHNEITFGVGPAGTGKTYLAVAMAVQALKERRIKRIVLTRPAVEAGEKLGFLPGDLQAK
FT                   IDPYLRPLYDALYDMLDGDKSEQLFQNGTIEVAPLAFMRGRTLNDAFIILDEAQNTTPE
FT                   QMKMFLTRMGFNSRVVVTGDITQTDLPQNVESGLRVAERILRGIEGIRFVTFTEADVVR
FT                   HPLVARIVKAYDQYT"
FT   gene            complement(491048..491602)
FT                   /locus_tag="Trad_0446"
FT   CDS_pept        complement(491048..491602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0446"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SH3, pleckstrin-like and PDZ/DHR/GLGF
FT                   domain-containing protein; SPTR: A9UNP0 SH3,
FT                   pleckstrin-like and PDZ/DHR/GLGF domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13583"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS51"
FT                   /protein_id="ADI13583.1"
FT                   /translation="MNLPNIPFELLLIALFFLLPALGNLLGKRPPPRPPAGGRPREGTN
FT                   PDAAPAARPPGDDALQRRLEEARRRVQEAAAQERSRRGGRAPAPPPSAPPRAPVPQPPS
FT                   APPRRPSDERPATPPSPPLEVAPAMRVQRLEAPKRVTITSRAGRGPFTDPTATLQGFIW
FT                   HQVLSPPRAKRPATLSRRRRR"
FT   sig_peptide     complement(491459..491602)
FT                   /locus_tag="Trad_0446"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(491599..492576)
FT                   /locus_tag="Trad_0447"
FT   CDS_pept        complement(491599..492576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0447"
FT                   /product="band 7 protein"
FT                   /note="COGs: COG4864 conserved hypothetical protein;
FT                   InterPro IPR001107; KEGG: ttj:TTHA1048 hypothetical
FT                   protein; PFAM: band 7 protein; SPTR: Q72JT2 UPF0365 protein
FT                   TT_C0686; PFAM: SigmaW regulon antibacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13584"
FT                   /db_xref="GOA:D7CS52"
FT                   /db_xref="InterPro:IPR022853"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS52"
FT                   /protein_id="ADI13584.1"
FT                   /translation="MDFGVLIIAGIVVLFFIVLFSFVPVGLWISAVAAGVRVSLTSLVA
FT                   MRLRRIPPNRIILPLIKADKAGIEVTQDLLEAHYLAGGNVDRVVDALIAADKARIALPF
FT                   DRAAAIDLAGRDVLDAVKVSVNPRVITTPSIAAVAKDGIELIGTARVTVRANLERLVGG
FT                   AGEDTIIARVGEGIISSIGSSENHKQVLESPDIISKAVLERGLDSGTAFEILSIDIADV
FT                   NVGKNIGATLQTDQAEADKRVAQAKAEERRAMAVAVEQENRAMVEAMRAKVVEAEAEVP
FT                   RAIAEAFRSGNLGVMDYYNLENLQADTRMRGNIGRAAGGGEDGA"
FT   sig_peptide     complement(492475..492576)
FT                   /locus_tag="Trad_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(492650..494170)
FT                   /locus_tag="Trad_0448"
FT   CDS_pept        complement(492650..494170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0448"
FT                   /product="protein of unknown function DUF107"
FT                   /note="COGs: COG1030 Membrane-bound serine protease (ClpP
FT                   class); InterPro IPR002810; KEGG: tth:TTC0687 putative
FT                   protease/transporter; PFAM: protein of unknown function
FT                   DUF107; SPTR: C1XQ70 Membrane-bound serine protease (ClpP
FT                   class); PFAM: Clp protease; NfeD-like"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13585"
FT                   /db_xref="GOA:D7CS53"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS53"
FT                   /protein_id="ADI13585.1"
FT                   /translation="MGYTRETMTYLVPRTRVFRWVVLALLLGGALLGTGGVAWAQSPSA
FT                   VWIVPIDATITTATARYVEDRLARANAEGPLAVVFTIDTPGGSVEAAERISSAILRARV
FT                   PTIAVVEQAISAGALVAMSAEQVAMLPGSAIGAATAINALTGEAAPEKISSVWRGRFRS
FT                   VAEARGRNARVAEGMVSESIEIPGLSTAQELITLSAAQAVEYDIADLQASSLTDALRQL
FT                   GYGDVATETLAPSPAERFASALANPLLAAVLLAVGLIGLAVEIFTPGFGIPGAVGLVAL
FT                   LLFFGGSFLGSPPGTLDLVLLVVGLLLIAVEVFVLPGFGVFGLLGFAAVAWGVARIFQG
FT                   DALTMLGYTTIIGGALLALALWLLPNSRFSRPLTLSTRLSGGLGAQTPGLPLEATPALA
FT                   ELRGQRGVTLTDLRPTGVARFGERRVDVLSEGGFVPRGSAVEVLRVEGNRVTVREVTGS
FT                   AGTPSGVDLEVTGSAGTPSGADLEVTGSAGTPSGVDLEATDPAPRAEA"
FT   sig_peptide     complement(494051..494170)
FT                   /locus_tag="Trad_0448"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            494367..494612
FT                   /locus_tag="Trad_0449"
FT   CDS_pept        494367..494612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0449"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swd:Swoo_4091 hypothetical protein; SPTR:
FT                   B1KH35 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13586"
FT                   /db_xref="GOA:D7CS54"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS54"
FT                   /protein_id="ADI13586.1"
FT                   /translation="MLFLAVICFVLAGFGVLWTVRSFATKDKTPTERADLDKAGGIIFT
FT                   LVSLAVGGVALYLYASGFLAPDPGLDPSTALAQLLA"
FT   sig_peptide     494367..494438
FT                   /locus_tag="Trad_0449"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(494629..494877)
FT                   /locus_tag="Trad_0450"
FT   CDS_pept        complement(494629..494877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0450"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; K10601 E3
FT                   ubiquitin-protein ligase synoviolin; SPTR: C5M3H2 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13587"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS55"
FT                   /protein_id="ADI13587.1"
FT                   /translation="MKRLSHDALCWWWSLPAAKRLDIELSCLEEGVDLTDIIYLLSGQV
FT                   FDDLQAAPPRAHPGSGEALAPLGAGALPLVERGLEGS"
FT   gene            complement(494979..496493)
FT                   /locus_tag="Trad_0451"
FT   CDS_pept        complement(494979..496493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0451"
FT                   /product="Carbohydrate kinase, FGGY"
FT                   /note="COGs: COG1070 Sugar (pentulose and hexulose) kinase;
FT                   InterPro IPR018483:IPR018484:IPR018485; KEGG: gka:GK1941
FT                   gluconokinase; PFAM: Carbohydrate kinase, FGGY-like; SPTR:
FT                   Q5KYL0 Gluconokinase; PFAM: FGGY family of carbohydrate
FT                   kinases, N-terminal domain; FGGY family of carbohydrate
FT                   kinases, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13588"
FT                   /db_xref="GOA:D7CS56"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS56"
FT                   /protein_id="ADI13588.1"
FT                   /translation="MKGAAPQEVCIGLDAGTTGCKAVALSAAGRVCAEASATYPLLSDT
FT                   AGAAEQDAADLWRAVQAALRALAEGLGGARPVALALSGAMHSLLALSGRGEALGRATTW
FT                   ADTRAATALAELRRENPAGLYEATGCPLVAPYHPARLRWLRAAEPAVFGRAAHFVSLKD
FT                   WLGYQLTGALRTDRGYASTTGLLELRTGRWSDLALELAGVTAARLPELAEPTDPLGPLR
FT                   AEVARACGLPPGLPVFVGSSDGALANFGAGVRSPGSTALTVGTSGAVRRVTAAPLLDPE
FT                   ARTWCYRFFAGRFLAGGAVSNGGLTLEWVRRTLYGELPKAEGFARLLDEAAAAKAEGLM
FT                   VLPYLTGERSPHYNAALRGAVFGLSEAHTRADFARAALEGVAFCLKDVWEVLGTSAQGA
FT                   APPQTAERPVQLTGGLSRSPFWAQLVADVLGTPLEVVGVADASAVGAAALAWAAQCGLP
FT                   LGRAPHPAAARPRRFTPREAERRRYDAAFARFRALYTAVAEDAARS"
FT   sig_peptide     complement(496422..496493)
FT                   /locus_tag="Trad_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            496695..497369
FT                   /locus_tag="Trad_0452"
FT   CDS_pept        496695..497369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0452"
FT                   /product="PKD domain containing protein"
FT                   /note="InterPro IPR000601; KEGG: rbi:RB2501_13489 putative
FT                   secreted protein; PFAM: PKD domain containing protein;
FT                   SMART: PKD domain containing protein; SPTR: A4CKE5 Putative
FT                   secreted protein; PFAM: PKD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13589"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS57"
FT                   /protein_id="ADI13589.1"
FT                   /translation="MATSRLLASRRVATRRVASVALVGLFLGACGPLPGGSGALPDPVI
FT                   ELEAENARGEWPLVVTLTARTAELARPVTAYRWDFGAGEAIGAPTEGGARRTVVYTEAG
FT                   TYTARVEVVAGAQTGEASTQIEVLPRSAPRDINNLPPTVTLEADVTEGSAPLEVTLSAT
FT                   AEDPNADALTTTLFFGDGTRTLASEATHVYTEPGTYVATAVVTDGRGGVAAADVVITVA
FT                   SP"
FT   sig_peptide     496695..496811
FT                   /locus_tag="Trad_0452"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(497547..498296)
FT                   /locus_tag="Trad_0453"
FT   CDS_pept        complement(497547..498296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0453"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="COGs: COG0548 Acetylglutamate kinase; InterPro
FT                   IPR001048:IPR011148:IPR004662; KEGG: dge:Dgeo_0079
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; PRIAM: Acetylglutamate kinase; SPTR: Q1J2A2
FT                   Acetylglutamate/acetylaminoadipate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: Amino acid kinase family;
FT                   TIGRFAM: acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13590"
FT                   /db_xref="GOA:D7CS58"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS58"
FT                   /protein_id="ADI13590.1"
FT                   /translation="MPTVIKYGGSAMTDPEVRRQMAQRLAALPETVVVHGGGPFIAQAL
FT                   RDAGLKSHFVRGLRVTDAPSLAVIERTLTRLSKVLAQEIGDAVGLQGRDARLLVAEPLG
FT                   AELGFVGEVVEVNRALLTGLLGLGLTPVVACLAATPDRRGVLNVNADSAAGAVAGALAA
FT                   PVVFLSDVPGVLEDPAVPESRLATLSARDIAARIADGRIAGGMIPKVEAALGALRAGAP
FT                   VAIIADGRVPEQLEASLRGEVGTRVVR"
FT   gene            498385..499806
FT                   /locus_tag="Trad_0454"
FT   CDS_pept        498385..499806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0454"
FT                   /product="Phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="COGs: COG1109 Phosphomannomutase;
FT                   InterProIPR016066:IPR005841:IPR005844:IPR005845:IPR
FT                   005846:IPR005843:IPR016055; KEGG: dra:DR_A0047
FT                   phospho-sugar mutase, putative; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase; PRIAM:
FT                   Phosphoglucosamine mutase; SPTR: C1XTB1 Phosphomannomutase;
FT                   PFAM: Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain II;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain III; Phosphoglucomutase/phosphomannomutase,
FT                   C-terminal domain; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13591"
FT                   /db_xref="GOA:D7CS59"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS59"
FT                   /protein_id="ADI13591.1"
FT                   /translation="MDTLVFGTDGWRDVIGDKFTFLNVARAAQAYADFLNAQGTPSAVV
FT                   GYDTRFNGALFARRVAEVLAANGIDTRLSASYLPTPALSFAVKHYGVGGGVMLTASHNP
FT                   PPYSGFKLKGPYGGTATEDIYRAVAARVATVSEREVRRDGGAKRIETFDVRAAYYDALA
FT                   QLVDLEALRRFDGTLVHDAMGGAAAGWLTGFVAHAELPWRLVALRGEPTPTFYGVNPEP
FT                   LPQNLAATMAYMKEQGALFASATDGDGDRLGLVLPGGTFFNSHQIFALLLNMLAERGGT
FT                   GRVVKTFTVSRLIERLAEKRGLAVQETPVGFKYIVDAMLGGDVLIGGEESGGIGVAGHI
FT                   PERDGLANTLLVLEAVVKAGRTVSELFAELEREAGWRHAYDRLDLHLSGNALKDAVLGA
FT                   LASPPDTFAGRALERVETLDGVKLNLSGNAWLLFRASGTEPVLRIYCEAPSAGEVAEIL
FT                   SSAQRFVSGLEAPGS"
FT   sig_peptide     498385..498474
FT                   /locus_tag="Trad_0454"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(500091..500663)
FT                   /locus_tag="Trad_0455"
FT   CDS_pept        complement(500091..500663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0455"
FT                   /product="chromosome segregation ATPase-like protein"
FT                   /note="KEGG: rxy:Rxyl_0656 chromosome segregation
FT                   ATPases-like protein; SPTR: A1CIS8 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13592"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS60"
FT                   /protein_id="ADI13592.1"
FT                   /translation="MKRCSVGVLVAATLFLGACDNQLSAESLARERQSLQREVNALRAE
FT                   AESLRAANDELMAQLSTITVLLETQREELRSRLDAFERSAERVQARASELGRSIESAQS
FT                   ATDDAQRVADRALEQAAREELEGALEARRQAPESEPATEPAVTEPAMTEPAMSEPAEGT
FT                   HAAPEQTAPIPSAPATPEPVAQPGGGH"
FT   sig_peptide     complement(500589..500663)
FT                   /locus_tag="Trad_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(500867..501931)
FT                   /locus_tag="Trad_0456"
FT   CDS_pept        complement(500867..501931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0456"
FT                   /product="peptidase M24"
FT                   /note="COGs: COG0006 Xaa-Pro aminopeptidase; InterPro
FT                   IPR001131:IPR001714:IPR000587:IPR000994; KEGG: ttj:TTHA1068
FT                   proline dipeptidase; PFAM: peptidase M24; creatinase; SPTR:
FT                   Q5SJE6 Proline dipeptidase; PFAM: Metallopeptidase family
FT                   M24; Creatinase/Prolidase N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13593"
FT                   /db_xref="GOA:D7CS61"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS61"
FT                   /protein_id="ADI13593.1"
FT                   /translation="MLAPVWEGLRAAGADALLVTHPANVRYLSGFSSPEDGRVLLSDKG
FT                   LQLWTDGRYIQQAREESRLEVVITDTGSTWVEQLCTHVKDVLGGPRLAFEAESTPYALF
FT                   AELREALGSEPVPTKGLVSELRLVKSPAEIATLREAARITDEAFAHILDVIRPGLREVD
FT                   VALELERFMRRAGAEGASFAIIVASGVRSAMPHGVASSKPLARGELVTLDFGAKVAGYH
FT                   ADMTRTVALGEVSEAHERLYDAVLRAQEAALAAVAPNAEGRAVDAVARDSLAAAGLAEG
FT                   FTHGLGHGVGLEVHERPRLSRLSQDTLRPGMVVTVEPGVYRPGDAGVRIEDLVVVTDAG
FT                   CERLSGSPKALLRL"
FT   sig_peptide     complement(501884..501931)
FT                   /locus_tag="Trad_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(501925..502677)
FT                   /locus_tag="Trad_0457"
FT   CDS_pept        complement(501925..502677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0457"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="COGs: COG0149 Triosephosphate isomerase; InterPro
FT                   IPR020861:IPR000652:IPR013785; KEGG: pth:PTH_2721
FT                   triosephosphate isomerase; PFAM: triosephosphate isomerase;
FT                   PRIAM: Triose-phosphate isomerase; SPTR: A5CYN7
FT                   Triosephosphate isomerase; TIGRFAM: triosephosphate
FT                   isomerase; PFAM: Triosephosphate isomerase; TIGRFAM:
FT                   triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13594"
FT                   /db_xref="GOA:D7CS62"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS62"
FT                   /protein_id="ADI13594.1"
FT                   /translation="MKPLIAANWKMHKLPSEVTAWASDFEAALADTDRSRFDLAICAPF
FT                   THLSALAAALDGTGVAVGAQDVSSHAEGAYTGEVSAAMLKDLGVRYVIVGHSERRAYHH
FT                   EDDALVRGKLERVLESGMTPILCVGETLQEREGGRAREVTLGQLRGALEGVALGNAGGL
FT                   VVAYEPVWAIGTGKTATDADAQEMCGAIRAALKELLPELGGAVRILYGGSMKGDNAAGL
FT                   LAQPDIQGGLVGSASLDARSLAQIAAAC"
FT   gene            complement(502833..503144)
FT                   /locus_tag="Trad_0458"
FT   CDS_pept        complement(502833..503144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0458"
FT                   /product="Bor family protein"
FT                   /note="InterPro IPR010438; KEGG: eca:ECA2067 lipoprotein;
FT                   PFAM: Bor family protein; SPTR: Q1ZW04 Putative
FT                   uncharacterized protein; PFAM: Bor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13595"
FT                   /db_xref="InterPro:IPR010438"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS63"
FT                   /protein_id="ADI13595.1"
FT                   /translation="MKRPSAVLFAGVLTVTLLAGCATQSFDINPPLTPTSPGQATVEES
FT                   QPFFVGGVSQSTLIDAAAVCGGADRVARVETETTVLDSILSFVTGGIYSPRTARVYCL"
FT   gene            complement(504067..506520)
FT                   /locus_tag="Trad_0459"
FT   CDS_pept        complement(504067..506520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0459"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="COGs: COG0466 ATP-dependent Lon protease;
FT                   InterProIPR001412:IPR001984:IPR003111:IPR003959:IPR
FT                   008269:IPR020568:IPR004815:IPR003593; KEGG: ttj:TTHA1111
FT                   alternative ATP-dependent protease La (Lon protease); PFAM:
FT                   peptidase S16 lon domain protein; AAA ATPase central domain
FT                   protein; PRIAM: Endopeptidase La; SMART: peptidase S16 lon
FT                   domain protein; AAA ATPase; SPTR: Q5SJA3 Alternative
FT                   ATP-dependent protease La (Lon protease); TIGRFAM:
FT                   ATP-dependent protease La; PFAM: ATP-dependent protease La
FT                   (LON) domain; ATPase family associated with various
FT                   cellular activities (AAA); Lon protease (S16) C-terminal
FT                   proteolytic domain; TIGRFAM: ATP-dependent protease La"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13596"
FT                   /db_xref="GOA:D7CS64"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS64"
FT                   /protein_id="ADI13596.1"
FT                   /translation="MALQSDIFEAPIPVCPVRGSVLYPTMVMPIDAGRAVSIRAINAAL
FT                   DRNRTILIVSQRDRETEEPTGSDLFTVGTACNILRMKRNPNGSIQMLVQAFARVRVKRY
FT                   TTGELIEAEVEPFEVPLGNAVTLEAAFRELKEKFSDIIEGGVRNIQPEVAQFVMNLEDA
FT                   GQFADYVAYHLDFRLEDKQAILEAETVEARVRRVLVLIDTEIELAETQRRVQREVKDEI
FT                   DRNQREYFLREQIKALQRELSGSDDGDDEVETFRAKLEELELPEEAMKEAERELNRLAR
FT                   MHPDSAEASVIRTYLTTLTELPWNERSQDRLDIEVAKQTLEEDHYGLEKIKDRILEYLA
FT                   VRKLKADRAARGELDQAEVNRGPILLFAGPPGVGKTSIAKSIAKALGREYVRISLGGAR
FT                   DESDIRGHRRTYIGSMPGRIIQGIRQAGTKNPVFLLDEIDKLGMSYQGDPSSALLEVLD
FT                   PAQNSGFVDHYLGVPFDLSEVLFIATANYAQNIPEALLDRMELLEFSSYIEQEKIEIAK
FT                   RYLLPRQIEENGLKPQQITISDGAIAKVITSYTREAGVRNLERTIGTLARKAARRIAEG
FT                   ESKRVRITERSLEAFLGPERFSPESEGEENLVGVATGMYYTPVGGDILFVETSVTKGKG
FT                   GLVLTGQLGDVMKESARAALTYARSNAERFGIPQEVLDNYEVHIHVPAGATPKEGPSAG
FT                   VAIAASLISALTGVPVRKDVAATGEITLRGRVLPIGGLKEKILGAKRAGIRHILFPEKN
FT                   LPDLGDIPAHLRRSLEFHPVAHLDRALDIFMVGGLAALEARGGGKSAPKKARRRRKEES
FT                   PAAQA"
FT   gene            506973..508796
FT                   /locus_tag="Trad_0460"
FT   CDS_pept        506973..508796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0460"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COGs: COG0018 Arginyl-tRNA synthetase;
FT                   InterProIPR015945:IPR005148:IPR008909:IPR009080:IPR
FT                   014729:IPR001278; KEGG: dge:Dgeo_1036 arginyl-tRNA
FT                   synthetase; PFAM: DALR anticodon binding domain protein;
FT                   arginyl tRNA synthetase domain protein; Arginyl-tRNA
FT                   synthetase, class Ic, core; PRIAM: Arginine--tRNA ligase;
FT                   SPTR: Q1IZJ9 Arginyl-tRNA synthetase; TIGRFAM: arginyl-tRNA
FT                   synthetase; PFAM: DALR anticodon binding domain; Arginyl
FT                   tRNA synthetase N terminal domain; tRNA synthetases class I
FT                   (R); TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13597"
FT                   /db_xref="GOA:D7CS65"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS65"
FT                   /protein_id="ADI13597.1"
FT                   /translation="MDVKIQLKAALERAVRALGTEAEVTVQAVPEGKAGDYGSPVAFGL
FT                   ARVLRKNPAAIAQELVERLELPAGVARAEAVGPYLNFHLDPGAFVRGVVEGELALPERG
FT                   KKVIVEHTSVNPNKEAHVGHLRNIVLGDAVARILRAAGYEVEVQNYIDDTGRQAAESLF
FT                   AVGYFGATYDGAEKYDHWLGKLYVRLTQAKETDAETIERGVSQTMHRLERGELRGEIER
FT                   VLRAQLETYHALGAEYDLLVWESDIVKSGFLARALEVLKRSEDVFTPSEGKYAGALVMD
FT                   VSKLIPGLEEPLVVLVRSDGNAMYVAKDIGTQFWKVGLFEGLRFRRFHRQPSGKPLYTS
FT                   APEGDLHPDGRTFAHADAVVNVIDTRQSHPQMIVKAALEMADAARGADASHHLAYEVVT
FT                   LEGQAMSGRKGITLAIDTVLAEAAKRARAVVEEKNPGLKAVDEVARQVGVGALRFAMLK
FT                   SEARRVIDFRWEQALSLQGDSAPYVQYAHARACSILRAACEAGVGESGAVWERLGPLEV
FT                   KLAQELARLPEIIGSAARDFAPHLVGQYCLDVATAWNAYYNHRGADGKPDTQVLKAEPG
FT                   LREARLALVRKVKETLATSLGLLGIEAPEEM"
FT   gene            complement(508811..509284)
FT                   /locus_tag="Trad_0461"
FT   CDS_pept        complement(508811..509284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_0665 hypothetical protein; SPTR:
FT                   C9Z019 PROBABLE TRANSMEMBRANE PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13598"
FT                   /db_xref="GOA:D7CS66"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS66"
FT                   /protein_id="ADI13598.1"
FT                   /translation="MDRIPAQGATRPHRTTVATYSVYADAQRAVDHLSDKGFPVERTAI
FT                   VAEGLRFVEQVTGRLNWGRVLLNGSGSGALTGVLIGLVFGLFSLVVPVLTFVLYGLIVG
FT                   AISGALFAAIGYGMTGGQRDFSSVRNMEAERYHVMVDDEVAAEAERLLAGMGR"
FT   gene            complement(509476..510465)
FT                   /locus_tag="Trad_0462"
FT   CDS_pept        complement(509476..510465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0462"
FT                   /product="von Willebrand factor type A"
FT                   /note="InterPro IPR002035; KEGG: cya:CYA_2093 hypothetical
FT                   protein; PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; SPTR: Q2JSY1 Putative
FT                   uncharacterized protein; PFAM: von Willebrand factor type A
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13599"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS67"
FT                   /protein_id="ADI13599.1"
FT                   /translation="MKRFWLPLVAVLALLGGCDRVQSIIDDVVTPADAVINGYTVERDA
FT                   NGDPTGNVALNVSALDSAGEPIAGRLSNPRATVTSVTPLPGLAAAQRYTATATITVDIT
FT                   VQEVINAVLNMDRSGSMRLNDPERLRVDAAKSFLERVTPEDRIAVMEFPGQSSGFRAST
FT                   LLQGFTSDKALLEAALDRVGQRGNTPIWDSLLDTLDLHAADEGGQGASRVVLLFTDGER
FT                   EGGQVAFGEALAAALESDVRVFTIGLGSDIDTAELQELAAETGGTFANVASAAELEELF
FT                   QRAFNAIRASGTITLSISPIPPPGSLVRGTLSFTVNGEDFTVDYAFTI"
FT   sig_peptide     complement(510397..510465)
FT                   /locus_tag="Trad_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(510625..513645)
FT                   /locus_tag="Trad_0463"
FT   CDS_pept        complement(510625..513645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0463"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="COGs: COG0277 FAD/FMN-containing dehydrogenase;
FT                   InterProIPR017900:IPR006094:IPR004113:IPR004017:IPR
FT                   017896:IPR016166:IPR016164:IPR009051:IPR016167; KEGG:
FT                   rca:Rcas_0560 FAD linked oxidase domain-containing protein;
FT                   PFAM: FAD linked oxidase domain protein; protein of unknown
FT                   function DUF224 cysteine-rich region domain protein; SPTR:
FT                   A7NGU3 FAD linked oxidase domain protein; PFAM: FAD binding
FT                   domain; FAD linked oxidases, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13600"
FT                   /db_xref="GOA:D7CS68"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS68"
FT                   /protein_id="ADI13600.1"
FT                   /translation="MTVPAPKAPAPLTPTPDPTAPEPDLARAYEELRASLEGEVRFDEA
FT                   ARVLYATDASPYEIKPYGVVLPKTREDVRRTLEVARRYRLPVLPRGGGTSLAGQTVGRA
FT                   LVVDVSKYLDRVLAFDEAARTVTVEPGVVRDNLNLFLKPYKLQFTPDVSTTNRANIGGI
FT                   VANNSAGTRSIKYGKAVDQVVAMTVLLADGTVTTFRDLDPDELQQKLRAPGLEGHIYRT
FT                   THRLVREHEAEIHARFPKVMRRVGGYNLDELTTGKPFNLAKLVAGSEGTLAFILDVTLK
FT                   LFPIPAYKCLALLHFDTLEKSLRAVQHINRHGPAAVETLDDTLLELGLENPNLAPLLSW
FT                   LQGRPAAVLMVEFDGESEAQMLAGLQSMQADPAVMELAYALHVAYGAQEQAEVWEVRKA
FT                   GLGVFNTIKGAAKPTPFIEDAAIPPEHLAEYIPAVAAICAKHGVRMVSYGHASVGVIHV
FT                   RPILDLKTREGLEAYRKISEETFALVRRFGGSWSGEHGDGLIRSYKNRELFGDTLYEAF
FT                   RELKRAFDPEGLMNPGKIVDAPPITENLRYGEGYTVLPIATHFDFSKDDGFMGAIEMCT
FT                   GVGACRKTTTGTMCPSYMVTRDEEHSTRGRANLLRDAMNGRLPGGLTSQEVYNALDLCL
FT                   ECKACKAECPSRVDMAKLKYEFLQHFYDDHGTPLSARALGHAAVVAPVGRFFAPLANAL
FT                   LPLAPVRWLMEKTAGIDRRRALPPYANASFHQWVRQREARREEERRALGAPAHAADKPK
FT                   VALFADTWTMYNEPEVGVAATRVLEALGFEVEHVPYGCCGRPQISKGLLREARARARKN
FT                   VAALHAYVARGVPVVGLEPSCVTAFQDDYRDLVPGEATEAVAAHVKMIDQFLAKAWTKG
FT                   DLEPGRVFRKGERHIMLHGHCQQRAIQGTSSTKAVLGWVSPDVFEVDSGCCGMAGSFGY
FT                   GHYDISMQIGERRLFPAVREHAGETVACGFSCRHQIRDGTGKRAKHLVELLAEALPESD
FT                   GDSSRSVPSSEACAELP"
FT   gene            complement(513936..515054)
FT                   /locus_tag="Trad_0464"
FT   CDS_pept        complement(513936..515054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0464"
FT                   /product="transcriptional regulator, GntR family with LacI
FT                   sensor"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000524:IPR001761:IPR011991; KEGG: gym:GYMC10_2719
FT                   transcriptional regulator, GntR family with LacI sensor;
FT                   PFAM: regulatory protein GntR HTH; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein GntR HTH; SPTR: Q2RGW9 Transcriptional regulator,
FT                   LacI family; manually curated; PFAM: Bacterial regulatory
FT                   proteins, gntR family; family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13601"
FT                   /db_xref="GOA:D7CS69"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS69"
FT                   /protein_id="ADI13601.1"
FT                   /translation="MTAPPAQGNNFAVDRSSQKPLHQQLCEHYRQLIEGGVLPVGSRLP
FT                   TELELMAKHGVSRGTVREALRGLHEAGLVRRTTKIGTVVQSPPQPAVSARRIIGVVFPQ
FT                   THDAFCLDIMKGVQTACRERGYHAAFGYSHFSSAVERAEVSRMRSAGFGGVLVLPHDDP
FT                   TLFRELVANTYPFVYIDQKFEAAPSDFVGVDNVSASFTVTEHLIGLGHRHIGFIHRNPS
FT                   LDQAPSTVKERYRGYRAALTAHAVPFESSWLVEIARNADPKAFLALTSQVDAVVAANDH
FT                   TALKFLDVATKAGVRVPEEIALVGFDDLPLAAEFALTTVAQPSREIGLRAAHLLIDRIE
FT                   GKGGPPQHVILPTHLVVRATCGQNLRASTKGR"
FT   gene            515314..516618
FT                   /locus_tag="Trad_0465"
FT   CDS_pept        515314..516618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0465"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006061:IPR006059; KEGG:
FT                   bcv:Bcav_3000 extracellular solute-binding protein family
FT                   1; PFAM: extracellular solute-binding protein family 1;
FT                   SPTR: C5BZR5 Extracellular solute-binding protein family 1;
FT                   PFAM: Bacterial extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13602"
FT                   /db_xref="GOA:D7CS70"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS70"
FT                   /protein_id="ADI13602.1"
FT                   /translation="MKLLKSLVLLSLSLFAAGQAQEVREVTFWTAHGEPDLSALRQIVD
FT                   NFNAEHDDIQVTLSQIPPGAETDVTRLMTAVRGGTGPDVYMLDRFIVAQRAADGLLQDL
FT                   SPYMDGEDVLANYLEFAREEAMLAGVPYALPFDTDARALYYNIDLLEEAGVDTSELDPE
FT                   NGPLTLARIQEIASMVDQKNAQGNFERMGFIPWHEQGWHYTYGFAFGGDFYDEVACQVT
FT                   PTDDNIVRAFEWIYDYAAQEGPQQVQTFRQAFTRPDLPPQQNPFIAGQLAMIITGDWMI
FT                   GNLERYAPDMNYGITYIPVPEEGDASVTWAGGWSMVMPQGAREPEAAFEFMKYIAGEPG
FT                   QRVYVQETRHMPTLTSLLDDAELFEGRHQFFRDLLPTARNRPPLPIGALYWDELTDAWE
FT                   RVYLNQQEPRAALEQVAARVQPQLEPFCAQLQAEN"
FT   sig_peptide     515314..515373
FT                   /locus_tag="Trad_0465"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            516726..517625
FT                   /locus_tag="Trad_0466"
FT   CDS_pept        516726..517625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0466"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG:
FT                   bfa:Bfae_01240 permease component of ABC-type sugar
FT                   transporter; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: C7MFA6 Permease
FT                   component of ABC-type sugar transporter; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13603"
FT                   /db_xref="GOA:D7CS71"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS71"
FT                   /protein_id="ADI13603.1"
FT                   /translation="MRRRFLSPLERRKLALGLLFISPWIVGFLAFTLYPILYTLRISFT
FT                   RYSGFGEPVWIGLANYRALWSDTVFWQSLGNTLYYTALAVPIGIVVALAMAIAMNQPLK
FT                   EIPFYRAALYLPSVLPLFAVSFIFIALLDPNRGIVNQLMVSLGLPNINWFGDPRYAKLG
FT                   LVLLAQLGAGNTALVFLAGLKAIPKTLYEAAVLDGAGPLRRFWSVTLPLMTPVILYSLI
FT                   LGLSLGLQVFAQAYIITNGGPANATNFYVFYLYNQAFRYSQMGVASAMAWVLFVITLVL
FT                   ALLIFRTSKRWVNYETVA"
FT   sig_peptide     516726..516821
FT                   /locus_tag="Trad_0466"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            517625..518500
FT                   /locus_tag="Trad_0467"
FT   CDS_pept        517625..518500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0467"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0395 ABC-type sugar transport system
FT                   permease component; InterPro IPR000515; KEGG:
FT                   bfa:Bfae_01230 ABC-type sugar transport system, permease
FT                   component; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: C7MFA5 ABC-type
FT                   sugar transport system, permease component; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13604"
FT                   /db_xref="GOA:D7CS72"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS72"
FT                   /protein_id="ADI13604.1"
FT                   /translation="MAAPAKTFREVPARRSRFKGKKLQVWVSRLLLLLFCAAFLLPLYW
FT                   MIVTALKSDQELALFPPTLFPLEPQWGNFREAVTYIPFFRFLNNTLIVTALTVVGAVIS
FT                   NPLIAYGFARLEWPGRDKVFLLVMATVFIPFPVVIIALFDIFAGLGWINTFLPLVVPMF
FT                   FGSAFWIFLMRQFLMQIPMEVSDAARIDGANEFQVFSQVVLPLTLPAVGVIGIFAALHA
FT                   WNDFIGPLIYLQDESLYTLAIGLTFFRSQYDVQFNLLMAASTLIVLPVVVIFLLFQRAF
FT                   LEGITLGSVK"
FT   sig_peptide     517625..517783
FT                   /locus_tag="Trad_0467"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(518493..519083)
FT                   /locus_tag="Trad_0468"
FT   CDS_pept        complement(518493..519083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0468"
FT                   /product="protein of unknown function DUF624"
FT                   /note="COGs: COG5578 integral membrane protein; InterPro
FT                   IPR006938; KEGG: ttr:Tter_1502 protein of unknown function
FT                   DUF624; PFAM: protein of unknown function DUF624; SPTR:
FT                   D1CC93 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function, DUF624"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13605"
FT                   /db_xref="GOA:D7CS73"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS73"
FT                   /protein_id="ADI13605.1"
FT                   /translation="MRLLDSRLYWWLNRLSSYVLLGGLWLLLSSPVVTFFPATAALFAV
FT                   FRAWQDNPDDAFYLPFFGRLRARFVSDALLGLLWLLIGALLLINAVLLPQLALPARLIA
FT                   FASLSLAAVLYTAASAFIFPVRVSTELGVWASARAAVILGMSQLGTTLLCVLAVALAAG
FT                   AFWLFPPTLLLSGVGVAHLTYWLCHRTLKRLAT"
FT   sig_peptide     complement(518952..519083)
FT                   /locus_tag="Trad_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            519165..522233
FT                   /locus_tag="Trad_0469"
FT   CDS_pept        519165..522233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0469"
FT                   /product="Alpha-mannosidase"
FT                   /EC_number="3.2.1.24"
FT                   /note="COGs: COG0383 Alpha-mannosidase; InterPro
FT                   IPR000602:IPR015341:IPR011682:IPR011330; KEGG:
FT                   dsh:Dshi_3007 alpha-mannosidase; PFAM: glycosyl hydrolase
FT                   38 domain protein; glycoside hydrolase family 38; Glycoside
FT                   hydrolase family 38 central region; PRIAM:
FT                   Alpha-mannosidase; SPTR: A8LKF7 Alpha-mannosidase; PFAM:
FT                   Glycosyl hydrolases family 38 C-terminal domain; Glycosyl
FT                   hydrolases family 38 N-terminal domain; Alpha mannosidase,
FT                   middle domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13606"
FT                   /db_xref="GOA:D7CS74"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="InterPro:IPR041147"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS74"
FT                   /protein_id="ADI13606.1"
FT                   /translation="MHHHVRHTLPKLGKRLSLITPLVYRRRQPLAPFRYKPLASPLEPP
FT                   PLDADTSDWETLAYGDHWGAPRTDFVLRSRFCVPQDWDASLPTALYLPLGEAGDFSHPE
FT                   ALVYLDGRPYAAADRHHQEIGLPQGVTGTHEVALHGWTGINYAEDRRLYLRECSVVQLD
FT                   PPTRAFVNLARVALETAQHLDEDAPVKGALLNALDDAFKRLETLQLGDAFYESVPEALE
FT                   RLQTGVAKAGPPMDVSIAAAGHAHIDVAWLWTLGQTRRKAGRTFHTVLRLMEQFPEYRF
FT                   SQSQPQLYDYVRQDYPELFEAIKARVAEGRWEILGGMWVEADCNLSGPESLARQFVLGR
FT                   AFFKEHFGEVDSSILWLPDVFGYAWNLPQLIKEAGLEYFFTIKIGWSQYNRLPYDTFYW
FT                   RGLDGTEVLTHFSTTPEIGSPHASTYNASATPEQVLGTWRNFQQKETQRDLFMAFGYGD
FT                   GGGGPTREMLENISLMQAFPGLPKVRHSTAEAFFRALEATPGLPTWDGELYLELHRGTY
FT                   TTQSRNKRANRKSEFLLHDAEFACVLAGLLDADYRYPESELRRAWELVCLNQFHDIIPG
FT                   SSIGEVYAESLAQYDEVRRLGEAARDGALEAIARQVGGEVVVLNPTSFARGDLAFVPAR
FT                   LEGLSVPTQAVAGGTLLAVGTLPPYSATPVGAGEAPTVDGELSVGERHLENAYVRVELD
FT                   ADGDITRVWDKVAGREVLQEGAKANQFLAFEDRPLEWDAWDIDVFYDDKVYYAAPAASV
FT                   RVVEAGPLRAMLEVKRQILGSPYTQRLSLAYNSPRLDITTDIDWRERHTLLKVAFPVRI
FT                   LSPVATHEIQWGSVQRPTHRNTSWDWARFETCAQKWVDLSEGDYGVSLLNDCKYGHDVQ
FT                   GNTLRLSLLRSPTFPDPEADRGRHVFTYSLLPHTGGVGEATIAAAYALNDPLLVVRAAG
FT                   GRGSPVQLLAADRPNAVIETVKRAEDGRGFVVRLYESQRRRGPVTLHVGCDLAHAERTD
FT                   LLERPRQALTVEGRRVTLELRPFEIATLRLVPA"
FT   gene            522303..523367
FT                   /locus_tag="Trad_0470"
FT   CDS_pept        522303..523367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0470"
FT                   /product="oxidoreductase domain protein"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR000683:IPR004104:IPR016040; KEGG: ttr:Tter_0652
FT                   oxidoreductase domain protein; PFAM: oxidoreductase domain
FT                   protein; Oxidoreductase domain; SPTR: C1WS26 Predicted
FT                   dehydrogenase; PFAM: Oxidoreductase family, NAD-binding
FT                   Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13607"
FT                   /db_xref="GOA:D7CS75"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS75"
FT                   /protein_id="ADI13607.1"
FT                   /translation="MPTPTTASTTSKVKLALIGAGNIAAFHLRGLLAHADKAECVALCD
FT                   VSDANLALCAQRLRTSPARYHDWNRLFSEQDVDAVIIALPHHLHAPAILAAAAAGKHIL
FT                   CEKPMCTTLAEADAILGAVKRAGVTYMSAHNQLFSPVVREAKRLLDEGAIGGLRWLRTQ
FT                   DAFLAEAASMRDTWRGDAASQGGGELIDTGYHPSYLLLYLAAAPVAAVGASMSRFHMMI
FT                   EGEDTASVQVRFQNGVLGEILTSWAMERPYGTHQIHLVGDRGELFGSDNELFYRPRGFD
FT                   TPARRTLPPVDTFTEEIGHFVTCLLTEERPLHGAEEGRAVLELILRATESAAGWQSTAP
FT                   KAAPERQGRLEATP"
FT   sig_peptide     522303..522407
FT                   /locus_tag="Trad_0470"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            523405..523932
FT                   /locus_tag="Trad_0471"
FT   CDS_pept        523405..523932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0471"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbe:BBR47_28730 peroxidase/catalase; SPTR:
FT                   C0ZDJ1 Catalase-peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13608"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS76"
FT                   /protein_id="ADI13608.1"
FT                   /translation="MGPLSSWKDDLSGVSAWARDNGFSALDLGVVEGEAAKAVQGGKLR
FT                   LGSVDLPEWQPMLSLDPSKRREAVARNVAYVGACVEACGAAGPLNFFVVMLSEDPHAPP
FT                   REVFDAMVANYRDLAPVLEAHGARLEQGVLGLAAQGNVAKAEGAGSVAYITPKPRAPQL
FT                   FCRFPNALHFFC"
FT   gene            524021..524623
FT                   /locus_tag="Trad_0472"
FT   CDS_pept        524021..524623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0472"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nml:Namu_0862 hypothetical protein; SPTR:
FT                   C8XAA8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13609"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS77"
FT                   /protein_id="ADI13609.1"
FT                   /translation="MHKFALTPTLSAARYTLPLLLSAALIGCQSSATSEGGPQGERPQH
FT                   PTYERSDYTIPCLEVALDAPDEVKVGTGVTFAVSATNTCEEPLKLEHIPTPQRFFVLDG
FT                   DQIVWDSWPAGAEPSAVAYELTLGPGESASWEFPSPDFGKAPFSGISDDGTALAEGAYT
FT                   VVGRLMNFHPALEEGATQGPPIVPGLDTELQPIKIVR"
FT   sig_peptide     524021..524122
FT                   /locus_tag="Trad_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            524722..525330
FT                   /locus_tag="Trad_0473"
FT   CDS_pept        524722..525330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0473"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nml:Namu_0862 hypothetical protein; SPTR:
FT                   C8XAA8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13610"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS78"
FT                   /protein_id="ADI13610.1"
FT                   /translation="MQKRTLLVVSSLLLGTALVGCQRTGGALDPGGDPSEPEPVYERSD
FT                   FMIPCLEVALDADGDAPYTLEVGSELTLELLATNVCDEPLGLEYDASPTQTQLLVLDAD
FT                   GRVVWSAPRSNLPYPDVLLRVTLAPGETMSWPNRDDPTGAGRHAPVVFTGLDNAGRALA
FT                   AGAYTLVGRLSVGQVEVGPPSEAPEPGTIDTEPQPLTLR"
FT   sig_peptide     524722..524802
FT                   /locus_tag="Trad_0473"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(525391..527568)
FT                   /locus_tag="Trad_0474"
FT   CDS_pept        complement(525391..527568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0474"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /note="COGs: COG0608 Single-stranded DNA-specific
FT                   exonuclease; InterPro IPR001667:IPR003156:IPR004610; KEGG:
FT                   dge:Dgeo_1599 single-stranded-DNA-specific exonuclease
FT                   RecJ; PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; SPTR: Q1IXZ0
FT                   Single-stranded-DNA-specific exonuclease RecJ; TIGRFAM:
FT                   single-stranded-DNA-specific exonuclease RecJ; PFAM: DHH
FT                   family; DHHA1 domain; TIGRFAM: single-stranded-DNA-specific
FT                   exonuclease RecJ"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13611"
FT                   /db_xref="GOA:D7CS79"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS79"
FT                   /protein_id="ADI13611.1"
FT                   /translation="MRPSAPPHPTAPAARWAVRPSAPPAEVARLVRAFSLPPLVASVLW
FT                   ARGLRSPEALQPPFERTRIPALATAAERLAEALARGKRILIHGDYDADGISGTAVLTLG
FT                   LRALGGRVTPFIPNRLRDGYGVHPARVAEHAAGADLFITVDCGISNRAEVAALQAAGVE
FT                   VIVTDHHHPGQVLPDCLTVHPSLSPYAKKGLPELTGAGVAYHLLWALHEHLGLEAPVEY
FT                   SDLATIGTVADVAPLMGENRALVTAGLAQLARSRWPGLRAMMARTLSHGRAPSAREVAF
FT                   VLAPRLNAAGRLGEADLGLELLTTASERRALELASYLDARNADRRKVQDAMLGEALKLV
FT                   DPEAPALVLERPSWHPGVMGIVASKLLERFYKPVFIIAQGKGSVRSTPGISAVGGLEYA
FT                   RDLLERFGGHSQAAGFAIREGCVEAFRERVYDYARQHPTPRPELVADTLLAPDEIDTDL
FT                   YRALCTLEPYGEGHPAPRFALCAPLEGVGCMGEGGKHLNLRVGGVRGVAWDRGADAPAL
FT                   RAAGVINAAVTLRENTWQGKTQLELLADDVRPAAPLELSTPSAVRRPLYRGPPPEGVDA
FT                   RWVREVPLSADLLQLTAPLAALVRRGEPLSFDLPEAELGRLAALPLPPTLSEVRRAFVC
FT                   LRRGTPLPADTPKAQLCRRILEELELVGPSGHALRGQKRDPYSSESFVKGLLERYKLQG
FT                   FLKAYRALSDVAFAETVWTLFGPSEAGPKRT"
FT   sig_peptide     complement(527425..527568)
FT                   /locus_tag="Trad_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(527572..528015)
FT                   /locus_tag="Trad_0475"
FT   CDS_pept        complement(527572..528015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0475"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eli:ELI_07570 hypothetical protein; SPTR:
FT                   A5P897 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF1049)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13612"
FT                   /db_xref="GOA:D7CS80"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS80"
FT                   /protein_id="ADI13612.1"
FT                   /translation="MKIFRVIQLLALGALIGYLVVLHNVNPQIVILPFFISLPVSWVVG
FT                   ASLLLGFLVGWLAFSGHAWRLARENRALRQRLSKAGAVLEPALTERDTARPTQVRRTPP
FT                   PRPERDAEPLSPEDLSSAAENHAPRRGWRFGSRNAPTDTDEER"
FT   gene            complement(528079..528981)
FT                   /locus_tag="Trad_0476"
FT   CDS_pept        complement(528079..528981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0476"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="InterProIPR001440:IPR013105:IPR019734:IPR013026:IPR
FT                   011990; KEGG: dge:Dgeo_2293 tetratricopeptide TPR_2; PFAM:
FT                   Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; SPTR: Q1IVZ7 Tetratricopeptide
FT                   TPR_2; PFAM: Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13613"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS81"
FT                   /protein_id="ADI13613.1"
FT                   /translation="MRRLYTATLYALLAALPAAMTAPPASAQITTLTQPLPAEAREVLE
FT                   GARERTREALKTYEAPYRPDQPLFREALSLARRAVELAPDNPEALRFLAELNGVTGFYG
FT                   PAFAAWERFVAAGGVLDAAALDQLVRAGTQVGYARYQQGDLEGALAAYERVADLAPERP
FT                   LAHRWRGRILLELERPQRALEAWETVLRLRPGDAAAEHFADLAAAGVRYGLPAARAFYD
FT                   GVAHYEAGRRERARERFAEAARLNPAYAEAWAYVGRVAFEAGDYREAERAYSEASALEP
FT                   DNATYRYFLAEARRRAEGS"
FT   sig_peptide     complement(528901..528981)
FT                   /locus_tag="Trad_0476"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            529298..530236
FT                   /locus_tag="Trad_0477"
FT   CDS_pept        529298..530236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0477"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439:IPR003593; KEGG:
FT                   scl:sce0659 sodium ABC transporter ATP-binding protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; SPTR:
FT                   A9EN41 Sodium ABC transporter ATP-binding protein; PFAM:
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13614"
FT                   /db_xref="GOA:D7CS82"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS82"
FT                   /protein_id="ADI13614.1"
FT                   /translation="MERRKSLPLQASESAFKGISEPLIAASELHKSFPPRKAVLKGVDL
FT                   TLYAGEVVGLLGLNGAGKTTLIKLLTGLLEPDAGSVTLLGRARDRQGVRRHVALMKEGQ
FT                   PTLFEFMTPRQNLRYYGGLLGVRDLAAGVARVLAEVELTEVADTPLLYLSNGTKRRVGL
FT                   ALAYLKGARVLLLDEPSAGLDIRSTALMKGALKAFAAAGNAVLLTGHEMGFLESVCDRV
FT                   VVLHGGRVAAEGTLRALLQRFAPEQWVEVWLEGRPGAGELLEEQGGLFRVRLPLAELGA
FT                   LGALRVRQLRLETPALEALLREVGDVARRVA"
FT   gene            530214..530969
FT                   /locus_tag="Trad_0478"
FT   CDS_pept        530214..530969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0478"
FT                   /product="ABC-2 type transporter"
FT                   /note="InterPro IPR013526:IPR013525; KEGG: tte:TTE1177
FT                   ABC-type multidrug transport system, permease component;
FT                   PFAM: ABC-2 type transporter; SPTR: Q8R6H7 ABC-type
FT                   multidrug transport system, permease component; PFAM: ABC-2
FT                   type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13615"
FT                   /db_xref="GOA:D7CS83"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS83"
FT                   /protein_id="ADI13615.1"
FT                   /translation="MWRAEWLRLRADWLFYRQLLLGSLLNQVLVTVGAFWVVSLLADKS
FT                   LATLMALFFWQYASVPLSRVAADIWEETSTGAFEQTYLHAGAPVAVLFVRLCLYFVRQS
FT                   ALQLPVFAALALLSFGWAPLASYPWFGFALSLALTLASLAGLGLVVGGVLLVSRNAISY
FT                   ASAAEYALLFLSGVIVPIAALPAPLQALAPWLPLSLGVEALRRLEAGAAPYGLLLLLGV
FT                   QAAALLLLGLAVFRVCLARALRRGFAMGR"
FT   sig_peptide     530214..530315
FT                   /locus_tag="Trad_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(530966..531547)
FT                   /locus_tag="Trad_0479"
FT   CDS_pept        complement(530966..531547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0479"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="COGs: COG0127 Xanthosine triphosphate
FT                   pyrophosphatase; InterPro IPR002637; KEGG: ttj:TTHA1654
FT                   nucleoside-triphosphatase (HAM1 protein); PFAM: Ham1 family
FT                   protein; SPTR: A1HQF7 Nucleoside-triphosphatase; TIGRFAM:
FT                   non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family;
FT                   PFAM: Ham1 family; TIGRFAM: non-canonical purine NTP
FT                   pyrophosphatase, rdgB/HAM1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13616"
FT                   /db_xref="GOA:D7CS84"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS84"
FT                   /protein_id="ADI13616.1"
FT                   /translation="MKLALATANEDKVREFRRALAQSPLTLVSARELGVTDFPAETGAS
FT                   YAANALTKAAFLAGRTGLLSLADDSGLEVDALGGAPGLYSARFASGSDLERTAHLLAQL
FT                   RGVPEGERRARFVCVLGLVTPAGDAHTFEGRCDGVILEAPRGAGGFGYDPVFWSPELGK
FT                   TFAEATPEEKAAVSHRGRALAELAAWLQAR"
FT   sig_peptide     complement(531485..531547)
FT                   /locus_tag="Trad_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(531544..532254)
FT                   /locus_tag="Trad_0480"
FT   CDS_pept        complement(531544..532254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0480"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="COGs: COG0689 RNase PH; InterPro
FT                   IPR001247:IPR015847:IPR020568:IPR002381; KEGG:
FT                   dge:Dgeo_2086 ribonuclease PH; PFAM: 3' exoribonuclease;
FT                   Exoribonuclease, phosphorolytic domain 2; PRIAM: tRNA
FT                   nucleotidyltransferase; SPTR: Q1IWK4 Ribonuclease PH;
FT                   TIGRFAM: ribonuclease PH; PFAM: 3' exoribonuclease family,
FT                   domain 1; 3' exoribonuclease family, domain 2; TIGRFAM:
FT                   ribonuclease PH"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13617"
FT                   /db_xref="GOA:D7CS85"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS85"
FT                   /protein_id="ADI13617.1"
FT                   /translation="MRKGRQPFQLREIRVTPGYNRFAEGSALVEWGDTRVLATVTVENK
FT                   LPPHLRGKKGRVGWLTAEYAMLPRSTAERTQRERLYAGGRSLEIQRLIGRSLRSVTDLT
FT                   LFHGQTLTVDVDVLQADGGTRCAGILAGYAALHHAAGRLVRKGALDEWPLTHEVAAVSV
FT                   GVVRGETLLDLDFHEDAAAEIDLNVVATADGKLVEVQGSGEERPIDAGRYVELVAQGIS
FT                   AVQGLLAHVRGSFT"
FT   gene            complement(532363..533175)
FT                   /locus_tag="Trad_0481"
FT   CDS_pept        complement(532363..533175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0481"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="COGs: COG0796 Glutamate racemase; InterPro
FT                   IPR018187:IPR015942:IPR001920:IPR004391; KEGG: tth:TTC1280
FT                   glutamate racemase; PFAM: Asp/Glu/hydantoin racemase;
FT                   PRIAM: Glutamate racemase; SPTR: Q72I52 Glutamate racemase;
FT                   TIGRFAM: glutamate racemase; PFAM: Asp/Glu/Hydantoin
FT                   racemase; TIGRFAM: glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13618"
FT                   /db_xref="GOA:D7CS86"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS86"
FT                   /protein_id="ADI13618.1"
FT                   /translation="MKTPPHAPLGVFDSGVGGLTVLAALRALLPAEHFLYVGDTARVPY
FT                   GSKPLEMVRAFAAEICALLLSRGVKGIVVACNTASAAALPGLAAELPVPVWGVIAPGVQ
FT                   AALRRAPGGRIGVLGTAGTIRTGAYQRPLEAAGCRVWARPCPLFVPIVEEGVSDTVIAR
FT                   LVAEHYLKDAPALDAAILGCTHYPALKGILSEVLPGTALLDSAEETARVVAHDLALLGL
FT                   ANPNAAPGTVRHLVTGDLPSYAHTARLLGGPEGALERVVLGAPPVAQP"
FT   sig_peptide     complement(533086..533175)
FT                   /locus_tag="Trad_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(533222..533503)
FT                   /locus_tag="Trad_0482"
FT   CDS_pept        complement(533222..533503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0482"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SORBIDRAFT_04g035660; hypothetical protein;
FT                   SPTR: C5XUD5 Putative uncharacterized protein Sb04g035660"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13619"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS87"
FT                   /protein_id="ADI13619.1"
FT                   /translation="MRFVRRFCLLATLAALTACGPNTQVGDTTRLDGPHNVQQAGVIVP
FT                   QEGQGQRAAEVAAAKARVPYQYREKNNPSLFAFGVNLNPGSNRSTDRD"
FT   sig_peptide     complement(533327..533503)
FT                   /locus_tag="Trad_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            533698..536073
FT                   /locus_tag="Trad_0483"
FT   CDS_pept        533698..536073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0483"
FT                   /product="ribonuclease R"
FT                   /note="COGs: COG0557 Exoribonuclease R;
FT                   InterProIPR001900:IPR013223:IPR003029:IPR016027:IPR
FT                   012340:IPR011805:IPR004476:IPR011129; KEGG: ddr:Deide_03240
FT                   putative ribonuclease R, (RNase R); PFAM: ribonuclease II;
FT                   Ribonuclease B OB region domain; RNA binding S1 domain
FT                   protein; SMART: Cold shock protein; SPTR: C1CZA7 Putative
FT                   Ribonuclease R, (RNase R); TIGRFAM: ribonuclease R; VacB
FT                   and RNase II family 3'-5' exoribonuclease; PFAM:
FT                   Ribonuclease B OB domain; RNB domain; S1 RNA binding
FT                   domain; TIGRFAM: ribonuclease R; VacB and RNase II family
FT                   3'-5' exoribonucleases"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13620"
FT                   /db_xref="GOA:D7CS88"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS88"
FT                   /protein_id="ADI13620.1"
FT                   /translation="MSELDRERLYAFFQQHPEKPWHLQDLQKRLKLSDRADLRRELGAL
FT                   VEEGRLVRTRRRSYGLPQEMNLRPGRLQVTAGGYGFVILDSEEKDLFIPAESLNGAWDG
FT                   DRVLARLNPERENGRLSGEVVRILERKHNRVVGTLEYARGYAILRPDSPRLRERILLLP
FT                   ESVGQVEAGTRIVAKIVWPEVSGEKDPFGEVEEVLGAGDDAEVETRAVIVKFDLKDAFD
FT                   PDTLAEARAVPSTVSEEMMRGRLDLREVNTFTIDGADAKDFDDAISLERLGKGKNALLR
FT                   VGVHIADVSYYVAEGTSLDQEAKARATSVYLPGRVLPMLPEALSNGICSLVEGEPRLTL
FT                   SVLVDLTKDGEVKAMQVAETVIVSNARLTYDEVQAFADGEKLPKGRGKLSRDLTQLLKL
FT                   TQKLRAARMAAGALDFDFTETKVDVDPEGELKVMPVRPNAARQLIEELMLLANRLVAEY
FT                   LSKRDLPALYRVHEDPSEAKMQALQASLARLGYTLDLEHATPQDLQAIVRAASSKPESQ
FT                   LVNTLLLRSLKQARYSADNLGHFGLAFEHYLHFTSPIRRYPDLVVHRVLRAALQNRLSP
FT                   TLKERLKSDFPALAQHTSERERLAEEAERDLTRYYQAKWAKEHRGEVFNGLITGVTNFG
FT                   VFVALPNGVEGLLHVSQLDDDYYMYIEEQMMLLGKTSKRKFRLGGRLDVRILSANPTVR
FT                   QIDLGLSSAELPDEEEADEVRPERPPKRLRNPLTDRSPEDEVRERVEGRRHRRGRRPEE
FT                   EREAPGESASAETPTAPAQAPSGVRKRRVLVFGDVYKK"
FT   gene            536288..537586
FT                   /locus_tag="Trad_0484"
FT   CDS_pept        536288..537586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0484"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tth:TTC0207 hypothetical protein; SPTR: C1XKD7
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13621"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS89"
FT                   /protein_id="ADI13621.1"
FT                   /translation="MTTEFTYCLTRICLRTGQLTLPLSMRELFPAPGSVRAVDTKTGDS
FT                   LELQVTASHQLLGVAPFLARHGLAVNDLLSVRALPDGAYAITPLPRPKRPDYTRPEAQR
FT                   ELIDRIVEQAPLSEREIRALFPDLPPEFDLGAALQRDGRLTKYEGRWGFAVPDAAPAAP
FT                   RPYPTVTTFVARSGEASFARPSEAPSTDTSQSALLRRALETFGFRVEAHAHGHLVAHAE
FT                   LGRRHYTVLAHLLAEGARLDWTKLLARRRELSSTYLAVFGSHHDLLRLRAPAAGAGATL
FT                   WSWEALERALGLLATVPLSPVDLEPHFVKEGLFDEGLRRFERTIERRVAERGAFSQVLS
FT                   RLAGLRAPSVFLLDDVVDGAAPSREEVLKVLELLGEAPFHLVSRVDSGEFCLRQGVPES
FT                   LTHLSAYALSLVERLPERRTERVRGVAVLAADE"
FT   sig_peptide     536288..536398
FT                   /locus_tag="Trad_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(537591..540674)
FT                   /locus_tag="Trad_0485"
FT   CDS_pept        complement(537591..540674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0485"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /note="COGs: COG0458 Carbamoylphosphate synthase large
FT                   subunit (split gene in MJ);
FT                   InterProIPR005479:IPR005483:IPR005481:IPR005480:IPR
FT                   011761:IPR016185:IPR013817:IPR013816:IPR006275; KEGG:
FT                   dge:Dgeo_2070 carbamoyl phosphate synthase large subunit;
FT                   PFAM: Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   Carbamoyl-phosphate synthetase large chain oligomerisation;
FT                   SPTR: Q1IWM0 Carbamoyl-phosphate synthase large chain;
FT                   TIGRFAM: carbamoyl-phosphate synthase, large subunit; PFAM:
FT                   Carbamoyl-phosphate synthase L chain, ATP binding domain;
FT                   Carbamoyl-phosphate synthetase large chain, oligomerisation
FT                   domain; Carbamoyl-phosphate synthase L chain, N-terminal
FT                   domain; TIGRFAM: glutamate--cysteine
FT                   ligase/gamma-glutamylcysteine synthetase, Streptococcus
FT                   agalactiae type; carbamoyl-phosphate synthase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13622"
FT                   /db_xref="GOA:D7CS90"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS90"
FT                   /protein_id="ADI13622.1"
FT                   /translation="MPKRDDIHKILILGSGPIVIGQAAEFDYSGTQACKALRAAGFEVV
FT                   LINANPATIMTDPEVADRTYIEPLTPEVAERVIAQERPDALLPTLGGQTALNLAKALYE
FT                   TGVLERYGVELIGANYEAINKGEDRELFQAAMRKIGIKTPAGKMVGSLEEALDFVATIG
FT                   YPAIIRPSFTLGGTGGGVAYDEAEFRQIVRRGLHDSPVHTVLVEQSVLGWKEYELEVMR
FT                   DHNDTVVIICSIENVDPMGVHTGDSITVAPAQTLSDKEYQRLRDDAIAIIREIGVDTGG
FT                   SNIQFAVNPRNGEVMVIEMNPRVSRSSALASKATGYPIAKIAALLAVGYHLDELPNDIT
FT                   KETKAAFEPSIDYVVTKIPRFAFEKFPETSPLLGTQMRSVGEVMAIGRTFKESLQKALR
FT                   SLELDVRSETKNLNLAQLESRLAATPQRLGALLELLRRGKSVRFLAERTHIDPWFLAQL
FT                   KEIVDAEREITALGPVERWNWETWREVKRFGFSDSDLAQLTGTDVMTVRRLRKERHAAP
FT                   VYKTVDTCAAEFEAYTPYHYSTYEWEDEVRPSERPKVVILGSGPNRIGQGVEFDYATVH
FT                   AVWALKEAGYETIMINSNPETVSTDYDTADRLYFEPLTFEDVLNVIEREEPAGVIVQLG
FT                   GQTPLKLAAPLEAAGVPIWGTPARAIAEAEDRDAFHRLCARLGVPQPAGGVAQRPAEAL
FT                   TLAASLGYPLMVRPSFVLGGRAMQVVEDEGALERYLREVYAELPGSPSILLDAFVAGAQ
FT                   EVDVDALADGERVVVAGIMEHIEGAGVHSGDSACITPPVSLSDEVIATLHDYSTRLARA
FT                   IGVRGLINLQFVVKGGEVLVIEANPRASRTVPYLSKAIGHPLAKYAALIAAGKTLAEIG
FT                   FTETPTPSVYSVKEAVLPFLKFAGVTPVLGPEMRSTGESMGIDPDPYMAYYKALLGANV
FT                   RLPTSGTVALIGEGLEVVGAELCELGFSVTKAPEGAGEPAYALLIATTATPELRRALEA
FT                   GVPIVTTPEAARWTVRALRAAQRGTLEVRPLQELHRGA"
FT   sig_peptide     complement(540606..540674)
FT                   /locus_tag="Trad_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            540799..541338
FT                   /locus_tag="Trad_0486"
FT   CDS_pept        540799..541338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0486"
FT                   /product="protein of unknown function DUF820"
FT                   /note="InterPro IPR008538:IPR012296; KEGG: mar:MAE_46710
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF820; SPTR: B0JUP5 Putative uncharacterized protein;
FT                   PFAM: Protein of unknown function (DUF820)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13623"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS91"
FT                   /protein_id="ADI13623.1"
FT                   /translation="MITKRKLTVADFLAMGEAGLFAPDERVELLEGEIYTMSPPSSKHA
FT                   AWVDRMMKALERACGDRAIVRVQSPVALSEEDAPEPDVTVLVPRADFYEAELPRATDVY
FT                   LVVEVSVSTLLHDRKVKLPIYARTGVPEYWLVNLEKGRLEVYREPQGDHYRVRLLLGLH
FT                   EPLTLAALPTPSPVAL"
FT   gene            complement(541321..541572)
FT                   /locus_tag="Trad_0487"
FT   CDS_pept        complement(541321..541572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0487"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="COGs: COG2501 conserved hypothetical protein;
FT                   InterPro IPR002942; KEGG: cyb:CYB_1892 S4 domain-containing
FT                   protein; PFAM: RNA-binding S4 domain protein; SMART:
FT                   RNA-binding S4 domain protein; SPTR: Q2JKE2 S4 domain
FT                   protein; PFAM: S4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13624"
FT                   /db_xref="GOA:D7CS92"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS92"
FT                   /protein_id="ADI13624.1"
FT                   /translation="MNRPPDTDRFDDPEPTITLNDALKLSGLAQTGGQAKLMIQSGRVR
FT                   VNGEVETRRKRKLREGDTVTVGDETFVLGLAGELEGDR"
FT   gene            complement(541569..542426)
FT                   /locus_tag="Trad_0488"
FT   CDS_pept        complement(541569..542426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0488"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="COGs: COG0077 Prephenate dehydratase; InterPro
FT                   IPR018528:IPR001086:IPR002912; KEGG: ttj:TTHA1104
FT                   prephenate dehydratase; PFAM: prephenate dehydratase; amino
FT                   acid-binding ACT domain protein; PRIAM: Prephenate
FT                   dehydratase; SPTR: Q5SJB0 Prephenate dehydratase; PFAM:
FT                   Prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13625"
FT                   /db_xref="GOA:D7CS93"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS93"
FT                   /protein_id="ADI13625.1"
FT                   /translation="MHTPPRIAFQGVAGAFSEQAALQFCPHAEAVGYSTFQEGFAAAVS
FT                   GACDYACLPVENSLAGSINQTYDLLTDSVLHVVGEQVVRVEHNLLVVPGTKLADVRRVY
FT                   SHPQALEQCRGFLTRHGFEAVTDFDTAGAAKLLAERQENGGAHGHAAIASKRAAEIYGL
FT                   EILAANIEDTDFNYTRFFILGADEVPRGEGEHKTSLVIATRHRPGDLVRCLELFPRHGI
FT                   NMTKLESRPRRDKPWSYLFYIDIEGHLDDANVQAAVTGLMRRAAFVKFLGSYPAAPSVS
FT                   EVAS"
FT   gene            complement(542454..543092)
FT                   /locus_tag="Trad_0489"
FT   CDS_pept        complement(542454..543092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0489"
FT                   /product="NmrA family protein"
FT                   /note="COGs: COG2910 Putative NADH-flavin reductase;
FT                   InterPro IPR008030:IPR016040; KEGG: fal:FRAAL4004 putative
FT                   nucleoside-diphosphate-sugar epimerases; PFAM: NmrA family
FT                   protein; SPTR: C1XST4 Putative NADH-flavin reductase; PFAM:
FT                   NmrA-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13626"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS94"
FT                   /protein_id="ADI13626.1"
FT                   /translation="MKLAVFGGTGKTGRPLLEQALAAGHEVRALVRDPGKLPLSLSGHE
FT                   RLELIQGDALDPEAVARTVKGVDAVLSVLGQTKGSPPDLVTRATENILAAMHAHGVRRI
FT                   VTLTGAGVPDPRDRPKLIDRVFTFLLKRLSGAVLEDGEQHAARLKASGLAWTVVRAPRL
FT                   TNGPHTGSYRVGFVGKDSGVQVSRADVADFMLQEVASSRFVQQMPVVTS"
FT   gene            complement(543344..543727)
FT                   /locus_tag="Trad_0490"
FT   CDS_pept        complement(543344..543727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0490"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="COGs: COG0735 Fe2+/Zn2+ uptake regulation protein;
FT                   InterPro IPR002481; KEGG: ttj:TTHA1292 metal uptake
FT                   regulation protein, putative; PFAM: ferric-uptake
FT                   regulator; SPTR: Q72J54 Ferric uptake regulation protein;
FT                   PFAM: Ferric uptake regulator family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13627"
FT                   /db_xref="GOA:D7CS95"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS95"
FT                   /protein_id="ADI13627.1"
FT                   /translation="MKRQTAQRRAILRALERAPGPLTPQEVLHAARETHASLGLATVYR
FT                   NLSTMEAEGEVVPVHLPGESARFEIAGRGHHHHFRCQSCGGVFELTTTCPVVVLEGLTL
FT                   PGGFTVKHHELTLYGVCPQCQSN"
FT   gene            543911..544078
FT                   /locus_tag="Trad_0491"
FT   CDS_pept        543911..544078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0491"
FT                   /product="ribosomal protein L33"
FT                   /note="InterPro IPR018264:IPR001705; KEGG: dra:DR_2049 50S
FT                   ribosomal protein L33; PFAM: ribosomal protein L33; SPTR:
FT                   Q9RSS4 50S ribosomal protein L33; TIGRFAM: ribosomal
FT                   protein L33; PFAM: Ribosomal protein L33; TIGRFAM:
FT                   ribosomal protein L33, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13628"
FT                   /db_xref="GOA:D7CS96"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS96"
FT                   /protein_id="ADI13628.1"
FT                   /translation="MAKDGPRIKILLRSTAGTGSVYATTKNRRTTTHKLELKKYDPRLR
FT                   RHVLFREEKV"
FT   gene            complement(544084..544422)
FT                   /locus_tag="Trad_0492"
FT   CDS_pept        complement(544084..544422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to DNA helicase homolog, putative;
FT                   SPTR: A8P8J6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13629"
FT                   /db_xref="GOA:D7CS97"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS97"
FT                   /protein_id="ADI13629.1"
FT                   /translation="MVGDQEPRPRNLVVVAVVGVLGVVMVVMVVVLVVMVVVLAMLMVV
FT                   LGVVVSTLGVTAVLVMVMRVVMIVVVTFVIAVPIVRVVTVRLLGVRCLPLLGQGAAEGQ
FT                   QRGQRQVA"
FT   sig_peptide     complement(544303..544422)
FT                   /locus_tag="Trad_0492"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            544435..545499
FT                   /locus_tag="Trad_0493"
FT   CDS_pept        544435..545499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR011048; KEGG: mes:Meso_4007 hypothetical
FT                   protein; SPTR: C1XGI5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13630"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS98"
FT                   /protein_id="ADI13630.1"
FT                   /translation="MAVLDLLSEEVLASFSVPGPGGNVYRSPSGQYGLVVHRDENRVTV
FT                   VHSGLRLEDHGDHADLVQGAPYILQTLNVGRQPTHVWTGEHEIAIFNDADGTVAVLDER
FT                   LFGLSLEYLGLESAGPDHGAAVVLGDHVLVGYLELGRVDAFTRGGELETSFEGCPRLHG
FT                   EASAGDVAAFGCADGVLLVTYEEGALSAVKLDNPAGTPEDARVGTVVAHEASPVMVGNL
FT                   GDGVVLIDAAAQTLEPVSLPSAPLRFAFDHTGEHLLVLTRDGELHRLEAQSGELQGSVS
FT                   VMEAFDPGPGGGHGAARPGLAVGEHAVYVSVPSAGEVAEVRFEGDALSVTRRLEVGGTP
FT                   SGVALLALEGGVIH"
FT   gene            545519..546811
FT                   /locus_tag="Trad_0494"
FT   CDS_pept        545519..546811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0494"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR000815; KEGG: cyn:Cyan7425_1918
FT                   hypothetical protein; SPTR: B8HT58 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13631"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS99"
FT                   /protein_id="ADI13631.1"
FT                   /translation="MRPLSDVPLTVVGGRGPHGLALHLLLQDRGVSGYRLLDKAADWLP
FT                   LYGPGGPMQAVGHLRSPAELDFALGVPERGMGAFEDDDGSFPLRGVYRLEDAAASAFNL
FT                   STTPAHRAPRLAFWRYANCVARRSGADAHVLQASAARLEPVWEGAEGHWRVHLEDGRSF
FT                   ATAAVVLATGLGPHLRVPRPWRPWWARLPEATRAHVLGFRYEGLAGKRVVVAGSSNLSS
FT                   WEAAIRAAEAGAKVTLLSRALNPIEWQLPFAPHWFQADFMARFMALSPEKRLRTLRKTH
FT                   VPNTSLPGLAARARALGVRVTFYARVQAAAPLWGGVQLQYRTPEGDHAEYADLLLAATG
FT                   AAPRLRELPLIAETAREHRAPVVVGGPAKHRPILDDTGRWKNLPPLYPMGAHALTRGGL
FT                   GVNTLASATAYLPLTLPHIARAAGLALPKSA"
FT   sig_peptide     545519..545617
FT                   /locus_tag="Trad_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            546823..547092
FT                   /locus_tag="Trad_0495"
FT   CDS_pept        546823..547092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0495"
FT                   /product="ribosomal protein S14"
FT                   /note="COGs: COG0199 Ribosomal protein S14; InterPro
FT                   IPR018271:IPR001209; KEGG: dra:DR_2109 ribosomal protein
FT                   S14; PFAM: ribosomal protein S14; SPTR: A3XJV8 Ribosomal
FT                   protein S14; PFAM: Ribosomal protein S14p/S29e"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13632"
FT                   /db_xref="GOA:D7CSA0"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSA0"
FT                   /protein_id="ADI13632.1"
FT                   /translation="MARKSLIAKNRQRQRLAAKYADKRRALRAAGDYRGLGRLPRDASK
FT                   VRVKNRCALTGRSRGYLRAFGVSRIALRELAHAGLLPGVKKASW"
FT   gene            complement(547137..547475)
FT                   /locus_tag="Trad_0496"
FT   CDS_pept        complement(547137..547475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_1777 hypothetical protein; SPTR:
FT                   Q0A7R4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13633"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSA1"
FT                   /protein_id="ADI13633.1"
FT                   /translation="MATHDDHPHTHGPGCGHTAVRHDGHTDYLHDGHLHHQRDDGAVEE
FT                   HALEVSSTNPAEHNPTVDGHDAAHVHGPGCGHEAVPHGDHVDYLVNGRLHHPHGDHCDD
FT                   HGPVEVVA"
FT   gene            547747..549015
FT                   /locus_tag="Trad_0497"
FT   CDS_pept        547747..549015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0497"
FT                   /product="Kelch repeat-containing protein"
FT                   /note="InterPro IPR006652:IPR011043:IPR015915; KEGG:
FT                   xcb:XC_4204 ring canal kelch-like protein; PFAM: Kelch
FT                   repeat-containing protein; SPTR: C1XWE6 Uncharacterized
FT                   conserved protein; PFAM: Kelch motif"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13634"
FT                   /db_xref="GOA:D7CSA2"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR030104"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSA2"
FT                   /protein_id="ADI13634.1"
FT                   /translation="MNRFATRPHRSWRALLWAPLGLLSACYAPGGPTPDNRPPTVSAGG
FT                   DRTVTLPADGVLLAGRAADPDGDPLTALWAQLAGPAEVTFADASALETSARFPEAGAYT
FT                   LELSVTDGQASARDQAVITVEPGAGGAGAWRALPESAAPRQEVSYVQLGGRFYLAGGST
FT                   LHEVYDPVARTWTEVAPLPRNLDHIQGVAVGGKILYIGGNVGGDLRVETDTVYIYDPET
FT                   DTFTEGSPMPRGRGAGGVAVHDGLIYYAGGLNGFVARTWFDVYDPVADTWTALPDMPNP
FT                   RDHFHAVVLDGVFYAIGGREARINATTPAVDAFDIASGTWTTLDTELPTERGGFAAAVL
FT                   GDEILVIGGEGGGNTYEEVEAYNPRTNTWRRLAPMPTPRHGVQAAVCNGGVYLAAGGVV
FT                   QGIGPSSAHEVFFVGEPRPCEAP"
FT   sig_peptide     547747..547875
FT                   /locus_tag="Trad_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            549081..550085
FT                   /locus_tag="Trad_0498"
FT   CDS_pept        549081..550085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0498"
FT                   /product="glucose sorbosone dehydrogenase"
FT                   /note="COGs: COG2133 Glucose/sorbosone dehydrogenase;
FT                   InterPro IPR012938:IPR011041:IPR011042; KEGG: hau:Haur_0421
FT                   glucose sorbosone dehydrogenase; PFAM: glucose sorbosone
FT                   dehydrogenase; SPTR: A9AUF3 Glucose sorbosone
FT                   dehydrogenase; PFAM: Glucose / Sorbosone dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13635"
FT                   /db_xref="GOA:D7CSA3"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSA3"
FT                   /protein_id="ADI13635.1"
FT                   /translation="MRSSLPGLGALVLSALLTLGWAQPLALPDGYAADPLVTGLRGPTQ
FT                   MTFGPDGRLWVAQLAGGENSGAGQVVAVDLRTGEREVLLKELFKPTGLAVTEADLWVMA
FT                   GDRLLRAPLAGGAVGELEVVLRDLPSNGRSQGTLTLTPAGELLFETSGALTATGVREGS
FT                   GALWRLDPANPAAPRPLATGLKGAYAHAFDASGTLYSTEVGDDWVDGRPPPDELNIIRE
FT                   GADYGWPSCYGDRQPAHNFGGTRARCAATEAPLALFARGATPTSVVGSPFEEGALLVAL
FT                   WAASRVVRVDARTGAVTPFITGIRLPQHLLAHEGALLVSSFADGTVYRVEARE"
FT   sig_peptide     549081..549176
FT                   /locus_tag="Trad_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(550036..550362)
FT                   /locus_tag="Trad_0499"
FT   CDS_pept        complement(550036..550362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0499"
FT                   /product="glutaredoxin"
FT                   /note="InterPro IPR002109:IPR012336:IPR012335; KEGG:
FT                   tth:TTC1680 hypothetical protein; PFAM: glutaredoxin; SPTR:
FT                   Q72H15 Putative uncharacterized protein; PFAM:
FT                   Glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13636"
FT                   /db_xref="GOA:D7CSA4"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSA4"
FT                   /protein_id="ADI13636.1"
FT                   /translation="MNAPESAPPVRLYGLAGCGPCEVAKRFLSSRGVPFTFVDVAREPE
FT                   RRNLLEARLGSPARGVILEDGDTLEVMQGVSVAVLSRWLSAYRERHGFTPWPRRGTPSR
FT                   RQRS"
FT   gene            complement(550359..551279)
FT                   /locus_tag="Trad_0500"
FT   CDS_pept        complement(550359..551279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0500"
FT                   /product="1-phosphofructokinase"
FT                   /note="COGs: COG1105 Fructose-1-phosphate kinase and
FT                   related fructose-6-phosphate kinase (PfkB); InterPro
FT                   IPR008265:IPR002139:IPR011611:IPR017583; KEGG:
FT                   mxa:MXAN_2372 6-phosphofructokinase; PFAM: PfkB domain
FT                   protein; SPTR: Q1D9T1 6-phosphofructokinase; TIGRFAM:
FT                   1-phosphofructokinase; PFAM: pfkB family carbohydrate
FT                   kinase; TIGRFAM: 1-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13637"
FT                   /db_xref="GOA:D7CSA5"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSA5"
FT                   /protein_id="ADI13637.1"
FT                   /translation="MIHTVTANPALDLTYRVTELKLDDKLRATAVFRAPGGNGVNVSRV
FT                   AARLGHPTVAMGLVGGRAGDEFKELLKEEHVRTWFTQQSGTTRTNAIIQDDHAQQLRVS
FT                   GPGPEASPEETAMLRSSIFELRAPDFLVLSGSLQRGMPEDFYTDVIAEAKRQGVKVAAD
FT                   IDKELAQVVAAGVELIKPNQYELERLTGLRVTDIGSAVAAAERALAQGAKAVLASLGAQ
FT                   GAVLVTEGGAWQGVPPKVKADSAVGAGDSLLGGALVALAEGEGWEAALRLGVACGAATA
FT                   TTPGTDLCHKPTVEALLPQVVVTAL"
FT   gene            complement(551284..551553)
FT                   /locus_tag="Trad_0501"
FT   CDS_pept        complement(551284..551553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0501"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dra:DR_0202 hypothetical protein; SPTR: Q9RXV4
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13638"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSA6"
FT                   /protein_id="ADI13638.1"
FT                   /translation="MRRVAVVGTKLWRLFKRTLRRIATRDVLWGTNEETFRQAFLRRKS
FT                   LLLCKTHWRGRRRYEAHFATLLPHVRLLRLFEPAEAERLLKGLR"
FT   sig_peptide     complement(551485..551553)
FT                   /locus_tag="Trad_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(551568..552488)
FT                   /locus_tag="Trad_0502"
FT   CDS_pept        complement(551568..552488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0502"
FT                   /product="peptidase T2 asparaginase 2"
FT                   /note="COGs: COG1446 Asparaginase; InterPro IPR000246;
FT                   KEGG: azc:AZC_2990 aspartylglucosaminidase family protein;
FT                   PFAM: peptidase T2 asparaginase 2; SPTR: A8IDT5
FT                   Aspartylglucosaminidase family protein; PFAM: Asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13639"
FT                   /db_xref="GOA:D7CSA7"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSA7"
FT                   /protein_id="ADI13639.1"
FT                   /translation="MWLDTPMTRPLSSPLLVIHGGAGTIRDEDREAYTLGLIAARDAGF
FT                   AVLAGGGDALAAALAAVKVMEDNPDAFNAGTGGSPNARGEVECDAAVMSGADGSAGAVG
FT                   AVKTARNPVLLANKVRLETPHAFFVGAGAEALVDDPIDNESLLTERTRRAFRAWQQGAG
FT                   KPATSATVGAVVRDARGDLAAATSTGGMLGKWPGRVGDSPIIGAGTYADSRVAVSCTGK
FT                   GEAFIRAVTAKALAERLAAGAALEESVQRALEEVRGFGGSGGLISVTKAGELCVGFNSA
FT                   TMAYAWRAEDREGAVVGLEAGVFLL"
FT   sig_peptide     complement(552423..552488)
FT                   /locus_tag="Trad_0502"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            552616..553176
FT                   /locus_tag="Trad_0503"
FT   CDS_pept        552616..553176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0503"
FT                   /product="Septum formation inhibitor MinC"
FT                   /note="COGs: COG0850 Septum formation inhibitor; InterPro
FT                   IPR005526:IPR016098; KEGG: dge:Dgeo_0673 septum formation
FT                   inhibitor MinC; PFAM: Septum formation inhibitor MinC;
FT                   SPTR: C1XI01 Septum formation inhibitor; PFAM: Septum
FT                   formation inhibitor MinC, C-terminal domain; TIGRFAM:
FT                   septum site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13640"
FT                   /db_xref="GOA:D7CSA8"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSA8"
FT                   /protein_id="ADI13640.1"
FT                   /translation="MKTRGTRSGILLSLEPHDTPETLRARLGAQRELLTGKVFVELAER
FT                   TPWETLRTLDDIVTEAGGRLAEVRPPTAVTQARGETLIVGRTVRSGARLEARGSAIIIG
FT                   DVNAGAEVIAEDDIIVLGTLRGVAHAGAGGNERAIIWAQQVQSKQLRIAGALAQAGGDA
FT                   KTVSGPEVAQLHNGQIILRPWDP"
FT   gene            complement(553436..554209)
FT                   /locus_tag="Trad_0504"
FT   CDS_pept        complement(553436..554209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0504"
FT                   /product="Methyltransferase type 11"
FT                   /note="InterPro IPR013216; KEGG: cmu:TC0410 hypothetical
FT                   protein; PFAM: Methyltransferase type 11; SPTR: Q9PKQ5
FT                   Putative uncharacterized protein; PFAM: Methyltransferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13641"
FT                   /db_xref="GOA:D7CSA9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSA9"
FT                   /protein_id="ADI13641.1"
FT                   /translation="MVKRKPTTRPTPKVPAHSSWDPVAKWYNGWVGKRGSHYHRKSALP
FT                   TVLALSDPQKGERVLDIGCGQGVLAPAVLQRGAAYLGVDASRTLVRFARQNHPEARFVH
FT                   GDARRLEALAEVSAESFEVAVFMLSIQDMNPLEEVLQQAAWALSRGGRLVIFMVHPCFR
FT                   SPRGSGWGYDAARKLTYRRVEQYLTGRRVPMKAYAEAGVKSTGTTLSFHRPLKAYVNTL
FT                   AALGLLVDRLEELPDPHDERAPEIPLFAALRARKL"
FT   gene            554764..556635
FT                   /locus_tag="Trad_0505"
FT   CDS_pept        554764..556635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0505"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1132 ABC-type multidrug transport system
FT                   ATPase and permease components;
FT                   InterProIPR017871:IPR001140:IPR003439:IPR017940:IPR
FT                   011527:IPR003593; KEGG: gvi:glr2719 HlyB/MsbA family ABC
FT                   transporter; PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; SPTR: Q7NH18
FT                   HlyB/MsbA family ABC transporter; PFAM: ABC transporter
FT                   transmembrane region; ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13642"
FT                   /db_xref="GOA:D7CSB0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSB0"
FT                   /protein_id="ADI13642.1"
FT                   /translation="MLPSAPTPKAPPLKRYGALLGRYLRPQGRKVALMATLLLASIGLQ
FT                   LVVPQILRFFIDTAEAGGALDALVRAALLFLGAALVNQLLSAAATYYAADVGWSATNAM
FT                   RADLARHALGLDLSFHTARTPGEMIERIDGDVTALANFFSQFSVRVLGGALMLLGILVI
FT                   LWLEHAGVGLALTLFVGCVFGALYFTRNVAVAATRDEREASAQLFGFVEERLSGLDDLR
FT                   ANGGGAYTMHAFNRVAREFFYKGRRAWMKRSTIWMLSYGMFTLGDLITLGAAIYLYSTG
FT                   AVTLGTAYLFFQYMLMLEAPVEEITQQMQELQKAGAGVARIDELFALRSELPRGRALPL
FT                   PEGALGVSFERLSFAYGDARILDEVSFRLEPGKVLGLLGRTGSGKTTLTRLLLRHYDAS
FT                   AGSLRLGPLGGGVEVRDIDPDVLRRRIGLVTQEVQLFHASVRDNLTFFDPTVPDERITA
FT                   VLHDLGLGSWLAGLENGLDTLLAAGGSGLSAGQAQLLAFARVFLTDPGLVILDEPSSRL
FT                   DPATEALLERAVDRLLAGRTAIIIAHRLKTVRRADDILVLEGGRVLEHGPRARLARDPR
FT                   SRFYRLLRAGGEGSGATLQASLTARDDPNELDDPFGAEFEGATKELA"
FT   gene            556632..558455
FT                   /locus_tag="Trad_0506"
FT   CDS_pept        556632..558455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0506"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1132 ABC-type multidrug transport system
FT                   ATPase and permease components;
FT                   InterProIPR001140:IPR003439:IPR017940:IPR011527:IPR 003593;
FT                   KEGG: dra:DR_0095 ABC transporter, ATP-binding protein;
FT                   PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; SPTR: Q9RY55 ABC
FT                   transporter, ATP-binding protein; PFAM: ABC transporter
FT                   transmembrane region; ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13643"
FT                   /db_xref="GOA:D7CSB1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSB1"
FT                   /protein_id="ADI13643.1"
FT                   /translation="MSTQTASRAPSQTAGHPSWTTARLMRRLLGYRTGYFGLNIILWIL
FT                   IHLTPAAFPVLIQGLFDALAGASPFGLNAWSFLALLTALNLGRIGLFFAGIWTWATYWH
FT                   ELSLLLRRNLIDHLVRAPGSRVLPDSPSEAVSRFRDDVDEVTLYVESWVDFGGLALYAV
FT                   AAAALMASVNPSITLLVFAPLIGMVLLTRAFTERIRHYRRRSRAATGRVTDFIGETFAA
FT                   VQAVKIAGAEDRVVRHFEGLNRTRRAAALKDVLLTEVLRGVNVNMMTITTGIILLVAAG
FT                   PMLRGSFSVGDFALFVAFLPRLTNVMAFMGDLLAQHKRTGVSFERMQWLLQDAPPEKLV
FT                   ARDPLDLRGEVPEVPQPHPEPGEQLARLEVRGLTCHHPGTANGVTDVTFALERGSFTVI
FT                   TGRVGSGKTTLLRALMGLLPKASGEILWNGQPVQDPASWFVPPRSAYTAQVPRLFSDTL
FT                   RHNILMGRTGDGSAQVLQDALELAVMTPDVRRLEHGLDTPVGTRGVKLSGGQVQRASAA
FT                   RMFLRGAELLVFDDLSSALDVETEQRLWAQLFARRATCLVVSHRRAALERADHIVVLEG
FT                   GRVAAQGTLAALLEASPEMRRLWAEEGVGEG"
FT   sig_peptide     556632..556784
FT                   /locus_tag="Trad_0506"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(558533..560299)
FT                   /locus_tag="Trad_0507"
FT   CDS_pept        complement(558533..560299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0507"
FT                   /product="para-aminobenzoate synthase, subunit I"
FT                   /note="COGs: COG0147 Anthranilate/para-aminobenzoate
FT                   synthase component I;
FT                   InterProIPR019999:IPR015890:IPR001544:IPR005801:IPR 005802;
FT                   KEGG: hau:Haur_2989 para-aminobenzoate synthase, subunit I;
FT                   PFAM: Chorismate binding-like; aminotransferase class IV;
FT                   SPTR: A9B3Q5 Para-aminobenzoate synthase, subunit I;
FT                   TIGRFAM: para-aminobenzoate synthase, subunit I; manually
FT                   curated; PFAM: Aminotransferase class IV; chorismate
FT                   binding enzyme; TIGRFAM: aminodeoxychorismate synthase,
FT                   component I, bacterial clade"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13644"
FT                   /db_xref="GOA:D7CSB2"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSB2"
FT                   /protein_id="ADI13644.1"
FT                   /translation="MLVFDFSPGPRRVFGRPLEVIRADRLGEVAGAFAAVQRAVSGGLY
FT                   AAGFVAYEAAPAFDEALRTHPPGPLPLVWFGLYEAPTGSAPLTARPPSRMGGWALDTSP
FT                   EAYARAVAAIQGAIADGVTYQANYTVRLRGRVREPSSENLFALYEALRRVHAPPYASYL
FT                   ELGEAHLLSLSPELFFSVRGTRVTARPMKGTAARGRWLEEDEAQQRALLASPKERAENV
FT                   MIVDLLRNDLGKLARPGGVRVPALLSLETYPTFHTLTSTVTADLPERPTLWALFRALFP
FT                   CGSVTGAPKVSTMQLLRRLETTPRGVYCGAIGFVTPHGEMRFSVPIRTLVVTPDGRAEY
FT                   GVGSGVTYDARAEAEYEELATKAAAITRPRPEVELLETLLWDGARYTLLARHLRRMETS
FT                   ARFFGVAFDARALQRALMAHAEAFRGERRRVRARLSHSGVAVESTPYAPPPERPPVALA
FT                   RTPIDPRDPFLYHKTTHREVYARHRRAFPDAFDVLLWNGRGELTEFTIGNLVVERRGER
FT                   LTPPREAGLLAGTFRAELLEAGEITERPLFKHDLLDASRVWLVNSVHGWVEVQLQNAFR
FT                   RSFGAAEAGAPP"
FT   sig_peptide     complement(560255..560299)
FT                   /locus_tag="Trad_0507"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            560316..561389
FT                   /locus_tag="Trad_0508"
FT   CDS_pept        560316..561389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0508"
FT                   /product="Threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /note="COGs: COG2008 Threonine aldolase; InterPro
FT                   IPR001597:IPR015424:IPR015421:IPR015422; KEGG:
FT                   dge:Dgeo_1451 threonine aldolase; PFAM: aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; PRIAM: Threonine
FT                   aldolase; SPTR: Q1IYD8 Threonine aldolase; manually
FT                   curated; PFAM: Beta-eliminating lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13645"
FT                   /db_xref="GOA:D7CSB3"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSB3"
FT                   /protein_id="ADI13645.1"
FT                   /translation="MPRRPNDAPTDARPIDRRPIDLRSDTVTRPTPAMRRAMAEAEVGD
FT                   DVYGEDPTVNRLQEVLAERAGFEAGLLMPTGTMSNQVAIAVHTRRGEEVIVPEGAHVYE
FT                   YELGSMAVVSGALPRTIPAPLGVPEAAAVRAAVHRSVHQAPTGLIVLENTHNRAGGTVV
FT                   PLGRCAEIATVAREEGLPLHLDGARAFNAAAALGVSLAEVCRGFDSASLCLSKGLAAPV
FT                   GTVLLGSTAFIREAHRYRKLLGGGMRQAGVVAAAGLVALDEMSARLAEDHARARALAEG
FT                   LVRLGVSVDLAAVQTNMVYLTVPDAPALAARLARKGVLCGALGPQSVRMVTHYEIGDDD
FT                   VARTLEAVEACLEEARV"
FT   gene            561386..562216
FT                   /locus_tag="Trad_0509"
FT   CDS_pept        561386..562216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0509"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="COGs: COG0169 Shikimate 5-dehydrogenase; InterPro
FT                   IPR013708:IPR006151:IPR016040:IPR011342; KEGG:
FT                   mta:Moth_1558 shikimate dehydrogenase; PFAM: Shikimate
FT                   dehydrogenase substrate binding domain protein;
FT                   Shikimate/quinate 5-dehydrogenase; SPTR: Q2RI72 Shikimate
FT                   dehydrogenase; TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate dehydrogenase substrate binding domain; Shikimate
FT                   / quinate 5-dehydrogenase; TIGRFAM: shikimate
FT                   5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13646"
FT                   /db_xref="GOA:D7CSB4"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSB4"
FT                   /protein_id="ADI13646.1"
FT                   /translation="MKRAFLLAGSASYTLSPAMHNAAFRALGARAHYEALALAAAELPE
FT                   AVARLRDPGCLGANVTIPHKLAVVPLLDTLSEAARATGAVNTIVNRGGALEGHNTDAAG
FT                   FMRALKEDGGYDPAGQEVVLLGAGGSARAVAYALLRSGVARLAVYNRTLERAHALARAL
FT                   GPYGELEVLSPAQLKGRVRSAALLVNTTSVGLSGVQEGASPLPEDALPRAMVCDIIYRP
FT                   PQTTLLKRASAAGLAVQNGLPMLVYQGAEALTLWTGLPAPVAVMRAAAEAALAA"
FT   sig_peptide     561386..561469
FT                   /locus_tag="Trad_0509"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            562957..563937
FT                   /locus_tag="Trad_0510"
FT   CDS_pept        562957..563937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pth:PTH_1110 hypothetical protein; SPTR:
FT                   A5D390 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13647"
FT                   /db_xref="GOA:D7CSB5"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSB5"
FT                   /protein_id="ADI13647.1"
FT                   /translation="MERTGIAPELDPVRMADSGDLYVYGRNMNHYLTSLILAYRTTGDR
FT                   RLVQQIDTVMNRMQGTLRDTTGDGFRNWRYLRSGSGSFYGRDTHEMDEMMTHSVVAAAA
FT                   YTLRQAGFNSSADFWTNYLRNDFEAKWRRRKGVRSGFPFLTRNLMHPYVQWIRYHHYMG
FT                   KLTGDSGYTAEARRMARIVENNMRSVNTPSGTGYVWDHRVQLSGRASNGCQPMVYVRLT
FT                   TQGLADLATQGVFSNTFMQRVANGMAHVGLKSTDGQLAGNICGSGTYSNRSAVRNFPYA
FT                   QIASWDRSGRLRTAAERVYNATERHNLSQPRLYNLPATMVFTLGR"
FT   gene            complement(564291..565160)
FT                   /locus_tag="Trad_0511"
FT   CDS_pept        complement(564291..565160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0511"
FT                   /product="metallophosphoesterase"
FT                   /note="COGs: COG1408 phosphohydrolase; InterPro IPR004843;
FT                   KEGG: gym:GYMC10_5433 metallophosphoesterase; PFAM:
FT                   metallophosphoesterase; SPTR: A3IRX3
FT                   Metallophosphoesterase; PFAM: Calcineurin-like
FT                   phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13648"
FT                   /db_xref="GOA:D7CSB6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSB6"
FT                   /protein_id="ADI13648.1"
FT                   /translation="MTPWVFLVVGLFVIGVIQALIEPRMLVTERHKAHVPGLPASWEGA
FT                   TVALLADFQVGLFGDNRSTVGRAVERVLEERPALVLIAGDFIHDTARAIEPVTELLCPL
FT                   TDAGLPCYAVLGNHDYAMPTEKDTPDLELARRLTSALEEIDVQVLENEAVRLENEAGEA
FT                   LYLVGIGTHTPGHDDPEKALAAVPEGAPRIVMMHHPSSFANVPACAAPFAVAGHTHGGQ
FT                   VRLPLGPGWSLLTWLRDGEVYTDDWVRGHGKVGNRLYVTRGLGCSVAPVRLNCLPELTL
FT                   FTLTAQKV"
FT   sig_peptide     complement(565104..565160)
FT                   /locus_tag="Trad_0511"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            565411..567456
FT                   /locus_tag="Trad_0512"
FT   CDS_pept        565411..567456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0512"
FT                   /product="PKD domain containing protein"
FT                   /note="InterPro IPR000601; KEGG: afw:Anae109_3722
FT                   hypothetical protein; PFAM: PKD domain containing protein;
FT                   SMART: PKD domain containing protein; SPTR: A7BMA0 Putative
FT                   uncharacterized protein; PFAM: PKD domain; TIGRFAM:
FT                   Listeria/Bacterioides repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13649"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSB7"
FT                   /protein_id="ADI13649.1"
FT                   /translation="MKKRLWSLPLLLLVGLMGCGGPGGPDPNVTPPQITSFTANPSAIS
FT                   APGQAVTLSWTVSGAVTSLNLSADNGTSPGAVSGSSTVVYPTQNTTYTLTASNSAGSAS
FT                   SSTNVTIGGNVSPPGGENGLPPTGTFGVSLTQSDFQNDAGSNISSPDDPRIVRVQPGGT
FT                   FYALVSYSDPGGISGVSIRIANSSPPGLAAPLVQGQEVGGFTLVGEVAGCDLSGTQTSV
FT                   NCIYEIRVGNIQNIDQLQGSGSEFAYVFRTNVTDNAGNTSDEAIRGYVIVGSNTSNPPS
FT                   QPSPPSPPSPPSPPSPPSPPSPPSPPSPPSPPSPPSPPSPPSPPSPPSPPPSPTTYTLT
FT                   VNKTGNGSGTVKSNPSGIDCGSDCTENYQSGTQVTLTATAANGSTFAGWSGACSGTGTC
FT                   QVTMSQARNVTAKFDAASPTPMTYTLTVNKPQNGTVTSTPQGINCGVNGNDCTEDYTSG
FT                   TKVTLSANPATGYKFDSWGGACSGSTCEVTMNAATTVSATFSAVPQELNAEAGPARRSA
FT                   TVGETVQLDGSASTGATTYLWTMEKPTGSNATISGVTRVRASFVPDVPGQYKVTLTVGN
FT                   GTDTDTDEQVVDVTLPAPVADAGDDREVKVNQSTPLDATDSKNAASFKWEVTTKAPGSS
FT                   PQIAEPTKASTTFTADVVGEYVVTLTVFDSEGKQSDKDTVKITVIP"
FT   sig_peptide     565411..565539
FT                   /locus_tag="Trad_0512"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            567608..569140
FT                   /locus_tag="Trad_0513"
FT   CDS_pept        567608..569140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0513"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="COGs: COG1884 Methylmalonyl-CoA mutase N-terminal
FT                   domain/subunit; InterPro
FT                   IPR006099:IPR016176:IPR014348:IPR006098; KEGG: ttj:TTHA1246
FT                   methylmalonyl-CoA mutase; PFAM: methylmalonyl-CoA mutase;
FT                   PRIAM: Methylmalonyl-CoA mutase; SPTR: C1XUL4
FT                   Methylmalonyl-CoA mutase; TIGRFAM: methylmalonyl-CoA
FT                   mutase, large subunit; PFAM: Methylmalonyl-CoA mutase;
FT                   TIGRFAM: methylmalonyl-CoA mutase N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13650"
FT                   /db_xref="GOA:D7CSB8"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterP