(data stored in ACNUC7421 zone)

EMBL: CP002050

ID   CP002050; SV 1; circular; genomic DNA; STD; PRO; 3650813 BP.
XX
AC   CP002050;
XX
PR   Project:PRJNA41701;
XX
DT   03-JUN-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Geobacillus sp. C56-T3, complete genome.
XX
KW   .
XX
OS   Geobacillus sp. C56-T3
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
XX
RN   [1]
RP   1-3650813
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Kyrpides N., Mikhailova N., Kourtz L., Brumm P., Mead D., Woyke T.;
RT   "Complete sequence of Geobacillus sp. C56-T3";
RL   Unpublished.
XX
RN   [2]
RP   1-3650813
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Kyrpides N., Mikhailova N., Kourtz L., Brumm P., Mead D., Woyke T.;
RT   ;
RL   Submitted (21-MAY-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; a6104a540b0e5cfcdf7c9a231deae3f0.
DR   BioSample; SAMN02598534.
DR   EnsemblGenomes-Gn; EBG00001433958.
DR   EnsemblGenomes-Gn; EBG00001433959.
DR   EnsemblGenomes-Gn; EBG00001433960.
DR   EnsemblGenomes-Gn; EBG00001433961.
DR   EnsemblGenomes-Gn; EBG00001433962.
DR   EnsemblGenomes-Gn; EBG00001433963.
DR   EnsemblGenomes-Gn; EBG00001433964.
DR   EnsemblGenomes-Gn; EBG00001433965.
DR   EnsemblGenomes-Gn; EBG00001433966.
DR   EnsemblGenomes-Gn; EBG00001433967.
DR   EnsemblGenomes-Gn; EBG00001433968.
DR   EnsemblGenomes-Gn; EBG00001433969.
DR   EnsemblGenomes-Gn; EBG00001433970.
DR   EnsemblGenomes-Gn; EBG00001433971.
DR   EnsemblGenomes-Gn; EBG00001433972.
DR   EnsemblGenomes-Gn; EBG00001433973.
DR   EnsemblGenomes-Gn; EBG00001433974.
DR   EnsemblGenomes-Gn; EBG00001433975.
DR   EnsemblGenomes-Gn; EBG00001433976.
DR   EnsemblGenomes-Gn; EBG00001433977.
DR   EnsemblGenomes-Gn; EBG00001433978.
DR   EnsemblGenomes-Gn; EBG00001433979.
DR   EnsemblGenomes-Gn; EBG00001433980.
DR   EnsemblGenomes-Gn; EBG00001433981.
DR   EnsemblGenomes-Gn; EBG00001433982.
DR   EnsemblGenomes-Gn; EBG00001433983.
DR   EnsemblGenomes-Gn; EBG00001433984.
DR   EnsemblGenomes-Gn; EBG00001433985.
DR   EnsemblGenomes-Gn; EBG00001433986.
DR   EnsemblGenomes-Gn; EBG00001433987.
DR   EnsemblGenomes-Gn; EBG00001433988.
DR   EnsemblGenomes-Gn; EBG00001433989.
DR   EnsemblGenomes-Gn; EBG00001433990.
DR   EnsemblGenomes-Gn; EBG00001433991.
DR   EnsemblGenomes-Gn; EBG00001433992.
DR   EnsemblGenomes-Gn; EBG00001433993.
DR   EnsemblGenomes-Gn; EBG00001433994.
DR   EnsemblGenomes-Gn; EBG00001433995.
DR   EnsemblGenomes-Gn; EBG00001433996.
DR   EnsemblGenomes-Gn; EBG00001433997.
DR   EnsemblGenomes-Gn; EBG00001433998.
DR   EnsemblGenomes-Gn; EBG00001433999.
DR   EnsemblGenomes-Gn; EBG00001434000.
DR   EnsemblGenomes-Gn; EBG00001434001.
DR   EnsemblGenomes-Gn; EBG00001434002.
DR   EnsemblGenomes-Gn; EBG00001434003.
DR   EnsemblGenomes-Gn; EBG00001434004.
DR   EnsemblGenomes-Gn; EBG00001434005.
DR   EnsemblGenomes-Gn; EBG00001434006.
DR   EnsemblGenomes-Gn; EBG00001434007.
DR   EnsemblGenomes-Gn; EBG00001434008.
DR   EnsemblGenomes-Gn; EBG00001434009.
DR   EnsemblGenomes-Gn; EBG00001434010.
DR   EnsemblGenomes-Gn; EBG00001434011.
DR   EnsemblGenomes-Gn; EBG00001434012.
DR   EnsemblGenomes-Gn; EBG00001434013.
DR   EnsemblGenomes-Gn; EBG00001434014.
DR   EnsemblGenomes-Gn; EBG00001434015.
DR   EnsemblGenomes-Gn; EBG00001434016.
DR   EnsemblGenomes-Gn; EBG00001434017.
DR   EnsemblGenomes-Gn; EBG00001434018.
DR   EnsemblGenomes-Gn; EBG00001434019.
DR   EnsemblGenomes-Gn; EBG00001434020.
DR   EnsemblGenomes-Gn; EBG00001434021.
DR   EnsemblGenomes-Gn; EBG00001434022.
DR   EnsemblGenomes-Gn; EBG00001434023.
DR   EnsemblGenomes-Gn; EBG00001434024.
DR   EnsemblGenomes-Gn; EBG00001434025.
DR   EnsemblGenomes-Gn; EBG00001434026.
DR   EnsemblGenomes-Gn; EBG00001434027.
DR   EnsemblGenomes-Gn; EBG00001434028.
DR   EnsemblGenomes-Gn; EBG00001434029.
DR   EnsemblGenomes-Gn; EBG00001434030.
DR   EnsemblGenomes-Gn; EBG00001434031.
DR   EnsemblGenomes-Gn; EBG00001434032.
DR   EnsemblGenomes-Gn; EBG00001434033.
DR   EnsemblGenomes-Gn; EBG00001434034.
DR   EnsemblGenomes-Gn; EBG00001434035.
DR   EnsemblGenomes-Gn; EBG00001434036.
DR   EnsemblGenomes-Gn; EBG00001434037.
DR   EnsemblGenomes-Gn; EBG00001434038.
DR   EnsemblGenomes-Gn; EBG00001434039.
DR   EnsemblGenomes-Gn; EBG00001434040.
DR   EnsemblGenomes-Gn; EBG00001434041.
DR   EnsemblGenomes-Gn; EBG00001434042.
DR   EnsemblGenomes-Gn; EBG00001434043.
DR   EnsemblGenomes-Gn; EBG00001434044.
DR   EnsemblGenomes-Gn; EBG00001434045.
DR   EnsemblGenomes-Gn; EBG00001434046.
DR   EnsemblGenomes-Gn; EBG00001434047.
DR   EnsemblGenomes-Gn; EBG00001434048.
DR   EnsemblGenomes-Gn; EBG00001434049.
DR   EnsemblGenomes-Gn; EBG00001434050.
DR   EnsemblGenomes-Gn; EBG00001434051.
DR   EnsemblGenomes-Gn; EBG00001434052.
DR   EnsemblGenomes-Gn; EBG00001434053.
DR   EnsemblGenomes-Gn; EBG00001434054.
DR   EnsemblGenomes-Gn; EBG00001434055.
DR   EnsemblGenomes-Gn; EBG00001434056.
DR   EnsemblGenomes-Gn; EBG00001434057.
DR   EnsemblGenomes-Gn; EBG00001434058.
DR   EnsemblGenomes-Gn; EBG00001434059.
DR   EnsemblGenomes-Gn; EBG00001434060.
DR   EnsemblGenomes-Gn; EBG00001434061.
DR   EnsemblGenomes-Gn; EBG00001434062.
DR   EnsemblGenomes-Gn; EBG00001434063.
DR   EnsemblGenomes-Gn; EBG00001434064.
DR   EnsemblGenomes-Gn; EBG00001434065.
DR   EnsemblGenomes-Gn; EBG00001434066.
DR   EnsemblGenomes-Gn; EBG00001434067.
DR   EnsemblGenomes-Gn; EBG00001434068.
DR   EnsemblGenomes-Gn; EBG00001434069.
DR   EnsemblGenomes-Gn; EBG00001434070.
DR   EnsemblGenomes-Gn; EBG00001434071.
DR   EnsemblGenomes-Gn; EBG00001434072.
DR   EnsemblGenomes-Gn; EBG00001434073.
DR   EnsemblGenomes-Gn; EBG00001434074.
DR   EnsemblGenomes-Gn; EBG00001434075.
DR   EnsemblGenomes-Gn; EBG00001434076.
DR   EnsemblGenomes-Gn; EBG00001434077.
DR   EnsemblGenomes-Gn; EBG00001434078.
DR   EnsemblGenomes-Gn; EBG00001434079.
DR   EnsemblGenomes-Gn; EBG00001434080.
DR   EnsemblGenomes-Gn; EBG00001434081.
DR   EnsemblGenomes-Gn; EBG00001434082.
DR   EnsemblGenomes-Gn; EBG00001434083.
DR   EnsemblGenomes-Gn; EBG00001434084.
DR   EnsemblGenomes-Gn; EBG00001434085.
DR   EnsemblGenomes-Gn; EBG00001434086.
DR   EnsemblGenomes-Gn; EBG00001434087.
DR   EnsemblGenomes-Gn; EBG00001434088.
DR   EnsemblGenomes-Gn; EBG00001434089.
DR   EnsemblGenomes-Gn; EBG00001434090.
DR   EnsemblGenomes-Gn; EBG00001434091.
DR   EnsemblGenomes-Gn; EBG00001434092.
DR   EnsemblGenomes-Gn; EBG00001434093.
DR   EnsemblGenomes-Gn; EBG00001434094.
DR   EnsemblGenomes-Gn; EBG00001434095.
DR   EnsemblGenomes-Gn; EBG00001434096.
DR   EnsemblGenomes-Gn; EBG00001434097.
DR   EnsemblGenomes-Gn; EBG00001434098.
DR   EnsemblGenomes-Gn; EBG00001434099.
DR   EnsemblGenomes-Gn; EBG00001434100.
DR   EnsemblGenomes-Gn; EBG00001434101.
DR   EnsemblGenomes-Gn; EBG00001434102.
DR   EnsemblGenomes-Gn; EBG00001434103.
DR   EnsemblGenomes-Gn; EBG00001434104.
DR   EnsemblGenomes-Gn; EBG00001434105.
DR   EnsemblGenomes-Gn; GC56T3_R0001.
DR   EnsemblGenomes-Gn; GC56T3_R0002.
DR   EnsemblGenomes-Gn; GC56T3_R0003.
DR   EnsemblGenomes-Gn; GC56T3_R0004.
DR   EnsemblGenomes-Gn; GC56T3_R0005.
DR   EnsemblGenomes-Gn; GC56T3_R0006.
DR   EnsemblGenomes-Gn; GC56T3_R0007.
DR   EnsemblGenomes-Gn; GC56T3_R0008.
DR   EnsemblGenomes-Gn; GC56T3_R0009.
DR   EnsemblGenomes-Gn; GC56T3_R0010.
DR   EnsemblGenomes-Gn; GC56T3_R0011.
DR   EnsemblGenomes-Gn; GC56T3_R0012.
DR   EnsemblGenomes-Gn; GC56T3_R0013.
DR   EnsemblGenomes-Gn; GC56T3_R0014.
DR   EnsemblGenomes-Gn; GC56T3_R0015.
DR   EnsemblGenomes-Gn; GC56T3_R0016.
DR   EnsemblGenomes-Gn; GC56T3_R0017.
DR   EnsemblGenomes-Gn; GC56T3_R0018.
DR   EnsemblGenomes-Gn; GC56T3_R0019.
DR   EnsemblGenomes-Gn; GC56T3_R0020.
DR   EnsemblGenomes-Gn; GC56T3_R0021.
DR   EnsemblGenomes-Gn; GC56T3_R0022.
DR   EnsemblGenomes-Gn; GC56T3_R0023.
DR   EnsemblGenomes-Gn; GC56T3_R0024.
DR   EnsemblGenomes-Gn; GC56T3_R0025.
DR   EnsemblGenomes-Gn; GC56T3_R0026.
DR   EnsemblGenomes-Gn; GC56T3_R0027.
DR   EnsemblGenomes-Gn; GC56T3_R0028.
DR   EnsemblGenomes-Gn; GC56T3_R0029.
DR   EnsemblGenomes-Gn; GC56T3_R0030.
DR   EnsemblGenomes-Gn; GC56T3_R0031.
DR   EnsemblGenomes-Gn; GC56T3_R0032.
DR   EnsemblGenomes-Gn; GC56T3_R0033.
DR   EnsemblGenomes-Gn; GC56T3_R0034.
DR   EnsemblGenomes-Gn; GC56T3_R0035.
DR   EnsemblGenomes-Gn; GC56T3_R0036.
DR   EnsemblGenomes-Gn; GC56T3_R0037.
DR   EnsemblGenomes-Gn; GC56T3_R0038.
DR   EnsemblGenomes-Gn; GC56T3_R0039.
DR   EnsemblGenomes-Gn; GC56T3_R0040.
DR   EnsemblGenomes-Gn; GC56T3_R0041.
DR   EnsemblGenomes-Gn; GC56T3_R0042.
DR   EnsemblGenomes-Gn; GC56T3_R0043.
DR   EnsemblGenomes-Gn; GC56T3_R0044.
DR   EnsemblGenomes-Gn; GC56T3_R0045.
DR   EnsemblGenomes-Gn; GC56T3_R0046.
DR   EnsemblGenomes-Gn; GC56T3_R0047.
DR   EnsemblGenomes-Gn; GC56T3_R0048.
DR   EnsemblGenomes-Gn; GC56T3_R0049.
DR   EnsemblGenomes-Gn; GC56T3_R0050.
DR   EnsemblGenomes-Gn; GC56T3_R0051.
DR   EnsemblGenomes-Gn; GC56T3_R0052.
DR   EnsemblGenomes-Gn; GC56T3_R0053.
DR   EnsemblGenomes-Gn; GC56T3_R0054.
DR   EnsemblGenomes-Gn; GC56T3_R0055.
DR   EnsemblGenomes-Gn; GC56T3_R0056.
DR   EnsemblGenomes-Gn; GC56T3_R0057.
DR   EnsemblGenomes-Gn; GC56T3_R0058.
DR   EnsemblGenomes-Gn; GC56T3_R0059.
DR   EnsemblGenomes-Gn; GC56T3_R0060.
DR   EnsemblGenomes-Gn; GC56T3_R0061.
DR   EnsemblGenomes-Gn; GC56T3_R0062.
DR   EnsemblGenomes-Gn; GC56T3_R0063.
DR   EnsemblGenomes-Gn; GC56T3_R0064.
DR   EnsemblGenomes-Gn; GC56T3_R0065.
DR   EnsemblGenomes-Gn; GC56T3_R0066.
DR   EnsemblGenomes-Gn; GC56T3_R0067.
DR   EnsemblGenomes-Gn; GC56T3_R0068.
DR   EnsemblGenomes-Gn; GC56T3_R0069.
DR   EnsemblGenomes-Gn; GC56T3_R0070.
DR   EnsemblGenomes-Gn; GC56T3_R0071.
DR   EnsemblGenomes-Gn; GC56T3_R0072.
DR   EnsemblGenomes-Gn; GC56T3_R0073.
DR   EnsemblGenomes-Gn; GC56T3_R0074.
DR   EnsemblGenomes-Gn; GC56T3_R0075.
DR   EnsemblGenomes-Gn; GC56T3_R0076.
DR   EnsemblGenomes-Gn; GC56T3_R0077.
DR   EnsemblGenomes-Gn; GC56T3_R0078.
DR   EnsemblGenomes-Gn; GC56T3_R0079.
DR   EnsemblGenomes-Gn; GC56T3_R0080.
DR   EnsemblGenomes-Gn; GC56T3_R0081.
DR   EnsemblGenomes-Gn; GC56T3_R0082.
DR   EnsemblGenomes-Gn; GC56T3_R0083.
DR   EnsemblGenomes-Gn; GC56T3_R0084.
DR   EnsemblGenomes-Gn; GC56T3_R0085.
DR   EnsemblGenomes-Gn; GC56T3_R0086.
DR   EnsemblGenomes-Gn; GC56T3_R0087.
DR   EnsemblGenomes-Gn; GC56T3_R0088.
DR   EnsemblGenomes-Gn; GC56T3_R0089.
DR   EnsemblGenomes-Gn; GC56T3_R0090.
DR   EnsemblGenomes-Gn; GC56T3_R0091.
DR   EnsemblGenomes-Gn; GC56T3_R0092.
DR   EnsemblGenomes-Gn; GC56T3_R0093.
DR   EnsemblGenomes-Gn; GC56T3_R0094.
DR   EnsemblGenomes-Gn; GC56T3_R0095.
DR   EnsemblGenomes-Gn; GC56T3_R0096.
DR   EnsemblGenomes-Gn; GC56T3_R0097.
DR   EnsemblGenomes-Gn; GC56T3_R0098.
DR   EnsemblGenomes-Gn; GC56T3_R0099.
DR   EnsemblGenomes-Gn; GC56T3_R0100.
DR   EnsemblGenomes-Gn; GC56T3_R0101.
DR   EnsemblGenomes-Gn; GC56T3_R0102.
DR   EnsemblGenomes-Gn; GC56T3_R0103.
DR   EnsemblGenomes-Gn; GC56T3_R0104.
DR   EnsemblGenomes-Gn; GC56T3_R0105.
DR   EnsemblGenomes-Gn; GC56T3_R0106.
DR   EnsemblGenomes-Gn; GC56T3_R0107.
DR   EnsemblGenomes-Gn; GC56T3_R0108.
DR   EnsemblGenomes-Gn; GC56T3_R0109.
DR   EnsemblGenomes-Gn; GC56T3_R0110.
DR   EnsemblGenomes-Gn; GC56T3_R0111.
DR   EnsemblGenomes-Gn; GC56T3_R0112.
DR   EnsemblGenomes-Gn; GC56T3_R0113.
DR   EnsemblGenomes-Gn; GC56T3_R0114.
DR   EnsemblGenomes-Gn; GC56T3_R0115.
DR   EnsemblGenomes-Gn; GC56T3_R0116.
DR   EnsemblGenomes-Gn; GC56T3_R0117.
DR   EnsemblGenomes-Gn; GC56T3_R0118.
DR   EnsemblGenomes-Tr; EBT00001811791.
DR   EnsemblGenomes-Tr; EBT00001811792.
DR   EnsemblGenomes-Tr; EBT00001811793.
DR   EnsemblGenomes-Tr; EBT00001811794.
DR   EnsemblGenomes-Tr; EBT00001811795.
DR   EnsemblGenomes-Tr; EBT00001811796.
DR   EnsemblGenomes-Tr; EBT00001811797.
DR   EnsemblGenomes-Tr; EBT00001811798.
DR   EnsemblGenomes-Tr; EBT00001811799.
DR   EnsemblGenomes-Tr; EBT00001811800.
DR   EnsemblGenomes-Tr; EBT00001811801.
DR   EnsemblGenomes-Tr; EBT00001811802.
DR   EnsemblGenomes-Tr; EBT00001811803.
DR   EnsemblGenomes-Tr; EBT00001811804.
DR   EnsemblGenomes-Tr; EBT00001811805.
DR   EnsemblGenomes-Tr; EBT00001811806.
DR   EnsemblGenomes-Tr; EBT00001811807.
DR   EnsemblGenomes-Tr; EBT00001811808.
DR   EnsemblGenomes-Tr; EBT00001811809.
DR   EnsemblGenomes-Tr; EBT00001811810.
DR   EnsemblGenomes-Tr; EBT00001811811.
DR   EnsemblGenomes-Tr; EBT00001811812.
DR   EnsemblGenomes-Tr; EBT00001811813.
DR   EnsemblGenomes-Tr; EBT00001811814.
DR   EnsemblGenomes-Tr; EBT00001811815.
DR   EnsemblGenomes-Tr; EBT00001811816.
DR   EnsemblGenomes-Tr; EBT00001811817.
DR   EnsemblGenomes-Tr; EBT00001811818.
DR   EnsemblGenomes-Tr; EBT00001811819.
DR   EnsemblGenomes-Tr; EBT00001811820.
DR   EnsemblGenomes-Tr; EBT00001811821.
DR   EnsemblGenomes-Tr; EBT00001811822.
DR   EnsemblGenomes-Tr; EBT00001811823.
DR   EnsemblGenomes-Tr; EBT00001811824.
DR   EnsemblGenomes-Tr; EBT00001811825.
DR   EnsemblGenomes-Tr; EBT00001811826.
DR   EnsemblGenomes-Tr; EBT00001811827.
DR   EnsemblGenomes-Tr; EBT00001811828.
DR   EnsemblGenomes-Tr; EBT00001811829.
DR   EnsemblGenomes-Tr; EBT00001811830.
DR   EnsemblGenomes-Tr; EBT00001811831.
DR   EnsemblGenomes-Tr; EBT00001811832.
DR   EnsemblGenomes-Tr; EBT00001811833.
DR   EnsemblGenomes-Tr; EBT00001811834.
DR   EnsemblGenomes-Tr; EBT00001811835.
DR   EnsemblGenomes-Tr; EBT00001811836.
DR   EnsemblGenomes-Tr; EBT00001811837.
DR   EnsemblGenomes-Tr; EBT00001811838.
DR   EnsemblGenomes-Tr; EBT00001811839.
DR   EnsemblGenomes-Tr; EBT00001811840.
DR   EnsemblGenomes-Tr; EBT00001811841.
DR   EnsemblGenomes-Tr; EBT00001811842.
DR   EnsemblGenomes-Tr; EBT00001811843.
DR   EnsemblGenomes-Tr; EBT00001811844.
DR   EnsemblGenomes-Tr; EBT00001811845.
DR   EnsemblGenomes-Tr; EBT00001811846.
DR   EnsemblGenomes-Tr; EBT00001811847.
DR   EnsemblGenomes-Tr; EBT00001811848.
DR   EnsemblGenomes-Tr; EBT00001811849.
DR   EnsemblGenomes-Tr; EBT00001811850.
DR   EnsemblGenomes-Tr; EBT00001811851.
DR   EnsemblGenomes-Tr; EBT00001811852.
DR   EnsemblGenomes-Tr; EBT00001811853.
DR   EnsemblGenomes-Tr; EBT00001811854.
DR   EnsemblGenomes-Tr; EBT00001811855.
DR   EnsemblGenomes-Tr; EBT00001811856.
DR   EnsemblGenomes-Tr; EBT00001811857.
DR   EnsemblGenomes-Tr; EBT00001811858.
DR   EnsemblGenomes-Tr; EBT00001811859.
DR   EnsemblGenomes-Tr; EBT00001811860.
DR   EnsemblGenomes-Tr; EBT00001811861.
DR   EnsemblGenomes-Tr; EBT00001811862.
DR   EnsemblGenomes-Tr; EBT00001811863.
DR   EnsemblGenomes-Tr; EBT00001811864.
DR   EnsemblGenomes-Tr; EBT00001811865.
DR   EnsemblGenomes-Tr; EBT00001811866.
DR   EnsemblGenomes-Tr; EBT00001811867.
DR   EnsemblGenomes-Tr; EBT00001811868.
DR   EnsemblGenomes-Tr; EBT00001811869.
DR   EnsemblGenomes-Tr; EBT00001811870.
DR   EnsemblGenomes-Tr; EBT00001811871.
DR   EnsemblGenomes-Tr; EBT00001811872.
DR   EnsemblGenomes-Tr; EBT00001811873.
DR   EnsemblGenomes-Tr; EBT00001811874.
DR   EnsemblGenomes-Tr; EBT00001811875.
DR   EnsemblGenomes-Tr; EBT00001811876.
DR   EnsemblGenomes-Tr; EBT00001811877.
DR   EnsemblGenomes-Tr; EBT00001811878.
DR   EnsemblGenomes-Tr; EBT00001811879.
DR   EnsemblGenomes-Tr; EBT00001811880.
DR   EnsemblGenomes-Tr; EBT00001811881.
DR   EnsemblGenomes-Tr; EBT00001811882.
DR   EnsemblGenomes-Tr; EBT00001811883.
DR   EnsemblGenomes-Tr; EBT00001811884.
DR   EnsemblGenomes-Tr; EBT00001811885.
DR   EnsemblGenomes-Tr; EBT00001811886.
DR   EnsemblGenomes-Tr; EBT00001811887.
DR   EnsemblGenomes-Tr; EBT00001811888.
DR   EnsemblGenomes-Tr; EBT00001811889.
DR   EnsemblGenomes-Tr; EBT00001811890.
DR   EnsemblGenomes-Tr; EBT00001811891.
DR   EnsemblGenomes-Tr; EBT00001811892.
DR   EnsemblGenomes-Tr; EBT00001811893.
DR   EnsemblGenomes-Tr; EBT00001811894.
DR   EnsemblGenomes-Tr; EBT00001811895.
DR   EnsemblGenomes-Tr; EBT00001811896.
DR   EnsemblGenomes-Tr; EBT00001811897.
DR   EnsemblGenomes-Tr; EBT00001811898.
DR   EnsemblGenomes-Tr; EBT00001811899.
DR   EnsemblGenomes-Tr; EBT00001811900.
DR   EnsemblGenomes-Tr; EBT00001811901.
DR   EnsemblGenomes-Tr; EBT00001811902.
DR   EnsemblGenomes-Tr; EBT00001811903.
DR   EnsemblGenomes-Tr; EBT00001811904.
DR   EnsemblGenomes-Tr; EBT00001811905.
DR   EnsemblGenomes-Tr; EBT00001811906.
DR   EnsemblGenomes-Tr; EBT00001811907.
DR   EnsemblGenomes-Tr; EBT00001811908.
DR   EnsemblGenomes-Tr; EBT00001811909.
DR   EnsemblGenomes-Tr; EBT00001811910.
DR   EnsemblGenomes-Tr; EBT00001811911.
DR   EnsemblGenomes-Tr; EBT00001811912.
DR   EnsemblGenomes-Tr; EBT00001811913.
DR   EnsemblGenomes-Tr; EBT00001811914.
DR   EnsemblGenomes-Tr; EBT00001811915.
DR   EnsemblGenomes-Tr; EBT00001811916.
DR   EnsemblGenomes-Tr; EBT00001811917.
DR   EnsemblGenomes-Tr; EBT00001811918.
DR   EnsemblGenomes-Tr; EBT00001811919.
DR   EnsemblGenomes-Tr; EBT00001811920.
DR   EnsemblGenomes-Tr; EBT00001811921.
DR   EnsemblGenomes-Tr; EBT00001811922.
DR   EnsemblGenomes-Tr; EBT00001811923.
DR   EnsemblGenomes-Tr; EBT00001811924.
DR   EnsemblGenomes-Tr; EBT00001811925.
DR   EnsemblGenomes-Tr; EBT00001811926.
DR   EnsemblGenomes-Tr; EBT00001811927.
DR   EnsemblGenomes-Tr; EBT00001811928.
DR   EnsemblGenomes-Tr; EBT00001811929.
DR   EnsemblGenomes-Tr; EBT00001811930.
DR   EnsemblGenomes-Tr; EBT00001811931.
DR   EnsemblGenomes-Tr; EBT00001811932.
DR   EnsemblGenomes-Tr; EBT00001811933.
DR   EnsemblGenomes-Tr; EBT00001811934.
DR   EnsemblGenomes-Tr; EBT00001811935.
DR   EnsemblGenomes-Tr; EBT00001811936.
DR   EnsemblGenomes-Tr; EBT00001811937.
DR   EnsemblGenomes-Tr; EBT00001811938.
DR   EnsemblGenomes-Tr; GC56T3_R0001-1.
DR   EnsemblGenomes-Tr; GC56T3_R0002-1.
DR   EnsemblGenomes-Tr; GC56T3_R0003-1.
DR   EnsemblGenomes-Tr; GC56T3_R0004-1.
DR   EnsemblGenomes-Tr; GC56T3_R0005-1.
DR   EnsemblGenomes-Tr; GC56T3_R0006-1.
DR   EnsemblGenomes-Tr; GC56T3_R0007-1.
DR   EnsemblGenomes-Tr; GC56T3_R0008-1.
DR   EnsemblGenomes-Tr; GC56T3_R0009-1.
DR   EnsemblGenomes-Tr; GC56T3_R0010-1.
DR   EnsemblGenomes-Tr; GC56T3_R0011-1.
DR   EnsemblGenomes-Tr; GC56T3_R0012-1.
DR   EnsemblGenomes-Tr; GC56T3_R0013-1.
DR   EnsemblGenomes-Tr; GC56T3_R0014-1.
DR   EnsemblGenomes-Tr; GC56T3_R0015-1.
DR   EnsemblGenomes-Tr; GC56T3_R0016-1.
DR   EnsemblGenomes-Tr; GC56T3_R0017-1.
DR   EnsemblGenomes-Tr; GC56T3_R0018-1.
DR   EnsemblGenomes-Tr; GC56T3_R0019-1.
DR   EnsemblGenomes-Tr; GC56T3_R0020-1.
DR   EnsemblGenomes-Tr; GC56T3_R0021-1.
DR   EnsemblGenomes-Tr; GC56T3_R0022-1.
DR   EnsemblGenomes-Tr; GC56T3_R0023-1.
DR   EnsemblGenomes-Tr; GC56T3_R0024-1.
DR   EnsemblGenomes-Tr; GC56T3_R0025-1.
DR   EnsemblGenomes-Tr; GC56T3_R0026-1.
DR   EnsemblGenomes-Tr; GC56T3_R0027-1.
DR   EnsemblGenomes-Tr; GC56T3_R0028-1.
DR   EnsemblGenomes-Tr; GC56T3_R0029-1.
DR   EnsemblGenomes-Tr; GC56T3_R0030-1.
DR   EnsemblGenomes-Tr; GC56T3_R0031-1.
DR   EnsemblGenomes-Tr; GC56T3_R0032-1.
DR   EnsemblGenomes-Tr; GC56T3_R0033-1.
DR   EnsemblGenomes-Tr; GC56T3_R0034-1.
DR   EnsemblGenomes-Tr; GC56T3_R0035-1.
DR   EnsemblGenomes-Tr; GC56T3_R0036-1.
DR   EnsemblGenomes-Tr; GC56T3_R0037-1.
DR   EnsemblGenomes-Tr; GC56T3_R0038-1.
DR   EnsemblGenomes-Tr; GC56T3_R0039-1.
DR   EnsemblGenomes-Tr; GC56T3_R0040-1.
DR   EnsemblGenomes-Tr; GC56T3_R0041-1.
DR   EnsemblGenomes-Tr; GC56T3_R0042-1.
DR   EnsemblGenomes-Tr; GC56T3_R0043-1.
DR   EnsemblGenomes-Tr; GC56T3_R0044-1.
DR   EnsemblGenomes-Tr; GC56T3_R0045-1.
DR   EnsemblGenomes-Tr; GC56T3_R0046-1.
DR   EnsemblGenomes-Tr; GC56T3_R0047-1.
DR   EnsemblGenomes-Tr; GC56T3_R0048-1.
DR   EnsemblGenomes-Tr; GC56T3_R0049-1.
DR   EnsemblGenomes-Tr; GC56T3_R0050-1.
DR   EnsemblGenomes-Tr; GC56T3_R0051-1.
DR   EnsemblGenomes-Tr; GC56T3_R0052-1.
DR   EnsemblGenomes-Tr; GC56T3_R0053-1.
DR   EnsemblGenomes-Tr; GC56T3_R0054-1.
DR   EnsemblGenomes-Tr; GC56T3_R0055-1.
DR   EnsemblGenomes-Tr; GC56T3_R0056-1.
DR   EnsemblGenomes-Tr; GC56T3_R0057-1.
DR   EnsemblGenomes-Tr; GC56T3_R0058-1.
DR   EnsemblGenomes-Tr; GC56T3_R0059-1.
DR   EnsemblGenomes-Tr; GC56T3_R0060-1.
DR   EnsemblGenomes-Tr; GC56T3_R0061-1.
DR   EnsemblGenomes-Tr; GC56T3_R0062-1.
DR   EnsemblGenomes-Tr; GC56T3_R0063-1.
DR   EnsemblGenomes-Tr; GC56T3_R0064-1.
DR   EnsemblGenomes-Tr; GC56T3_R0065-1.
DR   EnsemblGenomes-Tr; GC56T3_R0066-1.
DR   EnsemblGenomes-Tr; GC56T3_R0067-1.
DR   EnsemblGenomes-Tr; GC56T3_R0068-1.
DR   EnsemblGenomes-Tr; GC56T3_R0069-1.
DR   EnsemblGenomes-Tr; GC56T3_R0070-1.
DR   EnsemblGenomes-Tr; GC56T3_R0071-1.
DR   EnsemblGenomes-Tr; GC56T3_R0072-1.
DR   EnsemblGenomes-Tr; GC56T3_R0073-1.
DR   EnsemblGenomes-Tr; GC56T3_R0074-1.
DR   EnsemblGenomes-Tr; GC56T3_R0075-1.
DR   EnsemblGenomes-Tr; GC56T3_R0076-1.
DR   EnsemblGenomes-Tr; GC56T3_R0077-1.
DR   EnsemblGenomes-Tr; GC56T3_R0078-1.
DR   EnsemblGenomes-Tr; GC56T3_R0079-1.
DR   EnsemblGenomes-Tr; GC56T3_R0080-1.
DR   EnsemblGenomes-Tr; GC56T3_R0081-1.
DR   EnsemblGenomes-Tr; GC56T3_R0082-1.
DR   EnsemblGenomes-Tr; GC56T3_R0083-1.
DR   EnsemblGenomes-Tr; GC56T3_R0084-1.
DR   EnsemblGenomes-Tr; GC56T3_R0085-1.
DR   EnsemblGenomes-Tr; GC56T3_R0086-1.
DR   EnsemblGenomes-Tr; GC56T3_R0087-1.
DR   EnsemblGenomes-Tr; GC56T3_R0088-1.
DR   EnsemblGenomes-Tr; GC56T3_R0089-1.
DR   EnsemblGenomes-Tr; GC56T3_R0090-1.
DR   EnsemblGenomes-Tr; GC56T3_R0091-1.
DR   EnsemblGenomes-Tr; GC56T3_R0092-1.
DR   EnsemblGenomes-Tr; GC56T3_R0093-1.
DR   EnsemblGenomes-Tr; GC56T3_R0094-1.
DR   EnsemblGenomes-Tr; GC56T3_R0095-1.
DR   EnsemblGenomes-Tr; GC56T3_R0096-1.
DR   EnsemblGenomes-Tr; GC56T3_R0097-1.
DR   EnsemblGenomes-Tr; GC56T3_R0098-1.
DR   EnsemblGenomes-Tr; GC56T3_R0099-1.
DR   EnsemblGenomes-Tr; GC56T3_R0100-1.
DR   EnsemblGenomes-Tr; GC56T3_R0101-1.
DR   EnsemblGenomes-Tr; GC56T3_R0102-1.
DR   EnsemblGenomes-Tr; GC56T3_R0103-1.
DR   EnsemblGenomes-Tr; GC56T3_R0104-1.
DR   EnsemblGenomes-Tr; GC56T3_R0105-1.
DR   EnsemblGenomes-Tr; GC56T3_R0106-1.
DR   EnsemblGenomes-Tr; GC56T3_R0107-1.
DR   EnsemblGenomes-Tr; GC56T3_R0108-1.
DR   EnsemblGenomes-Tr; GC56T3_R0109-1.
DR   EnsemblGenomes-Tr; GC56T3_R0110-1.
DR   EnsemblGenomes-Tr; GC56T3_R0111-1.
DR   EnsemblGenomes-Tr; GC56T3_R0112-1.
DR   EnsemblGenomes-Tr; GC56T3_R0113-1.
DR   EnsemblGenomes-Tr; GC56T3_R0114-1.
DR   EnsemblGenomes-Tr; GC56T3_R0115-1.
DR   EnsemblGenomes-Tr; GC56T3_R0116-1.
DR   EnsemblGenomes-Tr; GC56T3_R0117-1.
DR   EnsemblGenomes-Tr; GC56T3_R0118-1.
DR   EuropePMC; PMC4995803; 27559429.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01315; CRISPR-DR2.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01412; BsrG.
DR   RFAM; RF01690; Bacillaceae-1.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01735; epsC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02004; group-II-D1D4-5.
DR   SILVA-LSU; CP002050.
DR   SILVA-SSU; CP002050.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4086840
CC   Source DNA and organism available from David Mead
CC   (dmead@lucigen.com)
CC   Contacts: David Mead (dmead@lucigen.com)
CC        Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Geobacillus sp. C56-T3
CC   GOLD Stamp ID         :: Gi06672
CC   Oxygen Requirement    :: Facultative
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Sporulation           :: Sporulating
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Energy Source         :: Chemoorganotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3650813
FT                   /organism="Geobacillus sp. C56-T3"
FT                   /strain="C56-T3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:691437"
FT   gene            219..1571
FT                   /locus_tag="GC56T3_0001"
FT   CDS_pept        219..1571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   gka:GK0001 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25075"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADI25075.1"
FT                   /translation="MENIHDLWDRVLAEIEQKISKPSFETWLKSTKAHSLRGDTLVIVA
FT                   PNEFARDWLDSRYSHLIAETIYTITGEELAVKFIIPPNQDDEELEFQSSKKKQRKPYEE
FT                   TNDFPQSMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLM
FT                   HAIGHYVIEHNPSAKVVYLSSEKFTNEFINAIRDNRPDDFRNKYRNVDVLLIDDIQFLA
FT                   GKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLE
FT                   TRIAILRKKAKAEGFDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKEITADLA
FT                   AEALKDIIPSAKPKVITIQDIQRVVGQHFNIKMEDFKAKKRTKSVAFPRQIAMYLSREL
FT                   TDCSLPKIGDEFGGRDHTTVIHAHEKISKLLQTDTQLQRHIQEIQEKLKQL"
FT   gene            1744..2880
FT                   /locus_tag="GC56T3_0002"
FT   CDS_pept        1744..2880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: gka:GK0002 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25076"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADI25076.1"
FT                   /translation="MNISIDREALAKSVQDVMKAVSTRTTIPILTGIKLTATALGVTLT
FT                   GSDSDISIESFIPLEKEGKLLVDVKRPGSIVLQARFFSEIVKKLPQQTVEIETEDNFLT
FT                   IIRSGHSEFRLNGLNADEYPRLPQIEEENVFQIPADLLKTVIRQTVFAVSTSETRPILT
FT                   GVNWKVEHGELVCTATDSHRLAMRKVKIESENEVSYNVVIPGKSLNELSKILDDGNHPV
FT                   DIVMTANQVLFKAEHLLFFSRLLDGNYPETARLIPTESKTTMIVNAKEFLQAIDRASLL
FT                   AREGRNNVVKLTTLPGGMLEISSISPEIGKVTEQLQTESLEGEELNISFSAKYMMDALR
FT                   ALDGTDIQISFTGAMRPFLLRPLHTDSMLQLILPVRTY"
FT   gene            3069..3299
FT                   /locus_tag="GC56T3_0003"
FT   CDS_pept        3069..3299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0003"
FT                   /product="S4 domain protein YaaA"
FT                   /note="TIGRFAM: S4 domain protein YaaA; KEGG:
FT                   gyc:GYMC61_0003 S4 domain protein YaaA"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25077"
FT                   /inference="protein motif:TFAM:TIGR02988"
FT                   /protein_id="ADI25077.1"
FT                   /translation="MTRMEQRVTITTETITLGQLLKLVRLIDTGGAAKWFLQEHHVLVN
FT                   GERENRRGRKLRDGDRIDIEPFGTFVVVKAE"
FT   gene            3311..4429
FT                   /locus_tag="GC56T3_0004"
FT   CDS_pept        3311..4429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: gyc:GYMC61_0004 DNA replication and repair
FT                   protein RecF; TIGRFAM: DNA replication and repair protein
FT                   RecF; PFAM: SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25078"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADI25078.1"
FT                   /translation="MFLTNLTLTNYRNYEYETLNFGEGVNVILGENAQGKTNMMEAIYV
FT                   LAMAKSHRTSNDKDLIRWNEEYAKIEGRAEKRSGSLTLELLISKKGKKARCNHIEQQRL
FT                   SQYVGHLNVVMFAPEDLNLVKGSPQVRRRFVDMEIGQVSPVYIHDLSQYQKLLQQRNHY
FT                   LKMMQARERSDEAVLDVLTEQLVLLAAKITLRRRQFLSLLEQWAMPIHYEISRGAEQLC
FT                   IRYEPSVDVSEKAELSRIVEAYSETFAAMREREVLRGTTLVGPHRDDIAFFVNGKNVQT
FT                   FGSQGQQRTTALAVKLAELELIFSELGDYPILLLDDVLSELDDFRQTHLLDAIRKKVQT
FT                   FVTTTSIDGIKHDIIQEAAIYRVHSGSVTAPS"
FT   gene            4482..6398
FT                   /locus_tag="GC56T3_0005"
FT   CDS_pept        4482..6398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: gyc:GYMC61_0005 DNA gyrase, B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM domain
FT                   protein; DNA gyrase subunit B domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25079"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADI25079.1"
FT                   /translation="MEQRVEQTYDASQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVWE
FT                   IVDNSIDEALAGYCTNIDVTIGKDNSITVADNGRGIPVDIHEATGRPAVEVIMTVLHAG
FT                   GKFGGGGYKVSGGLHGVGASVVNALSEWLEVYVYRDGKIHYQRYERGEPCTDLQVIGET
FT                   DRTGTTTRFKPDPEIFTETTEFDYETLATRLRELAFLNRGLKITLTDERVDSRKNEYVY
FT                   EGGIRSYVRHLNRTREVLHEEPIYIAGERDGIAVEIALQYNDGYTSNIYSFVNNIHTHE
FT                   GGTHESGFKMALTRIINDYARKQQIFKENDANLTGEDVREGLTAIVSIKHPSPQFEGQT
FT                   KTKLGNSDARTVTDAVFSEQFETFLLENPTIARKIVEKGMMAARARLAAKKARELTRRK
FT                   SALEISNLPGKLADCSSRDPSISELYVVEGDSAGGSAKQGRDRHFQAILPLRGKILNVE
FT                   KARLDKILSNNEVRAIITALGTGIGEEFDISKARYHKVIIMTDADVDGAHIRTLLLTFF
FT                   YRYMRELIEHGYIYIAQPPLYKIEQGKQVRYAYNDRQLEKILAELPDQPKPTIQRYKGL
FT                   GEMNPEQLWETTMNPETRTLLQVSLQDAIDADETFEILMGDKVEPRRQFIEENARYVKN
FT                   LDI"
FT   gene            6549..9005
FT                   /locus_tag="GC56T3_0006"
FT   CDS_pept        6549..9005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: gyc:GYMC61_0006 DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25080"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADI25080.1"
FT                   /translation="MAEHEQPRIREVNISQEMRSSFLDYAMSVIVSRALPDVRDGLKPV
FT                   HRRILYAMHDLGMTADKPYKKSARIVGEVIGKYHPHGDAAVYDTMVRMAQDFNYRYMLV
FT                   DGHGNFGSIDGDAAAAMRYTEARMSKIAMELLRDINKDTIDYQDNYDGSEKEPVVLPSR
FT                   FPNLLVNGSSGIAVGMATNIPPHQLGEVIDALLALSQNPEMTVADLMEYIPGPDFPTAG
FT                   QIIGRSGIRKAYETGRGSITLRAKAEIEQQPNGKETIIVTELPYQVNKAKLIERIAELV
FT                   RDKKIDGITDLRDESDRSGMRIVIEVRRDANAKVVLNNLYKHTALQTSFGINMLALVNG
FT                   EPKVLNLKECLEHYLNHQKTVIRRRTAFELKKAEARAHILEGLRIALDHLDEVIDLIRR
FT                   SQTTEAAREGLMARFSLSERQAQAILDMRLQRLTGLEREKIEQEYQDLVRLIAELRGVL
FT                   ADEEKVLQIIRDELSEIKERFNDERRTEIVSGAVEQFDDEDLIPQEHVVITLTHKGYIK
FT                   RLPLSTYRSQKRGGRGVQGMHTAEDDFVEHLLITSTHDTVLFFTNKGKVYQAKGYEIPE
FT                   FGRTAKGLPIINLLELDKDEWINAMIPIESEFSDERYLVFATKQGIAKRSPLSAFAHIR
FT                   NNGLIAIHLREGDELISVRLTDGKKHLIIGTKNGMLIRFPETDVRAMGRSATGVKAITL
FT                   DDGDEVVGMEILEDHHDVLVVTKKGFGKRTPASEYRVQSRGGKGLKTCNVTDKNGPVVA
FT                   VTTVVGNEDVMVITTGGVLIRIAVSDISRTGRIAQGVKLIRLSGEDGHECVATVAKVPE
FT                   EERDEE"
FT   gene            9153..10220
FT                   /locus_tag="GC56T3_0007"
FT   CDS_pept        9153..10220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0007"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: gyc:GYMC61_0007 metal dependent
FT                   phosphohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25081"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADI25081.1"
FT                   /translation="MVRVKRSQLREGCVLAEDVLGKTKRPIIPKNTVITKPLLLVLEKF
FT                   LVEEVDVEPLLANGEPFPNVDSASTAAAKQPMAFYLEAVQRYKTWFQSWQAGLPVDIGE
FT                   IRGVIISLFERMAGQKRELLMLHHYATKDEYLHHHAVSVGLLAGFLAMQLGYSEGECHQ
FT                   IALAGVLADCGMAKVSKRILTNPSALTEAEFNEVKQHPVFSYRMVQKIPALNHGAKLAV
FT                   LQHHERNDGSGYPLGVKAERIHPYSQIVAVADVYHAMTSERLYRRKQSPFRAIETMQRE
FT                   QFGKLSTEAVAALVNNLIGLQTGAVVKLSNGEMAEVMFIPSDEPARPIVKIIETGQLLS
FT                   LSVQRDIYIEEMVQG"
FT   gene            10593..12138
FT                   /locus_tag="GC56T3_R0001"
FT   rRNA            10593..12138
FT                   /locus_tag="GC56T3_R0001"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            12480..12553
FT                   /locus_tag="GC56T3_R0002"
FT                   /note="tRNA-Ile1"
FT   tRNA            12480..12553
FT                   /locus_tag="GC56T3_R0002"
FT                   /product="tRNA-Ile"
FT   gene            12560..12635
FT                   /locus_tag="GC56T3_R0003"
FT                   /note="tRNA-Ala1"
FT   tRNA            12560..12635
FT                   /locus_tag="GC56T3_R0003"
FT                   /product="tRNA-Ala"
FT   gene            13201..16127
FT                   /locus_tag="GC56T3_R0004"
FT   rRNA            13201..16127
FT                   /locus_tag="GC56T3_R0004"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            16421..16537
FT                   /locus_tag="GC56T3_R0005"
FT   rRNA            16421..16537
FT                   /locus_tag="GC56T3_R0005"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 67.32"
FT   gene            complement(16582..17559)
FT                   /locus_tag="GC56T3_0008"
FT   CDS_pept        complement(16582..17559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_0008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25082"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0008"
FT                   /protein_id="ADI25082.1"
FT                   /translation="MFGNHGQLFRLSVFRSADTAQQFLRQCYQQLQRDDAVQRSYANCY
FT                   PFLYYLEHGQNFYAAAQQAPLSIKPVLLFYGMVQLLKACLLTVDPDYPESTSVLAHGVS
FT                   ARKRKKQGYEFLDDEVKIQKNGLFAHFSEKMFHVKQEAGEKFRMGTLLQRIGELHETFF
FT                   LLSGRKKPLSLPVVHTASPPMLAIPKVILDHYHMSLSRFVQYLCEEGQGKRLSFAKEEG
FT                   EFLYFHIESPLSPAGEGPFLFHLDGTLRIPVKKEKTFSLPEIHAHYLLLYNLSMISRYE
FT                   TEWWSELLHSYPSKAYTFILEFLSVSAEKVPLLLHEYLMRKFLG"
FT   gene            17685..19151
FT                   /locus_tag="GC56T3_0009"
FT   CDS_pept        17685..19151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0009"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="SMART: CBS domain containing protein; TIGRFAM:
FT                   inosine-5'-monophosphate dehydrogenase; KEGG:
FT                   gyc:GYMC61_0009 inosine-5'-monophosphate dehydrogenase;
FT                   PFAM: IMP dehydrogenase/GMP reductase; CBS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25083"
FT                   /inference="protein motif:TFAM:TIGR01302"
FT                   /protein_id="ADI25083.1"
FT                   /translation="MWEAKFAKEGLTFDDVLLIPAKSDVLPRDVDVTTKLSDTLQLNIP
FT                   ILSAGMDTVTEAEMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSERGVITDPFFLTP
FT                   DHQVYDAEHLMSKYRISGVPIVNNPEEQKLVGIITNRDLRFIQDYSIKISEVMTKENLI
FT                   TAPVGTTLEEAEKILQRHKVEKLPLVDENGVLKGLITIKDIEKVIEFPNSAKDAKGRLI
FT                   VGAAVGVTADTMIRVKKLVEAGVDVIVVDTAHGHSKGVLETVANIRRQYPDLNIIAGNV
FT                   ATAEGTRDLIEAGANIIKVGIGPGSICTTRVVAGVGVPQITAIYDCATEARKHGVPIIA
FT                   DGGIKYSGDIVKAIAAGAHAVMLGSLLAGVSESPGETEIYQGRRFKVYRGMGSVAAMER
FT                   GSKDRYFQEDAKKFVPEGIEGRVPYKGPLADTIYQLVGGLRAGMGYCGTRNLEELREKT
FT                   QFIRMTSAGLRESHPHDVQITKEAPNYSAF"
FT   gene            19256..20614
FT                   /locus_tag="GC56T3_0010"
FT   CDS_pept        19256..20614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0010"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="KEGG: gyc:GYMC61_0010 serine-type D-Ala-D-Ala
FT                   carboxypeptidase; PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; Penicillin-binding protein 5 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25084"
FT                   /inference="protein motif:PRIAM:3.4.16.4"
FT                   /protein_id="ADI25084.1"
FT                   /translation="MRRRKQNWLFWLLSICLCLTFGPFQQTVKAESAPLDIRADAAILV
FT                   DAQTGRILYEKNIDTVLGIASMTKMMTEYLLLDAIKAKRVKWDQMYTPSDYVYRLSQDR
FT                   ALSNVPLRKDGKYTVRELYEAMAIYSANGATVAIAEIIAGSEKNFVKMMNDKAKELGLK
FT                   DYKFVNATGLSNKDLKGFHPEGTSTNEENVMSARAMAMLAYRLLKDHPEVLKTASIPHK
FT                   VFREGTKDEIKMDNWNWMLPGLVYGYEGVDGLKTGYTEFAGNCFTGTAKRNGVRLISVV
FT                   MNAKDASGKTTKEARFKETEKLFNYGFNQYSLETLYPKGYQLKGKETLPVVKGKDKEVR
FT                   VATGKNLDLLVKNGEEKQYKPVYVLDKKKMTKEGKLVAPLKKGETVGYMTLEYKGDDSL
FT                   AFLSPDMQKNIRVPLVTTAEVEKANWFVLSMRAVGGLFVDLWTSVAKTVKGWL"
FT   sig_peptide     19256..19348
FT                   /locus_tag="GC56T3_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.850 at
FT                   residue 31"
FT   gene            20745..21629
FT                   /locus_tag="GC56T3_0011"
FT   CDS_pept        20745..21629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0011"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="KEGG: gyc:GYMC61_0011 pyridoxine biosynthesis
FT                   protein; TIGRFAM: pyridoxine biosynthesis protein; PFAM:
FT                   Vitamin B6 biosynthesis protein; Indole-3-glycerol
FT                   phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25085"
FT                   /inference="protein motif:TFAM:TIGR00343"
FT                   /protein_id="ADI25085.1"
FT                   /translation="MALTGTDRVKRGMAEMQKGGVIMDVVNAEQAKIAEAAGAVAVMAL
FT                   ERVPADIRAAGGVARMADPTVIEEVMNAVSIPVMAKVRIGHYVEARVLEALGVDYIDES
FT                   EVLTPADEEFHIDKRQFTVPFVCGCRDLGEAARRIAEGASMLRTKGEPGTGNIVEAVRH
FT                   MRKVNAQIRKVVNMSEDELVAEAKQLGAPVEVLREIKRLGRLPVVNFAAGGVATPADAA
FT                   LMMHLGADGVFVGSGIFKSENPEKYARAIVEATTHYEDYELIAHLSKGLGGAMRGIDIA
FT                   TLLPEHRMQERGW"
FT   gene            21654..22244
FT                   /locus_tag="GC56T3_0012"
FT   CDS_pept        21654..22244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0012"
FT                   /product="SNO glutamine amidotransferase"
FT                   /note="PFAM: SNO glutamine amidotransferase; KEGG:
FT                   gyc:GYMC61_0012 SNO glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25086"
FT                   /inference="protein motif:PFAM:PF01174"
FT                   /protein_id="ADI25086.1"
FT                   /translation="MKIGVLGLQGAVREHVRAIEACGAEAVIVKKPEQLEGLDGLVLPG
FT                   GESTTMRRLIDRYGLMEPLKQFAAAGKPMFGTCAGLILLAKRIVGYDEPHLGLMDITVE
FT                   RNSFGRQRESFEAELSIKGVGDGFVGVFIRAPHIVEVGDGVDVLATYNDRIVAARQGQF
FT                   LGCSFHPELTDDHRLMQYFLNMVKEAKMASSLK"
FT   gene            22524..23798
FT                   /locus_tag="GC56T3_0013"
FT   CDS_pept        22524..23798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0013"
FT                   /product="seryl-tRNA synthetase"
FT                   /note="KEGG: gka:GK0013 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl-tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25087"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ADI25087.1"
FT                   /translation="MLDMKVLRTQFQEVKEKLMQRGGDLTNIDRFEQLDKDRRRLIAEV
FT                   EELKSKRNDVSQQIAVLKREKKDAEPLIAQMREVGDRIKRMDEQIRQLEAELDDLLLSI
FT                   PNVPHESVPIGQSEEDNVEVRRWGEPRSFSFEPKPHWEIADRLGLLDFERAAKVAGSRF
FT                   VFYKGLGARLERALINFMLDIHLDEFGYEEVLPPYLVNRASMIGTGQLPKFAEDAFHLD
FT                   SEDYFLIPTAEVPVTNLHRDEILAADDLPIYYAAYSACFRAEAGSAGRDTRGLIRQHQF
FT                   NKVELVKFVKPEDSYDELEKLTRQAETILQRLGLPYRVVALCTGDLGFSAAKTYDIEVW
FT                   LPSYGTYREISSCSNFEAFQARRANIRFRRDPKAKPEYVHTLNGSGLAIGRTVAAILEN
FT                   YQQEDGSVIVPEALRPYMGNRDVIR"
FT   gene            complement(24014..25300)
FT                   /locus_tag="GC56T3_0014"
FT   CDS_pept        complement(24014..25300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0014"
FT                   /product="glycoside hydrolase family 18"
FT                   /note="KEGG: gka:GK0014 spore peptidoglycan hydrolase
FT                   (N-acetylglucosaminidase); PFAM: glycoside hydrolase family
FT                   18; Peptidoglycan-binding lysin domain; SMART: chitinase
FT                   II; Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25088"
FT                   /inference="protein motif:PFAM:PF00704"
FT                   /protein_id="ADI25088.1"
FT                   /translation="MQIHVVQSGQTLSGIAEAYGTTAEEIVRANKLPNPDKLVVGQALV
FT                   IPIVGRFYWVQRGDTLWSIARRFSIPMQRLAEVNRLSLNAPLKVGQRLYIPPGAKRRAE
FT                   FNAYIEPRGATVSPALEASAREAAPYLTYLSPFYFAIRRDATLQEPPLDDFPDIARANR
FT                   VTLVMVVANIENGQFSDELGALMLTNETLQNRLLDNIVATARRYGFRDIHFDFEYLRPE
FT                   DREAYNAFLRKAKRRFAREGWMMSTALAPKTSATQRGRWYEAHDYRAHGQIVDFVVIMT
FT                   YEWGYSGGPPMPVSPIGPVRRVLEYAISEMPAGKILMGQNLYGYDWTLPYVPGGPYAQA
FT                   ISPQQAIALAAKYNVAIEYDTEAQAPHFRYRDENGREHEVWFEDARSIQAKFNLVKELG
FT                   LRGVSYWKLGIDFPQNWLLIADQFTVVKK"
FT   gene            25386..25883
FT                   /locus_tag="GC56T3_0015"
FT   CDS_pept        25386..25883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0015"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   gyc:GYMC61_0015 CMP/dCMP deaminase zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25089"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADI25089.1"
FT                   /translation="MNTDEYYMRLAMEEAKKAEQIGEVPIGAVIVQDGRVIARAHNLRE
FT                   TEQRAIAHAEILAIDEACRATGSWRLERATLYVTLEPCAMCAGAIVLSRIERVVFGAFD
FT                   PKGGCAGTLMNLLQESRFNHQVKVVSGVLADECGSLLSQFFRRLREQKRNVGGSANENS
FT                   VD"
FT   gene            26028..26093
FT                   /gene="ffs"
FT                   /locus_tag="GC56T3_R0006"
FT   ncRNA           26028..26093
FT                   /gene="ffs"
FT                   /locus_tag="GC56T3_R0006"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            26304..27983
FT                   /locus_tag="GC56T3_0016"
FT   CDS_pept        26304..27983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0016"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /note="TIGRFAM: DNA polymerase III, subunits gamma and tau;
FT                   PFAM: AAA ATPase central domain protein; KEGG:
FT                   gyc:GYMC61_0016 DNA polymerase III, subunits gamma and tau;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25090"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ADI25090.1"
FT                   /translation="MAYQALYRVFRPQRFADMVGQEHVTKTLQSALLQHKISHAYLFSG
FT                   PRGTGKTSAAKIFAKAVNCEQAPAAEPCNECPACLGITNGTVPDVLEIDAASNNRVDEI
FT                   RDIREKVKFAPTSARYKVYIIDEVHMLSIGAFNALLKTLEEPPKHVIFILATTEPHKIP
FT                   ATIISRCQRFDFRRIPLPAIVSRLKYVASAQGVEASDEALSAIARAADGGMRDALSLLD
FT                   QAISFSDGKLRLDDVLAMTGAASFAALSSFIEAIHRKDTAAVLQQLETMMAQGKDPHRL
FT                   VEDLILYYRDLLLYKTAPYVEGAIQIAVVDEAFTSLSEMIPVSNLYEAIELLNKSQQEM
FT                   KWTNHPRLLLEVALVKLCHPSAAAPSLSASELEPLIKRIETLEAELRRLKEQPPAPPST
FT                   AAPVKKLSKPMKTGGYKAPVGRIYELLKQATHEDLALVKGCWADVLDTLKRQHKVSHAA
FT                   LLQESEPVAASASAFVLKFKYEIHCKMATDPTSSVKENVEAILFELTNRRFEMVAIPEG
FT                   EWGKIREEFIRNKDAMVEKSEEDPLIAEAKRLFGEELIEIKE"
FT   gene            28007..28333
FT                   /locus_tag="GC56T3_0017"
FT   CDS_pept        28007..28333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0017"
FT                   /product="hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   gyc:GYMC61_0017 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25091"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ADI25091.1"
FT                   /translation="MMRGGMGNMQKMLKQMQKMQKEMQKAQEELAEKTVEGTAGGGMVT
FT                   VVANGHKQILEVKIKEEVVDPDDIEMLQDLILAATNDALKKADELANEMMGQFTKGLNI
FT                   PGLF"
FT   gene            28343..28939
FT                   /locus_tag="GC56T3_0018"
FT   CDS_pept        28343..28939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0018"
FT                   /product="recombination protein RecR"
FT                   /note="TIGRFAM: recombination protein RecR; PFAM: TOPRIM
FT                   domain protein; Zinc finger C4-type, RecR; KEGG: gka:GK0019
FT                   recombination protein RecR; SMART: Toprim sub domain
FT                   protein; Helix-hairpin-helix DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25092"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ADI25092.1"
FT                   /translation="MHYPEPLSKLIDSFMKLPGIGPKTAARLAFHVLAMKEDTVLEFAK
FT                   ALVDVKRHIHYCTICGHITDTDPCYICKDERRDRTTICVVQDPKDVIAMERMKEYNGLY
FT                   HVLHGAISPMEGIGPEDIKIAELLTRLQDETVQEVILATDPNIEGEATAMYISRLLKPT
FT                   GIKVTRIAHGLPVGGDLEYADEVTLSKALEGRREL"
FT   gene            28963..29187
FT                   /locus_tag="GC56T3_0019"
FT   CDS_pept        28963..29187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0019"
FT                   /product="Protein of unknown function DUF2508"
FT                   /note="PFAM: Protein of unknown function DUF2508; KEGG:
FT                   gka:GK0020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25093"
FT                   /inference="protein motif:PFAM:PF10704"
FT                   /protein_id="ADI25093.1"
FT                   /translation="MLWRRKGKLKRQFDEKLMAELQKARTEWLEQKQLIEKSVDPSPEV
FT                   LSALQLAEAKYFFLLREAKHRRITLKEVR"
FT   gene            29266..29529
FT                   /locus_tag="GC56T3_0020"
FT   CDS_pept        29266..29529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0020"
FT                   /product="pro-sigmaK processing inhibitor BofA"
FT                   /note="KEGG: gka:GK0021 inhibitor of the pro-sigma K
FT                   processing machinery; TIGRFAM: pro-sigmaK processing
FT                   inhibitor BofA; PFAM: sigmaK-factor processing regulatory
FT                   BofA"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25094"
FT                   /inference="protein motif:TFAM:TIGR02862"
FT                   /protein_id="ADI25094.1"
FT                   /translation="MEPKVVITVLLALIAVLLIVGARLKALRLIGYAAIRLIVGALALF
FT                   VINAIGGHFNIHIPINLVTSIVCGFLGLPGAAALIVIDRYIL"
FT   gene            30079..31624
FT                   /locus_tag="GC56T3_R0007"
FT   rRNA            30079..31624
FT                   /locus_tag="GC56T3_R0007"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            31965..32038
FT                   /locus_tag="GC56T3_R0008"
FT                   /note="tRNA-Ile2"
FT   tRNA            31965..32038
FT                   /locus_tag="GC56T3_R0008"
FT                   /product="tRNA-Ile"
FT   gene            32045..32120
FT                   /locus_tag="GC56T3_R0009"
FT                   /note="tRNA-Ala2"
FT   tRNA            32045..32120
FT                   /locus_tag="GC56T3_R0009"
FT                   /product="tRNA-Ala"
FT   gene            32686..35612
FT                   /locus_tag="GC56T3_R0010"
FT   rRNA            32686..35612
FT                   /locus_tag="GC56T3_R0010"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            35972..36088
FT                   /locus_tag="GC56T3_R0011"
FT   rRNA            35972..36088
FT                   /locus_tag="GC56T3_R0011"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 67.32"
FT   gene            36241..36447
FT                   /locus_tag="GC56T3_0021"
FT   CDS_pept        36241..36447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0021"
FT                   /product="Sigma-G inhibitor, Gin"
FT                   /note="PFAM: Sigma-G inhibitor, Gin; KEGG: gyc:GYMC61_0022
FT                   sigma-G inhibitor, Gin"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25095"
FT                   /inference="protein motif:PFAM:PF10764"
FT                   /protein_id="ADI25095.1"
FT                   /translation="MRTSIADRNQREHVCIVCEQEKKEGIFLFGHFLCLDCNRAIVQTN
FT                   TDDPNYSFYVRQLRKMFTSKIHS"
FT   gene            36618..38051
FT                   /locus_tag="GC56T3_0022"
FT   CDS_pept        36618..38051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0022"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   gyc:GYMC61_0023 Orn/Lys/Arg decarboxylase major region"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25096"
FT                   /inference="protein motif:PFAM:PF01276"
FT                   /protein_id="ADI25096.1"
FT                   /translation="MDQTKTPLYDALVHHWARRPVSFHVPGHKYGALFSKRGRDMFAPL
FT                   LALDATEISGLDDLHHPESVIAEAQALAAELYGVRETFFLVNGSTAGNLAMIAAVCDGK
FT                   RKKVIVQRNCHKSVMHALQLMEATPVLLAPEFDRDVCVASHIRPEAVKEALALYDDVAA
FT                   VVLTNPNYYGMAADLTEIVRLVHEHGIPVLIDEAHGAHFVVGPPFPTSALRYGADVVVQ
FT                   SAHKTLPAMTMGAFLHVNSERVDLERLKYFLQLFQSSSPSYPIMASLDLARSYVAQLSK
FT                   SDAAAIVAEIEKFKAALADIDGVAVVCSRHFGVQTDPLKVTVQTRCSLTGYELQRWLER
FT                   EGVFVELADRMNVLFVCPLAVTGRLQEAAEKIKRAWRDLPDGEAPVCNASPFLGPPLSV
FT                   LVPYNELRHLRTKAVALEEAEGHIAAETVIPYPPGVPLVWVGERIGRGHIEQIRQLLCQ
FT                   RAHIQGGSRLKDGQLVVYE"
FT   gene            38066..38710
FT                   /locus_tag="GC56T3_0023"
FT   CDS_pept        38066..38710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0023"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="TIGRFAM: thymidylate kinase; KEGG: gyc:GYMC61_0024
FT                   thymidylate kinase; PFAM: thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25097"
FT                   /inference="protein motif:TFAM:TIGR00041"
FT                   /protein_id="ADI25097.1"
FT                   /translation="MPRVMNGCFFSFEGPEGAGKTTMISKLESLLRERGIDVVATREPG
FT                   GVRIAEAIRSIILNRDYTEMDGRTEALLYAAARRQHLLEKIVPALEAGCVVLCDRFVDS
FT                   SLAYQGFARGLGIEEVWKINEFAIDGYMPSLTIYFDIDPQIGLERIRRNRGREVNRLDL
FT                   ETLSFHEKVREGYRELARRFADRIVVIDANRPLDDVFAETTAAVLSRLKGR"
FT   gene            38790..39782
FT                   /locus_tag="GC56T3_0024"
FT   CDS_pept        38790..39782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0024"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   KEGG: gyc:GYMC61_0025 DNA polymerase III, delta prime
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25098"
FT                   /inference="protein motif:TFAM:TIGR00678"
FT                   /protein_id="ADI25098.1"
FT                   /translation="MAMRWEQLAKRQPVVAKMLQSGLEKGRISHAYLFEGQRGTGKKAA
FT                   SLLLAKRLFCLSPIGVSPCLECRNCRRIDSGNHPDLRVIGPDGGSIKKEQIEWLQQEFS
FT                   KTAVESDKKMYIVEHADQMTTSAANSLLKFLEEPHPGTVAVLLTEQYHRLLGTIVSRCQ
FT                   VLSFRPLPPAELAQGLVEEHVPLPLALLAAHLTNSFEEALALAKDSWFAEARTLVLQWY
FT                   EMLGKPELQLLFFIHDRLFPHFLESHQLDLGLDLLLYLYRDLLHIQTGQMDGVLYRDQL
FT                   DRLQRWALACPQRRIVAGMEAILQAKTRLNTTNMSTALLVEQLVLQLKR"
FT   gene            39797..40624
FT                   /locus_tag="GC56T3_0025"
FT   CDS_pept        39797..40624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0025"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: gyc:GYMC61_0026
FT                   PSP1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25099"
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /protein_id="ADI25099.1"
FT                   /translation="MYTVVGVRFKKAGKIYYFDPGDAVIPVGEFVIVETVRGIEYGKVV
FT                   IANKQVDENDIVLPLKKVIRVANEKDKWIVEENKKAAREAYDICLRKVEEHGLEMKLVD
FT                   VEYTFDRNKVIFYFTADGRVDFRELVKDLASIFRTRIELRQIGVRDEAKMLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYENEEYETAKEQLPDL
FT                   GEYVETPHGFGKVVGLNILERVLQIELPEFGRVVEYTLDELMKNGTLSIRVAD"
FT   gene            40640..41002
FT                   /locus_tag="GC56T3_0026"
FT   CDS_pept        40640..41002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0026"
FT                   /product="protein of unknown function DUF972"
FT                   /note="PFAM: protein of unknown function DUF972; KEGG:
FT                   gyc:GYMC61_0027 protein of unknown function DUF972"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25100"
FT                   /inference="protein motif:PFAM:PF06156"
FT                   /protein_id="ADI25100.1"
FT                   /translation="MEKVDKKEVFRSVANMEEQLSYFYRELVQLKQRVTELLEENHQLQ
FT                   IENAHLRRRLEQLSEAWEEGKRKGDKHGKKLIDIGEGYDNLARLYQEGFHICHIHYGSI
FT                   RTEGDCLFCLSFLNKN"
FT   gene            41063..41812
FT                   /locus_tag="GC56T3_0027"
FT   CDS_pept        41063..41812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0027"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: gyc:GYMC61_0028
FT                   methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25101"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ADI25101.1"
FT                   /translation="MVELYEDERLDYLFNEELRIIQSPSVFSFSLDAVLLAHFAYMPIQ
FT                   KGQIVDLCTGNGVIPLLLSRRTKGTIIGIEIQERLCDMARRSVQYNGLEGQIEIIHGDI
FT                   KEAPQRIGYSRYDVVTCNPPYFPAVGKDELSKNEHIAIARHEIYCTLEDVIRVSSQLLK
FT                   QGGKAAFVHRPGRLLDLVTLMRQYRLEPKRLRFVYPKEGKEANMILIEGTKDASPDLKV
FT                   LPPLVVYDENNEYTEETKRILYGIISS"
FT   gene            41828..42739
FT                   /locus_tag="GC56T3_0028"
FT   CDS_pept        41828..42739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0028"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: gyc:GYMC61_0029
FT                   uroporphyrin-III C/tetrapyrrole (corrin/porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25102"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ADI25102.1"
FT                   /translation="MLWQQKSFTEQTEQGTLYIVPTPIGNLEDMTFRAVRTLQEADVIA
FT                   AEDTRQTKKLLAHFGIHTPLVSYHEHNKYASGRQLVEWLKEGKTVALVSDAGMPGISDP
FT                   GYELIAAALAERCRVVPLPGANAALTALVASGLPTDRFLFVGFLKRAKKEKKEQLLSLK
FT                   TAAETLIFYEAPHRLKETLALMYDIFGNRRIALGRELTKRFEEFIRGDLSDAVAWAEEH
FT                   DIRGEFCLIVEGARDGNKQEQEGEEWWQPLSLVEHVDYYIREHSLSVKEAVKQAASDRN
FT                   MSKRDVYRQYHQQQEEEKKEFL"
FT   gene            complement(42756..43055)
FT                   /locus_tag="GC56T3_0029"
FT   CDS_pept        complement(42756..43055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0029"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: gyc:GYMC61_0030 transcriptional regulator,
FT                   AbrB family; TIGRFAM: transcriptional regulator, AbrB
FT                   family; PFAM: SpoVT/AbrB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25103"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADI25103.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLDINEKDALEIYVDDDRIIL
FT                   KKYKPNMTCVVTGEVSDDNFKLAGGKIILSREGAEILLQEIQQHLEAATDKEKE"
FT   gene            43452..45404
FT                   /locus_tag="GC56T3_0030"
FT   CDS_pept        43452..45404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0030"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="KEGG: gka:GK0031 methionyl-tRNA synthetase
FT                   (methionine--tRNA ligase); TIGRFAM: methionyl-tRNA
FT                   synthetase; methionyl-tRNA synthetase, beta subunit; PFAM:
FT                   tRNA synthetase class I (M); t-RNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25104"
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /protein_id="ADI25104.1"
FT                   /translation="MEKKTFYLTTPIYYPSDRLHIGHAYTTVAGDAMARYKRMRGYDVM
FT                   YLTGTDEHGQKIQRKAEEKGVTPQQYVDEIVAGIQELWKKLDISYDDFIRTTQERHKKV
FT                   VEQIFTRLVEQGDIYLGEYEGWYCTPCESFYTERQLVDGNCPDCGRPVEKVKEESYFFR
FT                   MSKYVDRLLQYYEENPDFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKH
FT                   VIYVWIDALANYITALGYGTDNDEKFRKYWPADVHLVGKEIVRFHTIYWPIMLMALGLP
FT                   LPKKVFGHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGADGVFTPE
FT                   GFIERINYDLANDLGNLLHRTVAMIEKYFDGVIPPYRGPKTPFDQELAQTAREVVRQYE
FT                   EAMEGMEFSVALAAVWQLISRTNKYIDETQPWVLAKDEQKRDELAAVMTHLAESLRHMA
FT                   VLLQPFLTRTPERMFAQLGITDHSLKEWDSLYDFGLIPEGTKVQKGEPLFPRLDIEAEV
FT                   EYIKAHMQGGKPAAEPVKEEKKAAEAAEISIDEFAKVDLRVAEVIHAERMKNADKLLKL
FT                   QLDLGGEKRQVISGIAEFYKPEELVGKKVICVANLKPAKLRGEWSEGMILAGGSGGEFS
FT                   LATVDQHVPNGTKIK"
FT   gene            45541..46311
FT                   /locus_tag="GC56T3_0031"
FT   CDS_pept        45541..46311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0031"
FT                   /product="hydrolase, TatD family"
FT                   /note="KEGG: gka:GK0032 deoxyribonuclease; TIGRFAM:
FT                   hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25105"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ADI25105.1"
FT                   /translation="MLFDTHAHLNAVQYEEDLEQVIERARDEGVSHIVVVGFDRPTIDR
FT                   AIELAERYPFIYAAVGWHPVDAIEMTDDDLQMIEQLAAHPKVVALGEMGLDYHWDKSPK
FT                   DVQQEVFRQQIRLAKKVKLPIIIHNREATADILKILQEENAAEVGGIMHCFSGSVEVAK
FT                   QCMDMNFLISLGGPVTFKNAKKPKEVAKEIPLSHLLIETDCPYLTPHPFRGKRNEPSYV
FT                   KYVAEAIAQIKNISFAEVAETTAENAKKLFAIDR"
FT   gene            46512..47717
FT                   /locus_tag="GC56T3_0032"
FT   CDS_pept        46512..47717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0032"
FT                   /product="3D domain protein"
FT                   /note="PFAM: 3D domain protein; G5 domain protein; protein
FT                   of unknown function DUF348; KEGG: gyc:GYMC61_0033 3D domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25106"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ADI25106.1"
FT                   /translation="MLPNGRKWLDLWRKNVTVTAGGFLAISATTGVAGYEMAKDDVTLI
FT                   KNGNKQEIRTHAKTVKELLAEQNIQPRKEDYVYPSLHSPITDDLHIVWEASKEVTLTVN
FT                   GKKKKIWTTADTVAELLRSQHVAVGAYDKVAPALSAKIQKGMDIGVEKAFPVHVNVGGK
FT                   QQQVWTTSTTVADFLKQQGIQLGQFDRIEPSLHETVKEQMTIRVIRVKKVTDVVEEPVD
FT                   FAVVTKRDDSLPKGERRVIQPGEKGTVQKTYEVTLENGKETARKLIAAKTLKESKARIV
FT                   AIGTKTVRSAAAPDRPSSRGSDHAAKEFYVTATAYTAYCAGCSGITSTGINLRKNPSAK
FT                   VIAVDPSIIPLGSKVYVEGYGYAIAADTGSGIRGYKIDVFFPERSDAFRWGRKRVKIRV
FT                   LP"
FT   gene            47990..48538
FT                   /locus_tag="GC56T3_0033"
FT   CDS_pept        47990..48538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0033"
FT                   /product="primase/topoisomerase like protein"
FT                   /note="TIGRFAM: primase/topoisomerase like protein; PFAM:
FT                   TOPRIM domain protein; KEGG: gka:GK0034 hypothetical
FT                   protein; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25107"
FT                   /inference="protein motif:TFAM:TIGR00334"
FT                   /protein_id="ADI25107.1"
FT                   /translation="MIVVEGKDDTAAIRRAVDADTIETNGAAVGADVIERIKLAKERRG
FT                   VIIFTDPDFPGEKIRRTIAEQVPGCKHAFLPREAAKAKNGKGIGVEHASPDEIRRALAN
FT                   VYEEASDWKEEITFAELIEAGLIGGAMARRRRQRLGEELKIGYANGRQFHKRLQVFRIS
FT                   RDAFYAALAHVMQEEADDV"
FT   gene            48531..49412
FT                   /locus_tag="GC56T3_0034"
FT   CDS_pept        48531..49412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0034"
FT                   /product="dimethyladenosine transferase"
FT                   /note="SMART: Ribosomal RNA adenine methylase
FT                   transferase-like; TIGRFAM: dimethyladenosine transferase;
FT                   KEGG: gka:GK0035 dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25108"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ADI25108.1"
FT                   /translation="MYKDIATPGRTKEILERYGFSFKKSLGQNFLIDANILRKIVDVAD
FT                   ISPDTGAIEIGPGIGALTEQLARRAKKVVAFEIDGRLLPILADTLSPYDNVRIFHQDVL
FT                   KADLHAVIAEELADVSDRMVVANLPYYVTTPIIMKLLTERLPIRGMVVMLQKEVADRLA
FT                   AKPGTKDYGSLTIAVQYYTEAEVIMTVPRTVFMPQPNVDSAVIRLVKRQHPPVVVDDEG
FT                   VFFQVVRASFAQRRKTLFNNLTNNLPGGKENKEQIERVLVALGIDPRRRGETLDIAEFA
FT                   SLSNALAPLFGK"
FT   gene            49553..50452
FT                   /locus_tag="GC56T3_0035"
FT   CDS_pept        49553..50452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0035"
FT                   /product="sporulation peptidase YabG"
FT                   /note="KEGG: gyc:GYMC61_0036 sporulation peptidase YabG;
FT                   TIGRFAM: sporulation peptidase YabG; PFAM: peptidase U57
FT                   YabG"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25109"
FT                   /inference="protein motif:TFAM:TIGR02855"
FT                   /protein_id="ADI25109.1"
FT                   /translation="MDVIKIGDIVARKSYQCDLLFRVIDIKEKNGEWEAILYGEDVRLV
FT                   ADAPCSDLVVIDEQEQQERKKREIELIEQSYRLFRQDYQAIKQKVEYRATGGYRVEKDF
FT                   FQIPGRVLHLDGDPLYLRKCMDLYERIGVPVHGIYCEESEMPEKVGYWIEQFRPDILVI
FT                   TGHDSYSKSKGKVHELKAYRHSRHFVQTVKEARKKVPHLDQLIIFAGACQSHFESLIRA
FT                   GANFASSPARVNIHALDPVYIVSRLSFTPFTETVDVWDVLRNTLTGEKGLGGVETKGVL
FT                   RTGMPFRLIEDREENRRS"
FT   repeat_region   50536..52240
FT                   /note="region with at least 95 percent identity another
FT                   region of the genome"
FT   gene            52348..52605
FT                   /locus_tag="GC56T3_0036"
FT   CDS_pept        52348..52605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0036"
FT                   /product="protein of unknown function DUF1021"
FT                   /note="PFAM: protein of unknown function DUF1021; KEGG:
FT                   gyc:GYMC61_0037 protein of unknown function DUF1021"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25110"
FT                   /inference="protein motif:PFAM:PF06257"
FT                   /protein_id="ADI25110.1"
FT                   /translation="MPKTLSDIKKTLDSNIGKRLTLRANGGRRKMIERCGILAETYPSV
FT                   FVIELDQKENSFERVSFSYADVLTETVKLTFWDDEQAGGQ"
FT   gene            52878..53057
FT                   /locus_tag="GC56T3_0037"
FT   CDS_pept        52878..53057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0037"
FT                   /product="small acid-soluble spore protein,
FT                   minoralpha/beta-type SASP"
FT                   /note="KEGG: gyc:GYMC61_0038 small acid-soluble spore
FT                   protein, minoralpha/beta-type SASP"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25111"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0038"
FT                   /protein_id="ADI25111.1"
FT                   /translation="MGRRRGIMSQRLKEELAKELGFYDVVQREGWGAIRAKDAGNMVRL
FT                   AIERAERQLAGTTE"
FT   gene            53281..54153
FT                   /locus_tag="GC56T3_0038"
FT   CDS_pept        53281..54153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0038"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /note="KEGG: gyc:GYMC61_0039
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25112"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ADI25112.1"
FT                   /translation="MRLSIKAPAKINLSLDVLYKRPDGYHEVKMVMTTIDLADRIELVA
FT                   LPEEDAIRIVSQNRFVPDDCRNLAYQAAKLLKETFSIRQGVAISITKHIPVAAGLAGGS
FT                   SDAAATLRGLNKLWQLGLTMDELAELGAKIGSDVAFCVYGGTALATGRGEIITPIASPP
FT                   PCWVVLAKPPIGVSTAEVYRNLELERVSHPDVDAMVRAIERQDYAAICRLVGNVLEEVT
FT                   LKKYPEVAHIKEQMKRFGADAVLMSGSGPTVFGLIEHDSRMQRVYNGLRGFCDQVFAVR
FT                   MLGERHSLD"
FT   gene            54209..55030
FT                   /locus_tag="GC56T3_0039"
FT   CDS_pept        54209..55030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0039"
FT                   /product="pur operon repressor"
FT                   /note="KEGG: gka:GK0040 pur operon repressor; TIGRFAM: pur
FT                   operon repressor; PFAM: purine repressor ;
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25113"
FT                   /inference="protein motif:TFAM:TIGR01743"
FT                   /protein_id="ADI25113.1"
FT                   /translation="MKLRRSGRLVDMTHYLLERPHQLIPLTFFAERYESAKSSISEDLA
FT                   IIKQTFEQQGIGTVRTLPGAAGGVQYIPKMDAEEAEEVVAYLCEQLSRPDRLLPGGYLY
FT                   MTDILGDPRIMNKIGRLYASMFADRPVDVVMTIATNGIPFAYAIANFLYVPVVIVRHDN
FT                   KVTEGPMVSINYVSGSSKRIQTMVLSKRSLAEGANVLIVDDFMKAGGTINGMISLLQEF
FT                   NGNVSGIGVLVESEEAKERLVDEYISLVKLSEVDAKEKRISVKEGNYKAFL"
FT   gene            55074..55448
FT                   /locus_tag="GC56T3_0040"
FT   CDS_pept        55074..55448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0040"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="KEGG: gyc:GYMC61_0041 endoribonuclease L-PSP;
FT                   TIGRFAM: endoribonuclease L-PSP; PFAM: Endoribonuclease
FT                   L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25114"
FT                   /inference="protein motif:TFAM:TIGR00004"
FT                   /protein_id="ADI25114.1"
FT                   /translation="MRKVETTKAPQAIGPYSQGIIVNNMFYSSGQIPLTPEGELVKGDI
FT                   QAQTHQVFQNLKAVLEAAGASLDTVVKTTVFLKNMDDFAAMNEVYSQYFPNHKPARSCV
FT                   EVARLPKDVLVEIEVVALVP"
FT   gene            55576..55866
FT                   /locus_tag="GC56T3_0041"
FT   CDS_pept        55576..55866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0041"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: gyc:GYMC61_0042
FT                   SpoVG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25115"
FT                   /inference="protein motif:PFAM:PF04026"
FT                   /protein_id="ADI25115.1"
FT                   /translation="MEVTDVRLRRVNTEGRMKAIASITLDNEFVVHDIRVIDGNNGLFV
FT                   AMPSKRTPDGEFRDIAHPINSATRGKIQEAILAEYHRLGKLEEELEEAGAS"
FT   gene            55999..57375
FT                   /locus_tag="GC56T3_0042"
FT   CDS_pept        55999..57375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0042"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="KEGG: gyc:GYMC61_0043 UDP-N-acetylglucosamine
FT                   pyrophosphorylase; TIGRFAM: UDP-N-acetylglucosamine
FT                   pyrophosphorylase; PFAM: Nucleotidyl transferase;
FT                   transferase hexapeptide repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25116"
FT                   /inference="protein motif:TFAM:TIGR01173"
FT                   /protein_id="ADI25116.1"
FT                   /translation="MKRYAVILAAGQGTRMKSKWYKVLHPVCGKPMVQHVIDQVSKLGV
FT                   EKTIAVVGFGAEQVKEQLGSQCEYALQEEQLGTAHAVMQAAPHLRGLEGVTIVVCGDTP
FT                   LITAETMETLVEHHMAAKAKATVLTAIADDPSGYGRIVRNQAGHVEKIVEHKDASEQER
FT                   NIREINTGIYCFDNQTLFQALTKVTNHNAQGEYYLTDVIEIIKADGGVVSAYQAPSFEE
FT                   TIGVNDRIALAEAERIMRARICRQHMKNGVTIIDPASTYISAEAMIGRDTVIYPGTVIE
FT                   GETVIGEDCVIGPNSEIKNCYIGHRTSIRHSVAHDSEIGSDVTIGPFAHIRPLSKIDDE
FT                   VRIGNFVEVKKSTFGKGSKAPHLSYIGDAEVGADVNLGCGSITVNYDGVNKHMTKIEDG
FT                   AFIGCNVNLIAPVTVGQGAYVAAGSTITNDVPGRALAIARARQVNKENYVDRLPGKKKS
FT                   "
FT   gene            57388..58335
FT                   /locus_tag="GC56T3_0043"
FT   CDS_pept        57388..58335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0043"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="TIGRFAM: ribose-phosphate pyrophosphokinase; KEGG:
FT                   gyc:GYMC61_0044 ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25117"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ADI25117.1"
FT                   /translation="MSDCQHQLKLFALNSNMKLAKEIAEVMGIELGKCSVSRFSDGEIQ
FT                   INIEESIRGDDVFVIQSTSVPVNEHLMELLIMIDALKRASARTINIVMPYYGYARQDRK
FT                   ARSREPITAKLVANLLETAGASRVITLDLHAPQIQGFFDIPIDHLMGVPILADYFKSKQ
FT                   LEDIVVVSPDHGGVTRARKLADRLKAPIAIIDKRRPKPNVAEVMNIVGQVAGKTAILID
FT                   DIIDTAGTITLAANALAESGAKEVYACCTHPVLSGPAIERIQSSKIKELVVTNSIALPE
FT                   EKKIDKIVELSVAPLIAEAITRVYEMKSVSVLFD"
FT   gene            58413..59045
FT                   /locus_tag="GC56T3_0044"
FT   CDS_pept        58413..59045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0044"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="KEGG: gyc:GYMC61_0045 ribosomal 5S rRNA E-loop
FT                   binding protein Ctc/L25/TL5; TIGRFAM: ribosomal 5S rRNA
FT                   E-loop binding protein Ctc/L25/TL5; PFAM: Ribosomal protein
FT                   L25-like"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25118"
FT                   /inference="protein motif:TFAM:TIGR00731"
FT                   /protein_id="ADI25118.1"
FT                   /translation="MAIVLEAKERTDKKRSTLRRIRSQGGIPAILYGKKVENKMIFVSA
FT                   AELEKVLREGGRTSLLTLKVGGEDYSVLLREMQRDPLRGELLHADFQAVDLSTEVDIDV
FT                   EVRLVGEAPGVKDGGVLQQNLHELSIRVLPANIPPVIEVDISGLQVGDTVTVGDVQTDG
FT                   KFEINHEPSEVIATILPPQQEEEIDSGEQQEAGQPDAAEGRETTPEE"
FT   gene            59106..59666
FT                   /locus_tag="GC56T3_0045"
FT   CDS_pept        59106..59666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0045"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="TIGRFAM: peptidyl-tRNA hydrolase; KEGG:
FT                   gyc:GYMC61_0046 peptidyl-tRNA hydrolase; PFAM:
FT                   peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25119"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ADI25119.1"
FT                   /translation="MKLFVGLGNPGEEYEQTRHNVGFFVIDELAKRWNVSLKTAKFRGL
FT                   FGTASVSGEKVALCKPLTYMNLSGECVRPLMDYYDIAIDDVIVIYDDLDLPPGKIRLRL
FT                   KGSSGGHNGVKSLIHHLGTEQFKRIRIGIGRPTGGQPVTDYVLGRFTEEEKPAVDKAVL
FT                   RAANACEQAVKAPFIQVMNDFNE"
FT   gene            59778..60008
FT                   /locus_tag="GC56T3_0046"
FT   CDS_pept        59778..60008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0046"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_0047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25120"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0047"
FT                   /protein_id="ADI25120.1"
FT                   /translation="MALHYYCRHCGAKVGTIEQMPIYSEKLGFHHLTEEERLEMISYEP
FT                   NGDIHVKTICEDCQEALARNPEWHQYEKFIH"
FT   gene            60098..63631
FT                   /locus_tag="GC56T3_0047"
FT   CDS_pept        60098..63631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0047"
FT                   /product="transcription-repair coupling factor"
FT                   /note="TIGRFAM: transcription-repair coupling factor; PFAM:
FT                   transcription factor CarD; DEAD/DEAH box helicase domain
FT                   protein; helicase domain protein; TRCF domain protein;
FT                   KEGG: gyc:GYMC61_0048 transcription-repair coupling factor;
FT                   SMART: DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25121"
FT                   /inference="protein motif:TFAM:TIGR00580"
FT                   /protein_id="ADI25121.1"
FT                   /translation="MLSLHRYLAENQDVRTIIEGLHVRLKEQLVAGLSGSARSVFISTL
FT                   YKETGRPLLVVSHNLFQAQKMYDDLVSLLGPEDVFLYSMNEVIAAEMAVASPELKAQRL
FT                   EIMNHWAQGGKGVVVCPVAGLRRLLPPPSLWKQYLFTFSVGQEFDVERCKQKFVQMGYK
FT                   RVGTVSAPGEFSVRGGIIDIYPLTVELPYRIELFDTEIESIRTFTPDDQRSQGQIERIM
FT                   IGPADEIILDGETRRRGIERIEAGLASSLETMKDEAAKQRMYEHIHAELEQLREGQEIE
FT                   QQYKYMSLFYEKVASLLDYLPEDGVLLMDEMSRLQEAAERLDREEAEWYTSLLDGGKMI
FT                   HGVPLSHSFSELLQKHRFQRVYLSLFLRHVPYAHPQNVVNITCKQMQNFHGQMALLQSE
FT                   VERWEKANYAVVFLAPNAERVKKLQSLLQDYEIDALPLARDAALLHGKCQLLEGDLNTG
FT                   FELPLQKIAVITEEELFKKRVKRPVRRQKLSNAERIKSYAELQVGDYVVHVNHGIGKYL
FT                   GIETLEINGVHKDYIHIQYQGGDTLYVPVDQIDQVQKYVGSEGKEPKIYKLGGSEWKKV
FT                   KKKVESSVQDIAEDLIKLYAEREASKGYAFSPDTEMQREFEAAFPYQETEDQLRSIEEI
FT                   KRDMESDKPMDRLLCGDVGYGKTEVALRAAFKAIMDGKQVAFLVPTTILAQQHYETVRE
FT                   RFQGFPINVGLLNRFRTKKQQAEIIKGLKDGTIDMVIGTHRLLSKDVKFKDLGLLIIDE
FT                   EQRFGVAHKEKIKQLKANIDVLTLTATPIPRTLHMSMIGVRDLSIIETPPENRFPVQTY
FT                   VMEYTPELAKEAIERELARDGQVFFLYNHIEDIDLKAEEIAQLVPEARVTYVHGRMSET
FT                   ELESTILAFLEGQYDVLVTTTIIETGIDIPNVNTLIVYDADRMGLSQLYQLRGRVGRSN
FT                   RVAYAYFTYRKDKVLNEAAEKRLQAIKEFTELGSGFKIAMRDLSIRGAGNILGAEQHGF
FT                   IDSVGFDLYSQMLKEAIEKRRGIKREDEQPDVVIDVEVDAYIPSTYIADELQKIEMYKR
FT                   FKAVETLEDVEALREEMVDRFGDYPDEVAYLFQIAELKVLAKQLGVESMKQHKQQIDIL
FT                   FTEQASKTVEIQRLSDIGRRHGRLFGFGMDGAKLKIVLYIKEMKPHEWLMILEETLRRL
FT                   SGVENEKSVTA"
FT   gene            63839..64375
FT                   /locus_tag="GC56T3_0048"
FT   CDS_pept        63839..64375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0048"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: gyc:GYMC61_0049 transcriptional regulator,
FT                   AbrB family; TIGRFAM: stage V sporulation protein T;
FT                   transcriptional regulator, AbrB family; PFAM: SpoVT/AbrB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25122"
FT                   /inference="protein motif:TFAM:TIGR02851"
FT                   /protein_id="ADI25122.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPISELGDFAKEYAEALFDSLGQPVLICDRDVYIAVAGVSKKEYMNKSVSPLVEK
FT                   AMEDRNSILHTEEGEVELVDGMTETLKSYTIGPIVANGDPIGAVIILSREKTLGEVEHK
FT                   AVETAASFLARQMEQ"
FT   gene            64649..66199
FT                   /locus_tag="GC56T3_0049"
FT   CDS_pept        64649..66199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0049"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   gyc:GYMC61_0050 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25123"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADI25123.1"
FT                   /translation="MGNVWKGAAILTAAALAAKLLSALYRVPYQNMVGDIGFYIYQQVY
FT                   PIYGIVVALSLTGYPVAVSKLVAERLAGQDEAGAAASVRVALLVLSVLGVILFASLYLG
FT                   AGVIASAMGDGRLTPLVRLLSFSFLLFPPIALLRGYFQGRHDMTPTAASQVGEQFVRVT
FT                   AILGLSYGAVQRGADVYACGMAAVAGTLVGMAAALFILLFFLSRRRRLKTSGRTPPAWD
FT                   RQVGRRLLTAGTVICLTNMALTLIPLVDSFLFVPLLQEAGARLDEVQRLKGVYDRGQPL
FT                   IQLGTVVGTSFSLALVPLLSGARRQGAVFAYGALSIRLAVVIGLGASLGLICLIRPINA
FT                   MLFENDYGSSVLAVLSSSVFFTTIALTASALLQGMGREWTAAAGVALAVAGKAALMHWL
FT                   APRFGALGAAAATTGAYALMAGFLCAFLPREYRTAGRKYMYPTVKAAAMMAVVLHGYRW
FT                   LMDSSSEGRLWAAAEALGGVAIGAVVYLACIVKGHVFSEQELAALPLANKFRLRLGGR"
FT   gene            66206..67666
FT                   /locus_tag="GC56T3_0050"
FT   CDS_pept        66206..67666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0050"
FT                   /product="MazG family protein"
FT                   /note="KEGG: gyc:GYMC61_0051 MazG family protein; TIGRFAM:
FT                   MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25124"
FT                   /inference="protein motif:TFAM:TIGR00444"
FT                   /protein_id="ADI25124.1"
FT                   /translation="MNTIYVFGLGAGDVKQLPIGVYRKLKRAHPLFLRTKEHPVVKWLT
FT                   EEGIAFTSFDEVYEKHEQFADVYADIVDQLTEQAKRGDVFYAVPGHPLVAERTVQLLFE
FT                   AERRGVCRIVIEGGQSFLDALFTAVRIDPIEGFQLLDATTFRGEEWSPSLHAVFCQVYD
FT                   SFVASNVKLSLMEQLPDDYPIYIVTAAGTKDEQVKRVPLYELDRETGLDNLTSVYVPPV
FT                   KDEPLLYHRFETLRRVIATLRGPNGCPWDRKQTHASLKRYLLEEAYELLEAIDEGDDDH
FT                   MVEELGDVLLQVMLHAQIGADRGLFSIDDVIRTLTAKMIRRHPHVFGDVTAETAEQVVA
FT                   NWEKIKEKEKGGGLSESILADIPKSLPGTMRAYELQKRAAKVGFDWDDAAPIWQKVEEE
FT                   MAEFRAETSGGRRDRLVGEFGDLLFALINLARYYGIQPEEALQMANDKFARRFAYIEEQ
FT                   VRKSGRSITSFSLAELDRFWEEAKENER"
FT   gene            67680..67961
FT                   /locus_tag="GC56T3_0051"
FT   CDS_pept        67680..67961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0051"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="KEGG: gyc:GYMC61_0052 RNA-binding S4 domain protein;
FT                   PFAM: RNA-binding S4 domain protein; SMART: RNA-binding S4
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25125"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ADI25125.1"
FT                   /translation="MRLDKFLKVSRLIKRRTLAKEIADQGRVWINGHVAKASSDVKVGD
FT                   ELTIQFGQKRVTVKVTDLKETTKKEEATGLYELIREERTTPAPEQDDV"
FT   gene            68084..68389
FT                   /locus_tag="GC56T3_0052"
FT   CDS_pept        68084..68389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0052"
FT                   /product="sporulation protein YabP"
FT                   /note="KEGG: gyc:GYMC61_0053 sporulation protein YabP;
FT                   TIGRFAM: sporulation protein YabP; PFAM: YabP family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25126"
FT                   /inference="protein motif:TFAM:TIGR02892"
FT                   /protein_id="ADI25126.1"
FT                   /translation="MSRHDEFGGSTNKGPVQEHDVIMRGRRLLDITGVKQVESFDNEEF
FT                   LLETVMGFLAIRGQNLQMKNLDVDKGVVSIKGRIFDLVYLDDHQEKAKGFFSKLFK"
FT   gene            68386..69018
FT                   /locus_tag="GC56T3_0053"
FT   CDS_pept        68386..69018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0053"
FT                   /product="spore cortex biosynthesis protein YabQ"
FT                   /note="KEGG: gyc:GYMC61_0054 spore cortex biosynthesis
FT                   protein YabQ; TIGRFAM: spore cortex biosynthesis protein
FT                   YabQ; PFAM: Spore cortex biosynthesis protein, YabQ-like"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25127"
FT                   /inference="protein motif:TFAM:TIGR02893"
FT                   /protein_id="ADI25127.1"
FT                   /translation="MNVSIQLYTMLAMIGMGGWLGLAWDTYSRMLKRHERAHWLVFVND
FT                   VLFWAVQALIVFYVLLFVNEGELRFYLFLALLCGYAAYQSLLRSFYVRVLEWFIGLAVR
FT                   LGQTLVQLFRLMVMRPLILLGQMALALLLFAWRLLLWIVRFVLLAVWKMIRLLLAPLRW
FT                   TGIMIWRRVPPQRRAGVEKFFRRLKGFAGQIKNTKEKISMWFAKWRE"
FT   gene            69035..69406
FT                   /locus_tag="GC56T3_0054"
FT   CDS_pept        69035..69406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0054"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG:
FT                   gyc:GYMC61_0055 septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25128"
FT                   /inference="protein motif:PFAM:PF04977"
FT                   /protein_id="ADI25128.1"
FT                   /translation="MNVPRRTNVTKLSSTYIAEHEEKKQKAARRRRAVAVRLVVWSLLF
FT                   AMFASALVYTLHSQAKAIDAKTAEQQKLKEQLAELKRKEKQLKEEMKKLHDDDYIAELA
FT                   RKKYYLSKDGEIIFVLPEK"
FT   sig_peptide     69035..69190
FT                   /locus_tag="GC56T3_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.754) with cleavage site probability 0.559 at
FT                   residue 52"
FT   gene            69525..69923
FT                   /locus_tag="GC56T3_0055"
FT   CDS_pept        69525..69923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0055"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   gka:GK0056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25129"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ADI25129.1"
FT                   /translation="MSIEVGSKLQGKVTGITKFGAFVELPEGVTGLVHISEVADNYVKD
FT                   INDHLKVGDMVYVKVINVGQDGKIGLSIRKAKDTPSSQRPRHRTNDRSAADSLEQKISR
FT                   FLKESEDRLASLRRHTESKRGGRGARRG"
FT   gene            70097..70173
FT                   /locus_tag="GC56T3_R0012"
FT                   /note="tRNA-Met1"
FT   tRNA            70097..70173
FT                   /locus_tag="GC56T3_R0012"
FT                   /product="tRNA-Met"
FT   gene            70186..70257
FT                   /locus_tag="GC56T3_R0013"
FT                   /note="tRNA-Glu1"
FT   tRNA            70186..70257
FT                   /locus_tag="GC56T3_R0013"
FT                   /product="tRNA-Glu"
FT   gene            70455..72935
FT                   /locus_tag="GC56T3_0056"
FT   CDS_pept        70455..72935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0056"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="SMART: protein phosphatase 2C domain protein;
FT                   TIGRFAM: stage II sporulation protein E; KEGG:
FT                   gyc:GYMC61_0057 stage II sporulation protein E, protein
FT                   serine/threonine phosphatase; PFAM: Stage II sporulation E
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25130"
FT                   /inference="protein motif:TFAM:TIGR02865"
FT                   /protein_id="ADI25130.1"
FT                   /translation="MERVERGTVRRSISEVPIHDTQATVSRWMRHVKLRLGHLFIHQGF
FT                   LLLLVGFLLGRALILSKLTPFALPFFVSVYMLRRDKAAFALISLLAGALTLSLDVALFV
FT                   GISIFGFLFIYGWVRRVISESLKIVPFVVFVLSLSAKWLISYYWLGERSVYGAAMAVVE
FT                   AGLSLVLTLIFMQSIPLLTVQKHKHALRAEEIISLIILLASMLTGMIGWAVYGLSLEHV
FT                   MSRYLVLLFAFVAGAATGSTVGVVTGLVLSLANVGNLSEMSLLAFAGLLGGLLREGKKL
FT                   GVAFGLLVATLLLGLYGEGKSELVPTLLESGIAIMLFFGTSRSLTEKIAKYIPGTAEYI
FT                   NEQQQYVRKIRDMTVQRVSQFSNVFQALAESFSPEPLPDANEYSDREVDYFLSDITEKT
FT                   CQTCFKKTQCWADNFRTTYAYMKQMMGEADEKTLSQNHQLLREWERYCVKAGKVVDAIE
FT                   KEMVAYQANRKLKRQIHESRKLVAEQLLGVSQVMDDFAKEMQKEQENHYLQEEQIYHAL
FT                   QEFGIEVGHVDIYSLEKGNIDIEMSIPYCEGRGECEKLIAPMLSDILGETIVVKREECA
FT                   AYPNGYCRVAFGSTKAFVVETGVAFAAKGGGFISGDSYATIELATGKYAVAISDGMGNG
FT                   ERAHDESRETLRLLQKILQTGMDESIAIKSINSILALRTTEDMYATLDLAIIDLQNAAT
FT                   KFLKIGSTPSFIKRGDKVMKVEASNLPMGIIKEVEFDVVTEQLKSGDLLIMMSDGVFEG
FT                   PMNVENHDVWMKRKIQELKTNDPQEVADLIMEEVIRQCGGEIEDDMTVVVAKVRHNTPK
FT                   WATIPAYMYMKKAQ"
FT   gene            73001..73741
FT                   /locus_tag="GC56T3_0057"
FT   CDS_pept        73001..73741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0057"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_0058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25131"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0058"
FT                   /protein_id="ADI25131.1"
FT                   /translation="MRKGTLRQILLITDGCSNHGEDPAAMAALAREQGITVNVIGILDQ
FT                   GAMDENGRREIEAIAAAGGGMSQVVYAKQLSQTVQMVTRQAMTQTLQGLVNRELKQIFG
FT                   SDVSLEDLPPDKRGQVMEVVDELGETVALDVLILIDTSGSMKTKLPTVKEALIDLSLSL
FT                   NARMGENRFSVFIFPGKRAHAEKMIDWTPRIEELSTIFPKLASGGLTPTGPALREAIAY
FT                   FERKRSLRSWIGDGDEPYIEESSL"
FT   gene            73704..74678
FT                   /locus_tag="GC56T3_0058"
FT   CDS_pept        73704..74678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0058"
FT                   /product="serine/threonine protein kinase"
FT                   /note="KEGG: gyc:GYMC61_0059 serine/threonine protein
FT                   kinase; PFAM: Serine/threonine-protein kinase-like domain;
FT                   SMART: serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25132"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADI25132.1"
FT                   /translation="MAMSHTSKNRLCNLPPGTVITGKWHGRSYRLLRRLGSGANGVVYL
FT                   AENGRTRVAVKLSDDYASLASEMNILRRFAKVQGAALGPSLLEADDWQSPFARETIPFY
FT                   VMEYIEGENFAAFIRRRGKEWAPVLVMQLLSVLDRLHQEGWVFGDLKPDNLIVTGSPPS
FT                   VRLLDVGGTTLQGRAVKEFTELYDRGYWGLGSRKAEPSYDLFAAAMVMISSCCPGPIEK
FT                   KGDGRAQLLSIIETDRFLTRYKEVLQKALDGRYRKAADMRRDLLAASSRHTSAENERKA
FT                   VPSRRSGRQVKRRRQARGIVETVVIAAALLGAYAFYIYWQLAM"
FT   gene            74746..76140
FT                   /locus_tag="GC56T3_0059"
FT   CDS_pept        74746..76140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0059"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="KEGG: gyc:GYMC61_0060 tRNA(Ile)-lysidine synthetase;
FT                   TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM: PP-loop
FT                   domain protein; Protein of unkown function DUF1946 PP-loop
FT                   ATpase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25133"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ADI25133.1"
FT                   /translation="MIDKVRAFIHRHQLLSEGAAVIVGVSGGPDSLALLHVFLSLRDEW
FT                   KLQVIAAHVDHMFRGRESEEEMEFVKRFCVERRILCETAQIDVPAFQRSAGLGAQEAAR
FT                   ICRYRFFAELMEKHQAGYVAVGHHGDDQVETILMRLVRGSTSKGYAGIPVKRPFHGGYL
FT                   IRPFLAVSRAEIEAYCRQMGLSPRRDPSNEEDDYTRNRFRHHIVPLLRQENPRLHERFQ
FT                   QYSEMMAEDEQFLEELAADALNKVMEKQHRDAALSIGPFLALPRPLQRRVLQLLLLRLY
FT                   DGVPPTLTSVHIGHILMLCERGRPSGMIDLPKGLKVIRSYDRCLFTFDAESGEKGYWFE
FT                   LPVPALLPLPNGYAIISEFGEHYPRKQAGNDWFVVDPASVSLPLRVRTRRRGDRMVLKG
FT                   TGGTKKLKEIFIEAKIPRMERDRWPIVEDADGRILWVPGLKKSAFEAQNRGQARYILLQ
FT                   YQAMNS"
FT   gene            76153..76698
FT                   /locus_tag="GC56T3_0060"
FT   CDS_pept        76153..76698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0060"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="TIGRFAM: hypoxanthine phosphoribosyltransferase;
FT                   KEGG: gyc:GYMC61_0061 hypoxanthine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25134"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ADI25134.1"
FT                   /translation="MGMKDDIQKVLITEEEIQAKVKELGGLLTKEYEGRFPLAVGVLKG
FT                   AMPFMADLLKHIDTYLEMDFMDVSSYGNATVSSGEVKIVKDLNTSVEGRDILIIEDIID
FT                   SGLTLSYLVDLFRYRKANSIKIVTLLDKPSGRKADIQADYTGFTVPDEFVVGYGLDYAE
FT                   KYRNLPFIGVLKPEVYQK"
FT   gene            76793..78691
FT                   /locus_tag="GC56T3_0061"
FT   CDS_pept        76793..78691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0061"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; KEGG: gyc:GYMC61_0062 ATP-dependent
FT                   metalloprotease FtsH; PFAM: peptidase M41; AAA ATPase
FT                   central domain protein; peptidase M41 FtsH extracellular"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25135"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADI25135.1"
FT                   /translation="MNRIFRNTIFYLLIFLVVIGVVSFFNGTNQRTEPMTYDAFITHLE
FT                   NGDVKSFSIKPERGVYEIKGQLKTYSEGQYFSTYVMNSDKVLDRIDAAAARTRVEVVPA
FT                   DETSGWVTFFTSIIPFVIIFILFFFLLNQAQGGGSRVMNFGKSRARLYTDDKRKVRFRD
FT                   VAGADEEKEELVEIVEFLKDPRKFAELGARIPKGVLLVGPPGTGKTLLARAVAGEAGVP
FT                   FFSISGSDFVEMFVGVGASRVRDLFETAKKNAPCIIFIDEIDAVGRQRGAGLGGGHDER
FT                   EQTLNQLLVEMDGFNGNEGIIIIAATNRPDILDPALLRPGRFDRQITVDRPDVKGREAV
FT                   LRVHARNKPLDESVDLKTIAMRTPGFSGADLENLLNEAALVAARRNKKKIDMSDIDEAT
FT                   DRVIAGPAKKSRVISEKERRIVAFHEAGHTVIGMVLADAEMVHKVTIVPRGQAGGYAVM
FT                   LPKEDRYFMTKAELMDKITGLLGGRVAEEIVFNEVSTGAHNDFQRATNIARRMVTEFGM
FT                   SEKLGPLQFGQPSGQVFLGRDLHNEQNYSDKIAYEIDLEIQRIIKECYEKAKQILTQHR
FT                   DKLDLIANTLLEVETLDAEQIKHLFEHGTLPKDRNGREEAGKSDGDVKINIQKKEE"
FT   gene            78818..79594
FT                   /locus_tag="GC56T3_0062"
FT   CDS_pept        78818..79594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0062"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /EC_number="2.7.1.33"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   KEGG: gka:GK0063 pantothenate kinase; PFAM: Bvg accessory
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25136"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ADI25136.1"
FT                   /translation="MIFVLDVGNTNTVLGVYDGDELKHHWRIETSRSKTEDEYGMMIKA
FT                   LLNHVGLQFSDIRGIIISSVVPPIMFALERMCLKYFHIKPLIVGPGIKTGLDIKYDNPR
FT                   EVGADRIVNAVAGIHLYGSPLIIVDFGTATTYCYINEHKQYMGGAIAPGIMISTEALFA
FT                   RAAKLPRIEIARPDDIIGKNTVSAMQAGILYGYVGQVEGIVSRMKAKSKIPPKVIATGG
FT                   LAPLIASESDIIDVVDPFLTLTGLKLLYEKNTEKKG"
FT   gene            79603..80493
FT                   /locus_tag="GC56T3_0063"
FT   CDS_pept        79603..80493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0063"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: gyc:GYMC61_0064 HSP33
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25137"
FT                   /inference="protein motif:PFAM:PF01430"
FT                   /protein_id="ADI25137.1"
FT                   /translation="MKMGDYLVKALAYNGQVRAYAARTTETVAEAQRRHQTWPTASAAL
FT                   GRALTAGVMMGAMLKGEETLTIKIDGGGPIGVILVDSNARGEVRGYVTNPHVHFELNEH
FT                   GKLDVARAVGKNGMLTVVKDLGLRDFFTGQVPLISGELGDDFTYYFASSEQIPSSVGVG
FT                   VLVNPDHTIRAAGGFIIQLMPGTEENTITRIEERLKQIPPVSRMIERGLSPEQLLEQLL
FT                   GDGGVRVLETMPVSFVCRCSRERIADALISLGPEEIQDIIDKEGQAEASCHFCNETYHF
FT                   DKAELEQLKQLAKKE"
FT   gene            80580..81506
FT                   /locus_tag="GC56T3_0064"
FT   CDS_pept        80580..81506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0064"
FT                   /product="cysteine synthase A"
FT                   /note="KEGG: gyc:GYMC61_0065 cysteine synthase A; TIGRFAM:
FT                   cysteine synthase A; cysteine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25138"
FT                   /inference="protein motif:TFAM:TIGR01139"
FT                   /protein_id="ADI25138.1"
FT                   /translation="MARTVNSITELIGDTPAVKLNRIVDEDSADVYLKLEFMNPGSSVK
FT                   DRIALAMIEAAEKAGKLKPGDTIVEPTSGNTGIGLAMVAAAKGYKAVLVMPDTMSLERR
FT                   NLLRAYGAELVLTPGAQGMRGAIAKAEELVREHGYFMPQQFKNEANPEIHRLTTGKEIV
FT                   EQMGDQLDAFVAGVGTGGTITGAGKVLREAYPNIKIYAVEPADSPVLSGGKPGPHKIQG
FT                   IGAGFVPDILDTSIYDGVITVTTEEAFAAARRAAREEGILGGISSGAAIHAALKVAKEL
FT                   GKGKKVLAIIPSNGERYLSTPLYQFED"
FT   gene            81621..83042
FT                   /locus_tag="GC56T3_0065"
FT   CDS_pept        81621..83042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0065"
FT                   /product="Anthranilate synthase"
FT                   /EC_number="4.1.3.27"
FT                   /note="KEGG: gyc:GYMC61_0066 anthranilate synthase; PFAM:
FT                   Chorismate binding-like; Anthranilate synthase component I
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25139"
FT                   /inference="protein motif:PRIAM:4.1.3.27"
FT                   /protein_id="ADI25139.1"
FT                   /translation="MEQRRRRLKRTIDYRGRDWFRQYEQLAYSRPHHVLLESGQGGRYS
FT                   IIGLDPIGVIRADERRLIIKQRGVETVLDGSPLEGLRQWLRCFAVPDEGESLPCQGGLI
FT                   GFISYDAVRYLERLPVLAQDDLRLPLMYFLLFDDVAIYDHQTEQLHLLAYANEGEESEA
FT                   NRRLARHARMWLEDRNEALVWPLAASTAAPSVSMTKERFMDAVRRVQRYIAAGDVFQVN
FT                   LSVRQSQPLVTHPFAVYKQLRMLNPSPYMAYLHTPEFQVVSGSPELLVRKRGWRLETRP
FT                   IAGTRSRGRTAAEDEQIARKLLASEKERAEHAMLVDLERNDLGRVCAYGTVRVDEWMTV
FT                   EKYSHVMHIVSHVSGTMTTEHDAFSVIRAMFPGGTITGAPKVRTMEIIEELEPVRRGLY
FT                   TGSIGWIDFQGNMELNIAIRTMVVKDGLAHVQAGAGIVIDSNPEHEYKECLKKAAALWK
FT                   AKELSEAEALFPSMR"
FT   gene            83048..83623
FT                   /locus_tag="GC56T3_0066"
FT   CDS_pept        83048..83623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0066"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="KEGG: gyc:GYMC61_0067 glutamine amidotransferase of
FT                   anthranilate synthase; TIGRFAM: glutamine amidotransferase
FT                   of anthranilate synthase; PFAM: glutamine amidotransferase
FT                   class-I"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25140"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADI25140.1"
FT                   /translation="MIVMIDNYDSFTYNLVQYLGVLGEELIVKRNDEITVAEIERLRPD
FT                   FIMISPGPCTPNEAGVSLEVIDRFAGQIPIFGVCLGHQAIAQAFGGRVVRAPRLMHGKT
FT                   SSVYHDGETIFRGVPNPFTATRYHSLIVEKETLPDCFVVSAWTEEDEVMAIRHKTLPVE
FT                   GVQFHPESIMTSHGMQLLKNFINTYKKA"
FT   gene            83629..84504
FT                   /locus_tag="GC56T3_0067"
FT   CDS_pept        83629..84504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0067"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG:
FT                   gyc:GYMC61_0068 aminodeoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25141"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ADI25141.1"
FT                   /translation="MYVYINGAVVPREEAQLSAFDHGFLYGLGLFETFRTYSGHPFLLD
FT                   DHLARLNKGLSELHIERQFGRAEVVAIIEQLLEANGLRDAYVRFNVSAGVGDLGLPIER
FT                   YRNPTVIVYMKPLPPPVPPEGKEGVVLAARRNSPEGNERLKSHHYLNNMIGKWELGHRP
FT                   HAEGIFLNSDGAVAEGIVSNIFWVKDGIVYTPAPAVGILNGITRQFIIALLKQLRIPVE
FT                   EGVYPLSHLLQADEAFITNSVQEIVPLCRIGHCVYQGKNGPVVRALQHHYRRLTHRLWT
FT                   RNELAERMND"
FT   gene            84504..85355
FT                   /locus_tag="GC56T3_0068"
FT   CDS_pept        84504..85355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0068"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="TIGRFAM: dihydropteroate synthase; KEGG:
FT                   gyc:GYMC61_0069 dihydropteroate synthase; PFAM:
FT                   dihydropteroate synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25142"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ADI25142.1"
FT                   /translation="MTTSMRPLRLQCRGHELDLNKKTLIMGIVNVTPDSFSDGGRFYDV
FT                   ENAVKHAKRLVAEGADIIDIGGESTRPGADPVPLDEELRRVIPAVKAIAKAVSVPISID
FT                   TYKAEVARQAMEAGAHIINDVWGAKADPDMARVAATYGAPIILMHNRRDMAYRDLISDM
FT                   IADLKESIRIVKEAGVKDENIILDPGIGFAKTVEHNLEVMRRLDEFAALGYPLLLGTSR
FT                   KRFIGHVLGVPVEERVEGTGATVCLGIMKGVHIVRVHDVLPIARMAKMMDAMLGKGESG
FT                   HR"
FT   gene            85327..85707
FT                   /locus_tag="GC56T3_0069"
FT   CDS_pept        85327..85707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0069"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; KEGG:
FT                   gyc:GYMC61_0070 dihydroneopterin aldolase; PFAM:
FT                   dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25143"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ADI25143.1"
FT                   /translation="MGRERAVIDKIYVQGMEFYGYHGVFREENILGQRFLVDVTLELDL
FT                   QPAGRSDCLEYTVNYADVYERCRAIVEERTFALIEAVAEAIAADLLAAFPVVERCIVKV
FT                   TKPNPPIRGHYQHVAVEIDRGR"
FT   gene            85708..86235
FT                   /locus_tag="GC56T3_0070"
FT   CDS_pept        85708..86235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0070"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; KEGG: gka:GK0071
FT                   7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase
FT                   (2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase); PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25144"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ADI25144.1"
FT                   /translation="MENIAYLALGSNLGDRVSYLRSAIEALHHHQEIFITSSSSIYETD
FT                   PVGYVNQGKFLNMVIEVATTLSPFALLDVTQQIERRLGRKREIRWGPRTLDLDILLYNH
FT                   ENIETEQLTIPHPRMAERAFVLIPLFEVNSHVAIPNLSEPLIDIIGRLPDKKGVHVWKR
FT                   KDGEDVFALFES"
FT   gene            86187..86408
FT                   /locus_tag="GC56T3_0071"
FT   CDS_pept        86187..86408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0071"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: gyc:GYMC61_0072 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25145"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADI25145.1"
FT                   /translation="MEAERWGRRIRAFRKLKGYTQERLAKELGISVSILGEIERGNRMP
FT                   SDSLVGQIAERLNISVEELAPPKLESNK"
FT   gene            86425..87426
FT                   /locus_tag="GC56T3_0072"
FT   CDS_pept        86425..87426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0072"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="KEGG: gyc:GYMC61_0074 TIM-barrel protein, nifR3
FT                   family; TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25146"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ADI25146.1"
FT                   /translation="MFRIGDVEIKNRVVLAPMAGVCNSAFRLTVKEFGAGLVCAEMVSD
FT                   KGIVYNNEKTLNMLYIDEREKPISLQIFGGEKETLVKAAKFVDKNTNADIIDINMGCPV
FT                   PKITNCDAGAKWLLDPNKIYDVVAAIVDAVEKPVTVKMRIGWDEKHIYAVENAQAVERA
FT                   GGKAVAVHGRTRVQMYEGKADWNIIKQVKEAVNIPVIGNGDVKTPQDAKRMLEETGVDG
FT                   VMIGRAALGNPWMIYRTVRYLETGELIPEPTPREKIDVCLLHLDRLIALKGEYIAVKEM
FT                   RKHAAWYLKGIRGAAKIRNAINECETRDELAALLLRVAEEAEVQAAANAEAV"
FT   gene            87517..89001
FT                   /locus_tag="GC56T3_0073"
FT   CDS_pept        87517..89001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0073"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="KEGG: gyc:GYMC61_0075 lysyl-tRNA synthetase;
FT                   TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA synthetase class
FT                   II (D K and N); nucleic acid binding OB-fold
FT                   tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25147"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ADI25147.1"
FT                   /translation="MSHEELNDQLRVRREKLKKIEELGVDPFGKRFERTHKAQELFELY
FT                   GDLSKEELEEKQIEVAVAGRIMTKRGKGKAGFAHIQDVTGQIQIYVRQDDVGEQQYELF
FT                   KISDLGDIVGVRGTMFKTKVGELSIKVSSYEFLTKALRPLPEKYHGLKDIEQRYRQRYL
FT                   DLIMNPESKKTFITRSLIIQSMRRYLDSRGYLEVETPMMHAVAGGAAARPFITHHNALD
FT                   MTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDI
FT                   MELTENLIAHIATEVLGTTKIQYGEHVVDLTPEWRRLHMVDAIKEYVGVDFWRQMSDEE
FT                   ARELAKEHGVEVAPHMTFGHIVNEFFEQKVESHLIQPTFIYGHPVEISPLAKKNPDDPR
FT                   FTDRFELFIVGREHANAFTELNDPIDQRQRFEAQLKEREQGNDEAHEMDEDFLEALEYG
FT                   MPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRHK"
FT   gene            89184..89816
FT                   /locus_tag="GC56T3_0074"
FT   CDS_pept        89184..89816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0074"
FT                   /product="carbonic anhydrase"
FT                   /note="KEGG: cbk:CLL_A1432 carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25148"
FT                   /inference="similar to AA sequence:KEGG:CLL_A1432"
FT                   /protein_id="ADI25148.1"
FT                   /translation="MLSYPILYRNPPVAEAAQISAPKISPKAVIGVDSMIIGDITIADD
FT                   VFIGFKNLLRADSGYPYYVGPYTNIQDYVLMHVHPGREHVNVNGRKWGVYLEGENSVLH
FT                   HAAVHGPLFVGRNTFIGQHTNIYDAIIGRNCVIMHGATVTNGVKVPDNRFVAPGETVWQ
FT                   QEQADRLPTVPDKWKDLNRKIVDHYYRLGKSYLHHTPLAFSYGAHRH"
FT   gene            90025..90141
FT                   /locus_tag="GC56T3_R0014"
FT   rRNA            90025..90141
FT                   /locus_tag="GC56T3_R0014"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 69.05"
FT   gene            90150..90225
FT                   /locus_tag="GC56T3_R0015"
FT                   /note="tRNA-Val1"
FT   tRNA            90150..90225
FT                   /locus_tag="GC56T3_R0015"
FT                   /product="tRNA-Val"
FT   gene            90375..90450
FT                   /locus_tag="GC56T3_R0016"
FT                   /note="tRNA-Lys1"
FT   tRNA            90375..90450
FT                   /locus_tag="GC56T3_R0016"
FT                   /product="tRNA-Lys"
FT   gene            90461..90545
FT                   /locus_tag="GC56T3_R0017"
FT                   /note="tRNA-Leu1"
FT   tRNA            90461..90545
FT                   /locus_tag="GC56T3_R0017"
FT                   /product="tRNA-Leu"
FT   gene            90557..90631
FT                   /locus_tag="GC56T3_R0018"
FT                   /note="tRNA-Gly1"
FT   tRNA            90557..90631
FT                   /locus_tag="GC56T3_R0018"
FT                   /product="tRNA-Gly"
FT   gene            90648..90733
FT                   /locus_tag="GC56T3_R0019"
FT                   /note="tRNA-Leu2"
FT   tRNA            90648..90733
FT                   /locus_tag="GC56T3_R0019"
FT                   /product="tRNA-Leu"
FT   gene            90737..90810
FT                   /locus_tag="GC56T3_R0020"
FT                   /note="tRNA-Arg1"
FT   tRNA            90737..90810
FT                   /locus_tag="GC56T3_R0020"
FT                   /product="tRNA-Arg"
FT   gene            90815..90888
FT                   /locus_tag="GC56T3_R0021"
FT                   /note="tRNA-Pro1"
FT   tRNA            90815..90888
FT                   /locus_tag="GC56T3_R0021"
FT                   /product="tRNA-Pro"
FT   gene            90901..90973
FT                   /locus_tag="GC56T3_R0022"
FT                   /note="tRNA-Ala3"
FT   tRNA            90901..90973
FT                   /locus_tag="GC56T3_R0022"
FT                   /product="tRNA-Ala"
FT   gene            91612..93157
FT                   /locus_tag="GC56T3_R0023"
FT   rRNA            91612..93157
FT                   /locus_tag="GC56T3_R0023"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            93835..96762
FT                   /locus_tag="GC56T3_R0024"
FT   rRNA            93835..96762
FT                   /locus_tag="GC56T3_R0024"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            97004..97120
FT                   /locus_tag="GC56T3_R0025"
FT   rRNA            97004..97120
FT                   /locus_tag="GC56T3_R0025"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 67.32"
FT   gene            97385..97846
FT                   /locus_tag="GC56T3_0075"
FT   CDS_pept        97385..97846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0075"
FT                   /product="transcriptional repressor, CtsR"
FT                   /note="PFAM: Firmicute transcriptional repressor of class
FT                   III stress genes; KEGG: gka:GK0075 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25149"
FT                   /inference="protein motif:PFAM:PF05848"
FT                   /protein_id="ADI25149.1"
FT                   /translation="MPNISDIIEQYLKQVLNMSDQDIVEIKRSEIANKFQCVPSQINYV
FT                   INTRFTLERGYIVESKRGGGGYIRIMKVKTKSEAQLIDQLLELVGHRISQSNAEDVVKR
FT                   LVEEKVISEREAKIMLSAMDRSVLYIDLPERDELRARMLKAMLTSLKYK"
FT   gene            97862..98410
FT                   /locus_tag="GC56T3_0076"
FT   CDS_pept        97862..98410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0076"
FT                   /product="UvrB/UvrC protein"
FT                   /note="PFAM: UvrB/UvrC protein; KEGG: gka:GK0076
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25150"
FT                   /inference="protein motif:PFAM:PF02151"
FT                   /protein_id="ADI25150.1"
FT                   /translation="MICQECKQRPATMHFTKIVNGEKTEFHLCEQCAREHGHMFTFYGN
FT                   DDFSLNNLLAGLLNFQAPMKEMTANAFPNPDVLQCETCQMTYHQFTQIGRFGCANCYRT
FT                   FARYLPPILKRLHSGNTAHSGKIPKRKGGVLHLRKQLAMLKQKLQELVAREEFERAAEV
FT                   RDQIRSLEDELRRRGEGDM"
FT   gene            98416..99507
FT                   /locus_tag="GC56T3_0077"
FT   CDS_pept        98416..99507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0077"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /note="PFAM: ATP:guanido phosphotransferase; KEGG:
FT                   gka:GK0077 ATP:guanido phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25151"
FT                   /inference="protein motif:PFAM:PF00217"
FT                   /protein_id="ADI25151.1"
FT                   /translation="MSFEKFFNTAVSAWMSQEGPDSDIVLSSRIRLARNIVDFRFPTLF
FT                   SSEEAMQIVALFERTFAHRSYGGAGRFELLKMSELQPIEKRVLVEKHLISPHLAEDSPF
FT                   GACLLSENEEISIMINEEDHIRIQCLFPGLQLAEALEAASELDDWIEGYVNYAFDERLG
FT                   YLTSCPTNVGTGLRASVMMHLPALVLTQQINRIIPAINQLGLVVRGTYGEGSEALGNIF
FT                   QISNQITLGKSEEDIVADLHTIVQQLIAQERAARQALVKTLGIQLEDKVFRSYGILANC
FT                   RVIESKEAAQCLSDVRLGIDLGYIKNISRNILNELMILTQPGFLQQYAGGALRPEERDV
FT                   RRAALIRERLKMEERRKMEGDER"
FT   gene            99504..101936
FT                   /locus_tag="GC56T3_0078"
FT   CDS_pept        99504..101936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0078"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="KEGG: gka:GK0078 ATP-dependent Clp protease ATPase
FT                   subunit; PFAM: ATPase AAA-2 domain protein; AAA ATPase
FT                   central domain protein; UvrB/UvrC protein; Clp domain
FT                   protein; Clp ATPase-like; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25152"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ADI25152.1"
FT                   /translation="MMFGRFTERAQKVLALAQEEAIRLGHNNIGTEHILLGLIREGEGI
FT                   AAKALMALGLGPDKIQKEVESLIGRGSEVSHTIHYTPRAKKVIELSMDEARKLGHSYVG
FT                   TEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQLLGSNESMSGHGGGASHVSTPTL
FT                   DSLARDLTAIAREGRLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLA
FT                   QQIVNNEVPETLRDKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDEL
FT                   HTLIGAGGAEGAIDASNILKPALARGELQCIGATTLDEYRKYIEKDAALERRFQPIYVD
FT                   EPTVEESIQILKGLRDRYEAHHRVSISDEAIVQAVKLSDRYITDRFLPDKAIDLIDEAC
FT                   SKVRLRSFTAPPKLKELEQKLEEVRKEKDAAVQSQEFEKAASLRDMEQRLREELEETKR
FT                   AWKEKQGQENLEVTVEDIAAVVSSWTGIPVSKLAETETERLLKLEEILHSRVVGQDEAV
FT                   KAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAEAMFGDEDALIRIDMSE
FT                   YMEKHSTSRLIGSPPGYVGYEEGGQLTEKVRRKPYSVVLLDEMEKAHPDVFNILLQVLE
FT                   DGRLTDSKGRTVDFRNTIIIMTSNVGADALKRNKYVGFNIQDGNQQYKDMKSKVMDELK
FT                   KAFRPEFLNRIDEIIVFHSLEKDHLKQIVRLMADTLVKRLKEQDIDLELTEAAIEKIAA
FT                   EGFDPEYGARPLRRALQKHVEDRLSEELLKGTIAKGQKVVVDVKDGEFVVLSKQAVV"
FT   gene            102014..103387
FT                   /locus_tag="GC56T3_0079"
FT   CDS_pept        102014..103387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0079"
FT                   /product="DNA repair protein RadA"
FT                   /note="KEGG: gyc:GYMC61_0080 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25153"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ADI25153.1"
FT                   /translation="MAKKKTKFVCQECGYESAKWLGRCPGCQTWNSLVEEIEQEKPTVR
FT                   GAFLHSERAGSAKPVPITAVEAVQEPRMKTNSAELDRVLGGGIVKGSLVLIGGDPGIGK
FT                   STLLLQTSAQLAAAGHQVLYVSGEESVKQVKLRAGRLRAECDRLYVLAEADLEYIVAAV
FT                   ETVQPACVIIDSIQTVYRTDISSAPGSVAQVRECTAELMKLAKTKGIAIFIVGHVTKEG
FT                   AIAGPRLLEHMVDTVLYFEGERHHTYRILRAVKNRFGSTNEIGIFEMRDIGLKEVENPS
FT                   EVFLEERSRGAAGSTVVAAMEGTRPVLVEIQALVSPTSFGNPRRMATGLDHNRVSLLMA
FT                   VLEKRVGLLLQNQDAYLKVAGGVKLDEPAIDLAVAVSIASSFRDRPTNPADVIIGEVGL
FT                   TGEVRRVSRIEQRVQEAVKLGFSRIIVPKNNLAGWQPPKGVQVIGVSHVAEALEHTMC"
FT   gene            103696..104790
FT                   /locus_tag="GC56T3_0080"
FT   CDS_pept        103696..104790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0080"
FT                   /product="PilT protein domain protein"
FT                   /note="KEGG: gyc:GYMC61_0081 PilT protein domain protein;
FT                   PFAM: PilT protein domain protein; deoxyribonuclease/rho
FT                   motif-related TRAM; SMART: Nucleotide binding protein PINc"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25154"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADI25154.1"
FT                   /translation="MVKRIVQLFFLAVGGTLGAMFFPDLLKLMNVSGMPLLNNSYTLAV
FT                   LGAVVFFLLTFWLVDYVVDMIRWVEETLVKAPAADVLFGSLGLIFGLIIAFFVVMPLQS
FT                   FHIQVLNTVLPIFLTVLLGYLGFRVGLKKRNELMNLFSLSNRMAKKKGGEAENEPSKGG
FT                   AVKILDTSVIIDGRIADICQTGFLEGPLVIPRFVLEELQHIADSSDVLKRNRGRRGLDI
FT                   LNRIQKEMAMKVEIHEADFSDVQEVDSKLVKLAKQLQGVVVTNDFNLNKVCELQNVRVL
FT                   NINDLANAVKPVVLPGEELNVHVIKDGKEHNQGVAYLDDGTMIVVEDGKEYIGKRVDVL
FT                   VTSVLQTSAGRMIFAKLKLLQKAL"
FT   gene            104812..105498
FT                   /locus_tag="GC56T3_0081"
FT   CDS_pept        104812..105498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0081"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="KEGG: gyc:GYMC61_0082 2-C-methyl-D-erythritol
FT                   4-phosphate cytidylyltransferase; TIGRFAM:
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25155"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ADI25155.1"
FT                   /translation="MNYEAIVLAAGRGKRMNAGMNKQFLELGGEPLIVRTLNVFERDER
FT                   CTRIVLVVNPAERSRFEQLLARFRIRKVAALTDGGEERQHSVYNGLQALAGEEIVLIHD
FT                   GARPFVRVHHLHELVNAAVQYGAAIPAVRVKDTIKKANGLFVEQTIDRSSLWAVQTPQA
FT                   FRLSLIMEAHEAAKQAGYLGTDDAGLVERIGKPVKIIEGDYRNIKLTTPEDLLFAEAIL
FT                   ASRMAE"
FT   gene            105513..105989
FT                   /locus_tag="GC56T3_0082"
FT   CDS_pept        105513..105989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0082"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /note="KEGG: gyc:GYMC61_0083 2C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; PFAM:
FT                   MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25156"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ADI25156.1"
FT                   /translation="MFRIGQGFDVHQLVEGRPLIIGGVTIPYEKGLLGHSDADVLLHAV
FT                   ADACLGAIGAGDIGRHFPDTDPRFKDADSAELLAHVWALARQEGYRLVNADCTIIAQKP
FT                   KMAPYIEEMRAVIARLLEAERSQVNVKATTTEKLGFTGREEGIAAQAVVLLQKS"
FT   gene            106189..107664
FT                   /locus_tag="GC56T3_0083"
FT   CDS_pept        106189..107664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0083"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="KEGG: gyc:GYMC61_0084 glutamyl-tRNA synthetase;
FT                   TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   Glutamyl/glutaminyl-tRNA synthetase, class Ic, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25157"
FT                   /inference="protein motif:TFAM:TIGR00464"
FT                   /protein_id="ADI25157.1"
FT                   /translation="MMAKEVRVRYAPSPTGHLHIGGARTALFNYLFARHHGGKMIVRIE
FT                   DTDIERNVEGGEKSQLENLKWLGIDYDESIDQDGGYGPYRQTERLDIYRKYVNELLEQG
FT                   HAYKCFCTPEELEREREAQRAAGIAAPQYSGKCRHLTPEQVAELEAQGKPYTIRLKVPE
FT                   GKTYEFYDLVRGKVVFESKDVGGDWVIVKANGIPTYNFAVVIDDHLMEISHVFRGEEHL
FT                   SNTPKQLMVYEYFGWDPPQFAHLTLIVNEQRKKLSKRDESIIQFVSQYKELGYLPEAMF
FT                   NFFALLGWSPEGEEEIFTKDELIRMFDVSRLSKSPSMFDTKKLTWMNNQYIKKLDLDRL
FT                   VELALPHLVKAGRLPADMTDEQRQWARDLIALYQEQMSYGAEIVPLSELFFKEEIDYED
FT                   EARQVLAEEQVPAVLSTFLESVRELEPFTADEIKAAIKAVQKATGQKGKKLFMPIRAAV
FT                   TGQTHGPELPFAIQLLGKEKVIERLERALQEKF"
FT   gene            108033..108707
FT                   /locus_tag="GC56T3_0084"
FT   CDS_pept        108033..108707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0084"
FT                   /product="serine O-acetyltransferase"
FT                   /note="TIGRFAM: serine O-acetyltransferase; KEGG:
FT                   gyc:GYMC61_0085 serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25158"
FT                   /inference="protein motif:TFAM:TIGR01172"
FT                   /protein_id="ADI25158.1"
FT                   /translation="MFKTLKEDIEVIFEQDPAARSYLEVILTYSGLHAIWAHRIAHALY
FT                   KRKFYFLARLISQISRFFTGIEIHPGAKIGRRFFIDHGMGVVIGETCEIGDNVTVYQGV
FT                   TLGGTGKEKGKRHPTIKDNCLIAAGAKVLGSITIGENSKIGAGSVVLKDVPPNSTVVGI
FT                   PGRVVVRDGVKVKKDLNHTDLPDPIADRFRELEEEIARLKSELEALKQQERKNEYEQHP
FT                   AL"
FT   gene            108685..110085
FT                   /locus_tag="GC56T3_0085"
FT   CDS_pept        108685..110085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0085"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="TIGRFAM: cysteinyl-tRNA synthetase; KEGG:
FT                   gyc:GYMC61_0086 cysteinyl-tRNA synthetase; PFAM:
FT                   Cysteinyl-tRNA synthetase class Ia ; Cysteinyl-tRNA
FT                   synthetase class Ia DALR"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25159"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADI25159.1"
FT                   /translation="MSSIRLYNTLTRKKEPFEPLEPNKVKMYVCGPTVYNYIHIGNARA
FT                   AVVFDTIRRYLEFRGYDVTYVSNFTDVDDKLIKAARELGESVPAIAERFIEAYFEDIQA
FT                   LGCKKADIHPRVTENIDAIIEFIQALIDKGYAYEVDGDVYYRTRKFREYGKLSHQSIDE
FT                   LQAGARIEIGEKKDDPLDFALWKAAKEGEICWDSPWGKGRPGWHIECSAMARKYLGDTI
FT                   DIHAGGQDLTFPHHENEIAQSEALTGKPFAKYWLHNGYLNINNEKMSKSLGNFVLVHDI
FT                   IREIDPQVLRFFMLSVHYRHPINYSEELLESARRGLERLKTAYSNLQHRLQASTNLTDN
FT                   DEEWVSRIADIRASFIREMDDDFNTANGIAVLFELAKQANLYLQEKTTSEKVIHAFLRE
FT                   FEQLADVLGLTLKQDELLDEEIEALIQKRNEARKNRDFALADRIRDELRAKNIILEDTP
FT                   QGTRWKRG"
FT   gene            110092..110517
FT                   /locus_tag="GC56T3_0086"
FT   CDS_pept        110092..110517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0086"
FT                   /product="ribonuclease III"
FT                   /note="KEGG: gyc:GYMC61_0087 ribonuclease III; PFAM:
FT                   ribonuclease III; SMART: ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25160"
FT                   /inference="protein motif:PFAM:PF00636"
FT                   /protein_id="ADI25160.1"
FT                   /translation="MMAEFETVNDVKQLNGLALAYIGDAVYEVYVRRHLLAGGSVRPHE
FT                   LHRRAVRYVSARAQARVILALLDEGVLTEEEKDIVRRGRNAKSGTIPKNTDVQTYRHST
FT                   AFEALIGYHFLVNNEKRVDELIGRSFAIIEREERALE"
FT   gene            110514..111254
FT                   /locus_tag="GC56T3_0087"
FT   CDS_pept        110514..111254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0087"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="KEGG: gyc:GYMC61_0088 RNA methyltransferase, TrmH
FT                   family, group 3; TIGRFAM: RNA methyltransferase, TrmH
FT                   family, group 3; PFAM: tRNA/rRNA methyltransferase (SpoU);
FT                   RNA 2-O ribose methyltransferase substrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25161"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ADI25161.1"
FT                   /translation="MMDYIIGKNPVIEALKAGRDINKIWIAEGAQRHTVEPVLEWAKRR
FT                   GVLVQYVPKRKLDQMAEGAHQGVIAQAAAYRYYEIDDLFARAAERGEAPFFLILDELED
FT                   PHNLGAIMRTADAVGAHGLIIPKRRSVGLTQTVAKASTGAIEHVPVARVTNLARTIDEL
FT                   KERGVWVAGTDASAQDDYRSLDGTMPLALVIGSEGKGISRLVLEKCDFLFRLPMRGHVT
FT                   SLNASVAASLLMYEVYRKRYPLGE"
FT   gene            111258..111770
FT                   /locus_tag="GC56T3_0088"
FT   CDS_pept        111258..111770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0088"
FT                   /product="protein of unknown function DUF901"
FT                   /note="PFAM: protein of unknown function DUF901; KEGG:
FT                   gyc:GYMC61_0089 protein of unknown function DUF901"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25162"
FT                   /inference="protein motif:PFAM:PF05991"
FT                   /protein_id="ADI25162.1"
FT                   /translation="MNILIVDGYNIIGAWPELRRLKEEGDLAAARDLLIEKMADYKGFT
FT                   GDHVVIVFDAHLVQGNEKKYKHYDVDVIFTKEHETADERIERLAKTLMNARTKVYVATS
FT                   DYTEQWTVFGQGALRKSARELLDEVETVERDISQKVKAMRQRTPISKVPLNDRIAEIFE
FT                   KWRRGEK"
FT   gene            111807..112490
FT                   /locus_tag="GC56T3_0089"
FT   CDS_pept        111807..112490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0089"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-H factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   gyc:GYMC61_0090 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily; SMART: regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25163"
FT                   /inference="protein motif:TFAM:TIGR02859"
FT                   /protein_id="ADI25163.1"
FT                   /translation="MLAIDAVGGISVGECLKAMKGKDYHQLDDEQLVALVHEGDGEALD
FT                   FLIHKYQNFVRAKARSYFLVGADREDIVQEGMIGLYKAVRDFKGDKLSSFKAFAELCIT
FT                   RQMITAIKTATRQKHIPLNSYVSLDKPIYDDESDRTLMDVLSGTQVTDPEQLIVNREEV
FT                   DDIELKMAELLSDLERKVLALYLDGRSYQEISEELNRHVKSIDNALQRVKRKLEKYLEY
FT                   REISL"
FT   gene            112584..112733
FT                   /locus_tag="GC56T3_0090"
FT   CDS_pept        112584..112733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0090"
FT                   /product="ribosomal protein L33"
FT                   /note="manually curated; TIGRFAM: ribosomal protein L33;
FT                   KEGG: gyc:GYMC61_0091 ribosomal protein L33; PFAM:
FT                   ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25164"
FT                   /inference="protein motif:TFAM:TIGR01023"
FT                   /protein_id="ADI25164.1"
FT                   /translation="MRQKVTLACAQCGSRNYTAAKQIRRLGERLMANKFCSTCNKHTIH
FT                   RETK"
FT   sig_peptide     112584..112643
FT                   /locus_tag="GC56T3_0090"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.628) with cleavage site probability 0.541 at
FT                   residue 20"
FT   gene            112774..112956
FT                   /locus_tag="GC56T3_0091"
FT   CDS_pept        112774..112956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0091"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="KEGG: gyc:GYMC61_0092 preprotein translocase, SecE
FT                   subunit; TIGRFAM: preprotein translocase, SecE subunit;
FT                   PFAM: protein secE/sec61-gamma protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25165"
FT                   /inference="protein motif:TFAM:TIGR00964"
FT                   /protein_id="ADI25165.1"
FT                   /translation="MQRVINFLKEVVRELKKVSWPNRKELVNYTAVVLATVAFFTVFFA
FT                   VVDLGISELIRLVFE"
FT   gene            113069..113602
FT                   /locus_tag="GC56T3_0092"
FT   CDS_pept        113069..113602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0092"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: NGN domain protein; KOW domain protein;
FT                   KEGG: gyc:GYMC61_0093 NusG antitermination factor; SMART:
FT                   NGN domain protein; KOW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25166"
FT                   /inference="protein motif:TFAM:TIGR00922"
FT                   /protein_id="ADI25166.1"
FT                   /translation="MEKNWYVVHTYSGYENKVKANLEKRVESMGMQDKIFRVVVPEETE
FT                   TDVKNGKRKTTKKKVFPGYVLVEMVMTDDSWYVVRNTPGVTGFVGSSGAGSKPTPLMEE
FT                   EVKMILKRMGMPLAEVDVDYEVNETVRIKEGPFANFTGKIEAIDPDKHKVKLLVDMFGR
FT                   ETRVELEFSQIEKI"
FT   gene            113838..114263
FT                   /locus_tag="GC56T3_0093"
FT   CDS_pept        113838..114263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0093"
FT                   /product="ribosomal protein L11"
FT                   /note="TIGRFAM: ribosomal protein L11; PFAM: Ribosomal
FT                   protein L11-like; KEGG: gyc:GYMC61_0094 ribosomal protein
FT                   L11; SMART: ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25167"
FT                   /inference="protein motif:TFAM:TIGR01632"
FT                   /protein_id="ADI25167.1"
FT                   /translation="MAKKVIKVVKLQIPAGKANPAPPVGPALGQAGVNIMAFCKEFNAR
FT                   TADQAGLIIPVEITVFEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDK
FT                   VREIAELKMPDLNAASIEAAMRMIEGTARSMGIVIED"
FT   gene            114445..115146
FT                   /locus_tag="GC56T3_0094"
FT   CDS_pept        114445..115146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0094"
FT                   /product="ribosomal protein L1"
FT                   /note="KEGG: gyc:GYMC61_0095 ribosomal protein L1; TIGRFAM:
FT                   ribosomal protein L1; PFAM: ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25168"
FT                   /inference="protein motif:TFAM:TIGR01169"
FT                   /protein_id="ADI25168.1"
FT                   /translation="MPKRGKKYLEALKLVDRSKAYPIAEAIELVKKTNIAKFDATVEVA
FT                   FRLGVDPKKADQQIRGAVVLPHGTGKVARVLVFAKGEKAKEAEAAGADYVGDTEYINKI
FT                   QQGWFDFDVVVATPDMMGEVGKLGRILGPKGLMPNPKTGTVTFDVAKAVQEIKAGKVEY
FT                   RVDKAGNIHVPIGKVSFDNEKLAENFAAVYEAILKAKPAAAKGTYVKNVTITSTMGPGI
FT                   KVDPSTVAVAQ"
FT   gene            115405..115905
FT                   /locus_tag="GC56T3_0095"
FT   CDS_pept        115405..115905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0095"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: gyc:GYMC61_0096
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25169"
FT                   /inference="protein motif:PFAM:PF00466"
FT                   /protein_id="ADI25169.1"
FT                   /translation="MSSAIELKKQVVAEIADKFRASKATVIVDYRGLNVAEMTELRKQL
FT                   REAGVEFKVYKNTLTRRALAEVGLEGLDEVFTGPNAIAFSNEDVVAPAKILSEFAKTHE
FT                   ALEIKGGVIEGNIASKEEIDALAKLPSREGLLSMLLSVLQAPIRNFALAIKAVADKQEE
FT                   QGA"
FT   gene            115960..116328
FT                   /locus_tag="GC56T3_0096"
FT   CDS_pept        115960..116328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0096"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="KEGG: gyc:GYMC61_0097 ribosomal protein L7/L12;
FT                   TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25170"
FT                   /inference="protein motif:TFAM:TIGR00855"
FT                   /protein_id="ADI25170.1"
FT                   /translation="MTKEQIIEAVKNMTVLELNELVKAIEEEFGVTAAAPVVVAGGAAA
FT                   GAEAAAEKTEFDVILADAGAQKIKVIKVVREITGLGLKEAKDLVDNTPKPIKEGIAKEE
FT                   AEEIKAKLEEAGAKVEIK"
FT   gene            116440..117042
FT                   /locus_tag="GC56T3_0097"
FT   CDS_pept        116440..117042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0097"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: gyc:GYMC61_0098
FT                   methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25171"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ADI25171.1"
FT                   /translation="MSEHYYSVNPKSERNPQTWTYVLRGHEFRFTTDSGVFSKREVDFG
FT                   TRLLIETFEEPGVAGDLLDVGCGYGPIGLALAKSFPNRRVHMIDVNERALELAQENKQA
FT                   NGIDNAVIYKSDLFSEVGEQRFAAVVTNPPIRAGKRVVYAIFEQSRDHLLDHGELWVVI
FT                   QKKQGAPSALQKLNECFPAVEVVAKKKGYYIIKAKKC"
FT   gene            117457..121029
FT                   /locus_tag="GC56T3_0098"
FT   CDS_pept        117457..121029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0098"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="KEGG: gyc:GYMC61_0099 DNA-directed RNA polymerase,
FT                   beta subunit; TIGRFAM: DNA-directed RNA polymerase, beta
FT                   subunit; PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase
FT                   beta subunit; RNA polymerase Rpb2 domain 2; RNA polymerase
FT                   Rpb2 domain 3; DNA-directed RNA polymerase, beta subunit,
FT                   external 1 domain; RNA polymerase Rpb2 domain 7"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25172"
FT                   /inference="protein motif:TFAM:TIGR02013"
FT                   /protein_id="ADI25172.1"
FT                   /translation="MTGRLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYQWFLDEGL
FT                   REMFREISPIEDFSGNLSLEFIDYSLGEPKYTVEEAKERDVTYAAPLRVKVRLINKETG
FT                   EVKEQDVFMGDFPLMTETGTFIINGAERVIVSQLVRSPSVYYSDKVDKNGKRGYSATVI
FT                   PNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFSSDQEIIDLLGDNEYLRNTLE
FT                   KDNTDSTEKALIEIYERLRPGEPPTLENAKNLLASRFFDPKRYDLASVGRYKINKKLHI
FT                   KNRLFNQRLAETIIDPETKEVIAEAGAMIDRRTLNRLLPYLEKGVGLQTYRPAEGVVDG
FT                   DISVQTIKIYAPNDPDGEKVINVIGNGFIAEDVKHITPADIIASISYFFNLLHGVGDTD
FT                   DIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNTITPQQLINIRPVIAAI
FT                   KEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYGRMCPI
FT                   ETPEGPNIGLINSLSTYAKVNKFGFIETPYRRVDPETGRVTDQIDYLTADEEDNYVVAQ
FT                   ANVPLAEDGTFLEENVVARFRGENIVVKRDRVDYMDVSPKQVVSAATACIPFLENDDSN
FT                   RALMGANMQRQAVPLLEPEAPIVGTGMEYVSAKDSGAAVICKHRGIVERVEAKEIWVRR
FT                   LIEVDGKEVKGDLDKYRLLKFVRSNQGTCYNQRPIVKKGDIVEKGEILADGPSMDKGEL
FT                   ALGRNVLVAFMTWDGYNYEDAIIMSERLVKEDVYTSIHIEEYEAESRDTKLGPEEITRD
FT                   IPNVGEDALKNLDERGIVRIGAEVKDGDLLVGKVTPKGMTELTAEERLLHAIFGEKARE
FT                   VRDTSLRVPHGGGGIVLDVKVFNREDGDELPPGVNQLVRVYIVQKRKISEGDKMAGRHG
FT                   NKGVISRILPEEDMPFLPDGTPIDIMLNPLGVPSRMNIGQVFELHLGMAAKKLGLHIAS
FT                   PVFDGATEEDVWNILEEAGLARDAKTVLYDGRTGEPFDNRVSVGIMYMIKLAHMVDDKL
FT                   HARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRV
FT                   KTYEAIVKGENIPEPGVPESFKVLIKELQSLGMDVTILTSDEQEVNMENFDDDDDHAPD
FT                   AIMVDVKPAEREEAGEEKDAVTKE"
FT   gene            121122..124721
FT                   /locus_tag="GC56T3_0099"
FT   CDS_pept        121122..124721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0099"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta' subunit;
FT                   PFAM: RNA polymerase Rpb1 domain 1; RNA polymerase alpha
FT                   subunit; RNA polymerase Rpb1 domain 3; RNA polymerase Rpb1
FT                   domain 4; RNA polymerase Rpb1 domain 5; KEGG:
FT                   gyc:GYMC61_0100 DNA-directed RNA polymerase, beta' subunit;
FT                   SMART: RNA polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25173"
FT                   /inference="protein motif:TFAM:TIGR02386"
FT                   /protein_id="ADI25173.1"
FT                   /translation="MLDVNKFEYMKIGLASPEKIRSWSYGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRSKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTDPGDTPLEKKQLLSEKEYRAYREKYG
FT                   QSFQASMGAEAIKKLLQDIDLDKEVAALKEELKTAQGQRRARIIKRLEVLEAFRSSGND
FT                   PAWMVLDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVERGLAHNIKSAKRKIERVHPEVWD
FT                   VLEDVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTMEREGAIGEGMVFK
FT                   DTDEALLAYHNGYVHLHSRIAIHAGSLKNETFTEEQNNKLLLTTVGKLIFNEILPNSFP
FT                   YINEPTTENIEGRTPDKYFLDKGVNVREEIRKRELVPPFKKKVLGQIIAEVFKRFKITE
FT                   TSKMLDRMKDLGFQYSTKAGITIGVADIVVLPEKQEILDEAQAKVDTVLKQFRRGLITD
FT                   EERYERVISIWSAAKDKIQDRLMKSLDKRNPIFMMSDSGARGNASNFTQLAGMRGLMAN
FT                   PAGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   VREEDCGTDRGILARALTDGTEVVVKLEERLVGRYAHKTVRHPETGEVIVRKDEMITED
FT                   IANEIIKAGITEVWIRSVFACNTRHGVCKKCYGRNMATGMDVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRVQELFEARNPKGQAVISEIDGTVISINETRDNQY
FT                   EIVVQSEVETRTYVAPYNARLKVEEGQRVERGQELTEGSVDPKQLLRVRDITSVQEYLL
FT                   REVQKVYRMQGVEISDKHIEVMVRQMLRKVRVIDAGDTDVLPGTLLDVHQFTDVNAKAL
FT                   REGKRPATARQVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVI
FT                   IGKLVPAGTGMARYRKVKPAVKKETAGDTVSSK"
FT   gene            124856..125104
FT                   /locus_tag="GC56T3_0100"
FT   CDS_pept        124856..125104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0100"
FT                   /product="ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /note="PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45; KEGG:
FT                   gyc:GYMC61_0101 ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25174"
FT                   /inference="protein motif:PFAM:PF01248"
FT                   /protein_id="ADI25174.1"
FT                   /translation="MSYEKVLQAGKIVIGTKQTIRALKEGKAAEVIVAEDADLPIIEKV
FT                   TAAANEANVPVTKVDSMKKLGKACKIQVGAAAVAILR"
FT   gene            125201..125623
FT                   /locus_tag="GC56T3_0101"
FT   CDS_pept        125201..125623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0101"
FT                   /product="ribosomal protein S12"
FT                   /note="KEGG: gyc:GYMC61_0102 ribosomal protein S12;
FT                   TIGRFAM: ribosomal protein S12; PFAM: ribosomal protein
FT                   S12/S23"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25175"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ADI25175.1"
FT                   /translation="MPTINQLVRKGREKKVVKSKSPALNKGYNSFKKEQTNVSSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIIRGALDAAGVANRMQGRSKYGAKKPKAAKK"
FT   gene            125663..126133
FT                   /locus_tag="GC56T3_0102"
FT   CDS_pept        125663..126133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0102"
FT                   /product="ribosomal protein S7"
FT                   /note="KEGG: gyc:GYMC61_0103 ribosomal protein S7; TIGRFAM:
FT                   ribosomal protein S7; PFAM: ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25176"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ADI25176.1"
FT                   /translation="MPRRGPVAKRDVLPDPIYNSKLVTRLINKIMIDGKKSKAQKILYT
FT                   AFDIIRERTGKDPMEVFEQALKNVMPVLEVRARRVGGANYQVPVEVRPDRRVSLGLRWL
FT                   VQYARLRNEKTMEERLANEIMDAANNTGAAVKKREDTHKMAEANRAFAHYRW"
FT   gene            126315..128393
FT                   /locus_tag="GC56T3_0103"
FT   CDS_pept        126315..128393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0103"
FT                   /product="translation elongation factor G"
FT                   /note="KEGG: gka:GK0103 elongation factor G; TIGRFAM:
FT                   translation elongation factor G; small GTP-binding protein;
FT                   PFAM: protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   elongation factor G domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25177"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ADI25177.1"
FT                   /translation="MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGEVHE
FT                   GAATMDWMEQEQERGITITSAATTAQWKGHRINIIDTPGHVDFTVEVERSLRVLDGAIT
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVKTLHDRLQANAHPVQ
FT                   LPIGAEDQFSGIIDLVEMCAYHYHDELGKNIERIDIPEEYRDMAEEYHNKLIEAVAELD
FT                   EELMMKYLEGEEITAEELKAAIRKATISVEFFPVFCGSAFKNKGVQLLLDGVVDYLPSP
FT                   VDIPAIRGVVPDTEEEVTREASDDAPFAALAFKIMTDPYVGKLTFIRVYSGTLDSGSYV
FT                   MNTTKGKRERIGRLLQMHANHRQEISKVYAGDIAAAVGLKDTTTGDTLCDEKHPVILES
FT                   MQFPEPVISVAIEPKSKADQDKMSQALQKLQEEDPTFRAHTDPETGQTIISGMGELHLD
FT                   IIVDRMRREFKVEANVGAPQVAYRETFRKSAQVEGKFIRQSGGRGQYGHVWIEFSPNER
FT                   GKGFEFENAIVGGVVPKEYVPAVQAGLEEAMQNGVLAGYPVVDIKAKLFDGSYHDVDSS
FT                   EMAFKIAASLALKNAATKCDPVLLEPIMKVEVVIPEEYLGDIMGDITSRRGRIEGMEAR
FT                   GNAQVVRAMVPLAEMFGYATSLRSNTQGRGTFSMVFDHYEEVPKNIADEIIKKNKGE"
FT   gene            128522..129709
FT                   /locus_tag="GC56T3_0104"
FT   CDS_pept        128522..129709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0104"
FT                   /product="translation elongation factor Tu"
FT                   /note="KEGG: gyc:GYMC61_0105 translation elongation factor
FT                   Tu; TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein;
FT                   elongation factor Tu domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25178"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ADI25178.1"
FT                   /translation="MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLAKQGKAEAK
FT                   AYDQIDAAPEERERGITISTAHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDF
FT                   PGDEVPVIKGSALKALEGDPQWEEKIIELMNAVDEYIPTPQREVDKPFMMPIEDVFSIT
FT                   GRGTVATGRVERGTLKVGDPVEIIGLSDEPKTTTVTGVEMFRKLLDQAEAGDNIGALLR
FT                   GVSRDEVERGQVLAKPGSITPHTKFKAQVYVLTKEEGGRHTPFFSNYRPQFYFRTTDVT
FT                   GIITLPEGVEMVMPGDNVEMTVELIAPIAIEEGTKFSIREGGRTVGAGSVSEIIE"
FT   gene            130006..130314
FT                   /locus_tag="GC56T3_0105"
FT   CDS_pept        130006..130314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0105"
FT                   /product="ribosomal protein S10"
FT                   /note="KEGG: gyc:GYMC61_0106 ribosomal protein S10;
FT                   TIGRFAM: ribosomal protein S10; PFAM: ribosomal protein
FT                   S10"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25179"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ADI25179.1"
FT                   /translation="MAKEKIRIRLKAYDHRILDQSAEKIVETAKRSGAKVSGPIPLPTE
FT                   RTVYTILRAVHKYKDSREQFEMRTHKRLIDIINPTPQTVDSLMRLDLPSGVDIEIKL"
FT   gene            130335..130976
FT                   /locus_tag="GC56T3_0106"
FT   CDS_pept        130335..130976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0106"
FT                   /product="50S ribosomal protein L3"
FT                   /note="KEGG: gyc:GYMC61_0107 50S ribosomal protein L3;
FT                   TIGRFAM: 50S ribosomal protein L3; PFAM: ribosomal protein
FT                   L3"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25180"
FT                   /inference="protein motif:TFAM:TIGR03625"
FT                   /protein_id="ADI25180.1"
FT                   /translation="MTKGILGRKIGMTQIFAENGDLIPVTVIHATPNVVLQKKTIENDG
FT                   YEAIQLGFEDISEKRANKPQIGHAAKANTAPKRFIREIRGANIDEYEVGQEVKVDIFSE
FT                   GEIVDVTGISKGKGFQGAIKRHGQSRGPMAHGSRYHRRPGSMGSIAPNRVFKTKNLPGR
FT                   MGGERVTIQNLKIVKVDPERNLLLIKGNVPGPRKGLVIVKSAVKAAKKAK"
FT   gene            131006..131629
FT                   /locus_tag="GC56T3_0107"
FT   CDS_pept        131006..131629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0107"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG:
FT                   gyc:GYMC61_0108 ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25181"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ADI25181.1"
FT                   /translation="MPKVALYNQNGQTVGEIELNDAVFGIEPNKHVLFEAVIMQRASMR
FT                   QGTHKTKNRAEVSGGGRKPWRQKGTGRARQGSIRAPQWRGGGTVFGPVPRSYSYKLPKK
FT                   VRRLAIKSALSSKVLENDIVVLDQLSLEAPKTKEMVKILNNLSVDRKALIVTDELNENV
FT                   YLSARNIPGVKVVAANGINVLDVLNHDKLVITKAAVEKVEEVLA"
FT   gene            131629..131916
FT                   /locus_tag="GC56T3_0108"
FT   CDS_pept        131629..131916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0108"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG:
FT                   gyc:GYMC61_0109 ribosomal protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25182"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ADI25182.1"
FT                   /translation="MKDPRDIIKRPIITENTMNLIGQKKYTFEVDVKANKTEVKDAVEK
FT                   IFGVKVAKVNIMNYKGKFKRVGRYSGYTNRRRKAIVTLTPDSKEIELFEV"
FT   gene            131944..132774
FT                   /locus_tag="GC56T3_0109"
FT   CDS_pept        131944..132774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0109"
FT                   /product="ribosomal protein L2"
FT                   /note="KEGG: gyc:GYMC61_0110 ribosomal protein L2; TIGRFAM:
FT                   ribosomal protein L2; PFAM: ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25183"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ADI25183.1"
FT                   /translation="MAIKKYKPTSNGRRGMTVLDFSEITTDQPEKSLLAPLKKKAGRNN
FT                   QGKITVRHQGGGHKRQYRIIDFKRDKDGIPGRVATIEYDPNRSANIALINYADGEKRYI
FT                   IAPKNLKVGMEIMSGPDADIKIGNALPLENIPVGTLVHNIELKPGRGGQLVRAAGTSAQ
FT                   VLGKEGKYVIVRLASGEVRMILGKCRATVGEVGNEQHELVNIGKAGRARWLGIRPTVRG
FT                   SVMNPVDHPHGGGEGKAPIGRKSPMTPWGKPTLGYKTRKKKNKSDKFIIRRRKK"
FT   gene            132808..133086
FT                   /locus_tag="GC56T3_0110"
FT   CDS_pept        132808..133086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0110"
FT                   /product="ribosomal protein S19"
FT                   /note="KEGG: gyc:GYMC61_0111 ribosomal protein S19;
FT                   TIGRFAM: ribosomal protein S19; PFAM: ribosomal protein
FT                   S19/S15"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25184"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ADI25184.1"
FT                   /translation="MGRSLKKGPFCDEHLMKKIEKLNATGQKQVIKTWSRRSTIFPQFV
FT                   GHTIAVYDGRKHVPVYITEDMVGHKLGEFAPTRTFRGHAGDDKKTKR"
FT   gene            133105..133446
FT                   /locus_tag="GC56T3_0111"
FT   CDS_pept        133105..133446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0111"
FT                   /product="ribosomal protein L22"
FT                   /note="KEGG: gyc:GYMC61_0112 ribosomal protein L22;
FT                   TIGRFAM: ribosomal protein L22; PFAM: ribosomal protein
FT                   L22/L17"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25185"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ADI25185.1"
FT                   /translation="MQAKAVARTVRIAPRKARLVIDLIRGKEVGEAFAILRHTPKAASP
FT                   IIEKVLKSAVANAEHNYDMDVNNLVITQAYVDEGPTLKRFRPRAMGRASAINKRTSHIT
FT                   IVVSEKKEG"
FT   gene            133450..134106
FT                   /locus_tag="GC56T3_0112"
FT   CDS_pept        133450..134106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0112"
FT                   /product="ribosomal protein S3"
FT                   /note="TIGRFAM: ribosomal protein S3; PFAM: ribosomal
FT                   protein S3- domain protein; Ribosomal protein S3 domain; KH
FT                   type 2 domain protein; KEGG: gyc:GYMC61_0113 ribosomal
FT                   protein S3; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25186"
FT                   /inference="protein motif:TFAM:TIGR01009"
FT                   /protein_id="ADI25186.1"
FT                   /translation="MGQKVNPIGLRIGIIRDWESRWYAEKDYADLLHEDLKIREYISKR
FT                   LQDAAVSRVEIERAANRVNVTIHTAKPGMVIGKGGSEVEALRKALAQLTGKRVHINIVE
FT                   IKKPDLDARLVAENIARQLENRVSFRRAQKQAIQRAMRAGAKGIKTMVSGRLGGADIAR
FT                   SEHYSEGTVPLHTLRADIDYGTAEADTTYGKIGVKVWIYRGEVLPTKKKAEEGGK"
FT   gene            134109..134534
FT                   /locus_tag="GC56T3_0113"
FT   CDS_pept        134109..134534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0113"
FT                   /product="ribosomal protein L16"
FT                   /note="KEGG: gyc:GYMC61_0114 ribosomal protein L16;
FT                   TIGRFAM: ribosomal protein L16; PFAM: Ribosomal protein
FT                   L10e/L16"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25187"
FT                   /inference="protein motif:TFAM:TIGR01164"
FT                   /protein_id="ADI25187.1"
FT                   /translation="MLMPKRVKYRREHRGRMKGRAKGGTEVHFGEFGLQALESAWITNR
FT                   QIEAARRAMTRYMRRGGKVWIRIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVMF
FT                   EVGGVSEEVAREALRLASHKLPIKCKFVKREETGGEA"
FT   gene            134534..134734
FT                   /locus_tag="GC56T3_0114"
FT   CDS_pept        134534..134734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0114"
FT                   /product="ribosomal protein L29"
FT                   /note="KEGG: gyc:GYMC61_0115 ribosomal protein L29;
FT                   TIGRFAM: ribosomal protein L29; PFAM: ribosomal protein
FT                   L29"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25188"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ADI25188.1"
FT                   /translation="MKAKEIRELTTAEIEQKIKALKEELFNLRFQLATGQLENTARIRQ
FT                   VRKDIARMKTIIRERELAANK"
FT   gene            134759..135022
FT                   /locus_tag="GC56T3_0115"
FT   CDS_pept        134759..135022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0115"
FT                   /product="30S ribosomal protein S17"
FT                   /note="KEGG: gyc:GYMC61_0116 30S ribosomal protein S17;
FT                   TIGRFAM: 30S ribosomal protein S17; PFAM: ribosomal protein
FT                   S17"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25189"
FT                   /inference="protein motif:TFAM:TIGR03635"
FT                   /protein_id="ADI25189.1"
FT                   /translation="MSQRNQRKVYVGRVVSDKMDKTITVLVETYKKHPLYGKRVKYSKK
FT                   YKAHDEHNIAKVGDIVKIMETRPLSATKRFRLVEVIEKSVVL"
FT   gene            135072..135440
FT                   /locus_tag="GC56T3_0116"
FT   CDS_pept        135072..135440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0116"
FT                   /product="ribosomal protein L14"
FT                   /note="KEGG: gyc:GYMC61_0117 ribosomal protein L14;
FT                   TIGRFAM: ribosomal protein L14; PFAM: ribosomal protein
FT                   L14b/L23e"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25190"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ADI25190.1"
FT                   /translation="MIQQESRLKVADNSGAREVLVIKVLGGSGRRYANIGDVVVATVKD
FT                   ATPGGVVKKGQVVKAVVVRTKRGVRRPDGSYIRFDENACVIIRDDKSPRGTRIFGPVAR
FT                   ELRDKDFMKIISLAPEVI"
FT   gene            135477..135788
FT                   /locus_tag="GC56T3_0117"
FT   CDS_pept        135477..135788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0117"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: gyc:GYMC61_0118 ribosomal protein L24;
FT                   SMART: KOW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25191"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ADI25191.1"
FT                   /translation="MHVKKGDKVQVISGKDKGKQGVILAAFPKKNRVIVEGVNIVKKHA
FT                   KPSQANPQGGIIEKEAPIHVSKVMPLDPKTGEPTRIGYKIVDGKKVRYAKKSGEILDK"
FT   gene            135816..136355
FT                   /locus_tag="GC56T3_0118"
FT   CDS_pept        135816..136355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0118"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: gka:GK0118 50S
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25192"
FT                   /inference="protein motif:PFAM:PF00281"
FT                   /protein_id="ADI25192.1"
FT                   /translation="MNRLKEKYLNEVVPALMSKFNYKSIMQVPKIEKIVINMGVGDAVQ
FT                   NPKALDSAVEELTLIAGQRPVVTRAKKSIAGFRLRQGMPIGAKVTLRGERMYEFLDKLI
FT                   SVSLPRVRDFRGVSKKSFDGRGNYTLGIKEQLIFPEIDYDKVNKVRGMDIVIVTTANTD
FT                   EEARELLALLGMPFQK"
FT   gene            136385..136570
FT                   /locus_tag="GC56T3_0119"
FT   CDS_pept        136385..136570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0119"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: gyc:GYMC61_0120
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25193"
FT                   /inference="protein motif:PFAM:PF00253"
FT                   /protein_id="ADI25193.1"
FT                   /translation="MAKKSMIAKQKRTPKFKVRAYTRCERCGRPHSVYRKFKLCRICFR
FT                   ELAYKGQLPGIKKASW"
FT   gene            136604..137002
FT                   /locus_tag="GC56T3_0120"
FT   CDS_pept        136604..137002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0120"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: gyc:GYMC61_0121
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25194"
FT                   /inference="protein motif:PFAM:PF00410"
FT                   /protein_id="ADI25194.1"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKLEVPASKIKREIAEILKREGF
FT                   IRDYEYIEDNKQGILRIFLKYGPNNERVITGLKRISKPGLRVYVKAHEVPRVLNGLGIA
FT                   ILSTSQGILTDKEARQKGTGGEVIAYVW"
FT   gene            137035..137571
FT                   /locus_tag="GC56T3_0121"
FT   CDS_pept        137035..137571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0121"
FT                   /product="ribosomal protein L6"
FT                   /note="KEGG: gyc:GYMC61_0122 ribosomal protein L6; TIGRFAM:
FT                   ribosomal protein L6; PFAM: Ribosomal protein L6,
FT                   alpha-beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25195"
FT                   /inference="protein motif:TFAM:TIGR03654"
FT                   /protein_id="ADI25195.1"
FT                   /translation="MSRVGKKPIEIPAGVTVTVNGNTVTVKGPKGELTRTFHPDMTITV
FT                   EGNVITVTRPSDEKHHRALHGTTRSLLANMVEGVSKGYEKALELVGVGYRASKQGKKLV
FT                   LSVGYSHPVEIEPEEGLEIEVPSQTKIIVKGADKQRVGELAANIRAVRPPEPYKGKGIR
FT                   YEGELVRLKEGKTGK"
FT   gene            137605..137967
FT                   /locus_tag="GC56T3_0122"
FT   CDS_pept        137605..137967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0122"
FT                   /product="ribosomal protein L18"
FT                   /note="KEGG: gyc:GYMC61_0123 ribosomal protein L18;
FT                   TIGRFAM: ribosomal protein L18; PFAM: ribosomal protein
FT                   L18P/L5E"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25196"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ADI25196.1"
FT                   /translation="MITKVDRNAVRKKRHARIRKKIFGTAERPRLSVFRSNKHIYAQII
FT                   DDTKSSTIVSASTLDKEFGLDSTNNIEAAKKVGELVAKRALEKGIKKVVFDRGGYLYHG
FT                   RVKALADAAREAGLEF"
FT   gene            137987..138487
FT                   /locus_tag="GC56T3_0123"
FT   CDS_pept        137987..138487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0123"
FT                   /product="ribosomal protein S5"
FT                   /note="KEGG: gyc:GYMC61_0124 ribosomal protein S5; TIGRFAM:
FT                   ribosomal protein S5; PFAM: Ribosomal protein S5 ;
FT                   ribosomal protein S5 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25197"
FT                   /inference="protein motif:TFAM:TIGR01021"
FT                   /protein_id="ADI25197.1"
FT                   /translation="MRRIDPNKLELEERVVAVNRVAKVVKGGRRLRFSALVVVGDKNGH
FT                   VGFGTGKAQEVPEAIRKAIEDAKKNLIEVPIVGTTIPHEVIGHFGAGEIILKPASEGTG
FT                   VIAGGPARAVLELAGISDILSKSIGSNTPINMVRATFDGLKQLKRAEDVARLRGKTVEE
FT                   LLG"
FT   gene            138501..138689
FT                   /locus_tag="GC56T3_0124"
FT   CDS_pept        138501..138689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0124"
FT                   /product="ribosomal protein L30"
FT                   /note="KEGG: gyc:GYMC61_0125 ribosomal protein L30;
FT                   TIGRFAM: ribosomal protein L30; PFAM: ribosomal protein
FT                   L30"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25198"
FT                   /inference="protein motif:TFAM:TIGR01308"
FT                   /protein_id="ADI25198.1"
FT                   /translation="MAKKLAITLTRSVIGRPEDQRVTVRTLGLRKMHQTVIHNDNPAIR
FT                   GMINKVAHLVKVKEIEE"
FT   gene            138714..139154
FT                   /locus_tag="GC56T3_0125"
FT   CDS_pept        138714..139154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0125"
FT                   /product="ribosomal protein L15"
FT                   /note="KEGG: gyc:GYMC61_0126 ribosomal protein L15;
FT                   TIGRFAM: ribosomal protein L15; PFAM: ribosomal protein
FT                   L15"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25199"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ADI25199.1"
FT                   /translation="MKLHELKPAPGSRKKAVRVGRGIGSGNGKTSGRGQKGQNARSGGG
FT                   VRLGFEGGQTPLFRRLPKRGFTNINRKEYAVVNLEKLNRFEDGTEVTPELLLETGVISK
FT                   LKSGVKILGKGQIEKKLTVKAHKFSASAKEAIEAAGGKTEVI"
FT   gene            139154..140446
FT                   /locus_tag="GC56T3_0126"
FT   CDS_pept        139154..140446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0126"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="KEGG: gyc:GYMC61_0127 preprotein translocase, SecY
FT                   subunit; TIGRFAM: preprotein translocase, SecY subunit;
FT                   PFAM: SecY protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25200"
FT                   /inference="protein motif:TFAM:TIGR00967"
FT                   /protein_id="ADI25200.1"
FT                   /translation="MFRTISNFMRVSDIRNKIIFTLLMLIVFRIGTFIPVPGVNADVLK
FT                   LQDELNAFGVLNIFGGGALRNFSIFAMGVMPYITASIIVQLLQMDVVPKFTEWSKQGEV
FT                   GRRKLAQFTRYFTVVLGFIQAIGMSYGFNNLAGGMLIRNPGIGTYLLIAVVLTAGTAFL
FT                   MWLGEQITAKGVGNGISIIIFAGIVSGIPTVLNQIYAQQFENVGEDVFLRIVRLLLVAL
FT                   AVVAVIVGVIYIQQAFRKIPIQYAKRLEGRSPVGGHSTHLPLKVNPAGVIPVIFAVSFL
FT                   IAPPTIASFFGTNDVTLWIRRTFDYTHPVGMIIYVVLIIAFTYFYAFVQVNPEQMADNL
FT                   KKQGGYIPGIRPGKNTQEYVTRILYRLTLVGSIFLAVVAVLPVFFVNFANLPSSARIGG
FT                   TSLLIVVGVALETMKQLESQLVKRHYRGFIK"
FT   gene            140490..141143
FT                   /locus_tag="GC56T3_0127"
FT   CDS_pept        140490..141143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0127"
FT                   /product="adenylate kinase"
FT                   /note="KEGG: gka:GK0127 adenylate kinase; TIGRFAM:
FT                   adenylate kinase; PFAM: adenylate kinase; adenylate kinase
FT                   lid domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25201"
FT                   /inference="protein motif:TFAM:TIGR01351"
FT                   /protein_id="ADI25201.1"
FT                   /translation="MNLVLMGLPGAGKGTQAGKIVEAYGIPHISTGDMFRAAIKEGTPL
FT                   GLQAKQYMDRGDLVPDEVTIGIVRERLSKEDCQNGFLLDGFPRTVAQAEALETLLSEIG
FT                   RKLDYVIHIDVRQEVLMERLTGRRICRNCGATYHLVFHPPAKPGVCDKCGGDLYQRPDD
FT                   NEATVANRLEVNMKQMKPLLDFYEQKGYLRHINGEQEMEKVFADICEVLGGLAR"
FT   gene            141140..141907
FT                   /locus_tag="GC56T3_0128"
FT   CDS_pept        141140..141907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0128"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="KEGG: gka:GK0128 methionine aminopeptidase; TIGRFAM:
FT                   methionine aminopeptidase, type I; PFAM: peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25202"
FT                   /inference="protein motif:TFAM:TIGR00500"
FT                   /protein_id="ADI25202.1"
FT                   /translation="MIRCKTAQEIALMREAGKIVSLTLKELQKHIRPGITTKELDAIAE
FT                   EVIRSHGAIPSFKGYQGFPGSICASVNEELVHGIPSSRALREGDIITIDVGAQYEGYHA
FT                   DSAWTYPVGEIDAETKRLLDVTEQSLYVGLAEAKPGARLTNISHAIQTYVEAHHFSVVR
FT                   EYVGHGIGQHLHEDPQIPHYGPSNKGPILRSGMALCIEPMVNVGSRYVKTLADDWTVVT
FT                   ADGKRCAHFEHTIVITEDGYEILTHYGNESPTS"
FT   gene            142003..142221
FT                   /locus_tag="GC56T3_0129"
FT   CDS_pept        142003..142221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0129"
FT                   /product="translation initiation factor IF-1"
FT                   /note="KEGG: gyc:GYMC61_0130 translation initiation factor
FT                   IF-1; TIGRFAM: translation initiation factor IF-1; PFAM: S1
FT                   IF1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25203"
FT                   /inference="protein motif:TFAM:TIGR00008"
FT                   /protein_id="ADI25203.1"
FT                   /translation="MAKDDVIEVEGTVIETLPNAMFRVELENGHTVLAHVSGKIRMHFI
FT                   RILPGDRVTVELSPYDLTRGRITYRYK"
FT   gene            142258..142371
FT                   /locus_tag="GC56T3_0130"
FT   CDS_pept        142258..142371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0130"
FT                   /product="ribosomal protein L36"
FT                   /note="KEGG: gyc:GYMC61_0131 ribosomal protein L36;
FT                   TIGRFAM: ribosomal protein L36; PFAM: ribosomal protein
FT                   L36"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25204"
FT                   /inference="protein motif:TFAM:TIGR01022"
FT                   /protein_id="ADI25204.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRRGKVMVICENPKHKQRQG"
FT   gene            142392..142757
FT                   /locus_tag="GC56T3_0131"
FT   CDS_pept        142392..142757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0131"
FT                   /product="30S ribosomal protein S13"
FT                   /note="KEGG: gtn:GTNG_0129 30S ribosomal protein S13;
FT                   TIGRFAM: 30S ribosomal protein S13; PFAM: ribosomal protein
FT                   S13"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25205"
FT                   /inference="protein motif:TFAM:TIGR03631"
FT                   /protein_id="ADI25205.1"
FT                   /translation="MARIAGVDIPRDKRVVISLTYIYGIGKPTAQKILKEAGVSEDTRV
FT                   RDLTEEELGRIREIVGRLKVEGDLRREVSLNIKRLMEIGCYRGLRHRRGLPVRGQNTKN
FT                   NARTRKGPRRTVANKKK"
FT   gene            142783..143172
FT                   /locus_tag="GC56T3_0132"
FT   CDS_pept        142783..143172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0132"
FT                   /product="30S ribosomal protein S11"
FT                   /note="KEGG: gyc:GYMC61_0133 30S ribosomal protein S11;
FT                   TIGRFAM: 30S ribosomal protein S11; PFAM: ribosomal protein
FT                   S11"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25206"
FT                   /inference="protein motif:TFAM:TIGR03632"
FT                   /protein_id="ADI25206.1"
FT                   /translation="MARRTNTRKRRVRKNIDTGIAHIRSTFNNTIVTITDVHGNAIAWA
FT                   SAGSLGFKGSRKSTPFAAQMAAEAAAKASMEHGMKTVEVNVKGPGAGREAAIRALQAAG
FT                   LEITAIKDVTPIPHNGCRPPKRRRV"
FT   gene            143323..144267
FT                   /locus_tag="GC56T3_0133"
FT   CDS_pept        143323..144267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0133"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase insert; RNA polymerase dimerisation;
FT                   RNA polymerase alpha subunit domain protein; KEGG:
FT                   gyc:GYMC61_0134 DNA-directed RNA polymerase, alpha subunit;
FT                   SMART: RNA polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25207"
FT                   /inference="protein motif:TFAM:TIGR02027"
FT                   /protein_id="ADI25207.1"
FT                   /translation="MIEIEKPKIETVELSEDAKYGKFVVEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTSVQIDGVLHEFSTIDGVVEDVTAIILNIKKLALKIYSDEEKTLEIDVQGE
FT                   GVVTAADITHDSDVEILNPDLHIATLAEGGRLRMRMTAKRGRGYVPAEANKREDQPIGV
FT                   IPIDSIYTPVSRVSYQVENTRVGQVTDYDKLTIDVWTDGSIGPKEAISLGAKILTEHLN
FT                   IFVGLTDEAQNAEIMVEKEDDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELTQKT
FT                   EEDMMKVRNLGRKSLEEVKAKLAELGLSLRKDD"
FT   gene            144368..144730
FT                   /locus_tag="GC56T3_0134"
FT   CDS_pept        144368..144730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0134"
FT                   /product="ribosomal protein L17"
FT                   /note="KEGG: gyc:GYMC61_0135 ribosomal protein L17;
FT                   TIGRFAM: ribosomal protein L17; PFAM: ribosomal protein
FT                   L17"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25208"
FT                   /inference="protein motif:TFAM:TIGR00059"
FT                   /protein_id="ADI25208.1"
FT                   /translation="MSYRKLGRTTSQRKALLRDLATDLIINERIETTEARAKELRSVME
FT                   KMITLGKRGDLHARRQAAAFIRKEVANSETGQDALQKLFSDIAPRYQDRQGGYTRIMKL
FT                   GPRRGDGAPMVIIELV"
FT   gene            144848..145687
FT                   /locus_tag="GC56T3_0135"
FT   CDS_pept        144848..145687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0135"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gyc:GYMC61_0136 ABC transporter related
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25209"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI25209.1"
FT                   /translation="MAEPILSIEGVSFRYPNQSDYAVQNVSFTAERGEWLAIVGHNGSG
FT                   KSTIARMLIGLLRPERGAIRLFGRLLNDATVWEVRRRVGLVFQNPDNQFVGATVEDDIA
FT                   FALENNGIPRLEMVERIREAIRQVHMEPFLHYEPHRLSGGQKQRVAIAGILALRPDMIV
FT                   LDEATSMLDPRGREEVLETVRRLNRQQRITVLSITHDLEEAAKADRLIVMNKGEVMAEG
FT                   TPEQIFRLGSKLERIGLDLPFAVKMGSRLREQGIPLRAGYFTTEELVEELWTLYSKK"
FT   gene            145663..146535
FT                   /locus_tag="GC56T3_0136"
FT   CDS_pept        145663..146535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0136"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gka:GK0136 cobalt transporter ATP-binding
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25210"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI25210.1"
FT                   /translation="MDIVFEKVEHVYNARSPLARRALYDVNVAIRSGAYVAVVGHTGSG
FT                   KSTLLQHLNGLLQPTSGAVKIGEETITSNKRPKQLKPLRKKVGVVFQFPEHQLFEETVE
FT                   KDICFGPLNFGVPEDEAKRKVRELIKLVGLSEDVLAKSPFDLSGGQMRRVAIAGVLALE
FT                   PEVLVLDEPTAGLDPRGRKEMMEMFYRLHREKQLTTVLVTHSMEDAARYADEIIVMHEG
FT                   TVWGHGTPEEMFRDADKLAAIGLSVPETVKLKQQLEKRFGVVIPSPCLTLEQTAEAIQQ
FT                   LFSKVSVHD"
FT   gene            146528..147325
FT                   /locus_tag="GC56T3_0137"
FT   CDS_pept        146528..147325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0137"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: gka:GK0137
FT                   cobalt transporter system (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25211"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ADI25211.1"
FT                   /translation="MTNHLIIGQYVPGHSVIHRLDPRAKLLIVFAYVLIVFLANNAATY
FT                   ALLSLFAFAFAALSRIPFSFIARGLKPILWVVLFTLLLHLFMTKEGDVIYQIGALSVYE
FT                   GGIKQGVFISLRFLLLVLMTTMLTLTTTPIEVTDGVESLLGPLKKMRVPVHELALMMAI
FT                   SLRFIPTLMEETEKIMKAQAARGVDFSGGRFSERMKAIVSLLVPLFISSFKRADELATA
FT                   MEARGYRGGEGRTKFRQLAWKPVDTVFLAAVALLAALLCLLRS"
FT   gene            147338..148114
FT                   /locus_tag="GC56T3_0138"
FT   CDS_pept        147338..148114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0138"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /note="KEGG: gka:GK0138 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: Pseudouridine
FT                   synthase I, TruA, alpha/beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25212"
FT                   /inference="protein motif:TFAM:TIGR00071"
FT                   /protein_id="ADI25212.1"
FT                   /translation="MTTRIKCIIAYDGTHFSGYQIQPGKRTVQGEFEEVLRRMHKGTKV
FT                   RVAASGRTDAGVHAYGQVIHFDTSLSLSSEQWKKALNAQLPDDIVVRFVQEADADFHAR
FT                   FSAKAKEYRYKVWTAAERDVFRRHYCAWHPYSLHISAMNEALRLLHGTHDFTSFCSAKT
FT                   LIEDRVRTMYRAEVKADGPMLEFRFVGSGFLYNMVRIIVGTVLEIGQGKRSPADISMLL
FT                   AAKDRRLAGPTAPAEGLYLWRVYYEDECLVHSLADG"
FT   gene            148293..148730
FT                   /locus_tag="GC56T3_0139"
FT   CDS_pept        148293..148730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0139"
FT                   /product="ribosomal protein L13"
FT                   /note="KEGG: gyc:GYMC61_0140 ribosomal protein L13;
FT                   TIGRFAM: ribosomal protein L13; PFAM: ribosomal protein
FT                   L13"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25213"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ADI25213.1"
FT                   /translation="MRTTYMAKPNEVERKWYVVDAAGKTLGRLASEVAALLRGKHKPTF
FT                   TPHVDCGDHVIVINADKVELTGKKLTKKLYYRHSLYPGGLKVRTALEMRTNYPEQMIER
FT                   AVRGMLPKGSLGRQMFKKLHVYRGSEHPHQAQKPEVYELRG"
FT   gene            148751..149143
FT                   /locus_tag="GC56T3_0140"
FT   CDS_pept        148751..149143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0140"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: gka:GK0140 30S
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25214"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ADI25214.1"
FT                   /translation="MAQVQYYGTGRRKSSVARVRLVPGDGCIIVNKRDIREYIPTEALI
FT                   EMVKQPLVLTETLGSYDVLVNVQGGGFAGQAGAIRHGIARALLEVDPEFRTVLKRAGLL
FT                   TRDARVKERKKYGLKGARRAPQFSKR"
FT   gene            149263..149703
FT                   /locus_tag="GC56T3_0141"
FT   CDS_pept        149263..149703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0141"
FT                   /product="Protein of unknown function DUF2521"
FT                   /note="PFAM: Protein of unknown function DUF2521; KEGG:
FT                   gka:GK0141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25215"
FT                   /inference="protein motif:PFAM:PF10730"
FT                   /protein_id="ADI25215.1"
FT                   /translation="MTVITSLAEKRQEKQLRYERNMLRELSLEKLRTKALEHFVPFYTA
FT                   YRMFPSVVEEGCIDLAIEAYLLGARYSRFGYYGEPAASVRCRCAQEEKYLIDTLFDFLC
FT                   FWGNIDNDFLSQSLYDACEQYIGNWWTEGFERGKKRRRLKLR"
FT   gene            149770..150486
FT                   /locus_tag="GC56T3_0142"
FT   CDS_pept        149770..150486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0142"
FT                   /product="N-acetylmuramoyl-L-alanine amidase CwlD"
FT                   /note="TIGRFAM: N-acetylmuramoyl-L-alanine amidase CwlD;
FT                   PFAM: cell wall hydrolase/autolysin; KEGG: gyc:GYMC61_0143
FT                   N-acetylmuramoyl-L-alanine amidase CwlD; SMART: cell wall
FT                   hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25216"
FT                   /inference="protein motif:TFAM:TIGR02883"
FT                   /protein_id="ADI25216.1"
FT                   /translation="MKEKWKRLVAFAAVALMSTLLFPSLFSDLTSTKPWNLPLSGRIIV
FT                   LDPGHGGPDGGAVGGEAVEKDIALNVAKKLRDYLQQQGALVLMTRETDRDLASPSTRGY
FT                   SRRKTEDLLERTAFVNRSNADLFISIHLNAIPSPRWRGAQTFYYGSFIENERLARFIQA
FT                   ELRRNLENTHRLAKMIDTVYLLKHAKIPGALVEVGFLSNPDERELLVSDGYQTKLAASI
FT                   YKGVLRYFSNEHTPRE"
FT   sig_peptide     149770..149853
FT                   /locus_tag="GC56T3_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.952 at
FT                   residue 28"
FT   gene            150680..151696
FT                   /locus_tag="GC56T3_0143"
FT   CDS_pept        150680..151696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0143"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="PFAM: ATPase-like, ParA/MinD; KEGG: gyc:GYMC61_0144
FT                   ATPase-like, ParA/MinD"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25217"
FT                   /inference="protein motif:PFAM:PF10609"
FT                   /protein_id="ADI25217.1"
FT                   /translation="MLTETEVRAILEKMKDPFLNKTFKETNAIQEIKIKEEKNHVSVKI
FT                   ALAKTGTPEQLRVQTAIVEQLKDAGAATVGLRFAELPRDVVEKYSENKQKTTYIAIASG
FT                   KGGVGKSTVSVNLAVALARLGKKVGLIDADIYGFSVPDMMGITERPTVRGDKIIPVERF
FT                   GVKVISMAFFVEDNAPVIWRGPMLGKMLNNFFKEVEWGDLDYLLLDLPPGTGDVALDVH
FT                   TLLPSCKEIIVTTPHPTAAFVAARAGAMALRTEHEIIGVIENMSYYESRKTGEREYVFG
FT                   KGGGEKLAKELQTELLGQLPLQQPDWNDDDFAPSVYAEDHPIGKIYMDIARKIVAKY"
FT   gene            complement(151782..152411)
FT                   /locus_tag="GC56T3_0144"
FT   CDS_pept        complement(151782..152411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0144"
FT                   /product="spore germination protein GerD"
FT                   /note="KEGG: gyc:GYMC61_0145 spore germination protein
FT                   GerD"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25218"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0145"
FT                   /protein_id="ADI25218.1"
FT                   /translation="MNKCLPLLLLSFLVLGSCAPQEISPPPPDYDETKKMVVDILKTDE
FT                   GKKAIQDIMSEDQMKQQLVIDQKAVKETLQQMLTSDQGKKFWESALKDPKFAESFAKGL
FT                   QAEHEKMMKALMKDPDYQALMIDILKDPEMEKAMVDVLKSKEFRQHLQKVITETLNSPL
FT                   YQAKIQDMLMKAAEKVQQGGEKQEEEGGGEGGEGEESTGNQQGGGG"
FT   gene            152561..153160
FT                   /locus_tag="GC56T3_0145"
FT   CDS_pept        152561..153160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0145"
FT                   /product="KinB signaling pathway activation protein"
FT                   /note="KEGG: gyc:GYMC61_0146 KinB signaling pathway
FT                   activation protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25219"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0146"
FT                   /protein_id="ADI25219.1"
FT                   /translation="MNSRKWVRLFLSTLLIGGIATAAVGIVFNWEEFGRLLLRLEMVEF
FT                   MAVLLWHIGVGFIFSVISQAGFFAYLTVHRFGLGIFRSLWNAVQVVLIMFVLFDLVYFR
FT                   YMAFADKGDSIIPYLLTALFILVVGLVVAYVKSAQTNKGAFVPALFFMVVVTVIEWFPV
FT                   LRINDRDWLYLMLIPLLVCNAYQLLILHKLTGGAKQ"
FT   sig_peptide     152561..152629
FT                   /locus_tag="GC56T3_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.849 at
FT                   residue 23"
FT   gene            complement(153298..154053)
FT                   /locus_tag="GC56T3_0146"
FT   CDS_pept        complement(153298..154053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0146"
FT                   /product="polysaccharide deacetylase family sporulation
FT                   protein PdaB"
FT                   /note="KEGG: gyc:GYMC61_0147 polysaccharide deacetylase
FT                   family sporulation protein PdaB; TIGRFAM: polysaccharide
FT                   deacetylase family sporulation protein PdaB; PFAM:
FT                   polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25220"
FT                   /inference="protein motif:TFAM:TIGR02764"
FT                   /protein_id="ADI25220.1"
FT                   /translation="MFYALNGRTLKKVLIIICSAFFTAVVLYAYEMNRPVFSLPSGPKA
FT                   VYKVDNARNEVALTFDISWGDENADKILDVLKQHGIQNATFFLSASWAERHPAVVKRIK
FT                   EEGHEIGSMGYNFVNYTELENAKIRQDLIMAKKVFDMLGIKQVELLRPPGGNFNKNVLK
FT                   VAQSLGYTVVHWSIDSKDWLNPGTDQIVENVTRDLEPGDIVLLHASDSAKQTAKALPKI
FT                   IASMKENGYKNVNLSELLANGEAESRGIE"
FT   sig_peptide     complement(153964..154053)
FT                   /locus_tag="GC56T3_0146"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.926 at
FT                   residue 30"
FT   gene            154842..156388
FT                   /locus_tag="GC56T3_R0026"
FT   rRNA            154842..156388
FT                   /locus_tag="GC56T3_R0026"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            157009..159935
FT                   /locus_tag="GC56T3_R0027"
FT   rRNA            157009..159935
FT                   /locus_tag="GC56T3_R0027"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            160177..160293
FT                   /locus_tag="GC56T3_R0028"
FT   rRNA            160177..160293
FT                   /locus_tag="GC56T3_R0028"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 67.32"
FT   gene            160450..160524
FT                   /locus_tag="GC56T3_R0029"
FT                   /note="tRNA-Asn1"
FT   tRNA            160450..160524
FT                   /locus_tag="GC56T3_R0029"
FT                   /product="tRNA-Asn"
FT   gene            160532..160607
FT                   /locus_tag="GC56T3_R0030"
FT                   /note="tRNA-Thr1"
FT   tRNA            160532..160607
FT                   /locus_tag="GC56T3_R0030"
FT                   /product="tRNA-Thr"
FT   gene            160618..160689
FT                   /locus_tag="GC56T3_R0031"
FT                   /note="tRNA-Glu2"
FT   tRNA            160618..160689
FT                   /locus_tag="GC56T3_R0031"
FT                   /product="tRNA-Glu"
FT   gene            160804..160878
FT                   /locus_tag="GC56T3_R0032"
FT                   /note="tRNA-Gln1"
FT   tRNA            160804..160878
FT                   /locus_tag="GC56T3_R0032"
FT                   /product="tRNA-Gln"
FT   gene            161304..161379
FT                   /locus_tag="GC56T3_R0033"
FT                   /note="tRNA-Lys2"
FT   tRNA            161304..161379
FT                   /locus_tag="GC56T3_R0033"
FT                   /product="tRNA-Lys"
FT   gene            161384..161455
FT                   /locus_tag="GC56T3_R0034"
FT                   /note="tRNA-Gly2"
FT   tRNA            161384..161455
FT                   /locus_tag="GC56T3_R0034"
FT                   /product="tRNA-Gly"
FT   gene            161462..161537
FT                   /locus_tag="GC56T3_R0035"
FT                   /note="tRNA-Ala4"
FT   tRNA            161462..161537
FT                   /locus_tag="GC56T3_R0035"
FT                   /product="tRNA-Ala"
FT   gene            161683..162582
FT                   /locus_tag="GC56T3_0147"
FT   CDS_pept        161683..162582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0147"
FT                   /product="arginase"
FT                   /note="KEGG: gyc:GYMC61_0149 arginase; TIGRFAM: arginase;
FT                   PFAM: Arginase/agmatinase/formiminoglutamase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25221"
FT                   /inference="protein motif:TFAM:TIGR01229"
FT                   /protein_id="ADI25221.1"
FT                   /translation="MKPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLHYDIED
FT                   LGDIPIGKAERLHEQGDSRLRNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIG
FT                   TLAGVAKHYERLGVIWYDAHGDVNTEETSPSGNIHGMPLAASLGFGHPALTQIGGYSPK
FT                   IKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYLKERTDGVH
FT                   LSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPILDERNK
FT                   TASVAVALMGSLFGEKLI"
FT   gene            162774..163346
FT                   /locus_tag="GC56T3_0148"
FT   CDS_pept        162774..163346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0148"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: gyc:GYMC61_0150 RNA polymerase, sigma-24
FT                   subunit, ECF subfamily; TIGRFAM: RNA polymerase sigma-W
FT                   factor; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   sigma-70 region 2 domain protein; Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25222"
FT                   /inference="protein motif:TFAM:TIGR02948"
FT                   /protein_id="ADI25222.1"
FT                   /translation="MYFMDLFIKKRIKAIQKGDQNAYADLVDLYKDKIYRLCYRMLGNR
FT                   HEAEDAAQEAFIRAYIHIDTYNPEMKFSTWLYRIATNLTIDKLRKRKPDVYLDEEVGGT
FT                   DGLTMQAQLPSREASPEEAVESLELQETVQRAIEQLPEKYRSVIVLKYMEDLSLQEISE
FT                   ILGLPVGTVKTRLHRGREALRRQLGHL"
FT   gene            163361..163972
FT                   /locus_tag="GC56T3_0149"
FT   CDS_pept        163361..163972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0149"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: gyc:GYMC61_0151 putative transmembrane
FT                   anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25223"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0151"
FT                   /protein_id="ADI25223.1"
FT                   /translation="MECPKEIVLLMHSYFDGDLQPEGEQQLKEHLRSCAACAAHFHELK
FT                   KTVAFLQYAAHVAAPPSFAAKVMEAMPKERKTARLRRFMHRHPLLTAASLFLALTLGSL
FT                   ASSWGERGAFSVSADEHVIIRDHTVIVPKGETVKGDIVVRNGSIRIEGTVDGDVTVIHG
FT                   KKYMASAGQVTGEVEEINQVFEWIWYNIKERFNRALQSIE"
FT   gene            164045..164866
FT                   /locus_tag="GC56T3_0150"
FT   CDS_pept        164045..164866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0150"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; KEGG:
FT                   gyc:GYMC61_0152 protein of unknown function DUF147"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25224"
FT                   /inference="protein motif:PFAM:PF02457"
FT                   /protein_id="ADI25224.1"
FT                   /translation="MSFGELPIVSYLLKVVDILVVWYVIYKLIMMIRGTKAIQLLKGIF
FT                   LIILVRFVSNYLGLTTLQWLMDQAIIWGFLAIIIIFQPELRRALEQLGRGRLFTRNTVN
FT                   EDEERMRMVEAIVKATEYMAKRRIGALISIERETGMNDYVETGIMLNAHVSPELLINIF
FT                   IPNTPLHDGAVIIQKNQIAAAACYLPLSESPFISKELGTRHRAALGISEVTDSVTVVVS
FT                   EETGAVSLTKNGELYRDLTIDEFRELLTGELAPATKAPASSRWQWRGKKHG"
FT   gene            164859..166097
FT                   /locus_tag="GC56T3_0151"
FT   CDS_pept        164859..166097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0151"
FT                   /product="YbbR family protein"
FT                   /note="PFAM: YbbR family protein; KEGG: gyc:GYMC61_0153
FT                   YbbR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25225"
FT                   /inference="protein motif:PFAM:PF07949"
FT                   /protein_id="ADI25225.1"
FT                   /translation="MDKLMDHPWFIRVVSLLLAIMLYMSANVGAKTGETRNTFGQEDTE
FT                   TLIDIPVVAYYDEDNLVVSGVPKYVNVTLQGPASIVKPTALQRNFEVYVDLTELPLGTY
FT                   TVPIKYRDISDKLKVTIQPSSAKVTIREKVSKRFSVGVEFFNRNKMPDGYSVGEPTVKP
FT                   DAVTITGAKELIDEIAFVKAIVDLDGATETLTREARVRVYDRRGNELDIEPEPSSVEVT
FT                   VPVKSPSKTVPVQVQTTGELPDGVHLVSITPEPDRVTIYGPKEVLNHIDKLEGLTVDLD
FT                   DITDDATVELDAPLPDGAKNVDPDKIKVHIDVEKDVTQTWKDVPIAVVGLPDSYKAEFV
FT                   KPLEGKITVRLVGPPDVVRGLTKDDIRLYVDVRGLDTGEHQVPIQWNHPEQVQWQPSAE
FT                   TAMVHISDKATAQ"
FT   sig_peptide     164859..164951
FT                   /locus_tag="GC56T3_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.624) with cleavage site probability 0.606 at
FT                   residue 31"
FT   gene            166125..167474
FT                   /locus_tag="GC56T3_0152"
FT   CDS_pept        166125..167474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0152"
FT                   /product="phosphoglucosamine mutase"
FT                   /note="KEGG: gyc:GYMC61_0154 phosphoglucosamine mutase;
FT                   TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25226"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ADI25226.1"
FT                   /translation="MGKYFGTDGVRGVANRELTPELAFQIGRCGGYVLTKSAERPKVLI
FT                   GRDTRISGHMLEGALVAGLLSIGAEVMRLGVISTPGVAYLTKALGAQAGIMISASHNPV
FT                   QDNGIKFFGPDGFKLSDEQEAEIEALIDSAEDMLPRPIGAGLGQVNDYFEGGQKYLQYL
FT                   KQTIDEEDFSGMKIALDCAHGATSSLATYLFADLDADVVTMGASPNGLNINEGVGSTHP
FT                   EALAAFVKEKGADVGLAFDGDGDRLIAVDERGNIVDGDQIMYICAKYLKETGRLKQQTV
FT                   VSTVMSNLGFYKALEAQGIKSVQTAVGDRYVVEEMKKNGYNLGGEQSGHIIFLDYNTTG
FT                   DGMLTALQLVNIMKIKGKPLSELAGEMKKYPQLLVNVRVADKEKAMENEQVKKVIQEVE
FT                   AEMNGNGRVLVRPSGTEPLVRIMAEAQTEEACRAYVERIADVVRREMGVE"
FT   gene            168025..169827
FT                   /locus_tag="GC56T3_0153"
FT   CDS_pept        168025..169827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0153"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="KEGG: gyc:GYMC61_0155
FT                   glucosamine/fructose-6-phosphate aminotransferase,
FT                   isomerizing; TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: sugar isomerase (SIS);
FT                   glutamine amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25227"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ADI25227.1"
FT                   /translation="MCGIVGYIGYQDVKEILLRGLEKLEYRGYDSAGIAVLNESGVHVF
FT                   KEKGRIADLRRIVDPNVNATVGIGHTRWATHGAPSRVNAHPHQSASGRFTLVHNGVIEN
FT                   YEMVRRDYLADVTFQSDTDTEVIVQLVEKFVNDGLATEEAFRKTLSLLKGSYAIAMIDA
FT                   QDENTIYAAKNKSPLLVGLGDGFNVVASDAMAMLQVTNQFVELMDGELVIVTSENVTIQ
FT                   TLNGEKVERKPFTAELDASDIEKGTYPHYMLKEIDEQPFVIRRIIQKYQDENGGLTIDQ
FT                   AIINEVLNADRLYIVACGTSYHAGLVGKQLIESWAKIPVEVHIASEFSYNMPLLSEKPL
FT                   FIFISQSGETADSRAVLVQTNKLGHKAITITNVPGSTLSREADYTLLLHAGPEIAVAST
FT                   KAYTAQIAVLAILAAAAAKAKGFELDFDLTKELAIVANVMEMLCDAKEEMEKIASDYLT
FT                   LTRNCFFIGRAVDYYVCLEGALKLKEISYIQAEGFAGGELKHGTIALIEDGTPVIALAT
FT                   QEHVNLSIRGNVKEVVARGANPCVISMRGLEGDGDRFIIPAVHPDLTPLVSVVPLQLIA
FT                   YYAALHRGCDVDKPRNLAKSVTVE"
FT   gene            170206..170768
FT                   /pseudo
FT                   /locus_tag="GC56T3_0154"
FT   gene            170768..171784
FT                   /locus_tag="GC56T3_0155"
FT   CDS_pept        170768..171784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0155"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gka:GK0178 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25228"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADI25228.1"
FT                   /translation="MRAFRNVYFTTGFMIAAGLLLASFFYSYWLKDIIPQPSKQIYNEA
FT                   GRLVDVPPYPPSWAHPFGVDRQGEDVFWKVIDGAKYTIFTALAVSLLRLAFGTVGGIMY
FT                   AFYLQKFRFIAESIVRAFRFVPAIFLTMLFFAFIPLEEQGAGMGVLIKQLLVLAAVALP
FT                   PLMLVIGNDIAVFLQNEFVVSSRLMGADHVWLIRKHVLPYMRPRLFLLFTQQTVQSLLL
FT                   LVHLGAFQILLGGVKVIYDSDGLGPPEKVALSLSNEWSGLIGLSYREMMLDQWIVVGPC
FT                   VAFIVAIFAFKLMGKGLEQVIAGKGKRKQRKKQRSSSGKTASFPPQQGDFEFVLFYR"
FT   gene            171817..172416
FT                   /locus_tag="GC56T3_0156"
FT   CDS_pept        171817..172416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0156"
FT                   /product="uridine kinase"
FT                   /note="KEGG: gka:GK0179 uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25229"
FT                   /inference="similar to AA sequence:KEGG:GK0179"
FT                   /protein_id="ADI25229.1"
FT                   /translation="MRDRIDFLCKTILAIKTAGRLVLGIDGLSRSGKTTLANQLSQTLR
FT                   EQGISVCVFHMDDHIVERAKRYHTGNEEWFEYYYLQWDVEWLTHQLFRQLKASHQLTLP
FT                   FYDHETDTHSKRTVYLSDSDMIMIEGVFLQRKEWRPFFDFVVYLDCPREIRFARENDQA
FT                   KQNIQKFINRYWKAEDYYLETEEPIKRADVVFDMTS"
FT   gene            172937..173416
FT                   /locus_tag="GC56T3_0157"
FT   CDS_pept        172937..173416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0157"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25230"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1036"
FT                   /protein_id="ADI25230.1"
FT                   /translation="MKRETLFLKASLVLIGLPVLALCLFLVPALAKVAVKLVPTFPWIK
FT                   YFVYLVFEVSALPFYFALYQAFRLLVYIDRNDAFSEASVKALKTIKHCAVAISGLHLLV
FT                   LPLFYLFAEKDDAPGVIFVGLIVPFASLVIAVFAAVLQKLLQQAIEIKQENELTI"
FT   sig_peptide     172937..173032
FT                   /locus_tag="GC56T3_0157"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 32"
FT   gene            173427..173651
FT                   /locus_tag="GC56T3_0158"
FT   CDS_pept        173427..173651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0158"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: gyc:GYMC61_1037 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25231"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADI25231.1"
FT                   /translation="MPIIVNLDVMLAKRKMSVTELSERVGITMANLSILKNGKAKAIRF
FT                   STLEAICKALDCQPGDILEYRSDEGESNP"
FT   gene            173668..174570
FT                   /locus_tag="GC56T3_0159"
FT   CDS_pept        173668..174570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0159"
FT                   /product="protein of unknown function DUF817"
FT                   /note="PFAM: protein of unknown function DUF817; KEGG:
FT                   gyc:GYMC61_1038 protein of unknown function DUF817"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25232"
FT                   /inference="protein motif:PFAM:PF05675"
FT                   /protein_id="ADI25232.1"
FT                   /translation="MKGEKQELAVDESPPFGLMIVRVRQFGRKSRLIKAFVQLVRFGWA
FT                   QARSCVFPVVIFASLALTKIAPLPLLPRYDWLLVICLLMQWWMVRSGMETRDELKVITL
FT                   FHVIGLALELFKVRMGSWSYPEEGYTKIFGVPLYSGFMYASVASYLCQVWRRLKVELVQ
FT                   WPPFWMVVPLASAIYLNFFTHHYWVDVRWWLSSLVMLVFWRSWVTYEVGGIRYRMPLVL
FT                   SFLLIGFFIWIAENIATFFGAWQYPNQAKAWSLVHLGKVSSWCLLVIVSFLIVATLKQV
FT                   KTIAVTGAVERSHADGKSL"
FT   gene            complement(174634..175119)
FT                   /locus_tag="GC56T3_0160"
FT   CDS_pept        complement(174634..175119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0160"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25233"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1039"
FT                   /protein_id="ADI25233.1"
FT                   /translation="MDHNERVRQQLIKSVSGLSDEQLNTRAAKGSWTIAQVLEHLYLIE
FT                   TSIAAMIAHTLKHGESQPVEEKPIHLTVDRSKKVEAPDFARPDNRFFTRHELEEKLHQS
FT                   RQRLRQITEQANPADLEAKSFPHPIFGPLNLKQWVEFVGYHEQRHLAQIEEIKAQLP"
FT   gene            complement(175172..175924)
FT                   /locus_tag="GC56T3_0161"
FT   CDS_pept        complement(175172..175924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0161"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="PFAM: TatD-related deoxyribonuclease; KEGG:
FT                   gka:GK0184 deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25234"
FT                   /inference="protein motif:PFAM:PF01026"
FT                   /protein_id="ADI25234.1"
FT                   /translation="MIDAHIHLDQYTDIDEQINRWQEAGIIGVVAVSTDLRSSCRTLEL
FT                   KQRFPSFVYAAIGFHPEQPLPSEADWNEWTELVKQERPLLAAIGEVGLPYYSAEACAKL
FT                   PAYQERLTEIAAIAANASLPLVLHAVYDRAETALAILQQTRVRQAHFHWLKAEPAVVKQ
FT                   IVQCGYYISVTPEVCYRERDKQLLSLVPIEQLLLETDGPWPFAGPFAGKLTTPLWLLDS
FT                   ARAVAAHYGRDIEQVKTMITANTKRLYG"
FT   gene            complement(175982..177355)
FT                   /locus_tag="GC56T3_0162"
FT   CDS_pept        complement(175982..177355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0162"
FT                   /product="PAS modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; PAS fold domain
FT                   protein; helix-turn-helix Fis-type; KEGG: gyc:GYMC61_1041
FT                   PAS modulated sigma54 specific transcriptional regulator,
FT                   fis family; SMART: AAA ATPase; PAS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25235"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADI25235.1"
FT                   /translation="MNRDMETLLSMYEQILEMIDLGVHAVDQHGKTVIYNRKMRDIEGM
FT                   NIEDVLDKNILDVFRFNPEQPSTLLEALRTGESILNKQQTYFNNKGQAVTTVNQTHPLQ
FT                   KDGRIIGAVEIAKDITKFRKLIQEHHQRGEAGRTFADIIGQSEAMQKAIRLARHAARSE
FT                   ASVLLIGEKGTGKDLLASCIHHESERRAKPFFAQTCLSLPDDWMETMLFGSEEDGEIQP
FT                   GLFEQADGGTVLLDDIDSLSLPLQQKLARFLQEKQFVRAHGQKPVRADIRLIASTSGDP
FT                   IDAVQNRELLKSLYYQIAVHCIVLPPLRERKEDILPLAIHFIRQGNERYGLHVEGLGDD
FT                   VQEAFLAYSWPGNVRELEAVILETMATMEQEQTITLAHLPAPFRAKLAPDETKTDFLFD
FT                   TEDILPLDKYMEEVEIYYIRKALQHHGFNITKTAKALGLSRQNLQYRIRKYQIDKEWG"
FT   gene            177591..179003
FT                   /locus_tag="GC56T3_0163"
FT   CDS_pept        177591..179003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0163"
FT                   /product="amino acid permease-associated region"
FT                   /note="KEGG: gka:GK0186 amino acid permease; manually
FT                   curated; PFAM: amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25236"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ADI25236.1"
FT                   /translation="MQPVQELKRELKSRHLFMIALGGVIGTGLFLGSGYTIHEAGPGGA
FT                   VVAYLFGGLVMYLTMLSLGELAVRIPDAGSYQTYATKFISPAVGYCIGWLSWLNWSVTV
FT                   GIELLTVSILMKRWFPDVPTWVFCAVFALLLFLINALSVKGFGEVEFWFSSVKVLTVIA
FT                   FIVLGLAAMFGVIHMKNGQPAPFFSNFTDHGGLFPNGFWAIFTTMILVNFSFQGTELVG
FT                   VAAGESREPEKTVPVALRNTVWRILIFFILAIFVLAGLFPWEKAGVVESPFVEVFDNIG
FT                   IPYAADIMNFVIITAVLSVANSGLYATSRVLWSMSRQGMVSPFFSKLSKRGVPINALIA
FT                   SIAIGCLSLLCSVYAEDTVYVWLTAIAGFGAVTVWASIALSSYFGRKAFLREGGDVRDL
FT                   KYRTPLYPFVPLAAFALNMATIIGLAFIPDQRIALYCGIPFLLACYGYYHLVAKKRVQP
FT                   LAAEKGELKAAK"
FT   gene            179099..180646
FT                   /locus_tag="GC56T3_0164"
FT   CDS_pept        179099..180646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0164"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /note="KEGG: gyc:GYMC61_1043
FT                   delta-1-pyrroline-5-carboxylate dehydrogenase; TIGRFAM:
FT                   delta-1-pyrroline-5-carboxylate dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25237"
FT                   /inference="protein motif:TFAM:TIGR01237"
FT                   /protein_id="ADI25237.1"
FT                   /translation="MVQPYRHEPLTDFTVEANREAFLAALKKVESELGRDYPLVIGGER
FT                   VMTEDKIISINPANKTEVVGRVAKANKELAERAMKTADEAFRTWSRMSPEARADILFRA
FT                   AAIVRRRKHEFSAWLVKEAGKPWREADADTAEAIDFMEYYGRQMLKLKDGIPVESRPGE
FT                   TNRFFYIPLGVGVVISPWNFPFAIMAGTTVASLVTGNTVLLKPASATPVVAYKFVEVLE
FT                   EAGLPAGVLNYIPGSGAEVGDYLVDHPRTRFISFTGSRDVGIRIYERAAKVHPGQIWLK
FT                   RVIAEMGGKDAIVVDKEADLELAAQSIVASAFGFSGQKCSACSRAIVVQDVYDQVLNRV
FT                   VELTKQLNVGDPAEQATFMGPVIDQGAYNKIMEYIEIGKQEGRLMTGGEGDDSKGFFIQ
FT                   PTVFADVDPNARIMQEEIFGPVVAFAKARDFDHALEIANNTEYGLTGAVISRNRANLEK
FT                   ARHEFHVGNLYFNRGCTGAIVGYQPFGGFNMSGTDSKAGGPDYLILHMQAKTVSEMF"
FT   gene            180762..181961
FT                   /locus_tag="GC56T3_0165"
FT   CDS_pept        180762..181961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0165"
FT                   /product="ornithine aminotransferase"
FT                   /note="KEGG: gyc:GYMC61_1044 ornithine aminotransferase;
FT                   TIGRFAM: ornithine aminotransferase; PFAM: aminotransferase
FT                   class-III"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25238"
FT                   /inference="protein motif:TFAM:TIGR01885"
FT                   /protein_id="ADI25238.1"
FT                   /translation="MTTKSQQLIEQTERYGARNYHPLPIVISEAEGVWVKDPEGNRYMD
FT                   MLSAYSAVNQGHRHPKIIEALKKQADRVTLTSRAFHNDQLGPWYEKVCQLTKKDMVLPM
FT                   NTGAEAVETALKAARRWAYDVKGVPDNEAEIIVCEGNFHGRTLAAVSLSSEPAYKRGFG
FT                   PLLSGVKIIPYGDIEALKAAITPNTAAFLVEPIQGEAGIRIPPQGFLKAAYDVCKENNV
FT                   LFIADEIQTGLGRTGKLFACDWEDVVPDMYILGKALGGGVFPISCVVANRDILSVFEPG
FT                   SHGSTFGGNPLACAVSIAALEVIEEERLAERSLELGEYFLSKLKQIRNADIKEIRGRGL
FT                   FIGVELHVPARPYCEALKEQGLLCKETHETVIRFAPPLIITKEELDWAFERIANVLSRP
FT                   "
FT   gene            181988..183226
FT                   /locus_tag="GC56T3_0166"
FT   CDS_pept        181988..183226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0166"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   gyc:GYMC61_1045 Glu/Leu/Phe/Val dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25239"
FT                   /inference="protein motif:PFAM:PF00208"
FT                   /protein_id="ADI25239.1"
FT                   /translation="MEENMFLSTQRVIKAALAKLGYGEEMYELLKEPLRVLTVRIPVRM
FT                   DDGTVKVFTGYRAQHSDAVGPTKGGIRFHPDVTEEEVKALSMWMTIKAGIVGLPYGGGK
FT                   GGIVCDPRNMSMGELERLSRGYVRAISQIVGPSKDIPAPDVFTNSQIMAWMMDEYSRIR
FT                   EFDSPGFITGKPLVLGGSQGREKATALGVTICIEEAAKKAGIELQGARVIIQGFGNAGS
FT                   FLAKFLHEAGARVIGISDAYGALYDPNGLDIPYLLDRRDSFGTVTTLFENVITNQELLE
FT                   KECDILVPAAVANQITRDNAANIRAKIVVEAANGPTTLEATKILTERGVLLVPDVLASA
FT                   GGVTVSYFEWVQNNQGYYWTEEEVVEKLKEKLTSAFHRVYELAESRRVDMRMAAYMIGL
FT                   RQTAEAARYRGWV"
FT   gene            183464..184072
FT                   /locus_tag="GC56T3_0167"
FT   CDS_pept        183464..184072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0167"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   gka:GK0190 alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25240"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADI25240.1"
FT                   /translation="MQAWITNVMEQFGYIGIFLIIALENIFPPIPSEVILPFGGFMTTY
FT                   TSLTVPGVIAAATAGSVAGALVLYGIGRLLSVERLERIVDRWGRWLRVKPEDIAKANRT
FT                   FHRYGVWAVFLGRMIPLVRSLISIPAGMAKMNIGLFVWLSVLGTLIWNTILISIGAALG
FT                   ESWGKVSEVIGMYAEVVYVIIAAIILIGAVRFWKRRRAS"
FT   gene            complement(184271..185260)
FT                   /locus_tag="GC56T3_0168"
FT   CDS_pept        complement(184271..185260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0168"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   gka:GK0191 ferrichrome ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25241"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADI25241.1"
FT                   /translation="MRMRITAVLGMLLLLIAATAAIALGTGEAPLSYGRIAPTLFGYGS
FT                   MQEAFILFSLRLPRIVITLLAGMALALSGAMLQGTTRNELADPGILGINAGAGAGVAIF
FT                   FLFFPIEAGTFLYALPLVALVGALLTAAAMYAVSYHQTTGLQPVSFVLTGVGFSMALSG
FT                   LMIILISAADRTKVDFIARWLSGNIWGDDWPFIWAMLPWLVIGALIGLYRAKRLNLLHL
FT                   GDPVAIGVGVHVRRERLVLMATAVAVAAAAVAVTGGISFIGLMAPHIAKMIVGPRHERA
FT                   IPAAMLIGGWLLLAADTIGRNVLAEPLPAGVVVSFIGAPYFIYLLLKR"
FT   sig_peptide     complement(185189..185260)
FT                   /locus_tag="GC56T3_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.736 at
FT                   residue 24"
FT   gene            complement(185257..186264)
FT                   /locus_tag="GC56T3_0169"
FT   CDS_pept        complement(185257..186264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0169"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   gka:GK0192 ferrichrome ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25242"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADI25242.1"
FT                   /translation="MEANRRLWPFRYTFLFSLILLMAIWFGSMAIGVADTTWSDVWRAL
FT                   FSDEQGKQLDLIRELRLPRETAAAFVGAGLAVAGAIMQGMTRNPLADPGLLGLTAGANA
FT                   ALAITMAFFPSAHYLAITIACLLGAAAGAGMVFGIGAARKGGFSPLRIVLAGSAVSALL
FT                   FAVAEGVGLYFHISKDVSMWTSGGVAGTSWKQLSVIIPLIVIGLAIAVWYSRQLTILSL
FT                   SEDVAVGVGQKTTAVKTWLFSAVFLLTGASVAIAGNITFIGLMIPHLVRAIAGADYRFI
FT                   IPLSATVGATGMIVADTAARTVNAPFETPVAAIVAVIGLPFFLFVVRKKGRGFE"
FT   sig_peptide     complement(186160..186264)
FT                   /locus_tag="GC56T3_0169"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.653 at
FT                   residue 35"
FT   gene            complement(186332..187258)
FT                   /locus_tag="GC56T3_0170"
FT   CDS_pept        complement(186332..187258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0170"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: gka:GK0193
FT                   ferrichrome ABC transporter (ferrichrome-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25243"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADI25243.1"
FT                   /translation="MRKTWLSLLLLLALVLSACGNAADDNKNSSASPKEKKPETITYQS
FT                   ENGPVEVPADPKRVVVLSTFAGHVLALDVPIVGVDSWSKMSPLFQEKLKDAEVVTDEDI
FT                   EKIMALKPDLIIGLSNTKNVDKLSKIAPTVTFTYGKVDYLTQFLEIGKLLNKEKEAKAW
FT                   IDDFKQRAQQAGEDIRAKIGENATVTVAENFDKQLYVFGNNWARGTEILYQEMKLKMPK
FT                   AVEEQALKPGYYAVSLEALPQFVGDYLILSKNGDGDTSFMETNTFKNIPAVKNGRMFVA
FT                   DAKAFYFNDPITLDYQLDFFKKHFLGQ"
FT   sig_peptide     complement(187190..187258)
FT                   /locus_tag="GC56T3_0170"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.952 at
FT                   residue 23"
FT   gene            complement(187265..188056)
FT                   /locus_tag="GC56T3_0171"
FT   CDS_pept        complement(187265..188056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0171"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gka:GK0194 ferrichrome ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25244"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI25244.1"
FT                   /translation="MVRLYAEELTVRYDDRTIFERLSVRIPDRQITAIIGPNGCGKSTL
FT                   LKTLTRIISPQSGAVILDGRAISQQPTKELAKKIAILPQTPEATSGLTVAELVSYGRFP
FT                   YQRGWGRLTKQDYEAIDWALAVTKTADLKHRPVDALSGGQRQRVWIAMALAQETDIIFL
FT                   DEPTTYLDIAHQLEVLELLERLNKEEGRTIVMVLHDINQAARFSDYVIAMKAGTIVKAG
FT                   PSEDVICRDVLRDVFGIDADIGRDPRTNKPICFTYQLLREA"
FT   gene            188772..190844
FT                   /locus_tag="GC56T3_0172"
FT   CDS_pept        188772..190844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0172"
FT                   /product="PAS modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; PAS fold domain
FT                   protein; CBS domain containing protein; PAS fold-4 domain
FT                   protein; helix-turn-helix Fis-type; KEGG: gyc:GYMC61_1051
FT                   PAS modulated sigma54 specific transcriptional regulator,
FT                   fis family; SMART: PAS domain containing protein; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25245"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADI25245.1"
FT                   /translation="MAMMVGDIMVKAKAVIFESDSLDEAARTFVEYGLDGMVVCRCSEE
FT                   IVGVVAVKDVLFGLVQGKTTVREVMRPSLPPLSIHDRVEVIEFGGGPLRPVVDESGRLV
FT                   GVLTKEQHLTAYAKVAQLRLKHLDAIFNAAHNGILSIDAKGRITSINPPAEKMARTTKE
FT                   EAIGKFLTDVVIPSGLLEVVRTGKGHTEKYRVGKRVYITNRSPIIDEGKVVGAVGVFQD
FT                   ISEIEFISNELETVKRIVNELQTVMEASSDGIAITDRSGMITRRNKKWDALFLGTEQER
FT                   VTAPLDRVVRQALDGRQPCSMLHQGMETGNIWIVSAVPIIEEDGRAERVVLYVKDMTEM
FT                   EQLRSELEETKRLLHMLGRQEEDHLIYRAPAMAHVVNIARQAAAVDVTLLLTGESGTGK
FT                   EELANYIWKQSARRARPFVKVNCGAIPETLMESELFGYEPGAFTGAAKKGKKGYFEQAD
FT                   GGTIFLDEISEIPLHLQVKLLRVLQSMEIMRLGAEAPKRIDVRVIAATNKPLEELVAAG
FT                   RFRADLFYRLNVMPIAIPPLRDRKEDIPLLVDHYRKRFAEKYQKPLVFTDGALAAMMDY
FT                   HWPGNVRELVNAVERMFVTAVSPVIDEHQVAKWLHLEPEPAASPVAVGEIIPLKQATAE
FT                   VERQLIIKALHKAKTYRRAAKLLGVDASTLVRKAQKYGIQSWGGEEDGFHAASRD"
FT   gene            190816..191976
FT                   /locus_tag="GC56T3_0173"
FT   CDS_pept        190816..191976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0173"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   gka:GK0197 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25246"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADI25246.1"
FT                   /translation="MDFTLPAEIEFLKENVRKFVREVVEPVAMDIEENDQIPQDIIEKS
FT                   KEMGLFGLSIPEEYGGLGLSMVGKCAIYEELGKTHNGYTTLIGAHTGIGTVGIVELGTE
FT                   EQKQRYLPKMATGEWIGAFALTEPSAGSNAAAIKTTAVRKGDRYIINGSKHYITNAVDA
FT                   HVFTVMAVTDPSKGPKGITSFIVEKDFPGFIVGKVERKMGLRGSHSAELFFDNLEVPAE
FT                   NVLGREGEGYVNALKILANGRAGLAARNLGSCIRLLEYCMEYAEQREQFGKPIIEQQAI
FT                   QHMLAEMSMLIEVLSSTVYRVAWMVDQKMRVVKEAAIAKLFGSEVYNKIADMAVQIHGG
FT                   LGYMKDYPIERYFRDARITKIYEGTSEIQRNIIASELRKEYGKVRA"
FT   gene            192365..192619
FT                   /locus_tag="GC56T3_0174"
FT   CDS_pept        192365..192619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0174"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25247"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1053"
FT                   /protein_id="ADI25247.1"
FT                   /translation="MRRAEPLVTTGSRGLQEDSFPFRLYQKAKRLEAAAHDSMFGPDHH
FT                   ADIMNFTARQLATRMEVLKKAQEKPFDELFGLEESEIVG"
FT   gene            192764..194305
FT                   /locus_tag="GC56T3_0175"
FT   CDS_pept        192764..194305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0175"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: gyc:GYMC61_1054
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25248"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADI25248.1"
FT                   /translation="MTIDVQMHHFPLFIDGQWQPASSGETFNVYNPATGEAVATVAKAT
FT                   ADDVDRAVKAARKAFDETDWKAMKPKERARVLNVIAQAIAANAQELVYLEAISSGGTIR
FT                   RISSIDILQTVDLFQTMANIVQEYPFSETLPIPPFPGPAHNFVWREPIGVCAAITPWNL
FT                   PLMIASWKIAPALAAGNTIVVKPASYTPLSTLKLAEIISSFVPPGVINVVAGPGAEVGE
FT                   ALVRHPQVDKVAFTGSTEVGRRIMALAAETVKNVTLELGGKSPNILLEDADLDIAVPGS
FT                   LFGVFLHSGQLCESGTRLFVPDRLHDEVVEQLAALTKTLQIGHPLDPATDVGPVISKRQ
FT                   KETVLSYIEAGKQEGATIVCGGHEVEVPGCEGGHFVAPTIFSNVTNDMTIAQEEIFGPV
FT                   LSVIRYHDVEEAVAMANDTIYGLAAGVWTRDVNKAYAIAGRLQAGVVWINDWHMLRNDA
FT                   PFGGYKQSGIGREMGKYSLDAYTQLKHVHTSMVPELEKRKWYQVLFSRLHTMMKK"
FT   gene            194321..195532
FT                   /locus_tag="GC56T3_0176"
FT   CDS_pept        194321..195532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0176"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   gyc:GYMC61_1055 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25249"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ADI25249.1"
FT                   /translation="MTTLANFWLRTAIYTGSNTRALVPDLFRGLGAKRVLLLSDRGLEQ
FT                   AGVVEKVASLFDLTMHGVGPELAGIFLDIRQDAESECVNEAVRYAREIGADALLAVGGG
FT                   SVLDTAKGVKYALFKGLRDIKEAIPGGLRYESFPQAQFMPIPHIAIPTTAGTGSEVSPI
FT                   AVIYNEELRLKTNIINPFINADVAVLDPDLTVGLPPKVTAFTGMDALTHAIEALASPMA
FT                   TALTDACALQAIRLIRDYLPAAVRDGGNIRARLEMLQASLLGITAFSFALNAIPVHNFA
FT                   HAYGAMFRIPHGLANAVFLPVVMEAIPELYLPKAKLLAQALGIHDHGQGNEALLVKSIE
FT                   RIRQLRDDIGLPADFADYPMTEEQFAATIQAVASDPAAISFPMPPELIRAIGERVVKLT
FT                   VEKG"
FT   gene            complement(195596..195997)
FT                   /locus_tag="GC56T3_0177"
FT   CDS_pept        complement(195596..195997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0177"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: gyc:GYMC61_1056
FT                   DoxX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25250"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ADI25250.1"
FT                   /translation="MHFQELCAFLLRIVTGFIFFAHGWVKWQRGLEAATDSFATLGLPG
FT                   WLAYIVTIVELAGGWAMMLGLGTRPIAAAFAVIMVGAIATAKVDAGLLGNGRETGYEFN
FT                   LALLAMSIYLWLNGSRLWSLDAVIGRPRG"
FT   gene            196137..196844
FT                   /locus_tag="GC56T3_0178"
FT   CDS_pept        196137..196844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0178"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: gka:GK0202
FT                   protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25251"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ADI25251.1"
FT                   /translation="MKIEVWSDFVCPFCYIGKRRLEQALEQFPHREDVEIVFRSFELDP
FT                   NAKKETPLTIHEIIANKYGISIEEAKRANADIGRQAEAVGLTFRFETMKPTNTFDAHRL
FT                   AHYAKEKGKLNEMVERLFYAYFTESKRISDRDVLLAIAEATGLDRAEAEEVLASGRYTE
FT                   EVRRDEEEAAALGVRGVPFFVLNGKYAISGAQPVDVFRRALEKVWEEEQQASPLRSLAG
FT                   EGGMCADGSCSID"
FT   gene            complement(196954..197418)
FT                   /locus_tag="GC56T3_0179"
FT   CDS_pept        complement(196954..197418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0179"
FT                   /product="DinB family protein"
FT                   /note="PFAM: DinB family protein; KEGG: gka:GK0203
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25252"
FT                   /inference="protein motif:PFAM:PF05163"
FT                   /protein_id="ADI25252.1"
FT                   /translation="MSRAKKWVQYFLSHRHVTMELIHKIDEAHYDYKPTPTSMTAKQLA
FT                   THMLFSFYNFANTAKHGDPSLFRQKIEEPETNLAKLAETYTEKTRQLIESMSDDDFDRT
FT                   LDLTAIFGTQMSTAQFLQLAMDHEIHHKGQLFVYVRGMGHTDLPLFVKRG"
FT   gene            197639..198409
FT                   /pseudo
FT                   /locus_tag="GC56T3_0180"
FT   repeat_region   197905..198045
FT                   /note="region with at least 98 percent identity another
FT                   region of the genome"
FT   gene            198419..199525
FT                   /locus_tag="GC56T3_0181"
FT   CDS_pept        198419..199525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0181"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: gyc:GYMC61_1060 integral membrane sensor
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25253"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ADI25253.1"
FT                   /translation="MESLLIIYKLIVWGYAAFDYISSKQQTGAGFVLVSLIYFCLQLFA
FT                   LIVRHMRWKRGAAFGSVVLLVLAAAFVEPLWALLLPLNGYELASVYIHRVWGIGAVLLT
FT                   PMIWLDPSAGKLYGFVALFSFVSVTAVKRHIERMEQQEDRLDQMRNDLHRLTRRISEYH
FT                   QYIKQSEYTLQLEERNRLSQRIHDQIGHSLAGALIQMEAAKRLMDADRNKAKQLLENAI
FT                   HISKEGMEQIRMTLKQIKPPLEQIGLNRVKLFIEEFSAQHHLPVPLVCKGDLDVITPIQ
FT                   WKVIYENIAEALTNASKYAEATAIAVEIHVLNRVIKVEVKDNGKGAAKIKKGLGIIGME
FT                   ERAASVHGTVIVDGTNGFSVTTLLPIHE"
FT   gene            199628..200563
FT                   /locus_tag="GC56T3_0182"
FT   CDS_pept        199628..200563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0182"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gyc:GYMC61_1061 ABC transporter related
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25254"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI25254.1"
FT                   /translation="MNMLEIKQVTKKFGDFIAVDHMSLTVAEGEIFGFLGANGAGKSTT
FT                   IHMIAGLLRPNAGEIKILGKDIAKHRQFAKRHIGIVPQEIAIYENLTAYENVEFFAGLY
FT                   GLRGAELRQRVEEALEFVGLSDKRKSYPKHFSGGMKRRLNIACALAHRPKLIIMDEPTV
FT                   GIDPQSRNYILASVKKLNEMGCTIIYTSHYMEEVEEICTRIAIIDHGKIIAEGTKEKLE
FT                   AIITDTKDIWLEIRGMDRLNKQHLQDIRGVKAVQCEENMIKISSDISVNNLNEIVQCLI
FT                   NDGVEIRSLEDKSPNLETVFLALTGRNLRD"
FT   gene            200601..201704
FT                   /locus_tag="GC56T3_0183"
FT   CDS_pept        200601..201704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0183"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: gyc:GYMC61_1062
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25255"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADI25255.1"
FT                   /translation="MNIFRIAAKEIKSDFRDVRTLFFMLLFPIVLMFILGTALSNAFHW
FT                   TISVGDVHVLYNDQKAGPLSPYIQTMIQAAKKAHIDFQKASDRIKGTKAVQEGKADGYI
FT                   EIGPRGVELYTNERNKIKGSIVEGVMAAFVGRCQLAMAVSEVKPGFVPSNKSVHDEYIQ
FT                   ERSLHAKRKPGAMDYYAVAMTTMIALYSALPGSSLLRGERTRKTADRLLAAPVRKSEIF
FT                   IGKLAGNVAANFLCVAVVMLFSQWVLHADWGHHVSLVWLLMLTEVVLAISFGLGMGYMA
FT                   RTEGAARTIAMVIIQLSSFFGGAYFPIDETAWYAHLSPLSWMNDTIFKIVYANDLSSVV
FT                   PTMLLNIGIAALFLVIAVVSMARREGL"
FT   gene            201706..202851
FT                   /locus_tag="GC56T3_0184"
FT   CDS_pept        201706..202851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0184"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: gyc:GYMC61_1063
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25256"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADI25256.1"
FT                   /translation="MNDVIWLVRYTLKRTFRRKINFLLYFGTPLAAILLSLFAYGSSPA
FT                   KDVRIGVVNEDHGRISDDTIRFLKSLDHLSVKSVKLSAVDEQITSQKMDGVLIFRQGFS
FT                   ESVQHGQPRPIKLVSLKGAEITMFIKSYLHEYIDHLAILGRLANGDRDLFWKMYERYQQ
FT                   APFRLSVHSLSDTAKQKGVTYQTIGYLVMIMLMSAGNLTEIIIKEKEERTYSRLLTTPI
FT                   QARTYVLSNIVVNLLIMTAQIIVTIVAMKNIFHIDPNIPMWQMALVLLLFSLSAIGLSL
FT                   ITVMFANSSASAGALQPLITVPTCMLAGCFWPVELMPKFLQKAAYFMPQRWALDFLVKL
FT                   QEGRSFGSLYWHLLILLAFALTFFLLAVYKFSRSQQSGQFV"
FT   sig_peptide     201706..201831
FT                   /locus_tag="GC56T3_0184"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.924) with cleavage site probability 0.884 at
FT                   residue 42"
FT   gene            203063..203746
FT                   /locus_tag="GC56T3_0185"
FT   CDS_pept        203063..203746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0185"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="KEGG: gyc:GYMC61_1064 cell wall hydrolase/autolysin;
FT                   PFAM: cell wall hydrolase/autolysin; SMART: cell wall
FT                   hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25257"
FT                   /inference="protein motif:PFAM:PF01520"
FT                   /protein_id="ADI25257.1"
FT                   /translation="MVKIFLDPGHGGNDAGAVGNGLLEKDITLFIALEINRLLQSEYEG
FT                   VSVQLSRTKDETVPLDERTDRANQWGADLYVAIHVNAGGGTGYEDYIYDRLDDDSATAR
FT                   IRDAIHEEVIKSTGFRDRGKKKANFHVLRETVMPAVLTENGFIDREEDARKLNDTRFLR
FT                   MVARGHVNGLERALGLRKKQKPALTRVIVDGTQVGAFAKRENVLRQVEQHLGRARQIVL
FT                   EQVEE"
FT   gene            203880..205205
FT                   /locus_tag="GC56T3_0186"
FT   CDS_pept        203880..205205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0186"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: gka:GK0210 intracellular alkaline serine
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25258"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADI25258.1"
FT                   /translation="MFGHSIVQLVRRHAGRLDRPLRHVLVNMYKPMMHMPCVFHHWLER
FT                   WMRKWRTIPVLVQVEDEAGIEAVAAVEQGHLRMKVHHRFRHAPFCSASVTPAALEQLLE
FT                   HPKVKKVYLNRQVKVLLNNAVPSANAKRVAVNGTELSGKGVTIAIVDTGIYPHPDLEGR
FT                   IAAFVDFVNGRTTPYDDNGHGTHCAGDAAGNGRMSDGLYAGPAYEANLIGVKVLDRSGS
FT                   GTLETVMRGIEWCIDYNERHPSKRIDIISLSLGGEPQPFPTENDDPLVQAAERAWEQGI
FT                   VVCAAAGNEGPSYGTIASPGISDRIITIGALDDHDTAAMRADDDVASFSSRGPTEYGVT
FT                   KPDLVVPGVNIISLRAPRSFLDKMNKQSRVGDHYISMSGTSMATPICAGIVALMLQAKP
FT                   NATPDEIKRALKDGADLWKGRDPNVYGAGYVNAKRAVELLQR"
FT   gene            complement(205223..207187)
FT                   /locus_tag="GC56T3_0187"
FT   CDS_pept        complement(205223..207187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0187"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: gyc:GYMC61_1066 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25259"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ADI25259.1"
FT                   /translation="MKAIWEKWLKKCRSLPNQYIGFFIFAVLLFWLKTYAAYLAEFNLG
FT                   ISNSMQEFLLFINPISSAVFFLGLALLAKETRVYKWIIIINFILSFILYANIVYYRFFS
FT                   DFITFPTLTQTKNFGDLGRSIWELLRWYDVFYFLDTIILAVIVFSKRFSLPEVQAGRFK
FT                   KGAIFASAILMFSINLALAETDRPQLLTRTFDRNYIVKYLGVYNYLIYDAFQSMKSSTQ
FT                   RAFANKSDITTVLNYVQATYAKPNPKYFGVAKGKNVIYIHLESLQNFVINYKLNGEEVT
FT                   PFLNSLTRDPNTFYFDNFFHQTGQGKTSDAEFMLENSLFGLPQGAVFTTKGQNTYQAAP
FT                   AILHQYGYTSAVFHGNYKTFWNRDEIYKSFGFDHFFDASYYDMNDEDVLNYGLKDKPFF
FT                   RESIPLLETLKEPFYVKFITLSNHFPYPISEEDATIPPATTGDGSVDRYFQTARYLDEA
FT                   VKEFFDYLKKSGLYDRSVIILYGDHYGISENHNKAMAQILGKEITPYEHAQLQRVPLFI
FT                   HVPGIKGGVIHEFGGQIDLLPTVLHLLGIDTKNYVHFGTDLLSPEHQEIVPFRNGDFVT
FT                   PKVTAVNGKYYDTKTGEPVESTPEIQRLEQIVRTKLDLSDKVVYGDLLRFYTPKGFKPV
FT                   DPSKYDYNNREDNEEGSDQ"
FT   gene            207638..208975
FT                   /locus_tag="GC56T3_0188"
FT   CDS_pept        207638..208975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0188"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   KEGG: gyc:GYMC61_1067 potassium uptake protein, TrkH
FT                   family; PFAM: cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25260"
FT                   /inference="protein motif:TFAM:TIGR00933"
FT                   /protein_id="ADI25260.1"
FT                   /translation="MNANRKFFDPPKVLVSGFALIILVGAFLLMLPTATVDGKGLPFLD
FT                   ALFTATSATCVTGLVVVDTGTTFTLFGQLVILALIQVGGLGFMTFATLFAFLLGKRISL
FT                   KERLLLQEALNQLSIEGIVRLVKRILVFTVVIEGIGGLLLAIRFSFDMPFWKAVYFGFF
FT                   HAISNFNNAGFDLMGEFRSLTGYVEDPVVSLVVPILIILGGIGFIVMNEVYEYRQTRRL
FT                   SLHTKVVVITTAWLVFASMALILLLEWNNPKTMGPLSLSGKFLSAFYQAVTPRTAGSNT
FT                   LNIPDLTQPTLFLIVFLMFVGASPGSTGGGIKTTTFTTLLGAVWSQICGKEDVILFRKR
FT                   IVYDTVYKSLTVTMSGLFVVMLVTMVLTITEKGKDFFMILFEATSAFGTVGLSMGLTPE
FT                   LSPLGKAIIIFTMFAGRVGPLTIAYAVTLRRQPDPFRYPKGKMMIG"
FT   gene            209370..211205
FT                   /locus_tag="GC56T3_0189"
FT   CDS_pept        209370..211205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0189"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25261"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1068"
FT                   /protein_id="ADI25261.1"
FT                   /translation="MASLKRLLIGKPMETKQLKHEKLPKWKALAVFSSDALSSVAYATE
FT                   EILLVLALLGTSVFFYSLPIAMAILVLLLLVTLSYRQIIYAFPSGGGAYVVARDHLGTK
FT                   ISLVAGAALMIDYILTVAVSISSGVAALTSAFPGLLSWKVELAVALVLLLMVLNLRGIT
FT                   ESATVFAYPTYVFIGFVLVMIAVGGWQLWHEGWHGFTMHEHASTAHMFASGYSLFILLR
FT                   AFSSGCSAMTGVEAISNGVPAFRPDSSKNAAITMGWMSVLLGTMFLSITVLAAGFGVTP
FT                   TEHQTVISQIGRHVFGNGLFFYLFQLATMVILVLAANTSFAGFPQLTSIMAKDGFLPRS
FT                   LAARGDRLVFSNGIILLSVLAIVLIIAFHAKTHSLIPLYAVGVFLSFTIGQSGLIKKLW
FT                   KREEGRKIGVLLTVGTGAAVTGMVTLVTMVAKFTQGAWIVIVAIPLFVWMFSRIHEHYK
FT                   KLGEQLRLDEREWQQREKLLKPKVIIPISGVSKVVAQSVQYARSISDDITALSIIFDEK
FT                   DEQKLRQKWEKFYPDIPLKVIYSPYRTILSPLLEYITKAEKEADRAPVTVLLSQFIVKK
FT                   WWHTFLHNQTAIILRFFLIMKKDVVIATLPYHLRE"
FT   gene            211311..211949
FT                   /locus_tag="GC56T3_0190"
FT   CDS_pept        211311..211949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0190"
FT                   /product="sporulation protein YtaF"
FT                   /note="KEGG: gyc:GYMC61_1069 sporulation protein YtaF;
FT                   TIGRFAM: sporulation protein YtaF; PFAM: protein of unknown
FT                   function DUF204"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25262"
FT                   /inference="protein motif:TFAM:TIGR02840"
FT                   /protein_id="ADI25262.1"
FT                   /translation="MWLWVSMILLAFSVSMDSLSVGITYGMGGVRFSFFSLALIASMSG
FT                   AVVFASMNIGRLLALFLPLQVERGLASVILIALGGWAIYNVYKPKGDGSDSSMESDGAG
FT                   EANRFSGAVQVLKRPELGDLDRSGTISQKEAVLIGLALSMDAFGAGISSSLLHFPPLSF
FT                   ALLVGVFNLVFIRVGLLLGYMVSKTGIMKKATMLPGVVLIVLGLIKLFR"
FT   gene            212015..212998
FT                   /locus_tag="GC56T3_0191"
FT   CDS_pept        212015..212998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0191"
FT                   /product="SpoOM family protein"
FT                   /note="PFAM: SpoOM family protein; KEGG: gyc:GYMC61_1070
FT                   SpoOM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25263"
FT                   /inference="protein motif:PFAM:PF07070"
FT                   /protein_id="ADI25263.1"
FT                   /translation="MWKKFLSKFGIGAAKVDLVLHRPHVRLGETLEGEFLLEGGSVAQH
FT                   IRNLDVVLQLEVHAEGKAYRRTAAVIPVASSFTIQPGERKVLPFSYALPLHLPISRPTV
FT                   RYTFVTRLDIADGADAYDQDAIHILPPTALEQVFSALAALGFREKATSGSITPHGQEFS
FT                   FFPTSEFQGIVQEVEFFALVEGEGVRLYMEIDVRHGFGGEREMKRELLITHEQLRDSAT
FT                   AARLLREAIEEAVRAAGAFGQLSGHPLATPHSPIYSHPVGHYPPVHHSHHGGHGWAGAI
FT                   GGFAAGMLAGMVAEELLDDVIDDVADGLDVDDWFDGGDGFDGGDLL"
FT   gene            213147..213653
FT                   /locus_tag="GC56T3_0192"
FT   CDS_pept        213147..213653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0192"
FT                   /product="Coat F domain protein"
FT                   /note="PFAM: Coat F domain protein; KEGG: gyc:GYMC61_1071
FT                   coat F domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25264"
FT                   /inference="protein motif:PFAM:PF07875"
FT                   /protein_id="ADI25264.1"
FT                   /translation="MHGQMHGHRHLAWHETLELHELIAFQANGLIKMKKAVGKIDCPEL
FT                   KGLYLETIQGLETNLRELLAFIPAAPMMEESRDHDDGDRALHAGDLLGFSKTAVRNYAA
FT                   AITEAATPVLRKTFVKHLLKAIDTHEKAFNYMYERGYYPAYDLAQLLHNDVRNAQKALS
FT                   MGYER"
FT   gene            213807..214745
FT                   /locus_tag="GC56T3_0193"
FT   CDS_pept        213807..214745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0193"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: gyc:GYMC61_1072 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25265"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADI25265.1"
FT                   /translation="MRYYIVFDIGGTYVKHAVMNEHGDFFEKGRYRSERHDFHQFRDDL
FT                   LNVVRQAQANYPLSGIAISSAGSVDSDLGIIGGSSALPCIHGPNFKEVFGGAMGLPVEM
FT                   ENDANCAALGELWKGAGRGCRDIAFVIVGTGIGGAIVKDGRIHKGAHLHGGEFGYMLMD
FT                   VRYKNGRIECKTWSELAATSALIRMAAEEKGMPERELDGEKVFALAESGDEAAQKAIDR
FT                   FYFSLAQGIFNLQYAYDPEKIILGGAISSRPDFVDEINKRLSVLLSLVPIAKVQPVVET
FT                   CQFKNDANLLGALYHYLERRGELGEASGPSH"
FT   gene            214929..215750
FT                   /locus_tag="GC56T3_0194"
FT   CDS_pept        214929..215750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0194"
FT                   /product="undecaprenol kinase"
FT                   /note="KEGG: gyc:GYMC61_1073 undecaprenol kinase; TIGRFAM:
FT                   undecaprenol kinase; PFAM: Bacitracin resistance protein
FT                   BacA"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25266"
FT                   /inference="protein motif:TFAM:TIGR00753"
FT                   /protein_id="ADI25266.1"
FT                   /translation="MHWMELWKAIILGMVEGLTEFAPVSSTGHMIIVDDLWLKSTEFLG
FT                   KYAANTFKVVIQLGSILAAVVVFKDRFLDLLGVRGRHPGGHPRLNLIHVIIGLLPAGVL
FT                   GVLFEDYIDEHLFSTKTVLIGLVLGALLMIAADKFAKKAARTQTVDQITYKQAFFVGLM
FT                   QCLSLWPGFSRSGSTISGGVLVGMSHRAAADFTFIMAVPIMAGASGLSLLKNWQYVTAA
FT                   DIPFFIAGFFSAFVFALLAIRFFLELINRIRLVPFAVYRIVLAVVIYFLYF"
FT   repeat_region   216300..216451
FT                   /note="region with at least 98 percent identity another
FT                   region of the genome"
FT   gene            complement(216407..216931)
FT                   /pseudo
FT                   /locus_tag="GC56T3_0195"
FT   repeat_region   216960..218805
FT                   /note="region with at least 98 percent identity another
FT                   region of the genome"
FT   gene            218970..219674
FT                   /locus_tag="GC56T3_0196"
FT   CDS_pept        218970..219674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0196"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25267"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1076"
FT                   /protein_id="ADI25267.1"
FT                   /translation="MKFAENTDVFSILFWYSKGEAGRLDKIMNEELFILKKVKVLAFSL
FT                   IGALSISIATVCFAAEGDVLTAKQQQEIKAIQSYHPSIKGIDLKHPETWNLKQNVGIQV
FT                   PVQSSGKVSSGQVSTSSTSTEFVGAKGYTYVVDEGLYYEGVHGTIPYQLTPVVVVNAWL
FT                   GKQSPSASEITWVDNQEEIKYATKSAADVTTGTNKKAKGSVGTLIYGEAAHSITFLTGT
FT                   YTSTTNDAKIIE"
FT   gene            219855..220688
FT                   /locus_tag="GC56T3_0197"
FT   CDS_pept        219855..220688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0197"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1077 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25268"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1077"
FT                   /protein_id="ADI25268.1"
FT                   /translation="MKQIYSYTDIRETSMTTKLDYIVDSKKLLYTVDQDGKFEATYTLK
FT                   HNTRTPEKMVFYILMENTNTPISVKINGIQKKYHVMKVPKKGKVSVTFTISNVPKGNHI
FT                   VYLFTEIYEEDLNSKNPVEKHNIQTFMSFYYFQLKGKEGVTKAISQKSIKPISVLKADA
FT                   KKDHSLKLFKDEKLSNEILDSITRGMYYLSFNNSDEFNMRANMYVLNDYEVQNNDPNSV
FT                   DIAPFTKAVVPIDLSNIKSNNSIRIIMIGIPEKNKTEAPFPVRVAFSTMRFQVLR"
FT   gene            222560..223327
FT                   /pseudo
FT                   /locus_tag="GC56T3_0198"
FT   gene            complement(223866..224939)
FT                   /locus_tag="GC56T3_0199"
FT   CDS_pept        complement(223866..224939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0199"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; KEGG: gyc:GYMC61_1080
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; PFAM: glycosyl transferase family 28;
FT                   Glycosyltransferase 28 domain"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25269"
FT                   /inference="protein motif:TFAM:TIGR01133"
FT                   /protein_id="ADI25269.1"
FT                   /translation="MRKKIILTGGGTAGHVMVNVALIPKLKELGWDIVYIGSHQGIERE
FT                   IIGRIDGVPYYSVSTGKLRRYFDWKNFKDPFNVLKGVWQAYRLIQKEKPDVVFSKGGFV
FT                   SVPVILGAWLNGVPSVIHESDLTPGLANKIAMPFATKICLTFPETKQYVNADKAVYVGA
FT                   VVREELKDGNAEQGRKMCQFDGKKPVLLAMGGSLGSKKINDALRANLSTLLVEFDIIHI
FT                   CGKGNIDPSLTGQKGYKQFEYVNEELPHLLALADIVVSRAGANAIFELLALRKPMLLIP
FT                   LSKAASRGDQILNARSFEKAGYAEVLMEEDLTNESLQAAIHRLYENKDRYRKNMEKAGA
FT                   SDPLQTLLAIIQDTARR"
FT   gene            225318..226046
FT                   /locus_tag="GC56T3_0200"
FT   CDS_pept        225318..226046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0200"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   gyc:GYMC61_1081 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25270"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADI25270.1"
FT                   /translation="MWAWLFVCFIVGIAIYGIVPTIIIRKKRVRLFREGTASDCLALTF
FT                   DDGPDPYYTPKLLDLLKKYGVKATFFVVGRKVERYPDIVRRMAEEGHEIGIHNYRHISN
FT                   WLLPPLWLDWGVRRAAAAIERATGQRPVYYRPPWGHFNAWTPIVQKRYTTVLWSHILGD
FT                   WNEKIGTMELFRRLRSSIRGGAVIVLHDNGDALGADKRAPEQMLSALELLFKDEAAKKM
FT                   RWVTITELRNVQTNTQISAM"
FT   gene            226057..226653
FT                   /locus_tag="GC56T3_0201"
FT   CDS_pept        226057..226653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0201"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   gka:GK0221 alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25271"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADI25271.1"
FT                   /translation="MDTSVWLPYVQSYGYVMLFFFLFCGIVGIPAPEESLLFLVGVMVA
FT                   KEQLLLGPSLASCWGGAMAGMVTAYGAGRWWGAPFVQKYGKCVGITAERWERARRWFGR
FT                   YGKWGILFGCYAPGVRQICPYMAGVSRFPFGPFLLLSALGTAGWAVPLTAAGLWLGQRI
FT                   HIPLISFPLAGLALFLLFLLAAWVGQRRRKKSFES"
FT   gene            226666..227808
FT                   /locus_tag="GC56T3_0202"
FT   CDS_pept        226666..227808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0202"
FT                   /product="Monogalactosyldiacylglycerol synthase"
FT                   /note="PFAM: Monogalactosyldiacylglycerol synthase; KEGG:
FT                   gyc:GYMC61_1083 monogalactosyldiacylglycerol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25272"
FT                   /inference="protein motif:PFAM:PF06925"
FT                   /protein_id="ADI25272.1"
FT                   /translation="MMKVLFLPLFQMNTGHHKVADTLMDFLRRQFPAVESKKIDFLSYC
FT                   NELMEKMVSEAYLRWIRSHPASYHRVYKRLMYQEPPRFEFISFEPWLPYFESKMKKMVE
FT                   EEQPDLIVCTHSFPSRILQRLKRKRVLTVPVVNVYTDFFMNSIWGKRFIDYHFVPHQEA
FT                   KWELITKYGVDKGRIIVTGIPVHDVFMNRSEARRKRQPAHVLVAGGNQGLGNMLAFLRA
FT                   ARTSTLFRYSVLCGANRQLYEEIASWQLPHIRPLPYIADPEEMNRLYEEADAVITKPGG
FT                   VTVSELLHKRIPIFTIDCLPGQERINLQYLQQNGLIYHLVGPESGEQHMLRLLMDDVEK
FT                   NRFFRRVSDYFAGVEKTGQEALAEVVAAMPQRMAWRVLHP"
FT   gene            228063..229166
FT                   /locus_tag="GC56T3_0203"
FT   CDS_pept        228063..229166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0203"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="TIGRFAM: D-alanine/D-alanine ligase; KEGG:
FT                   gyc:GYMC61_1084 D-alanine/D-alanine ligase; PFAM:
FT                   D-alanine--D-alanine ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25273"
FT                   /inference="protein motif:TFAM:TIGR01205"
FT                   /protein_id="ADI25273.1"
FT                   /translation="MKTRVGVLYGGKSPEHQVSLSTAMAVMNAIDPHKFDVIPIYITPE
FT                   GQWIKGEQLTGPIEEIKQLQFTSAATALIPVSLNQVPAADSAAGGNEETIDVIFPLLHG
FT                   PNGEDGTVQGLLEILNIPYVGNGVLASAVGMDKVMMKNLFAQAGLRQAKYIAVTKYDWQ
FT                   KSGETVYDRIERELGYPCFVKPANAGSSVGISKCKQRGDLKAAFIEAFKYDRKIIIEEA
FT                   IVGREIEIGVIGNDEPICSVVGEIVPKKEFYDYEAKYEDGQTELIIPADVTKEQYETIK
FT                   QMAITAFQALDLSGLARVDFFLAEDGAVYINEVNTMPGFTPYSMFPLLWQHSGVPYPEL
FT                   IERLIALALERHQEKQTITYTFKKEKR"
FT   gene            229173..230549
FT                   /locus_tag="GC56T3_0204"
FT   CDS_pept        229173..230549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0204"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase"
FT                   /note="KEGG: gyc:GYMC61_1085
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D -alanyl ligase; TIGRFAM:
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase; PFAM: Mur
FT                   ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25274"
FT                   /inference="protein motif:TFAM:TIGR01143"
FT                   /protein_id="ADI25274.1"
FT                   /translation="MIKRTVRQIAEMADGQCLKPEWENMVVSGVSTDTRTIQAGNLYVP
FT                   LRGATFNGHDFVQEAAQKGAAAVLWAEREGTPPEGVPVVVVDDTLLALQRLAARYREQL
FT                   GLKVIGVTGSNGKTTTKDMIAALLSTHYRVQKTEGNLNNHIGVPLTLLSLDEGTEMAVV
FT                   EMGMSGFGEIERLTMIAKPDAAVITNIGESHLQELGSREGIAKAKLEILAGLHHDGLFV
FT                   YHGDEPLLTERVPKLPLPRHVVTFGAGEQNDYYPTDVRIEAGGTSFVINALPGRTLFMP
FT                   VLGKHHVYNALAAIAVARFFGIDWEGIDASLSRLQVTRMRTEVVKTKYGFTVINDAYNA
FT                   SPTSMRAALMLLQELSGYRQKIAVLGDMLELGDEEVAFHREIGEVLRPGMVDYVFTYGP
FT                   LAHHIAAAAAPFFDDGRVREFDDKAALAEAVRSVATSDDIVLLKASRGMKLEELLRYWV
FT                   "
FT   gene            230637..230798
FT                   /pseudo
FT                   /locus_tag="GC56T3_0205"
FT   gene            230859..232262
FT                   /locus_tag="GC56T3_0206"
FT   CDS_pept        230859..232262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0206"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="KEGG: gyc:GYMC61_1087 DEAD/DEAH box helicase domain
FT                   protein; PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25275"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADI25275.1"
FT                   /translation="MTTFQELGLSQEVMKAIERMGFEETTPIQAKTIPLSLQNKDVIGQ
FT                   AQTGTGKTAAFGIPIVEKVDVKNGAIQALVVAPTRELAIQVSEELYKIGAVKRVRVLPI
FT                   YGGQDIERQIRALKKHPHVIVGTPGRIIDHINRGTLRLEHVHTVVLDEADEMLNMGFIE
FT                   DIEAILSHVPAERQTLLFSATMPDPIRRIAERFMNEPELVKVKAKEMTVPNIQQYYLEV
FT                   HEKKKFDILTRLLDIQAPELAIVFGRTKRRVDELAEALNLRGYAAEGIHGDLSQAKRLS
FT                   VLRKFKEGAIEILVATDVAARGLDISGVTHVYNFDIPQDPESYVHRIGRTGRAGKTGVA
FT                   MTFVTPREIGQLHHIERTTKRKMERMKPPTLDEALEGQQRIAIEKLLNVVETENLSFYK
FT                   RAAEELLEEHDSVTIVAACLKMLTREPDTTPVQLTEEPPLAVKREKKRGGRPDGSARSR
FT                   TKKRRITAH"
FT   gene            complement(232274..232891)
FT                   /locus_tag="GC56T3_0207"
FT   CDS_pept        complement(232274..232891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0207"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: gka:GK0227
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25276"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ADI25276.1"
FT                   /translation="MFQHASDVRSFVRLYPVVAALLLVHIAAWLLFSLPLTALEPIWQY
FT                   AVGTNGAIRHGEYWRLVSPIVLHRDFHHMAVNSLSLWLFGPWLEHALGKRKFLFLYIGG
FT                   GIGANVATLFLLPPLYTHVGASGAIFALFGMYSYLALFRRDLVAPRHAQLLLSVMAVHL
FT                   LLGIMTPDGNLLAHLFGFAVGGLLAPFLSIRPKRPSFYMPRL"
FT   gene            233005..233394
FT                   /locus_tag="GC56T3_0208"
FT   CDS_pept        233005..233394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0208"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /note="KEGG: gyc:GYMC61_1089 holo-acyl-carrier-protein
FT                   synthase; TIGRFAM: holo-acyl-carrier-protein synthase;
FT                   PFAM: 4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25277"
FT                   /inference="protein motif:TFAM:TIGR00516"
FT                   /protein_id="ADI25277.1"
FT                   /translation="MIVGIGIDIVELERIRSLLERSRKFPERILTPREKAQFGELPPAR
FT                   QAEFLAGRFAAKEAYAKALGTGIGRHLSFQDIEIVSDEHGKPSIAARRDGETVHLSISH
FT                   SRDYAVAQVVIERLGPMTPADACHG"
FT   gene            233474..234487
FT                   /locus_tag="GC56T3_0209"
FT   CDS_pept        233474..234487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0209"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25278"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1090"
FT                   /protein_id="ADI25278.1"
FT                   /translation="MGRNVLMALVGIIFLFALAGCGSKSQEEVLKALDEKVDEMTGYQA
FT                   EAKMTFRTGEKPQVYHVEVWHKQPSYYRVSLKNADKGQSQMILRNDEGVFVFTPALNKT
FT                   FKFVSDWPKNSSQAYLYESLVKDILSDSKAKFKATDDYYVFETKTNYPNSEVVPTQEIT
FT                   LRKKDLAPVSVKVMDTDRKALLTVEFSNVEFNKKFDDDAFDTKKNMTGARLEVPTMAEG
FT                   KEQVMAVMYPSQLPKGVQALEEKEVKGENGTRVIMTFGGKKSFTLVQEKADVLPATSMP
FT                   VLVNGDPVDLGFTIGALTDRTLTWWYNGAEFTLASDDLTPEEMVMVASSVQEKAAK"
FT   sig_peptide     233474..233551
FT                   /locus_tag="GC56T3_0209"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.614) with cleavage site probability 0.244 at
FT                   residue 26"
FT   gene            234736..235890
FT                   /locus_tag="GC56T3_0210"
FT   CDS_pept        234736..235890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0210"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="TIGRFAM: alanine racemase; KEGG: gka:GK0231 alanine
FT                   racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25279"
FT                   /inference="protein motif:TFAM:TIGR00492"
FT                   /protein_id="ADI25279.1"
FT                   /translation="MDEFHRDTWVEIDLDAIYDNVANLRRFLPEGTQIMAVVKANAYGH
FT                   GDAQVAATALEAGASRLAVAFLDEALALRKKGIDAPILVLGASRPEDVALAAEHRIALT
FT                   VFRSDWLEKASSLYNGSTPIHFHLKMDTGMGRLGVKDEEETKRIAALIDRHPPFVLEGV
FT                   YTHFATADEVNTDYFSYQYARFLHMLDWLPSRPPLVHCANSAAALRFSDRAFNMVRFGI
FT                   SMYGLAPSPDIKPLLPYELKEAFSLHSRLVHVKKLQPGEKVSYGATYTAQTEEWIGTIP
FT                   IGYADGWLRRLQHFHVLVGGQRAPIVGRICMDQCMIRLPEPLPVGTKVTLIGRQGDEVI
FT                   SIDDVARHLGTINYEVPCTISYRVPRIFFRNKRIMEVRNAVGRG"
FT   gene            236017..236298
FT                   /locus_tag="GC56T3_0211"
FT   CDS_pept        236017..236298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0211"
FT                   /product="putative transcriptional regulator, CopG family"
FT                   /note="KEGG: gyc:GYMC61_1092 putative transcriptional
FT                   regulator, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25280"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1092"
FT                   /protein_id="ADI25280.1"
FT                   /translation="MSESGATTEIVVRLPQSLLTELDVLVKQENGNRNELIYQATKMYI
FT                   RERKKRQIREAMRRGYMEMAKINLSIASEAFHAEYEADHTVERLVSGG"
FT   gene            236303..236653
FT                   /locus_tag="GC56T3_0212"
FT   CDS_pept        236303..236653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0212"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /note="PFAM: PemK family protein; KEGG: afl:Aflv_0199
FT                   toxin-antitoxin addiction module toxin component MazF (an
FT                   endoRNAse)"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25281"
FT                   /inference="protein motif:PFAM:PF02452"
FT                   /protein_id="ADI25281.1"
FT                   /translation="MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVA
FT                   AITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVD
FT                   EALQISLGLIDF"
FT   gene            236919..239084
FT                   /locus_tag="GC56T3_0213"
FT   CDS_pept        236919..239084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0213"
FT                   /product="Tex-like protein protein-like protein"
FT                   /note="KEGG: gyc:GYMC61_1094 Tex-like protein protein-like
FT                   protein; PFAM: Tex-like protein-like; RNA binding S1 domain
FT                   protein; SMART: Resolvase RNase H domain protein fold"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25282"
FT                   /inference="protein motif:PFAM:PF09371"
FT                   /protein_id="ADI25282.1"
FT                   /translation="MANEQRLIEVIAAEQQLAAKQVENVIALHREGNTIPFIARYRKEM
FT                   TGALDEVQIREVLERWEYLQHLEQRKEEVIRLIDEQGKLTEELKRDILEATKLQQVEDL
FT                   YRPYRQKRRTKATIAKERGLEPLAEWLLSCPPAPTPEQQAEMFVNEDKGVATVEEALQG
FT                   AKDIIAEKVADDAALRQWVRDETRRKGTIASVAKAPEKDEKSVYEMYYDYEEPLAKIVP
FT                   HRVLALNRGEKEEVLRVSIKAPVEDIIRYLRRKTVADESSPAAPIVAEAIEDGYKRLME
FT                   PAIERDIRNELTEKAEERAIHIFAENLRKLLLQPPLKGKTVLGIDPAYRTGCKLAVVDE
FT                   TGKLLRIDVIYPHPPQERKEEARAKLLRLLDDYHVDMIAIGNGTASRETEQFVADTLKH
FT                   VQRDIFYLIVNEAGASVYSASDLARAEFPGLQVEERSAVSIARRVQDPLAELVKIDPKS
FT                   VGVGQYQHDVSQKKLAESLRFVVETVVNQVGVNVNTASVSLLQYVSGLTKTVAENIVKR
FT                   REEQGKFRNREELKTIPRLGAKTYEQCIGFLRIIDGDEPLDRTPIHPERYAEVKQLLRK
FT                   LGFTTAAIGSDELRQALQAIEVETVAAELGIGELTLCDIIDALCRPERDPRDELPKPLL
FT                   RKDVLKMEDLKPGMELEGTVRNVVDFGAFVDIGVKQDGLVHISKLSKQYVRHPLDVVSV
FT                   GDVVKVWVEHVDVAKGRISLSMVPPKE"
FT   gene            complement(239103..239216)
FT                   /locus_tag="GC56T3_0214"
FT   CDS_pept        complement(239103..239216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0214"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: gyc:GYMC61_1095 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25283"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1095"
FT                   /protein_id="ADI25283.1"
FT                   /translation="MPTWLKNQMRRAYYEKNREQIKLLNQCWFFYRRKHCS"
FT   gene            239306..239755
FT                   /locus_tag="GC56T3_0215"
FT   CDS_pept        239306..239755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0215"
FT                   /product="protein of unknown function DUF335 SprT"
FT                   /note="KEGG: gyc:GYMC61_1096 protein of unknown function
FT                   DUF335 SprT; PFAM: protein of unknown function DUF335 SprT;
FT                   SMART: protein of unknown function SprT"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25284"
FT                   /inference="protein motif:PFAM:PF03926"
FT                   /protein_id="ADI25284.1"
FT                   /translation="MDQKQLQALVEQISIRVFGKPFRHTAFFNPRLRTTGGRYMLQTHN
FT                   IELNKKHYEQFGEEELIAIIKHELCHYHLHLEGKGYRHRDRDFRELLQKVGAPRYCRPL
FT                   ARNTKAPKTIYTYICTSCGLTYRRKRRINIDRYVCGRCRSKLKRS"
FT   gene            240392..240466
FT                   /locus_tag="GC56T3_R0036"
FT                   /note="tRNA-Asn2"
FT   tRNA            240392..240466
FT                   /locus_tag="GC56T3_R0036"
FT                   /product="tRNA-Asn"
FT   gene            240474..240566
FT                   /locus_tag="GC56T3_R0037"
FT                   /note="tRNA-Ser1"
FT   tRNA            240474..240566
FT                   /locus_tag="GC56T3_R0037"
FT                   /product="tRNA-Ser"
FT   gene            240586..240657
FT                   /locus_tag="GC56T3_R0038"
FT                   /note="tRNA-Glu3"
FT   tRNA            240586..240657
FT                   /locus_tag="GC56T3_R0038"
FT                   /product="tRNA-Glu"
FT   gene            240690..240765
FT                   /locus_tag="GC56T3_R0039"
FT                   /note="tRNA-Asp1"
FT   tRNA            240690..240765
FT                   /locus_tag="GC56T3_R0039"
FT                   /product="tRNA-Asp"
FT   gene            240780..240854
FT                   /locus_tag="GC56T3_R0040"
FT                   /note="tRNA-Gln2"
FT   tRNA            240780..240854
FT                   /locus_tag="GC56T3_R0040"
FT                   /product="tRNA-Gln"
FT   gene            241148..241223
FT                   /locus_tag="GC56T3_R0041"
FT                   /note="tRNA-Lys3"
FT   tRNA            241148..241223
FT                   /locus_tag="GC56T3_R0041"
FT                   /product="tRNA-Lys"
FT   gene            241229..241310
FT                   /locus_tag="GC56T3_R0042"
FT                   /note="tRNA-Leu3"
FT   tRNA            241229..241310
FT                   /locus_tag="GC56T3_R0042"
FT                   /product="tRNA-Leu"
FT   gene            241326..241408
FT                   /locus_tag="GC56T3_R0043"
FT                   /note="tRNA-Leu4"
FT   tRNA            241326..241408
FT                   /locus_tag="GC56T3_R0043"
FT                   /product="tRNA-Leu"
FT   gene            241485..241561
FT                   /locus_tag="GC56T3_R0044"
FT                   /note="tRNA-Arg2"
FT   tRNA            241485..241561
FT                   /locus_tag="GC56T3_R0044"
FT                   /product="tRNA-Arg"
FT   gene            241566..241639
FT                   /locus_tag="GC56T3_R0045"
FT                   /note="tRNA-Pro2"
FT   tRNA            241566..241639
FT                   /locus_tag="GC56T3_R0045"
FT                   /product="tRNA-Pro"
FT   gene            241809..241882
FT                   /locus_tag="GC56T3_R0046"
FT                   /note="tRNA-Gly3"
FT   tRNA            241809..241882
FT                   /locus_tag="GC56T3_R0046"
FT                   /product="tRNA-Gly"
FT   gene            242286..243831
FT                   /locus_tag="GC56T3_R0047"
FT   rRNA            242286..243831
FT                   /locus_tag="GC56T3_R0047"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            244553..247479
FT                   /locus_tag="GC56T3_R0048"
FT   rRNA            244553..247479
FT                   /locus_tag="GC56T3_R0048"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            247839..247955
FT                   /locus_tag="GC56T3_R0049"
FT   rRNA            247839..247955
FT                   /locus_tag="GC56T3_R0049"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 67.32"
FT   gene            248189..248647
FT                   /locus_tag="GC56T3_0216"
FT   CDS_pept        248189..248647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0216"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   gyc:GYMC61_1097 protein of unknown function UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25285"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ADI25285.1"
FT                   /translation="MKKIEILVHSPEETKSVARRLAEHLEPGMVIALEGDLGAGKTTFT
FT                   KGLAEGLGITQTVNSPTFTIIKQYDGRLPLYHMDVYRLEDEWEDLGFDEYFAGDGVTVV
FT                   EWAHLIAGQLPEERLTVFLFHRGGDERLLRFEPSGERYEQLCKEIFPS"
FT   gene            248644..249384
FT                   /locus_tag="GC56T3_0217"
FT   CDS_pept        248644..249384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0217"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   gyc:GYMC61_1098 peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25286"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ADI25286.1"
FT                   /translation="MKVLGIDTSNMPLGIALVDGDVVKGEFITNVKKDHSSRAMPAIEL
FT                   LLRRCDVAPKDLDLIVVAKGPGSYTGVRIGVTIAKTLAWSLGIPIAGVSSLEVLAANGR
FT                   YFPGVIVPLFDARRGQIYTGLYRYEGGALRCLEEDRIVAADEWARRLSEREEDVLFIGA
FT                   DAPLYRDLFRSHLGERVHVAPPSLALPRPSELVMLGKQKERENAHVFVPNYLRLAEAEA
FT                   KWLAKQKGEQNDGDQCSISANDHS"
FT   gene            249344..249796
FT                   /locus_tag="GC56T3_0218"
FT   CDS_pept        249344..249796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0218"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; KEGG: gyc:GYMC61_1099
FT                   ribosomal-protein-alanine acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25287"
FT                   /inference="protein motif:TFAM:TIGR01575"
FT                   /protein_id="ADI25287.1"
FT                   /translation="MGINVQFRPMTIHDIDEVVQVERASFTSPWSRESFYNELMYNRYA
FT                   KYIVMVYNGRIIGYGGMWLVIDEAHVTNVAVLPQFRGQKLGEALMRRLMDMARQHGAAT
FT                   MTLEVRVSNHVAQSLYRKLGFRNGGIRKRYYPDNFEDALVMWVKLR"
FT   gene            249793..250806
FT                   /locus_tag="GC56T3_0219"
FT   CDS_pept        249793..250806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0219"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /note="KEGG: gyc:GYMC61_1100 metalloendopeptidase,
FT                   glycoprotease family; TIGRFAM: metalloendopeptidase,
FT                   glycoprotease family; PFAM: peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25288"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ADI25288.1"
FT                   /translation="MNEDVYVLGIETSCDETAAAVVKNGREVLSNVVASQMESHRRFGG
FT                   VVPEIASRHHVEQITLVIEEAMQQAGVSFAGLDAVAVTAGPGLVGALLVGVNAAKALAF
FT                   AHGLPLIGVHHIAGHIYANQLVAEMKFPLLALVVSGGHTELVFMKEHGNFAVIGETRDD
FT                   AAGEAYDKVARALGLPYPGGPHIDRLAHEGEPVIDLPRAWLEEGSYDFSFSGLKSAVLN
FT                   ALHNAKQRGEEIDPRQMAASFQASVVDVLVTKTVQAAKEYRVRQVLLAGGVAANRGLRA
FT                   ALQDKMKELPDVELVIPPLSLCTDNAAMIAVAGTVLYQQGKRADLALNANPSLPLV"
FT   gene            complement(251128..253053)
FT                   /locus_tag="GC56T3_0220"
FT   CDS_pept        complement(251128..253053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0220"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gyc:GYMC61_1101 ABC transporter related
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25289"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI25289.1"
FT                   /translation="MIILQVHGLTKYFGADLILSNIKLEIQSRDRIALVGRNGAGKSTL
FT                   LKIIAGELSFDSGKIIKPNHIKIGYLAQNSGLDSPRSIWDEMLEVFTPLLGLEKQLAEL
FT                   SMQLGDPDVLADPARYEKTLKTYDELQEQYKEQGGYQYEADIRSVLHGLQFSSYDYKTT
FT                   PVSSLSGGQRTRLALGKLLLSKPDLLILDEPTNHLDLETLAWLEQYLQAYPGAVLVVSH
FT                   DRYFLDKIVTDVYELSNATLKHYAGNYSRYLELRAEQYEQELRRYEKQQEEIARLQDFI
FT                   QRNIARASTAKRAQSRRKQLEKIERLERPVGDEKSASFSFSIDRPSGYEVLTAEDIAVG
FT                   YGDGAPIIRQISFRITRGESVALVGPNGIGKSTLLKAIARKLPIQTGELRYGANVQIGY
FT                   YDQDQADLSSNKRVLDELWDAYPEKTEKEIRTVLGNFLFSGDDVLKPVSALSGGEKARL
FT                   SLAKLMLQKANVLLLDEPTNHLDLDSKEVLEQALIDYPGTILFVSHDRYFINRIATKVF
FT                   ELSSGGLTEYLGDYDYYIAKKEEMRELALLNVRPTETASDSAKTTYEQEKEEKKRRRQR
FT                   QRRLDEIEAEIAALEAQIAEIEQQLCDPSVYGDYETMQRLTQENDERKQRVEMLLAEWE
FT                   QLYTSL"
FT   gene            253150..253638
FT                   /locus_tag="GC56T3_0221"
FT   CDS_pept        253150..253638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0221"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="KEGG: gyc:GYMC61_1102 molybdenum cofactor
FT                   biosynthesis protein C; TIGRFAM: molybdenum cofactor
FT                   biosynthesis protein C; PFAM: molybdopterin cofactor
FT                   biosynthesis MoaC region"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25290"
FT                   /inference="protein motif:TFAM:TIGR00581"
FT                   /protein_id="ADI25290.1"
FT                   /translation="MSSFTHFNEQGRAKMVDITHKEDTVRVAVAQTSVTVSREIYEKMT
FT                   SNAIEKGDVLAVAQVAGVMAAKKTADLIPMCHPLMLKGVDIAFAWENDGEAHKLVITAT
FT                   VKTKGSTGVEMEALTAASVCALTVYDMCKALDKGMVIGPTYLVEKTGGKSGHYRRKTD"
FT   gene            253654..254295
FT                   /locus_tag="GC56T3_0222"
FT   CDS_pept        253654..254295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0222"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; Rex DNA-binding
FT                   domain protein; KEGG: gyc:GYMC61_1103 CoA-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25291"
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /protein_id="ADI25291.1"
FT                   /translation="MSNEQPKIPQATAKRLPLYYRFLKNLHASGKQRVSSAELSEAVKV
FT                   DPATIRRDFSYFGALGKKGYGYNVNYLLSFFRRTLEEDEVTEVALFGVGNLGTAFLNYN
FT                   FSKNNNTKIVMAFDVDERKVGTTVGGVPVYHLDELEERLHENIPVAILTVPAAAAQALT
FT                   DRLVAQGIKGILNFTPARLNVPNHIRVHHIDLAIELQSLVYFLKNYPSPS"
FT   repeat_region   254299..254452
FT                   /note="region with at least 98 percent identity another
FT                   region of the genome"
FT   gene            254475..254627
FT                   /locus_tag="GC56T3_0223"
FT   CDS_pept        254475..254627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0223"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="KEGG: gyc:GYMC61_1104 twin-arginine translocation
FT                   protein, TatA/E family subunit; TIGRFAM: twin-arginine
FT                   translocation protein, TatA/E family subunit; PFAM:
FT                   sec-independent translocation protein mttA/Hcf106"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25292"
FT                   /inference="protein motif:TFAM:TIGR01411"
FT                   /protein_id="ADI25292.1"
FT                   /translation="MKYLLLVAVILLLFGTKKLPELGRSFGQSLREFKDATKGLADDEE
FT                   TKTDR"
FT   gene            254648..255391
FT                   /locus_tag="GC56T3_0224"
FT   CDS_pept        254648..255391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0224"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="KEGG: gyc:GYMC61_1105 sec-independent protein
FT                   translocase, TatC subunit; TIGRFAM: Sec-independent protein
FT                   translocase, TatC subunit; PFAM: Sec-independent
FT                   periplasmic protein translocase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25293"
FT                   /inference="protein motif:TFAM:TIGR00945"
FT                   /protein_id="ADI25293.1"
FT                   /translation="MNDKEMSVYEHLGELRKRLIIVLIFFAAALVVSFFFVDDVILYLQ
FT                   RTAEAKHLTMNAFRLTDPIKVYFQFAFVIAAVLSAPVLLYQIWAFVSPGLYEKERKVTL
FT                   SYIPASIVLFLAGVSFAYFVLFPFVVRFMSQLADQLGVQQMIGINEYFQFLLQLVLPFG
FT                   IVFQLPIVVLFFTRLGLITPQLLVRIRKYAYLALLILAAVITPPDVLSQVIVMIPLTIL
FT                   YEGSIWVARIGYRKAQRAAEEEGNE"
FT   gene            255407..255586
FT                   /locus_tag="GC56T3_0225"
FT   CDS_pept        255407..255586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0225"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25294"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1106"
FT                   /protein_id="ADI25294.1"
FT                   /translation="MERKASKAGPNEGAVSKAAKQGFEAGLLFFCFHFHDMIAVMRLMF
FT                   WSLPVRITGRGSAF"
FT   gene            complement(255575..255754)
FT                   /locus_tag="GC56T3_0226"
FT   CDS_pept        complement(255575..255754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0226"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25295"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1107"
FT                   /protein_id="ADI25295.1"
FT                   /translation="MMRNPQLFSLPYFVLGSMFTYLAIESAHETVWNVSTIALAALAAF
FT                   DFGTALRLLFASKR"
FT   gene            complement(255751..256485)
FT                   /locus_tag="GC56T3_0227"
FT   CDS_pept        complement(255751..256485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0227"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   gyc:GYMC61_1108 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25296"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADI25296.1"
FT                   /translation="MKRNHWYVIITYIVMQLSAFVGVPLLRALGVGQGTESRLEAAKLA
FT                   SGYWAIISFLLAFVIILWLLRGDRNERMMRRLPLGSSWMWAVLGVFLALTAQSIAANIE
FT                   WRLLGIKPGSENTRQIIDIIRLTPLLIVVTSVIGPILEEIIFRKIIFGSLYEKYNFWLA
FT                   ALVSSLLFALVHMEPEHLLLYTSMGMVFAFLYAKTGRIFVPIFAHVAMNTFVVAMQTLL
FT                   ADEIEKMMRQSELPLAVWRVWL"
FT   gene            256841..257125
FT                   /locus_tag="GC56T3_0228"
FT   CDS_pept        256841..257125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0228"
FT                   /product="Chaperonin Cpn10"
FT                   /note="PFAM: Chaperonin Cpn10; KEGG: gyc:GYMC61_1109
FT                   chaperonin Cpn10"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25297"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ADI25297.1"
FT                   /translation="MLKPLGDRIVIEVVETEEKTASGIVLPDTAKEKPQEGRVVAVGAG
FT                   RVLDNGQRIAPEVEVGDRIIFSKYAGTEVKYDGKEYLILRESDILAVIR"
FT   gene            257230..258846
FT                   /locus_tag="GC56T3_0229"
FT   CDS_pept        257230..258846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0229"
FT                   /product="chaperonin GroEL"
FT                   /note="KEGG: gyc:GYMC61_1110 chaperonin GroEL; TIGRFAM:
FT                   chaperonin GroEL; PFAM: chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25298"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ADI25298.1"
FT                   /translation="MAKQIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGS
FT                   PLITNDGVTIAKEIELEDPFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLK
FT                   NVAAGANPMGIRRGIEKAVAVAVEELKAISKPIKGKESIAQVAAISAADEEVGQLIAEA
FT                   MERVGNDGVITLEESKGFTTELDVVEGMQFDRGYVSPYMITDTEKMEAVLENPYILITD
FT                   KKVSSIQELLPILEQVVQQGRPLLIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGD
FT                   RRKAMLEDIAILTGGEVISEELGRELKSTTIASLGRASKVVVTKETTTIVEGAGDSERI
FT                   KARINQIRAQLEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALN
FT                   STRAAVEEGIVAGGGTALMNIYNKVAAIEAEGDEATGVKIVLRAIEEPVRQIAQNAGLE
FT                   GSIIVERLKNEKPGIGFNAATGEWVDMIEAGIVDPTKVTRSALQNAASVAAMVLTTEAV
FT                   VADKPEENKGNNNMPDMGGMM"
FT   gene            complement(258925..260109)
FT                   /locus_tag="GC56T3_0230"
FT   CDS_pept        complement(258925..260109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0230"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: saw:SAHV_2013
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25299"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADI25299.1"
FT                   /translation="MASFQKYKTKDGEKWMFKMDVGIDPATGKRKTTTRRGFKTKKEAQ
FT                   LAAAKLYDEINNGGYVKDTNILFKDFAQEWLAIYSETAKISTIRARKHELGHLMRYFGN
FT                   LKLKDVTRKMYQDMLLDLKKKGYADNTLDGIHTTGRMIFKKAMELELINSNPTEYAKVP
FT                   KQKKTVEDIESGNKDMKFLEKHELALFLKTAQEHGLAMDYVVFSTLAYTGMRLGELLAL
FT                   QWKDINFKEHTIAITKTLYSPRNNERYYQLLPPKTQGSIRTIKVDPNIISLLKKHKAEQ
FT                   NEIKLRMGELYHDLGFVFARPSGFPEVPKKIEIRMKRLLRIANIHKHVTPHSLRHTHTS
FT                   LLIEAGVGIKEIQQRLGHADIETTMNIYAHLTKDLEERASQKFSELMSNFIKNL"
FT   gene            complement(260112..260300)
FT                   /locus_tag="GC56T3_0231"
FT   CDS_pept        complement(260112..260300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0231"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcr:504179.50 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25300"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI25300.1"
FT                   /translation="MIIHLDDYRNKKNKKNKKKKKTNSCSMISIPVFSRITVEDGKLVG
FT                   VLENGQKIIIENSEEDR"
FT   sig_peptide     complement(260181..260300)
FT                   /locus_tag="GC56T3_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.837) with cleavage site probability 0.509 at
FT                   residue 40"
FT   gene            complement(260338..260778)
FT                   /locus_tag="GC56T3_0232"
FT   CDS_pept        complement(260338..260778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0232"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955; KEGG:
FT                   gtn:GTNG_2861 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25301"
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /protein_id="ADI25301.1"
FT                   /translation="MAEKIKQIVEKLITKHGTNNPFEIASQKGIVLLFEPLGGTYGYHH
FT                   TFRRIQIIHINSELDEPMKRFVCAHELGHAVLHPELSTSFLRKHTLFCMDKVEREANEF
FT                   AVELLLSDDVLYTYRDTDATIYEAAAAYGIPKEVVHLKNFDF"
FT   gene            complement(260799..261245)
FT                   /locus_tag="GC56T3_0233"
FT   CDS_pept        complement(260799..261245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0233"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: bha:BH3549 immunity repressor protein
FT                   (phage-related protein); PFAM: helix-turn-helix domain
FT                   protein; SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25302"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADI25302.1"
FT                   /translation="MSFPQRLRMLRKAKGLTQEELGRKVNVTKVSISGYESGNRTPDMD
FT                   TLKALADALDVSIDYLLGRDNTQPTDTKLPALTEKDERDIQKELEKIIKGLKTGSGFAA
FT                   FGGVDIDELDEEDRELLIASLENSLRLAKRIAKQKFTPKKYRKE"
FT   gene            261408..261644
FT                   /locus_tag="GC56T3_0234"
FT   CDS_pept        261408..261644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0234"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: bcl:ABC1851 repressor protein; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25303"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADI25303.1"
FT                   /translation="MNKRREKLISTRKKEGMTLQEVADKVGISKPYYWQIEQGKRGLSY
FT                   EMAVKIARVFNKRPDDIFLVGELTYEEQKEGVK"
FT   gene            261641..262396
FT                   /locus_tag="GC56T3_0235"
FT   CDS_pept        261641..262396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0235"
FT                   /product="prophage antirepressor"
FT                   /note="PFAM: phage antirepressor protein; BRO domain
FT                   protein; KEGG: gka:GK0519 phage associated-antirepressor"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25304"
FT                   /inference="protein motif:PFAM:PF03374"
FT                   /protein_id="ADI25304.1"
FT                   /translation="MNQLQIFNHPMFGDVRFVEINNNPHAVGNDVAKALGYSRPHEAIS
FT                   SHCKGAVTYRILTNGGEQTVKVIPEGDIYRLIIKAADQSKNPEIRQKAEEFEKWIFEVV
FT                   LPTIRRTGGYVANEDMFINTYLPFADEQTKMMFRGVLETVRRQNEQIAAMKPKADYFDA
FT                   LVDRNLLTNFRDTAKELEVKERYFIEWLLDNKFVYRDQKGKLKPYAQYVPELFKLKEFA
FT                   RNGKADVQTLITPRGKETFRLLLKKDQTA"
FT   gene            262419..262502
FT                   /pseudo
FT                   /locus_tag="GC56T3_0236"
FT   gene            262705..263019
FT                   /locus_tag="GC56T3_0237"
FT   CDS_pept        262705..263019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0237"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bld:BLi01434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25305"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI25305.1"
FT                   /translation="MQMVVQVPDIDKYVKDLVRQAYELGVEEGRKRYSYPPVLTRKDLA
FT                   EIFQVQLSTVSNLTDIPGFPKLTHIRARYPRDQVFRWIEENSTYLDQVAPNRKIGRRSE
FT                   "
FT   gene            263022..263297
FT                   /locus_tag="GC56T3_0238"
FT   CDS_pept        263022..263297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0238"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2858 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25306"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2858"
FT                   /protein_id="ADI25306.1"
FT                   /translation="MQIKNLSFDELPSGVREVADRALAERKVRNVFRVTELDFGDGRVY
FT                   YEISAISDSFIFELSVSELGVEHVNRIGVDTVRDAIKAHPERFGLE"
FT   gene            263314..263445
FT                   /locus_tag="GC56T3_0239"
FT   CDS_pept        263314..263445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: neq:NEQ321 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25307"
FT                   /inference="similar to AA sequence:KEGG:NEQ321"
FT                   /protein_id="ADI25307.1"
FT                   /translation="MNMECPRCGAEARWEVVEIVEGKGYVWEAECDECGWEDSKYEF"
FT   gene            263649..263981
FT                   /locus_tag="GC56T3_0240"
FT   CDS_pept        263649..263981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0240"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2857 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25308"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2857"
FT                   /protein_id="ADI25308.1"
FT                   /translation="MDDKRKARIRIGELLNACRRCPYGGLRTSSRYVKQCGTCDVYKEM
FT                   RELGDWLANTSKRRKNRGIKKWTEEERRILIDNVHLPVRELAKMLNRRVSSVKNQIDFL
FT                   KRKGLL"
FT   gene            263982..264179
FT                   /locus_tag="GC56T3_0241"
FT   CDS_pept        263982..264179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0241"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2856 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25309"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2856"
FT                   /protein_id="ADI25309.1"
FT                   /translation="MAVENPMTLNVKWEEPRVIGECAGCYENIVEGEEFIEFLDGQMIH
FT                   YDNHCAMAFCLESGERKIAW"
FT   gene            264199..264675
FT                   /locus_tag="GC56T3_0242"
FT   CDS_pept        264199..264675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0242"
FT                   /product="Gp157 family protein"
FT                   /note="PFAM: Gp157 family protein; KEGG: gtn:GTNG_2855
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25310"
FT                   /inference="protein motif:PFAM:PF05565"
FT                   /protein_id="ADI25310.1"
FT                   /translation="MKLYELAENYRELLEMAEEMESDAIVDTLEAIRDEIELKAENIAK
FT                   LIRNLESDAKAIREEEKRLNEKRTAIENKVKRLKTYLFEQLERAGIQRIKRPTITVYIQ
FT                   DNPPSVDVVDMSAIPAEFLKQKVEVDKKSILERIKSGEQIPGVELKREKGVRIR"
FT   gene            264672..265373
FT                   /locus_tag="GC56T3_0243"
FT   CDS_pept        264672..265373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0243"
FT                   /product="ERF family protein"
FT                   /note="PFAM: ERF family protein; KEGG: gtn:GTNG_2854
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25311"
FT                   /inference="protein motif:PFAM:PF04404"
FT                   /protein_id="ADI25311.1"
FT                   /translation="MTKTAEQPKPLNIHQKLVEIRKTVDVFVKDSQGYGYRYVSGTQVL
FT                   KKIREKMDELGVLLVPIVLNQTHSTFNYTVWDRENKRERPKTDFVVTGDMKYVWINADD
FT                   PSDRIEIPWQYMGQQDDISKAFGSALTYTERYFLMKFFSVPTDEDDPDARDTAKQNGKI
FT                   DKKENGKNKKASKNQLDYIDALISRRVTADWTKEMLYEKLKETMGVDKEPSEWTVEEAS
FT                   KAISIITGRFE"
FT   gene            265370..265525
FT                   /locus_tag="GC56T3_0244"
FT   CDS_pept        265370..265525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0244"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2853 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25312"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2853"
FT                   /protein_id="ADI25312.1"
FT                   /translation="MKTWIKRFGEAYWCFLETDEDTDTILRETKLGWLPYAVSGAILAL
FT                   ILIGNH"
FT   gene            265545..265769
FT                   /locus_tag="GC56T3_0245"
FT   CDS_pept        265545..265769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0245"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: snt:SPT_0504 cell wall surface anchor family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25313"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI25313.1"
FT                   /translation="MDTRKKKEKVQKAFKEGLEYRVAFPFCYTWMARTEKEYEAYATGY
FT                   IKIVHPEFKVIGVDREKQVVICVKEDKMP"
FT   gene            265784..266710
FT                   /locus_tag="GC56T3_0246"
FT   CDS_pept        265784..266710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0246"
FT                   /product="primosome, DnaD subunit"
FT                   /note="KEGG: gtn:GTNG_2852 hypothetical protein; TIGRFAM:
FT                   primosome, DnaD subunit; PFAM: DnaD and phage-associated
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25314"
FT                   /inference="protein motif:TFAM:TIGR01446"
FT                   /protein_id="ADI25314.1"
FT                   /translation="MLTGHPIVDKVAKINLAGTVIPHNWFSTITFENGKPDTIAIVLLS
FT                   EIVYWYRPMFIKDEATGRIKEVRKRFKADLLQRSYDSFAEQFGFTKRQVRDAIKRLEDK
FT                   GLIRREFRNIHVDGMTLTNVLFIELNPEKLSEFTYGIEDMTTDEIGSDVSTDRVLRSNV
FT                   TPYTIERQTNTEITTKTTTNIDDDDKDEPINEISREEKTECNPVTEFEKAFGYLPPSIL
FT                   QQEFEQVIENGQFQEPEAIIVEAIRLARKQMPRNPARYISSILRNFEFMGLFTLEDVKE
FT                   YNEMFEQKRKQAPRRRQSPTEINWDEL"
FT   gene            266731..266994
FT                   /locus_tag="GC56T3_0247"
FT   CDS_pept        266731..266994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0247"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25315"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2851"
FT                   /protein_id="ADI25315.1"
FT                   /translation="MTREQVKHVMKLISFVYSNFEVSKEKVDIWYDLLADEPFDLVLSN
FT                   AKRHAKEKTYPPTIAELCHRDERPAYYELYVHNMNAGEDWTQ"
FT   gene            266991..268241
FT                   /locus_tag="GC56T3_0248"
FT   CDS_pept        266991..268241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0248"
FT                   /product="DnaB domain protein helicase domain protein"
FT                   /note="PFAM: DnaB domain protein helicase domain protein;
FT                   KEGG: gtn:GTNG_2850 replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25316"
FT                   /inference="protein motif:PFAM:PF00772"
FT                   /protein_id="ADI25316.1"
FT                   /translation="MSVEAEKAVLGTFLECPYLLKETVLTETHFSDPKHRKLFAAMKRI
FT                   AQQGDEPDIVTLSTTEDVADFGGLSYLNEVSAFANETKFDQYEALVLDEWKEREKRRIL
FT                   VVAAQENWDIDKITTALTRLNEGRITDHHDISDLLHEVAEAPWTPTERKMGAPSGISEL
FT                   DKMLNGFNDGDSIILAARPSMGKTDFMIHFAKSVGWHGYLPIVFSLEMAADKIRDRLIG
FT                   SIGGFNRMKLRNPYHDLSEEQKRMWIEVIGKASETHMQIFDGAGQSIADIRSKIRKAVN
FT                   RFPDRKPVVFIDYLTLIRPERYYGGNMHLQVTEISRAIKETAKEFSCPIVTLAQLSRDV
FT                   EKRSDKRPLMSDIRESGSIEQDADVVIFLYRDSYYNAEADPRVAEVIVAKSRNGAVGTV
FT                   RVSYNRNTGVIQDLYRS"
FT   gene            268246..268674
FT                   /locus_tag="GC56T3_0249"
FT   CDS_pept        268246..268674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0249"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2849 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25317"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2849"
FT                   /protein_id="ADI25317.1"
FT                   /translation="MKEAIRDEAASLIYTLHYFLSAGRIRRDSTMDELEAAMESVAEED
FT                   TRTIARLIEENPLKVYEIRVFSLKIGQGRFAFVFAANEEEAKSFVRHKYGIEPKNCFQY
FT                   PIDFPVSIGNRFTTFREMARAKNSFPSLAGFYQKEVRE"
FT   gene            268671..269129
FT                   /locus_tag="GC56T3_0250"
FT   CDS_pept        268671..269129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0250"
FT                   /product="HNH nuclease"
FT                   /note="SMART: HNH nuclease; KEGG: gtn:GTNG_2848
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25318"
FT                   /inference="protein motif:SMART:SM00507"
FT                   /protein_id="ADI25318.1"
FT                   /translation="MSFKECRAVPKKVPEKRRKRKAPSSKTRGSISKTEYNRMIEVFGC
FT                   RCMMCGDPRIEAHHVRFRSQGGRGKWRNLAPLCHCCHQAVHQNRALAERLMAVREDMFG
FT                   KWYWADEYDLYENGLIKEPLKENFEDFMRREENEEVVRHCTGKEIGGW"
FT   gene            269080..269202
FT                   /locus_tag="GC56T3_0251"
FT   CDS_pept        269080..269202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25319"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI25319.1"
FT                   /translation="MKKWYVIVQEKKSVDGECLIEIKTIESRPKKFAYVVFAEK"
FT   gene            269219..269716
FT                   /locus_tag="GC56T3_0252"
FT   CDS_pept        269219..269716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0252"
FT                   /product="single-strand binding protein"
FT                   /note="KEGG: gtn:GTNG_2847 single-strand DNA binding
FT                   protein; TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25320"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ADI25320.1"
FT                   /translation="MINRVILTGRLTDDPQFRYTPSGVAVVTFILAVTRPFANQNGVRE
FT                   ADFIRCVAWRKQAENIANYLKKGSMVGIDGRLETGSYERNGRRTYYTQVVVDTATFLEP
FT                   RNASNSGEKQKGNRETSKQEKNASRRAREAFMKPQDGQGWFNDPFADNGEPIEMNDDDL
FT                   PF"
FT   gene            269795..270088
FT                   /locus_tag="GC56T3_0253"
FT   CDS_pept        269795..270088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0253"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2846 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25321"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2846"
FT                   /protein_id="ADI25321.1"
FT                   /translation="MYCVSVNSAYCGWLGYVEWVRPPAAMVRFTLDHDEKPVRRRKQML
FT                   LRQLALVDQWELTRENIDDMVNIALDTSDQEWFEQLITMRNEKEREEQKWRK"
FT   gene            270180..270362
FT                   /locus_tag="GC56T3_0254"
FT   CDS_pept        270180..270362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0254"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2845 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25322"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2845"
FT                   /protein_id="ADI25322.1"
FT                   /translation="MGSLYRYFQKSEVEREMKRHNAIQQLRQMGINEFKGQRIDEFDYE
FT                   ELKWILAVERAKRDE"
FT   gene            270381..270929
FT                   /locus_tag="GC56T3_0255"
FT   CDS_pept        270381..270929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0255"
FT                   /product="dUTPase"
FT                   /note="PFAM: dUTPase; KEGG: gtn:GTNG_2844 putative
FT                   cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25323"
FT                   /inference="protein motif:PFAM:PF08761"
FT                   /protein_id="ADI25323.1"
FT                   /translation="MELRELFEVQGELDAHIEKIHPRKEGEKRLEEKILALQTELGEIA
FT                   NEWRQFKFWSNDRKPRTDQLLEEYVDGLHFVLSIGLEESERYGQLVPIRLGLPDELTSI
FT                   CYETTIQQFNYLFFEIGRLYDSVTLHEVTTDTEVEEAYENIIRMFIGLGEKLGFTEDEI
FT                   VEAYTKKNRINHERQANGY"
FT   gene            270939..271439
FT                   /locus_tag="GC56T3_0256"
FT   CDS_pept        270939..271439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0256"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25324"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2843"
FT                   /protein_id="ADI25324.1"
FT                   /translation="MRFERFVGIDPSLRTGFVALSPLGEVIEAKEIEKEGDDPARMSEL
FT                   IQAVVDSVHDTDFVAIEGFGYASQRGFLLGGIGWGMRMELYRRGIQYIDVAPSLVKKFA
FT                   GAKGNANKEKVVLEVYKRWGFESDSNNVIDAFVLAQIARAAKTETKLIQAQKEVLDKIL
FT                   KLK"
FT   gene            271452..271874
FT                   /locus_tag="GC56T3_0257"
FT   CDS_pept        271452..271874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0257"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2842 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25325"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2842"
FT                   /protein_id="ADI25325.1"
FT                   /translation="MNEATDKEFEEYTRLHGRYIQQIRFYEERMDELTPYELSRMEYLY
FT                   TKLEQVAWQIAGWYKKRAKYHEGMAEIAQGQHYRKEREKSSATDAQHYSRIAKGTQLKI
FT                   AGQYEGDFITWRGIAGTYERAANAIKDMIKSITTEE"
FT   gene            271886..272680
FT                   /locus_tag="GC56T3_0258"
FT   CDS_pept        271886..272680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0258"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="TIGRFAM: thymidylate synthase; KEGG: gyc:GYMC61_2589
FT                   thymidylate synthase; PFAM: thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25326"
FT                   /inference="protein motif:TFAM:TIGR03284"
FT                   /protein_id="ADI25326.1"
FT                   /translation="MKQYLDLLRDILKNGIEKEDRTGTGTISVFGRQLRFDLQKGFPLL
FT                   TTKKLHIRSIIYELLWFLRGDTNVRFLNENGVTIWDEWADENGELGRIYGAQWRAWRTA
FT                   DGGTIDQITRVIEEIKHNPNSRRLLVSSWNIGELDQMALPPCHYAFQFYVAAGRLSCMW
FT                   QQRSVDTFLGLPFNIASYALLTHMVAQQCDLEVGELIFSGGDVHLYKNHVEQAKLQLTR
FT                   DPCPLPKLIIKRKPDSIFGYCYEDFEFVGYDPHPAIKAPISV"
FT   gene            272694..273122
FT                   /locus_tag="GC56T3_0259"
FT   CDS_pept        272694..273122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0259"
FT                   /product="phage transcriptional regulator, RinA family"
FT                   /note="TIGRFAM: phage transcriptional regulator, RinA
FT                   family; KEGG: gtn:GTNG_2841 GP53 protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25327"
FT                   /inference="protein motif:TFAM:TIGR01636"
FT                   /protein_id="ADI25327.1"
FT                   /translation="MTAVKIEKGVAQYIEHNLYYYFEYVRDIQRLKKDILFGRANYDEN
FT                   VGGGRGNLPSRPTERRTIELITHRRLERLEQIVHAIQTVYGLLSPEKQKAVQLKYWSGK
FT                   NYTWEQVAREIGVSVRQLYRWRDQIIYDIAKLLGEANS"
FT   gene            273119..273400
FT                   /pseudo
FT                   /locus_tag="GC56T3_0260"
FT   gene            273625..274587
FT                   /locus_tag="GC56T3_0261"
FT   CDS_pept        273625..274587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0261"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbe:BBR47_53530 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25328"
FT                   /inference="similar to AA sequence:KEGG:BBR47_53530"
FT                   /protein_id="ADI25328.1"
FT                   /translation="MFQYRNIPSKYINQLAKIHKIKYTGRSDEEIINDLVQAGQREKLL
FT                   YLNEQFKFADRFLNLCKTESNFPEKSKTPEKFLETLIAEGHINRNNINTEWEPSLNPSI
FT                   QICAVKHEGATVYLKLVEEKVTLRKNGYSKIPLSYAHFTPVAIHFGSEELIEVRCPYKE
FT                   VKKYCEYIMKIMGFALPYKYFTVPKLTKENAKKLCSLLSAGVSSTHILLPTSVGSMRLN
FT                   GKKGVNLDADNTFKLITNAIEKLGIPTNDTSDETCFFSFQDPVTSIVIEAKFEVNIKKN
FT                   YFKFTTEVPQIVVDHVLDALVMINESDNQGEQQVATGLD"
FT   gene            274613..274978
FT                   /locus_tag="GC56T3_0262"
FT   CDS_pept        274613..274978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ape:APE_0412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25329"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI25329.1"
FT                   /translation="MATSIPFGKINEILARWAANTPPIEDFTVENVLYAVGLDSSYYEI
FT                   ILRFLMSKAGFELIPKKMLVCPSNHKIQAFDLDEDLEGELFDCFCGESDFEAEDFILVF
FT                   SFTDDFKKDALALKKSL"
FT   gene            275046..275408
FT                   /locus_tag="GC56T3_0263"
FT   CDS_pept        275046..275408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0263"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: cho:Chro.10206 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25330"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI25330.1"
FT                   /translation="MGLFSEPQKGVFVYYMDNRRSISIQNSTLNNTNLSSGDGNSQSVV
FT                   TNNPAVEDLFKQLVNVIEKESPEDEKADALENAAKLQEAVNKNDKTRAKRIFNWLPTVV
FT                   QASSVGVEILKLINSQ"
FT   gene            275670..275822
FT                   /locus_tag="GC56T3_0264"
FT   CDS_pept        275670..275822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25331"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI25331.1"
FT                   /translation="MMYLYDDKEKAKMAYERHRCRNCIWAKWQVPYLVCCPFMRCIRMS
FT                   EIDEK"
FT   gene            276143..276505
FT                   /locus_tag="GC56T3_0265"
FT   CDS_pept        276143..276505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0265"
FT                   /product="Protein of unknown function DUF2513"
FT                   /note="PFAM: Protein of unknown function DUF2513; KEGG:
FT                   aat:D11S_1185 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25332"
FT                   /inference="protein motif:PFAM:PF10711"
FT                   /protein_id="ADI25332.1"
FT                   /translation="MERNMDLVRELLFIIEKNDDKKELPIPKDWDREVVAYHLKILEQA
FT                   GFVENYTKWAGNEPLWILASLTWDGHEFLDSIRNNTIWNKTKEGIKGKGLEIASVPLEV
FT                   IKEYAKLQIKALLGLN"
FT   gene            276571..277104
FT                   /locus_tag="GC56T3_0266"
FT   CDS_pept        276571..277104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0266"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25333"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2830"
FT                   /protein_id="ADI25333.1"
FT                   /translation="MTKNKKGRPIKLTPELQEELVKVIRAGNYIETACAYVGINKTTFY
FT                   DWLKRGAREKERLAKNPNARPKKSEQPFVELSNAVEKALAQAEIRDVAIIGKAAEENWQ
FT                   AAAWRLERKFPERWGRRDRLTADLNHSGQVANHGQYEIRVEHNIVSELLEDEEARELIK
FT                   RLIRKRNANKRDSE"
FT   gene            277079..278470
FT                   /locus_tag="GC56T3_0267"
FT   CDS_pept        277079..278470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0267"
FT                   /product="phage uncharacterized protein"
FT                   /note="KEGG: gtn:GTNG_2829 terminase large subunit,
FT                   putative; TIGRFAM: phage uncharacterized protein; PFAM:
FT                   protein of unknown function DUF264"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25334"
FT                   /inference="protein motif:TFAM:TIGR01630"
FT                   /protein_id="ADI25334.1"
FT                   /translation="MLISEILNNLDALEKELAKEDYSVYLEYTHFGRYCPSRHSDLICD
FT                   YLMRVERGEIDRLMIFMPPRHSKSMTVTETFPSWFIGRNPNRRVIEVSYGDSLARRFGK
FT                   ANRQKIELFGEELFGIRLSRDVNSVTSWDVEGHRGGMISVGIGGGITGQGADLLIIDDP
FT                   IKNRKEADSLTYRNMLWNEWQNTLSTRLQPGGRVILILTRWHEDDLAGRLLEHAPERWT
FT                   VVSLPAICDSENDLLGRKIGEPLWPEYGFDEKWAEETKKTVGSRTWNALYQQRPTPPSG
FT                   AIIHRSWFKYYKQAPQMDEYIQSWDFAFKDTNDGSFVVGQVWGRKGADKYLLDQVRAKL
FT                   SFTESIRAIVSLTSKWPQAQAKLIEDRANGTAIINALRHQISGMLSVVPNGTKVERLNA
FT                   VSPQFEAGNVYIPHPSIAPWVHDYVEELVAFPNAPTDDQVDATSQALRYLDRAGTKGTI
FT                   KVDIF"
FT   gene            278489..279931
FT                   /locus_tag="GC56T3_0268"
FT   CDS_pept        278489..279931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0268"
FT                   /product="phage portal protein, PBSX family"
FT                   /note="KEGG: gtn:GTNG_2828 putative portal protein;
FT                   TIGRFAM: phage portal protein, PBSX family; PFAM: portal
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25335"
FT                   /inference="protein motif:TFAM:TIGR01540"
FT                   /protein_id="ADI25335.1"
FT                   /translation="MGKQAVAKAYVLSDGEIIEESTLERYAIKQGESRALPSDRFGGAY
FT                   GELGLVEPLYNLEALAQLLELNPYHYRAVKTKARDTAGLGWYLEAKTNNPSEQQREIAM
FT                   QFLENPNPYKTLTDINNNVMVDYDSIGNGYYEVIRDEDGILIGLEHIPAHTVRVHQDMN
FT                   RFCQIRGTKKVWFKRFGFENDVDYVTGEIVPAGSIPAERRATEIIHIHNYTSRSDYYGL
FT                   PDILPALSAIISDRERAEYNISFFENHAVPAYVVTVTGAELDEQTKQLIRRYFQQDIKK
FT                   NRHSTLVVTAQKPQGDFSDTPVEIKFQALSVETKEASFRMLRADNRDEILSAHGVPPYR
FT                   AGIVVEGSLGGSTARESTEIYKQSVIEPRQDMLENVMNRLLWIGLGVTDWRFRFKDIDT
FT                   KDTQAKIEELRFLFEVGAYSPNMILRELGRDPIDDPNLDRHFIFGQPLDASQEETNAIL
FT                   NSLKQLHAKLIDIATKEGGKHV"
FT   gene            279924..280790
FT                   /locus_tag="GC56T3_0269"
FT   CDS_pept        279924..280790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0269"
FT                   /product="phage head morphogenesis protein, SPP1 gp7
FT                   family"
FT                   /note="KEGG: gtn:GTNG_2827 hypothetical protein; TIGRFAM:
FT                   phage head morphogenesis protein, SPP1 gp7 family; PFAM:
FT                   putative head morphogenesis protein SPP1 gp7"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25336"
FT                   /inference="protein motif:TFAM:TIGR01641"
FT                   /protein_id="ADI25336.1"
FT                   /translation="MCEVCKLLDMDRELVAFLVAHGALPAIKEQDERITEIEEKLARRL
FT                   VSLQVGLESMFIQRLRELGYIPLSILEQETFIADILDPIFADMEEEIAEAAVESAVVAR
FT                   QLTFEEILEQGLELVFTEFSERVLEELRERVYVFSEDTFRRIKGDFRATLIRGYEEGKG
FT                   IDDIAVDLRADFKDLRDHRLQTIARTEVQGAQNVGIFQTMQDYNVRYKQWLTVRDSRVR
FT                   GRNPKDRADHYSLHGQVVRMDERFSNGLMHPLDRSGPIEEWINCRCRCRPYIPTKGEQI
FT                   VRTPYYP"
FT   gene            280858..282261
FT                   /locus_tag="GC56T3_0270"
FT   CDS_pept        280858..282261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0270"
FT                   /product="putative structural protein"
FT                   /note="KEGG: gtn:GTNG_2826 putative structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25337"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2826"
FT                   /protein_id="ADI25337.1"
FT                   /translation="MKHELTAPVTHKNEEKRIVFGPVLVPDEPDSDGDVVTAEKIEEVA
FT                   HKFLEQYGNIDLQHTLNNVGKVVESYILPFDWKVDDELTIPKGSWMMGVRVQDEDVWQA
FT                   VKEGKLTGFSIMGVPKVALKSKEALKRTTLADLEREAGDWVVNAVSLVDEPAVPKAKFV
FT                   AIKSKDNREEAVKKAIQGSYEYIADLLRRKVYQTFDSGSFDSYIYSIFDDSVIIRVEDM
FT                   SSGKTRFFQIGYTINEQGDVEFVGDLQEVRIVENIVPVESPSPQSVAVAAQAALGGAES
FT                   EGQGVTLSSEEKSPQQANKGLFDRLKEKLGLKPSEKAGRKISDANYEKLKAAKEVIDEL
FT                   LRIAEEERANKSKEGDDEVKVEDVQKMIDDSLKPVNDKLSEIMNTLKGAAPENEPQEPQ
FT                   NEEDGLQDEAAAKSEDDSYKEKYEQVVKQLDELKRKIPFSKRLTGQDGAEKAKPQDEHD
FT                   RDPFGFKRK"
FT   gene            282304..283221
FT                   /locus_tag="GC56T3_0271"
FT   CDS_pept        282304..283221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0271"
FT                   /product="structural protein"
FT                   /note="KEGG: gtn:GTNG_2825 structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25338"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2825"
FT                   /protein_id="ADI25338.1"
FT                   /translation="MMTNDMLLGKLDNVLKAITTTDLGAARLAPAKQQLFVRTVSQATR
FT                   ILDEARRIDMTSHTHDIDRIAFGSRILQAATEGEAPTGEAKPEFSTNKLESVEVIGVSG
FT                   ITDSTLEDNIEREGFEDTLIQLIAERVGVDLEELFLNGDKASSDPFLAKTDGWLKKAAN
FT                   LVQGTTDFDPTNVEAMFDAMIQALPKKYLRDRSQWRFYVHWDIEDAYRDVLRARGTGLG
FT                   DTAQTTATQLAYKGIAVVDSANMPAGTALLVNPANLVYGIYRDIRIEPDRQPKLRRTDF
FT                   VTTLRVDCNFEDENAAVVGQGYTG"
FT   gene            283236..283595
FT                   /locus_tag="GC56T3_0272"
FT   CDS_pept        283236..283595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0272"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2824 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25339"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2824"
FT                   /protein_id="ADI25339.1"
FT                   /translation="MKTLRVVNKGRKTRYRLGIEFPPNQPVEITVGNREYLTVKAVRDF
FT                   EVEIIEKDDKSETKHRHESAKTAGNSLDVQSMTIDEVLEAVKEGKISVDEALSQEKAGK
FT                   NRSRLIDKLEALKEA"
FT   gene            283602..284024
FT                   /locus_tag="GC56T3_0273"
FT   CDS_pept        283602..284024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2823 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25340"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2823"
FT                   /protein_id="ADI25340.1"
FT                   /translation="MPLFEKPVTEVVTPQDVRNLTGVSAEYFRFPNATDPEAALDDLLS
FT                   TWIERIASHIHARLKRTVLETDDDYLAIQDVLLRTVAKVVAVAQQQRSSPIIQIDDFAV
FT                   SILNTSDVTKDLGTELRPFMKQSIDVFLSSDDFVEA"
FT   gene            284030..284455
FT                   /locus_tag="GC56T3_0274"
FT   CDS_pept        284030..284455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2822 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25341"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2822"
FT                   /protein_id="ADI25341.1"
FT                   /translation="MFDAEIRMDDLRRLIPRMRAALNRATELTALEVWGNLMEFSPQDH
FT                   GRLAGSWKLQKRNARFYTVGTNVEYALVQNYGSGPYEIYPRRAKALRFEVNGEVVFAKK
FT                   VKHPGIKPKRFIERSIAAAERRIDDFVEQALREVKLI"
FT   gene            284452..284895
FT                   /locus_tag="GC56T3_0275"
FT   CDS_pept        284452..284895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2821 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25342"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2821"
FT                   /protein_id="ADI25342.1"
FT                   /translation="MIQRKPLKDIHKEIRTKIREVLEQAPELTEIKRIVYGDKVRVGTL
FT                   HTPAIWIVPEPYAPNLLGGHTADHDIRFDFVVLVKANDPEQALEKAHDLALTVYDVLMQ
FT                   DRTLGGTVADVRPTQIDPAYEMGNNTQVCWSAVQFDFRVKRRE"
FT   gene            284897..285109
FT                   /locus_tag="GC56T3_0276"
FT   CDS_pept        284897..285109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0276"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppa:PAS_chr1-1_0437 Ubiquitin-conjugating
FT                   enzyme involved in ER-associated protein degradation"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25343"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI25343.1"
FT                   /translation="MAKVPKYIGKGEGGAGVAQLPAIFYDLIDDLNELRNKQIALLQKL
FT                   DADAGTADTDYAAVLTPAPLKTVKE"
FT   gene            285121..286071
FT                   /locus_tag="GC56T3_0277"
FT   CDS_pept        285121..286071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0277"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2819 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25344"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2819"
FT                   /protein_id="ADI25344.1"
FT                   /translation="MAITRYLMIGEETEFGVEAAQYAETLDPESVSIEPAEDDKLIYEG
FT                   ISGLDRVAQLGVYSTGGAITLPLDDKATGWFWKWALGGYEVTGDAATGYTHTFYPARNA
FT                   LMPSFSAKVGKDIMEHVFLGNVIESLELEIENEWALLTVNTLGASDKRAPLATNVQFTE
FT                   GNVFTAPMAALEKNGADMSASVNSLTLTVETGADIESAQGFGSRFPKKAFMGSMVVTLE
FT                   VALGFDSDQELIAFWGGADGPSTDTLQEFSYTLHLGNNLDIIFPRLIYTASSQPVEGRE
FT                   GIVQTVTARALFDQLTGTGPIQVSLTNNKASYTVA"
FT   gene            286141..286569
FT                   /locus_tag="GC56T3_0278"
FT   CDS_pept        286141..286569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0278"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2817 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25345"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2817"
FT                   /protein_id="ADI25345.1"
FT                   /translation="MAKKLTAGVLNGTAYQETLTVTWNGEEFEVDIRPLNNKEAMEIEE
FT                   LLQEGVAVKGTPTLKGKMTQTIQFDTKANLRGRKRAAIKAVAYGTVDPMITEQVVENEF
FT                   PPKLVDEIAARIYELTGIGNKQQIQEAVENDEDSFPQS"
FT   gene            286762..289458
FT                   /locus_tag="GC56T3_0279"
FT   CDS_pept        286762..289458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0279"
FT                   /product="TMP repeat-containing protein"
FT                   /note="PFAM: TMP repeat-containing protein; KEGG:
FT                   gtn:GTNG_2814 prophage LambdaBa01, membrane protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25346"
FT                   /inference="protein motif:PFAM:PF05017"
FT                   /protein_id="ADI25346.1"
FT                   /translation="MANVVEIEVRGTDEISKVLQRVSKTAEKAFRDVEAAIESIPDLDI
FT                   DVATEAVQNAKRHLEEIENKVKSLPQANVKVNAQTEEATGKVQGFLRTLRSIPRKVTTH
FT                   IEAQTNQVREQMDRLAETFQNFAIIGRTMVGGGLTAFLPALIPTISSLTVTVGGLGTAF
FT                   ASAGAGAAAFGSVAVTALNDVFEANEKLSDLQEKLNKTTDAKKQQKILQEMRAVVDGLS
FT                   SSQQKALSSLQKFLDFWDEFTAKFQAPVVEIFARSLEQIQSVIKALEPAFNGAVSAVDR
FT                   LSASLSKGLKSEPVERFIGFLNQNAGPMLQTFGKIAGNVIMGLMNIFVAFGSVGSDLAD
FT                   RLLKASESFVQFTSNLENNQGFQNFINYAMANLPNVIAFIGELIKFIINFSIALAPIGQ
FT                   TVLQVANSFLAWLSSITQNHQWIAQLIGVLVVMSGLITALSPLVLGMMSIFRGLGSVWN
FT                   WIVPIVKNLNLSIGTRLFLAFTSVGSAMSRVIPLILKVGSFLLRLANPVTLVISIIAAL
FT                   AIIIYQNWDSIKAYLAQVWNYLSSLAQTIFNMLGAFFSQVWNSVKSVSITVWNAIKSAL
FT                   STAWNTIKTVASTVFEAIKTAISNIWNTIKSVTSTVWNAIKSALTATWNGIKSAVSAVF
FT                   NAIQTVISTVWNAISTVTTTVWNVIKSVLFTLLNNLKRDFNNVFNFIQTIVSTVWNAIR
FT                   SVTSSVWNGIKSAISSVINGIRSGISSAFNSIRSIISSVWNGVKSATSSAWNSVVSSVR
FT                   GAVNKVIDFINRMINSINSVRIPIPKIPDWVPVIGGRGGGSIGFNIPNIPRLATGGVVD
FT                   EPTLAIVGDAGAGNPEIVAPQRMLRSIIREELQNSGAQGAEQIQVVVPVVLDGREIMRV
FT                   VTPYIDRELGQRRIGKMRANGIGGSVL"
FT   gene            289455..290204
FT                   /locus_tag="GC56T3_0280"
FT   CDS_pept        289455..290204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0280"
FT                   /product="phage tail component"
FT                   /note="KEGG: gtn:GTNG_2813 hypothetical protein; TIGRFAM:
FT                   phage tail component; PFAM: tail component family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25347"
FT                   /inference="protein motif:TFAM:TIGR01633"
FT                   /protein_id="ADI25347.1"
FT                   /translation="MITYDGFDLSPYLLVRDIGRPLMPPQEITSMSIAGRHGAYFLEKR
FT                   HQSVVIPVEVVIFEHLDMSYFELKRFLAGKLNKSEPKPLIFDDEPDKYINAIIQDQTEI
FT                   DDLIRSGQGTLNFFCPDPFYYAIEDEVFEFSGAGVYVINRQKGNEYSEPLIEIQGTCSG
FT                   GSIGVRTPFTSVRFSGTLQQGETLVLDSQLVTSYIVDGYGNKRSANQHLDSMDFPFLDI
FT                   EENEVEFFTEGNATIQKATVYARSRWI"
FT   gene            290220..291284
FT                   /locus_tag="GC56T3_0281"
FT   CDS_pept        290220..291284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0281"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2812 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25348"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2812"
FT                   /protein_id="ADI25348.1"
FT                   /translation="MAQTPYRDLTSQDILAAHISGLQHDINKMQAVLEMQTAQETGHVL
FT                   TPVADQDDPTIRYRIYEGTIRNWLDNPAPVIYRNGVQVDPSEYEISPAHGVVVFHNQQN
FT                   LNDTIAADFTYITNVSAWRQSVEGSIGSIPSLQQAVDQHSLLLANNPAGVEPFYPLSGT
FT                   YVSHFRRDYNPLNADGTANVNSHVPAFRILVYGNTIDAFPFPVPTKTRFGKAAMKLNSA
FT                   STDVSLRIGIYRDNGLRPSELLFQSPVITIPAAGGWGMVDINLELEPGFYWIARHDGAT
FT                   AYYDGLNQVSAIPIVKFDAQTFLQDLSPRPNPHTFYGGYRATNIPFGDMPSTFPASGAL
FT                   FQRSSYCSPWLVVA"
FT   gene            291295..292788
FT                   /locus_tag="GC56T3_0282"
FT   CDS_pept        291295..292788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0282"
FT                   /product="phage minor structural protein"
FT                   /note="TIGRFAM: phage minor structural protein; KEGG:
FT                   gtn:GTNG_2811 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25349"
FT                   /inference="protein motif:TFAM:TIGR01665"
FT                   /protein_id="ADI25349.1"
FT                   /translation="MLKYNQLRVGRYNILGKIRYNSQPPQRQQPLYNRLSNALLVVYDQ
FT                   NGNRLGVLENADDPILEQEIGSVDTLTFSLPYNDPKREYIQNENIVEVVNQRYFIRDVS
FT                   KVRAGGRLELVVYCEATWYDLQYTEPMKALSWQDATPEQIMADILDGTGWTVGRVEVTE
FT                   RRNLQLEEGLTNRLKALRELPNVFTGELWFNTSNNTVDFLRPEGRDSGASIVYRKNMKE
FT                   IEVNYSTKNLVTKLYLYGKNNMTIEDAHPEGLPYIENYQYTTKKKVMVVKDERFTNPFH
FT                   LYERGVYALSILSRPTASYVMKVADLSRMSGLSHEQFALGDNVFVYDKELGINEKKRIV
FT                   RWKYNIKKPWESEVELERPQPTLSDLLSGVQEAASVLESEDTVDRQDLLNLSVFNYLMN
FT                   SRADDGFNYWTNSGWEIDPVNGYSGNASFKATAEEGKTKTLKQIVYPSHRDSYSISMRV
FT                   AAENLQVGRGRVGVYIRIKYADGTEDEPIWLSLAGGETI"
FT   gene            292785..292982
FT                   /locus_tag="GC56T3_0283"
FT   CDS_pept        292785..292982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0283"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2810 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25350"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2810"
FT                   /protein_id="ADI25350.1"
FT                   /translation="MMFQLLNQVIEVKNPDRGVSAIEIEFVVENCQSGQVNVTDIMLQS
FT                   GSIATLWKGHPSETRWSLDG"
FT   gene            292987..293784
FT                   /locus_tag="GC56T3_0284"
FT   CDS_pept        292987..293784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25351"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2809"
FT                   /protein_id="ADI25351.1"
FT                   /translation="MNKGDWTRFLATLTKFQRKKVDHIEFELVAENLRRGAIRITDLQL
FT                   QEGEQATASIPNTAEWFQPAYGTLDETSTAVGGDVYLGDQPRVFENVKNRFYNIVGRGH
FT                   EAIIVPNVYETDFSRQLTTTVVDITLYAKNDFDLLRISTNYGDYVDEYERVYPDEPEHP
FT                   LNKRYSREFFFEGGAAGSEIRLWGSRNEASINGVPANRASRSLPVGNGTLKIRRQLFMG
FT                   LPYGSNRIRIEFYKLVNGKMQDVGIGYWGVVELIQWQEGKSKP"
FT   gene            293781..296672
FT                   /locus_tag="GC56T3_0285"
FT   CDS_pept        293781..296672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0285"
FT                   /product="glycoside hydrolase family 18"
FT                   /note="PFAM: glycoside hydrolase family 18; KEGG:
FT                   gtn:GTNG_2808 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25352"
FT                   /inference="protein motif:PFAM:PF00704"
FT                   /protein_id="ADI25352.1"
FT                   /translation="MIKLLSWSLNEPSNAEFEQYAREVSTGLWEIIDPNAWKNWGGDQR
FT                   NFWYAFLEHHDKIHAFGLHDFGVLADGSIYHYKAGESYPVLTDDESGIRYWMRDSLRFL
FT                   VDHYPSIKWSLQMVCFNESRVEPMLDNVNNAQDTFIRQLRKIAELYMNRFPNRIKGIEM
FT                   DFEKSSSRSRSYQEAEKYRDLLVRVKNEVCIPLGLELRVNLHAMTGDFEPYWYQWTDYR
FT                   TVASGRDLNGNQAIDEFQIMSYDFSSGNTAPGASTPLWWLEQVLDHVRNVLPPEKVYVG
FT                   TAAYGRRWQLNEKRTGTIVRYWQLLQWQNGLFKHNAGSRNENDEFVWYNQSFIPYAGFH
FT                   DEESSYEKTYLHVYDRFAVQFATLKTFNDQTVIFRDTYNGQDYITSYSKHQRAKFTGIK
FT                   KILNDVTSRMGNTRTGTTWTPRDTLSGYTFYGYSAHSAVYNYNKDLNTCEPAEGNEGQD
FT                   GRLYYSFTLPEAGSYRLIAVVYFPYLNPRIPISVNGQGFVIGEKGNQPEWYPFYVNPDR
FT                   HFYDCDVFSFGTSNTIEVGICEDDAQILGFIVCEAFEHGMSGGEVEYRVNLQPAWKRGE
FT                   VTNGIVSKVQAAFPANMTITGELLRRPPRPAIIWEDMFGPHVRSGITDLAKTKYYLHVD
FT                   PNYVPPGATPDPNLQRCVGAPVSRGYSFGSWRPYAATSTEEAHVFADTRTQSMQLIVNR
FT                   QYEMNAHIEADLRADVNDRNAVYGIRFCADQAGQIGRGYAFVADHRAGRFYLKYESGGN
FT                   SQVLASAPLTLTLGQRYTFKVRVYGNHIKCMVGNTEVIDYPSTQTFPAPPNKGAHGVYA
FT                   SGCRVKCYRLQIATNDRYEPMEKVAAIIDGVEHVALEETRPYSYDELGYLVYSGFDPDE
FT                   GLGIKISNDYENLPIVTVPSWQGEKTIRIRMADAGVWLRNFYVGDSEGYSIAWNGDLES
FT                   FIKAAEYTMRYGCKGVAMWTIGQEDPRIFTYIP"
FT   gene            296687..297040
FT                   /locus_tag="GC56T3_0286"
FT   CDS_pept        296687..297040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0286"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2807 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25353"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2807"
FT                   /protein_id="ADI25353.1"
FT                   /translation="MGISPHDGNGVTITLREIYDSLNGVSSSLDRLEQRIIRLEEKTSM
FT                   ASEADERSRNALKKAEEAFQKASEALVLIQEKEAEKKEFKKMWFSAILTAITPWLLGFL
FT                   FALIYLVQKGGEL"
FT   gene            297040..297234
FT                   /locus_tag="GC56T3_0287"
FT   CDS_pept        297040..297234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2806 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25354"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2806"
FT                   /protein_id="ADI25354.1"
FT                   /translation="MKDWKKIIGYFIPIVALVIANIVKVDDPSQIEGALEIIVSGVFGL
FT                   LAAIGVYKNNDKSDEKDKK"
FT   gene            297234..297614
FT                   /locus_tag="GC56T3_0288"
FT   CDS_pept        297234..297614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bay:RBAM_020310 YqgA"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25355"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI25355.1"
FT                   /translation="MGKGGWNMPCSDIMMPHVVCTDASYYTENATSIDVTVSYQGGGIA
FT                   DPNGDGFIAPTWDYVLALEIYDGYWKAVELQSGYYRHQTPVKKFYLAGKKEGRYRVRLY
FT                   YQARENEEYTGVVTTYSFMVYR"
FT   gene            297720..298538
FT                   /locus_tag="GC56T3_0289"
FT   CDS_pept        297720..298538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0289"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tet:TTHERM_00533920 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25356"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI25356.1"
FT                   /translation="MGKLAFGLLAAVVLGIGFFVMSDKDAQSAKPASNTQQSKWEQKEQ
FT                   LTVGIDPHDHPEYKSNFELYFAHLNSAVLVDKANVDNGGKTLSNEDYKRILNDIRKNLD
FT                   NIKYDGEKKDELNKVKKLVDQAIQNNAIKGDEIFYEIHQIIHELDKHFNTTYFVDEVSN
FT                   KQSEASFFIEKSEFDDVYKWLASTKRDLHSDKYDPFRDREEFLVHIAHASYAYSRHFYN
FT                   LEDDIFMKMKLSELIKLFGKMKNESDSRKYNEYIEQFDAIYDEIQKERRL"
FT   sig_peptide     297720..297788
FT                   /locus_tag="GC56T3_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.877) with cleavage site probability 0.860 at
FT                   residue 23"
FT   gene            298590..299312
FT                   /locus_tag="GC56T3_0290"
FT   CDS_pept        298590..299312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0290"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="KEGG: gtn:GTNG_2805 N-acetylmuramoyl-L-alanine
FT                   amidase, sporulationmother cell wall hydrolase; PFAM: cell
FT                   wall hydrolase/autolysin; Sporulation domain protein;
FT                   SMART: cell wall hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25357"
FT                   /inference="protein motif:PFAM:PF01520"
FT                   /protein_id="ADI25357.1"
FT                   /translation="MADFVQVIDPGHGGHDPGAVANGLREKDLTLKIALYTRDYIHELY
FT                   EGVKVYLTRDKDVFVSLSDRAAFANRLNADHFCSIHINAGGGEGFESYIYNGSYSSKPK
FT                   TQALRNVLHDTIVAETKFVNRGKKEANLAVLRETRMSAVLTENGFIDNKNDADFLKSDD
FT                   SLRKIALAHAHGLAKAHGWKAKAKPTLEAKPVPKPSDGGKVFYRVVAGSFADRENAEKR
FT                   VRELKEKGLDSFIDVYRA"
FT   gene            299379..300149
FT                   /locus_tag="GC56T3_0291"
FT   CDS_pept        299379..300149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oih:OB1017 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25358"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI25358.1"
FT                   /translation="MKLYKPMIGMLVAVLLSGCSDSPEKESKEPDKPKAEQTEQERNTK
FT                   QDSQREEQSKEKGTRNEEQSSKQEDRSENQQSKNAEYEAIRSYVGQKVNWKPGVKESIQ
FT                   KFVRDHHQFYEDTLTYGRIKNVNWEQQKKHADALIKEAKAIIPEITEQIKTMEQNNLLD
FT                   IVSIDDDPRDLKLDFEVLEVVLEIATSQKDTTGLVYAHRILHDLDVELNGTKTHKFGMS
FT                   SYYHGGENRPELWKYIEKNGRERPLSWNEQKSKR"
FT   gene            300156..300716
FT                   /locus_tag="GC56T3_0292"
FT   CDS_pept        300156..300716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_3124 peptidase S1 and S6,
FT                   chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25359"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI25359.1"
FT                   /translation="MNIVAINMSGQSIPVYRLDGYTGEKTRIGTIYPHELYGLNYLAGG
FT                   DYVYFDILFRNSSGSLQWGTIIEPPESARENAYRSKYSYGTITKNGKTYYTFKMTRTEN
FT                   LYSVSGRKIGSVAAGQYVATIADPSSGDTNPHWLQVYFARSTSGVWDSLAADGASYGFV
FT                   NIGLEDGSMYNTVSCDGLWSKYF"
FT   gene            301333..302703
FT                   /locus_tag="GC56T3_0293"
FT   CDS_pept        301333..302703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0293"
FT                   /product="fumarate hydratase, class II"
FT                   /note="KEGG: gyc:GYMC61_1120 fumarate hydratase, class II;
FT                   TIGRFAM: fumarate hydratase, class II; PFAM: fumarate
FT                   lyase; Fumarase C-like"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25360"
FT                   /inference="protein motif:TFAM:TIGR00979"
FT                   /protein_id="ADI25360.1"
FT                   /translation="MNERIERDSLGEVRVPADKYWGAQTERSRQNFRIGKETMPLELIY
FT                   AYAELKKAAAIVNHRAGKLSEAKQRAIVAACEEILAGQWDDHFPLVVWQTGSGTQTNMN
FT                   VNEVVARRASELLDEGEGRIHPNDDVNMSQSSNDTFPTVMHIAIFTKIQTHLLPALDGL
FT                   IGTFATKERQYGKTIKIGRTHLQDATPLTFGQEISGWRAMLEKSKAMIMEASEKLLDLA
FT                   IGGTAVGTGINAPPGFGEQVAEQLKTQTGYPFRSSTNKFHALTSHDEIVYVHGALKALA
FT                   ADLMKIANDIRWLASGPRSGLGEITIPANEPGSSIMPGKVNPTQSEAMTMVAVQVFGND
FT                   ATIGFAASQGNFQLNVFKPVIAYNAIQSVQLLGDVIRSFDERCAQGLEANEAKMKEYVD
FT                   RSLMLVTALSPRIGYDRAAEIAKLAHREGLTLKEAALKTGYVTAEQYEEWVRPEKMI"
FT   gene            302894..303850
FT                   /locus_tag="GC56T3_0294"
FT   CDS_pept        302894..303850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0294"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; KEGG: gka:GK0251 methanol dehydrogenase
FT                   regulatory protein (MoxR protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25361"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ADI25361.1"
FT                   /translation="MTINEPLLSPLEQVVRNIEQVIVGKRNVIVLSLTALLAKGHVLLE
FT                   DVPGVGKTMLVRALAKSFSAELKRIQFTPDLLPSDVIGVSVYNPKERQFEYKPGPIVAH
FT                   IVLADEINRTSPKTQSALLEAMEEGSVTVDGVTRALPQPFFVMATQNPIEYEGTYPLPE
FT                   AQLDRFLLKLHMGYPSPDEEIEMLNRLEKTAPLAEIGPVMSLDELLALQRKVADVHVSD
FT                   TVKRYIVDLIQQSRQHEAVYLGVSPRGSAALMKAAQAYAFIHGRDFVIPDDVQQLAPYV
FT                   LAHRLLVRPEAKWDKFDAETIIGQLIARTPVPVPGRR"
FT   gene            303847..305028
FT                   /locus_tag="GC56T3_0295"
FT   CDS_pept        303847..305028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0295"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   gyc:GYMC61_1118 protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25362"
FT                   /inference="protein motif:PFAM:PF01882"
FT                   /protein_id="ADI25362.1"
FT                   /translation="MSMRGKWNGRRWPAFLRLLILAAVLFSYAMFQGGFVSWFLFYSFL
FT                   PFGLYAFLVAMYPLRRAAVSRTVPARRYHAGESIPVMVRIELPWAVPLAALAVAEEGWK
FT                   HGGEMIAIAWPFRRHLSCTWPLSLPRGRHQLEAVRLEARDVFGWVNKTASFYAPCTVIV
FT                   YPRYIEWPPEMVCEWFAQGKAARTLAYRRDMAVAAGAREYVPGDKMSWVHWKASARRQE
FT                   LMTKEFDEQRNDDWIVVLDGAASPWFEELVTLAVSVSKALIDEGVPVGLFVAGKERSFL
FT                   APRRHDGQWQSILLRLAEVDVGGQEPLAHVLAEEANWRTAAGCIIVTSALSAQLAGQLR
FT                   AMAPKRHIVLYVVNREWGEDERNWADRLRRSGVYVSRIDPQALQTVRQGGGDG"
FT   gene            305025..307187
FT                   /locus_tag="GC56T3_0296"
FT   CDS_pept        305025..307187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0296"
FT                   /product="transglutaminase domain protein"
FT                   /note="KEGG: gka:GK0253 hypothetical protein; PFAM:
FT                   transglutaminase domain protein; SMART: transglutaminase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25363"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ADI25363.1"
FT                   /translation="MRPLGANMLSTVLPNALAAWLLTEWLWPLEAVTDTAHIGVFVSFV
FT                   ALCFGLHLLRVPIWLSALGKMVYIWWALSRLFSFASIAALPYALWRDSTVWLSGDWSSM
FT                   PGDALRTFVFFLLLWAVSFLLHWLIVRRNRWFVPYALTVGYIAVLDTFLPYSGNGAILR
FT                   LVALGFFAFVWLQGEELQAKAPSFRIGKWRAAALFIPAVALAVGYAGPKLPPQWPDPVA
FT                   FIRSYHAQPEETNDDSPSPGVAKVGYGQNDSRLGGPFIADDTVVFIAKDQGRHYWRVET
FT                   KDIYTGKGWEAFQSEQVQSFGNGELIRYEWWSDKVKTVEQTAEITRQDQAFHLVYPLGL
FT                   QQVQTSDHIVYRMHMATEKIYTSDQNANALPIRQYMLTYMEPDFPIEALRAAPPVQDPP
FT                   FLKRYTQLPETLPQRVRELAKQITDGKETVYDKVKAIEQYFHLNGYTYETTDVAVPRPD
FT                   QDYVDQFLFETKQGYCDNFSTSMAVLVRTLGIPARWVKGYTSGRLVGEQDGQSVYEVRN
FT                   NDAHSWVEVYFEGIGWVPFEPTQGFVNPYAFSLAASNPEEPEPQLQPEERETPHVPLDQ
FT                   LLEQPSTAQGEHWWEKLADVWSWKMGLTTLVVLAVLGGAAYATRRKWWPRFTLFRFRRR
FT                   KLDGAAWLISAYGALLRHLQDYGLKRRPHETLRQYAAEVDRLFETDEMNRLTKLYERAV
FT                   YGTGIKEANVREAVELWENLIKRTIS"
FT   gene            307391..308923
FT                   /locus_tag="GC56T3_0297"
FT   CDS_pept        307391..308923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0297"
FT                   /product="GMP synthase, large subunit"
FT                   /note="KEGG: gyc:GYMC61_1116 GMP synthase, large subunit;
FT                   TIGRFAM: GMP synthase, large subunit; GMP synthase, small
FT                   subunit; PFAM: GMP synthase domain protein; glutamine
FT                   amidotransferase class-I; tRNA methyl transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25364"
FT                   /inference="protein motif:TFAM:TIGR00884"
FT                   /protein_id="ADI25364.1"
FT                   /translation="MNQEMIVVLDFGSQYNQLITRRIREFGVYSELHPHTIRAEEIRAL
FT                   NAKGIIFSGGPNSVYDEQAFTCDPAIFELGLPILGICYGMQLMAHHLGGKVEKATHREY
FT                   GKALIQVKNDSLLFHGLPDEQVVWMSHGDLVTAPPAGFAVDATSPSCPIAAMSDERRKW
FT                   YGVQFHPEVRHSVYGNDLLKKFVFEVCGCRGDWTMENFIDEQVRRIREQVGGKKVLCAL
FT                   SGGVDSSVAAVLVHRAIGDQLTCIFVDHGLLRKGEAESVMKTFREQFQMNVIKVDAKDR
FT                   FLAKLKGVTDPEQKRKIIGNEFIYVFDDEAAKFEGIEFLVQGTLYTDIIESGTATAQTI
FT                   KSHHNVGGLPEDMKFELIEPLNTLFKDEVRALGTQLGIPDEIVWRQPFPGPGLGIRVLG
FT                   EVTEEKLEIVRESDAILREEVKKAGLDREIWQYFTVLPDIRSVGVMGDARTYDYTVAIR
FT                   AVTSIDGMTADWARIPWDVLERISTRIVNEVPHVNRVVYDITSKPPATIEWE"
FT   gene            309214..310539
FT                   /locus_tag="GC56T3_0298"
FT   CDS_pept        309214..310539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0298"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   gyc:GYMC61_1115 xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25365"
FT                   /inference="protein motif:PFAM:PF00860"
FT                   /protein_id="ADI25365.1"
FT                   /translation="MRKYFQFDELGTNYRTEMIAGLTTFLSMAYILFVNPFTLSLGAVK
FT                   DFPDELRIDQGAVFVATALAAAYGSILMGVLARYPIALAPGMGLNAFFAFTVVLHMGIP
FT                   WQTALAGVFVSGVIFTILSLTGIREKIIDAIPVELKYAVSAGIGLFITFIGLQNAGIIV
FT                   DNKATLVGLSSLKDGNTLLAIFGLFITVVLMVRKVNGGVFYGMVITAIVGMIFGLIKVP
FT                   HQIVGAIPDISPTFGVAIKHLPDIFSWKMLGVVLTFFIVDFFDATGTLLAVANQAGLLK
FT                   NNKLPRAGKALLVDATAVMVGAVFGTSTTTSYIESSAGVAAGGRSGFSAVVTGILFLLA
FT                   LFFSPLLSVITAPVTAPALIIVGVLMASSIGEIDWKKFEVAVPAFFTLITMPLSYSIAT
FT                   GIAVGFIFYPITMILKGRGKDVHPLLYVLFVVFICYFVFLRE"
FT   gene            310622..310999
FT                   /pseudo
FT                   /locus_tag="GC56T3_0299"
FT   repeat_region   311038..312742
FT                   /note="region with at least 95 percent identity another
FT                   region of the genome"
FT   gene            complement(312743..312802)
FT                   /pseudo
FT                   /locus_tag="GC56T3_0300"
FT   gene            complement(312892..313392)
FT                   /locus_tag="GC56T3_0301"
FT   CDS_pept        complement(312892..313392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0301"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: gyc:GYMC61_1122 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25366"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1122"
FT                   /protein_id="ADI25366.1"
FT                   /translation="MIYIKGGIVVLWIIIQFGLAAILLLFSTLAAWYEGSAILDNPWEW
FT                   KHSTPFSQMMYGQVHSKSHISQLDYFVYSAKFHPFFPIIMAISSLYLLILIGYYFLKPQ
FT                   NKKFACFLFILGGGLFLLGCFFMDSTTTGGKIFFYIWLVSGSLCTATAITTYFQVLNHN
FT                   PRR"
FT   gene            313490..313630
FT                   /pseudo
FT                   /locus_tag="GC56T3_0302"
FT   gene            313776..314339
FT                   /locus_tag="GC56T3_0303"
FT   CDS_pept        313776..314339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0303"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25367"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1124"
FT                   /protein_id="ADI25367.1"
FT                   /translation="MRMMKKIHHIIITLATILLFIFESNAVNAQVNDQAINRDKAPRVE
FT                   IYDENNNLIKTINLEEKSIETDDPKTKSIIAEQTVTAQSIKKYSFGNTTFSNYVWINGG
FT                   YYFYNPGIFEFELINRPEAVAVEVYKLGQVYTGKVVWRDVAGWAALDWRDTTLVKHPGS
FT                   YAFRFKNDGSGTVQIKHGNLKYNY"
FT   sig_peptide     313776..313865
FT                   /locus_tag="GC56T3_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.879 at
FT                   residue 30"
FT   gene            complement(314360..314467)
FT                   /pseudo
FT                   /locus_tag="GC56T3_0304"
FT   gene            314515..315719
FT                   /pseudo
FT                   /locus_tag="GC56T3_0305"
FT   gene            314658..315189
FT                   /pseudo
FT                   /locus_tag="GC56T3_0306"
FT   gene            316261..316377
FT                   /locus_tag="GC56T3_R0050"
FT   rRNA            316261..316377
FT                   /locus_tag="GC56T3_R0050"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 67.32"
FT   gene            complement(316632..317075)
FT                   /locus_tag="GC56T3_0307"
FT   CDS_pept        complement(316632..317075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0307"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   gyc:GYMC61_1128 small heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25368"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ADI25368.1"
FT                   /translation="MAKENPFTPFSDWTKHWQQFFQNDFWGSIQPLLPSSNKPSSGMNI
FT                   YKKDNELLVVISLPGLEKIEDAEVYVSYKTLEVKATINLNFKGFELVEEGLFQGQFQKT
FT                   IPLPFAVKEDRIEATYHNGLLFIHLHRLIPDEPKKKIVIKKSE"
FT   gene            317437..317925
FT                   /locus_tag="GC56T3_0308"
FT   CDS_pept        317437..317925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0308"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit; KEGG: gka:GK0257
FT                   phosphoribosylaminoimidazole carboxylase catalytic subunit;
FT                   PFAM: 1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate
FT                   (AIR) carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25369"
FT                   /inference="protein motif:TFAM:TIGR01162"
FT                   /protein_id="ADI25369.1"
FT                   /translation="MSPLVGVIMGSHSDWETMKHACAILEELGVPFEKKVVSAHRTPDE
FT                   MFRYAETAEERGIRVIIAGAGGAAHLPGMIAAKTTLPVIGVPVQSKALNGLDSLLSIVQ
FT                   MPGGVPVATVAIGKAGATNAGLLAASILGLLEPRYMEALKARREAIRKQIVESSDQFD"
FT   gene            317918..319066
FT                   /locus_tag="GC56T3_0309"
FT   CDS_pept        317918..319066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0309"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   ATPase subunit; KEGG: gyc:GYMC61_1130
FT                   phosphoribosylaminoimidazole carboxylase, ATPase subunit;
FT                   PFAM: ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25370"
FT                   /inference="protein motif:TFAM:TIGR01161"
FT                   /protein_id="ADI25370.1"
FT                   /translation="MTKQRIVPGQTIGIIGGGQLGRMMALAAREMGFRIAVLDPTPDSP
FT                   CGQVADVEITAPYHDLDAIAELACVSDVITYEFENIDARALEWLEANAYVPQGSRLLAV
FT                   TQDRALEKAAIVDASLPVAPYVEVNGAEELEQAVQTIGFPCVLKTRRGGYDGKGQYVLR
FT                   GEGDLAKAADLLGLGPCILEGWVPFVKEMSVIVARNLDGETAVFPVAENIHIENILHQT
FT                   IVPARIPESVQERAIRYAEVLAASFSLVGTLAVEMFLTADGDIYINELAPRPHNSGHYT
FT                   INACATSQFAQHIRAVCNWPLGSTELLKPAVMVNILGEHVEPVIRHIGAFDGGTYVHLY
FT                   GKHEAKPKRKMGHVTVLADDVEAALARIESWQIWHDRRLERG"
FT   gene            319063..320358
FT                   /locus_tag="GC56T3_0310"
FT   CDS_pept        319063..320358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0310"
FT                   /product="adenylosuccinate lyase"
FT                   /note="KEGG: gyc:GYMC61_1131 adenylosuccinate lyase;
FT                   TIGRFAM: adenylosuccinate lyase; PFAM: fumarate lyase;
FT                   Adenylosuccinate lyase-like"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25371"
FT                   /inference="protein motif:TFAM:TIGR00928"
FT                   /protein_id="ADI25371.1"
FT                   /translation="MIERYTRPEMGAIWTEENRFKAWLEVELLACEAWAELGVIPKEDV
FT                   RRLRENASFDVNRIKEIEEETRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTALGY
FT                   LLKQANAILRRDLENFIQVLKEKAREHKYTVMMGRTHGVHAEPTTFGLKLALWYAEMVR
FT                   NLERFEQAAKMVEVGKISGAVGTYANVDPFVEQYVCEKLGLTPAPISTQTLQRDRHAYY
FT                   MATLALIATSIEKFAVEIRGLQKSEVREVEEFFAKGQKGSSAMPHKRNPIGSENMTGMA
FT                   RVIRGYMVTAYENVPLWHERDISHSSAERIILPDATIALNYMLNRFANIVKHLLVYPEN
FT                   MKKNMERTFGLIYSQRVLLALIDKGMTREEAYDLVQPKAMEAWERQVPFRSLLEADERI
FT                   MSRLTKEELDDCFDYRHHLKHVDTIFARLGLE"
FT   gene            320434..321162
FT                   /locus_tag="GC56T3_0311"
FT   CDS_pept        320434..321162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0311"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   KEGG: gka:GK0260
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25372"
FT                   /inference="protein motif:TFAM:TIGR00081"
FT                   /protein_id="ADI25372.1"
FT                   /translation="MPTKQQLLYEGKAKKIYATDEPDVLWVEYKDSATAFNGEKKATIA
FT                   GKGRLNNEISSLLFLKLREAGIANHFIEKLSPTEQLVRRVTIIPLEVVVRNVVAGSLAK
FT                   RIGLEEGTPLEAPLVEFYYKNDDLGDPLLLEDHIFILKLASREEVAALKQAALAVNDVL
FT                   RLHFAERNVRLIDFKLEFGRTADGAILLADEISPDTCRLWDAKTNEKLDKDVFRRDLGS
FT                   LTDAYEVILQRLGGESACTK"
FT   gene            321150..321404
FT                   /locus_tag="GC56T3_0312"
FT   CDS_pept        321150..321404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0312"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="KEGG: gka:GK0261 phosphoribosylformylglycinamidine
FT                   synthase subunit PurS; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase, purS; PFAM:
FT                   phosphoribosylformylglycinamidine synthetase PurS"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25373"
FT                   /inference="protein motif:TFAM:TIGR00302"
FT                   /protein_id="ADI25373.1"
FT                   /translation="MYKVKVYVTLRESVLDPQGTAVKGALHSLSYTEVKDVRIGKFMEL
FT                   VIEESGRDINELVREMCEKLLANPVIEDYRYEIEEAVAR"
FT   gene            321401..322087
FT                   /locus_tag="GC56T3_0313"
FT   CDS_pept        321401..322087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0313"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   I; KEGG: gka:GK0262 phosphoribosylformylglycinamidine
FT                   synthase I; PFAM: ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25374"
FT                   /inference="protein motif:TFAM:TIGR01737"
FT                   /protein_id="ADI25374.1"
FT                   /translation="MKFAVVVFPGSNCDVDMYHAIADELGEEVEYVWHDEDDLDRFDAI
FT                   LLPGGFSYGDYLRSGAIARFSKVMAAVKKAAEAGKPVLGVCNGFQILLEAGLLPGAMRR
FT                   NQGLKFICRPVQLTVENHETMFTSAYEKGEVITIPIAHGEGNYYCDEQTLERLVENRQI
FT                   VFRYHGENPNGSLADIAGIVNERGNVLGMMPHPERAVDALLGSADGLKLFRSIVNYWRE
FT                   THVVTA"
FT   gene            322071..324299
FT                   /locus_tag="GC56T3_0314"
FT   CDS_pept        322071..324299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0314"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   II; KEGG: gyc:GYMC61_1135 phosphoribosylformylglycinamidine
FT                   synthase II; PFAM: AIR synthase related protein domain
FT                   protein; AIR synthase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25375"
FT                   /inference="protein motif:TFAM:TIGR01736"
FT                   /protein_id="ADI25375.1"
FT                   /translation="MSLLLEPSAAMIKEQKLYREMGLTDEEFARIEAILGRLPNYTETG
FT                   IFAVMWSEHCSYKNSKPVLKKFPTDGPHVLQGPGEGAGIVDIGDGLAVAFKIESHNHPS
FT                   AIEPYQGAATGVGGIIRDVFSMGARPIALLNSLRFGELTSPRVKYLFEQVVAGIAGYGN
FT                   CVGIPTVGGEVQFDPAYEGNPLVNAMCVGIIRHEDVQRGVATGVGNTVMYVGAKTGRDG
FT                   IHGATFASEELSEQSEAKRPAVQVGDPFMEKLLLEACLEAVKSDALVGIQDMGAAGLTS
FT                   SSAEMASKGGFGIEMNLDLVPQREAGMTPYEMMLSESQERMLLVVKQGCEDEIAAIFAK
FT                   YGLEAKAIGKVTDDKMLRLFFRGEVAAEIPVDALAKDAPVYHKPSAEPAYYREFQAMPP
FT                   YIPHIEDYNQTLLGLLAQPTIASKEWVYDQYDYMVRTNTVVAPGSDAAVVRIRGTNKAL
FT                   ALTTDCNSRYLYLDPETGGKIAVAEAARNVVCSGAKPLAITDCLNFGSPEKPEIFWQLE
FT                   KAVDGMSEACRALGTPVVSGNVSLYNETNGEAVYPTPVVGMVGLIDDLSHITTQSFKQA
FT                   GDLIYVIGEAKPEFGGSELQKWLEGRIFGKAPEIDLEVEASRQRQLLAAIRAGVVASAH
FT                   DIAEGGLAVALAECVMGASGLGAKVTIGGDLVSELFSETQSRFVVSVKKEQKEAFEQLV
FT                   EAKQIGEVTDDGAFVVNGEHGETLIHLSVAKMRNVWKGAIPCLLKSKD"
FT   gene            324275..325687
FT                   /locus_tag="GC56T3_0315"
FT   CDS_pept        324275..325687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0315"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="KEGG: gka:GK0264 amidophosphoribosyltransferase;
FT                   TIGRFAM: amidophosphoribosyltransferase; PFAM: glutamine
FT                   amidotransferase class-II; phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25376"
FT                   /inference="protein motif:TFAM:TIGR01134"
FT                   /protein_id="ADI25376.1"
FT                   /translation="MLAEIKGLNEECGIFGIWGHEDAARLTYYGLHSLQHRGQEGAGIV
FT                   VAHNGSLSGHKGLGLVTDVFQSGTLDALKGAAAIGHVRYSTAGGGGYENVQPLLFRSQT
FT                   GAMALAHNGNLTNAIELKLALEGQGSIFQTTSDTEVFAHLIRRSQAPTFVEQMKEALSQ
FT                   IEGAFAFLLLTEKALYAALDPHGFRPLSLGRLGSAYVVASETCAFDVIGVAYEREVSPG
FT                   ELLIISHEGVRSERFAPRQPRSICSMEYIYFARPDSHVDGINVHTARKNLGKRLALEAP
FT                   AEADIVTGVPDSSISVAIGYAEASGIPYELGLIKNRYVGRTFIQPSQALREQGVKMKLS
FT                   PVRGVVAGKRVVMVDDSIVRGTTSRRIVSMLREAGAVEVHVRISAPPITHPCFYGIDTS
FT                   SKEELIAANRTVEEIRRLIGADSLAFISQEGMLEAIGRPDVSPQRGQCLACFTGQYPTR
FT                   LGQAARPCLTMK"
FT   gene            325811..326851
FT                   /locus_tag="GC56T3_0316"
FT   CDS_pept        325811..326851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0316"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; KEGG: gka:GK0265 phosphoribosylaminoimidazole
FT                   synthetase; PFAM: AIR synthase related protein domain
FT                   protein; AIR synthase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25377"
FT                   /inference="protein motif:TFAM:TIGR00878"
FT                   /protein_id="ADI25377.1"
FT                   /translation="MAKAYKQAGVDIEAGYQAVALMKEHVQKTMRPEVLGGIGGFGGLF
FT                   DLSALGYRQPVLVSGTDGVGTKLKLAFLLDRHDTIGIDCVAMCVNDIIVQGAEPLFFLD
FT                   YIACGKAVPEKIAAIVKGVADGCVEAGCALIGGETAEMPGMYDEDEYDLAGFAVGIAEK
FT                   DRLVTGQTIQAGDVLIGLPSSGLHSNGYSLVRRIVFEQAKLSLDEIYEPLDVPLGEELL
FT                   KPTRIYAKLLRSVRERFTIKGMAHITGGGLIENIPRMLPPGIGARIQLGSWPVLPIFYF
FT                   LREKGSLEEEEMFSVFNMGIGLVLAVSPETAAPLVEWLSERGEPAYIIGEVAEGAGVSF
FT                   AGGGRA"
FT   gene            326848..327480
FT                   /locus_tag="GC56T3_0317"
FT   CDS_pept        326848..327480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0317"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="KEGG: gyc:GYMC61_1138 phosphoribosylglycinamide
FT                   formyltransferase; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25378"
FT                   /inference="protein motif:TFAM:TIGR00639"
FT                   /protein_id="ADI25378.1"
FT                   /translation="MKRLAVFASGSGTNFQAIVDAAKRGEVPAEVALLVCDRPGAKVIE
FT                   RAARENVPAFVFSPKDYPSKAAFESEILRELKERQIDWIALAGYMRLIGPTLLSAYEGK
FT                   IVNIHPSLLPAFPGKDAIGQAYRAGVLETGVTVHYVDEGMDTGPVIAQRAVPIVPGEPI
FT                   EALEARIHQVEHELYPTVLRMLLGEKEQQEERIENDGSETSIDQRVQ"
FT   gene            327443..328981
FT                   /locus_tag="GC56T3_0318"
FT   CDS_pept        327443..328981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0318"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /note="SMART: AICARFT/IMPCHase bienzyme formylation region;
FT                   TIGRFAM: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; KEGG: gka:GK0267
FT                   bifunctional phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM:
FT                   AICARFT/IMPCHase bienzyme formylation region; MGS domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25379"
FT                   /inference="protein motif:TFAM:TIGR00355"
FT                   /protein_id="ADI25379.1"
FT                   /translation="MAVKRALISVSNKEGIIPFAKQLAELGIGIISTGGTKRALEDAGV
FT                   PVISISDVTGFPEILDGRVKTLHPAIHGGILAVRSDERHQAALAEHGIRPIDLVVVNLY
FT                   PFQQTIAKPDVTLAEAIENIDIGGPTMVRAAAKNYADVAIVVDPADYPIVIEELKMTGS
FT                   IQAKTRQQLAAKAFRHTAAYDAMIAEYLTNLTGENYPETLTVTYTKKQSLRYGENPHQS
FT                   AAFYAKPLGAAFSIANAAQLHGKELSYNNINDANAAINLIREFQEPAVAAIKHMNPCAV
FT                   GVGATLLEAFTKAYEADRVSIFGGIIAVNREVDKETAERMHDIFLEIVIAPSFSDEAFA
FT                   ILTKKKNIRLLTLDFTAPDVKEKMLVSVNGGLLVQEADTFTLEDAEWNVVTKREPTEAE
FT                   REQLRFAWKVVKHVKSNAIVLAKNGMTVGVGAGQMNRVGAAKIAIEQAGEQAVGAVLAS
FT                   DAFFPMDDTVEAAAKAGITAIIQPGGSIRDADSIRKADEYGIAMVFTGVRHFKH"
FT   gene            329005..330297
FT                   /locus_tag="GC56T3_0319"
FT   CDS_pept        329005..330297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0319"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="TIGRFAM: phosphoribosylamine/glycine ligase; KEGG:
FT                   gka:GK0268 phosphoribosylamine--glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Phosphoribosylglycinamide synthetase, N-domain;
FT                   Phosphoribosylglycinamide synthetase, C-domain"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25380"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ADI25380.1"
FT                   /translation="MNVLVIGRGGREHAIAWKAAQSPLVGKLYVAPGNPGIADVAELVH
FT                   IDELDIEALVQFAKQQAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKA
FT                   FAKELMKKYGIPTADHATFTSYEEAKAYIEQKGAPIVVKADGLAAGKGVTVAQTVEEAL
FT                   AAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEG
FT                   PNTGGMGAYSPVPQISDEMIDAALEAILRPAAKALAAEGRPFLGVLYAGLMATANGPKV
FT                   IEFNARFGDPEAQVVLPRLKTDLVEAVLAVMDGKELELEWTDEAVLGVVLAAKGYPGAY
FT                   ERGAEIRGLDRISPDALLFHAGTKREGGAWYTNGGRVLLLAAKGETLAKAKEKAYEQLA
FT                   AIDCDGLFYRRDIGRRAIERASAAYTRMKGR"
FT   gene            complement(330486..330611)
FT                   /locus_tag="GC56T3_0320"
FT   CDS_pept        complement(330486..330611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0320"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK0269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25381"
FT                   /inference="similar to AA sequence:KEGG:GK0269"
FT                   /protein_id="ADI25381.1"
FT                   /translation="MREDIRPTLRTAFADVFHSTVIWQHFSHRERYVLLRYRSGQ"
FT   gene            complement(330608..330853)
FT                   /locus_tag="GC56T3_0321"
FT   CDS_pept        complement(330608..330853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0321"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25382"
FT                   /inference="similar to AA sequence:KEGG:GK0270"
FT                   /protein_id="ADI25382.1"
FT                   /translation="MANIGIVNAFIRITVGLTVIAWATARLARRPWCTSYLWAALLGAM
FT                   KVGEGITRFCPMTALFDNMQRRQLLEEEKEAVVNPT"
FT   gene            330950..332695
FT                   /locus_tag="GC56T3_0322"
FT   CDS_pept        330950..332695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0322"
FT                   /product="Adenine deaminase"
FT                   /EC_number="3.5.4.2"
FT                   /note="KEGG: gyc:GYMC61_1142 adenine deaminase; PFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25383"
FT                   /inference="protein motif:PRIAM:3.5.4.2"
FT                   /protein_id="ADI25383.1"
FT                   /translation="MGEQRYRWKGSELREQAAIIDGKQSPTKVLVNATYLHSYFREWVK
FT                   GNIWIHSDRIVYAGERFPNFVDDACEIVDCRGYVLVPGYIEPHVHPFQLYNPHSFARYA
FT                   AAHGTTTLLNDNLFLLLQLDDEEALFFLQEMNALPTSMYWWCRFDGQTELEREEEQVSN
FT                   ARIKRWLDQEAVLQGGELTSWPKVASGDDIILYWMQEAHRRRRKIEGHFPGASEKTLVK
FT                   MALFGADGDHEAMTGKEVRMRLWHGYTVALRHSSIRPDLPVLLEEMKALGIRHYDKCLL
FT                   TTDGSPPAFYENGVIDWLIRIAIEHGVPVIDAYAMATINAARHYGIEHLHGSIATGRIA
FT                   HINFLRSAHDPTPAQVLAKGEWVKRDGEAPPLWPDLEWGQFGIRPLSLPWEMDWDDLQF
FT                   SMPMGLRMENAVILKPYSVSIDTSRDRLGHDHDECFLALFDRNGRWRINTMLKGFSSAL
FT                   GGLASSYSNTGDLILIGKHKEDMMLAFRRMKEIGGGIVLAEDGEILFELSLPLGGMMSS
FT                   LEVDELINEEKTFVRLLRERGYPFEDPVYSLLFLQSTHLPYVRVTQRGIYDVMNKTVLF
FT                   PSIMR"
FT   gene            332723..333742
FT                   /locus_tag="GC56T3_0323"
FT   CDS_pept        332723..333742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0323"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK0272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25384"
FT                   /inference="similar to AA sequence:KEGG:GK0272"
FT                   /protein_id="ADI25384.1"
FT                   /translation="MKRWLFAVSCAALLLGGCTTKSEPKQAEPAKPAPRQEQPSKPPAE
FT                   EKQTFPLTGLPAKGNIHQRVVGVMINNHPKARPQSGLRAADIVYEVLAEGDITRLLALY
FT                   QSELPERVGPVRSARDYYIDLSEGYHALYVCHGWSPEAKVRLEGGGIDYLNGLFYDGTL
FT                   FQRVPFRKAPHNSYISFANIEKGAKQNGYAWTDNVAPLSFRTDEPRGKKVETVHIAYSH
FT                   RAYAQVEYQYVSEQKGYYRYSGGEQTIDYDTHKPVVVQNVMIIAAHHQVVDSHGRRDID
FT                   LVSGGKGYLLQGGVMQPIEWKNVDGRLLPYHNGAPIGFVPGKTWINIVPELAIVQWKS"
FT   sig_peptide     332723..332791
FT                   /locus_tag="GC56T3_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.902) with cleavage site probability 0.489 at
FT                   residue 23"
FT   gene            333835..334170
FT                   /locus_tag="GC56T3_0324"
FT   CDS_pept        333835..334170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0324"
FT                   /product="TrpR like protein, YerC/YecD"
FT                   /note="KEGG: gka:GK0273 hypothetical protein; TIGRFAM: TrpR
FT                   like protein, YerC/YecD; PFAM: Trp repressor"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25385"
FT                   /inference="protein motif:TFAM:TIGR02531"
FT                   /protein_id="ADI25385.1"
FT                   /translation="MQIDKLRGRELDQLFKAILSLRDLEECYRFFDDLCTVNEIQALAQ
FT                   RLEVARMLREGYTYHKIETETGASTATISRVKRCLNYGNDAYAMALDRIKEEQQQEEKE
FT                   ANEAVTD"
FT   gene            334269..334988
FT                   /locus_tag="GC56T3_0325"
FT   CDS_pept        334269..334988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0325"
FT                   /product="geranylgeranylglyceryl phosphate synthase family
FT                   protein"
FT                   /EC_number="2.5.1.41"
FT                   /note="TIGRFAM: geranylgeranylglyceryl phosphate synthase
FT                   family protein; KEGG: gyc:GYMC61_1145
FT                   geranylgeranylglyceryl phosphate synthase family protein;
FT                   PFAM: PcrB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25386"
FT                   /inference="protein motif:TFAM:TIGR01768"
FT                   /protein_id="ADI25386.1"
FT                   /translation="MEEIRAWRHVFKLDPNKPIDDERLERLCESGTDAVIVGGTDGVTI
FT                   DNVLDLLARIRRFSVPCALEVTDVEALTPGFDVYLVPIVLNSRQAEWIIGRHHEAVKQY
FT                   GDVMNWDEIFAEGYCILNPACKAAELAEADAALTDDDVVAYARLAAHLYRLPIFYLEYS
FT                   GVYGDPSLVEKVKQVLDQTQLFYGGGITTPEQAEHMARYADTVVVGNAIYDAFEQALAT
FT                   VAAVKKMAGQRSGDDGK"
FT   gene            335017..337191
FT                   /locus_tag="GC56T3_0326"
FT   CDS_pept        335017..337191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0326"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /note="KEGG: gyc:GYMC61_1146 ATP-dependent DNA helicase
FT                   PcrA; TIGRFAM: ATP-dependent DNA helicase PcrA; PFAM:
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25387"
FT                   /inference="protein motif:TFAM:TIGR01073"
FT                   /protein_id="ADI25387.1"
FT                   /translation="MNFLSEKLLAHLNKEQQEAVKTTEGPLLIMAGAGSGKTRVLTHRI
FT                   AYLMAEKQVAPWNILAITFTNKAAREMKERVQALLGGAAEDVWISTFHSMCVRMLRRDI
FT                   DRIGINRNFSILDPTDQLSVIKAILKDKNIDPKKFELRTILATISGAKNDLLTPEQFAK
FT                   RASTYYEKIVGDVYQEYQQRLLRNHSLDFDDLIMTTIHLFDRVPDVLQYYQYKFQYIHI
FT                   DEYQDTNRAQYTLVKKLAERFQNICAVGDADQSIYRWRGADIRNILSFERDYPNAKVIL
FT                   LEQNYRSTKRILQAANEVIAHNVNRKPKRLWTENPEGKPIVYYEAMNEVDEAQFVARRI
FT                   QEAVESGERRYRDFAVLYRTNAQSRVIEEMFLKANIPYQIVGGLKFYDRKEIKDILAYL
FT                   RVIANPDDDLSLLRIINVPKRGIGASTIDKLVRYAAEHELSLFEALGELEMIGFSTKTA
FT                   GALAAFRGQLEQWTQLQEYVPVTELVEEVLDQSGYREMLKAERTIEAQSRLENLDEFLS
FT                   VTKHFENVSDDKSLVAFLTDLALISDLDELNGTDQAAEGDAVVFMTLHAAKGLEFPVVF
FT                   LIGMEEGIFPHLRSLENEDEMEEERRLAYVGITRAEEELVLTNAQMRTLFGNIQMNRPS
FT                   RFLDEIPAHLLETVSRGKPSVSRSASARLQAGGAIGVWKVGDRANHRKWGIGTVVSVRG
FT                   EGDDQELDIAFPSPIGIKRLLAKFAPIEKV"
FT   gene            337212..339224
FT                   /locus_tag="GC56T3_0327"
FT   CDS_pept        337212..339224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0327"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="SMART: NAD-dependent DNA ligase ;
FT                   Helix-hairpin-helix DNA-binding class 1; BRCT domain
FT                   protein; TIGRFAM: DNA ligase, NAD-dependent; KEGG:
FT                   gyc:GYMC61_1147 DNA ligase, NAD-dependent; PFAM:
FT                   NAD-dependent DNA ligase adenylation; NAD-dependent DNA
FT                   ligase OB-fold; zinc-finger NAD-dependent DNA ligase
FT                   C4-type; helix-hairpin-helix motif; BRCT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25388"
FT                   /inference="protein motif:TFAM:TIGR00575"
FT                   /protein_id="ADI25388.1"
FT                   /translation="MDRQQAERRAAELRELLHRYGYEYYVLDRPSVPDAEYDRLMQELI
FT                   AIEEQYPELKTSDSPTQRIGGPPLEAFRKVTHRIPMMSLANAFDEGDLRDFDRRIRQEV
FT                   GEAAYVCELKIDGLAVSVRYEDGYFVQGATRGDGTTGEDITENLKTIRSLPLRLKEPVS
FT                   LEARGEAFMPKASFLRLNEERKARGEELFANPRNAAAGSLRQLDPKVAASRQLDLFVYG
FT                   LANAEELGIESHSEALDYLQALGFKVNPERRRCANIDEVIAFINEWHEKRPQLPYEIDG
FT                   IVIKVDSFAQQRELGATAKSPRWAIAYKFPAEEVVTTLIGIEVNVGRTGVVTPTAILEP
FT                   VRVAGTTVQRATLHNEDFIREKDIRIGDAVIIKKAGDIIPEVVGVVVDRRDGDETPFVM
FT                   PTHCPECESELVRLDGEVALRCLNPKCPAQLRERLIHFASRAAMNIEGLGEKVVTQLFN
FT                   AGLVHDVADLYRLTKEQLIGLERMGEKSATNLLAAIEASKQNSLERLLFGLGIRYVGAK
FT                   AAQLLAEHFETMERLEKATKEELMAVPEIGEKMADSIIAFFSQPEAAELLHELRLYGVN
FT                   MAYKGPKRAAEAPADSAFAGKTVVLTGKLASMSRNEAKEEIERLGGRVTGSVSRSTDIV
FT                   IAGEDAGSKLEKAQQLGIEIWDESRFLQEISRGKR"
FT   gene            339221..340444
FT                   /locus_tag="GC56T3_0328"
FT   CDS_pept        339221..340444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0328"
FT                   /product="CamS sex pheromone cAM373 family protein"
FT                   /note="PFAM: CamS sex pheromone cAM373 family protein;
FT                   KEGG: gyc:GYMC61_1148 CamS sex pheromone cAM373 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25389"
FT                   /inference="protein motif:PFAM:PF07537"
FT                   /protein_id="ADI25389.1"
FT                   /translation="MKRISPLRSLVACRWTNRARKRLAAVSLASICLLSACAPKFDKGE
FT                   EVVQDKGSKQQEAVIPKYNIADSYYRVILPFKPSGARGEVVNDLNTRLDVDEFETGLMR
FT                   LATEQFPSDEYLFQEGQYLDSETVGKWLARKKTTRQLKEEKMKPEDNLGLNPPISDTGT
FT                   NEQKNKQSPIYLASILEHDYLVKIDNDKVKLGGIAIGLALNSVHYYSTEQGYPREVKIK
FT                   DDVIEREGKRIAAEVLKRLRSMKGLGSVPITIALYKQAPRSSVVPGHFFAVAHVDGGDS
FT                   TIDEWEAVNEEYYLFPSDEAEENHRDDWLKFNNFKSDVEDFFPNYTGIVGRGLYVNDQL
FT                   QKLTINITMPFYGKAEVIGFTQYVTGLVMEKFPDYITVNVYIASAGQPESLIVRQAKAD
FT                   EPFVHIYQ"
FT   gene            340620..341177
FT                   /locus_tag="GC56T3_0329"
FT   CDS_pept        340620..341177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0329"
FT                   /product="hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   gyc:GYMC61_1149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25390"
FT                   /inference="protein motif:PFAM:PF03641"
FT                   /protein_id="ADI25390.1"
FT                   /translation="MKAICVFCGSSYGQSVKYKEAAKELGTFLARSGITLIYGGGTRGL
FT                   MGEVAQAALRHQGRVVGIIPQFLKDREVAHNRLSELLVVDTMHTRKAKMYEAADGFIAM
FT                   PGGYGTYEELFEVLSWSRVGLHQKPIGLLNVDRFFDPLLDLLRHTVENGFAAPEDLGLI
FT                   VSAGDVPTLYERMSLFRHHRRQ"
FT   gene            complement(341265..342740)
FT                   /locus_tag="GC56T3_0330"
FT   CDS_pept        complement(341265..342740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0330"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: gyc:GYMC61_1150 amine
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25391"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ADI25391.1"
FT                   /translation="MSHPYVSPKLSMETMISIIRNGLKKTAAPRHIVIIGAGMAGLVAA
FT                   SLLKQAGHRITILEASERVGGRIYTLRSNFRDDQYLEAGAMRIPHTHQLTLEYIKKFNL
FT                   PLYPFINSTPRDILYFRGVKARLGEYEQHPGLFGFPVAPHERGKTASELLQMAIRPVVQ
FT                   FIEQNPEQHWPIVIEQLDRYSLDSYLRYNPFGLSLSVGAIDMIKAVLSLGGLPELSFLE
FT                   MLRELMVLFTPNIRFYEIVGGNDRLPKAFLPQLKDDILFSHKVQKIVQDPNGVTIHATH
FT                   TKILQPFQVTADRAIVTIPFSILQFVDIEPRHSFSENKWKAIRELHYAGSTKTGIQFKT
FT                   RFWEKEGMFGGRAVSDLPITYTQYPSQGIGTTGPGVVLASYTWEDDTIPWDSLGDEERL
FT                   EYTLKNLAILHGEQVYREFETGTSHSWVRYPYSGGAFTMMKPNQVTELSPYIAVPEGRV
FT                   HFAGEHASTHHGWIQGAIESGIRVAHEVNNAQA"
FT   gene            complement(342843..343619)
FT                   /locus_tag="GC56T3_0331"
FT   CDS_pept        complement(342843..343619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0331"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK0279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25392"
FT                   /inference="similar to AA sequence:KEGG:GK0279"
FT                   /protein_id="ADI25392.1"
FT                   /translation="MHVVFDHLVHLVERPEQAKTAFEQWGFTAIHGGRHPSWGTYNALC
FT                   YFEHLRYIEWIGIADRQTARTCGNPLIAQLVADRQEGNGFSQFAFRTNNIEAVAAHLKR
FT                   NGFTPIGPLPGSRERDDGKRLTWSMLFIEDDTDGAFRYPFFIQWGDGDDVRMNELAPLM
FT                   RHPIGSVSLSSISIYTLDLQRAANGYRRLFDLPEPDVGRDEAGAYAKLAVGGIAIRFYE
FT                   ADRRHPSTRPFSCRLVGVQEQRSIEIDGATYIVSRP"
FT   gene            complement(343649..344065)
FT                   /locus_tag="GC56T3_0332"
FT   CDS_pept        complement(343649..344065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0332"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK0280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25393"
FT                   /inference="similar to AA sequence:KEGG:GK0280"
FT                   /protein_id="ADI25393.1"
FT                   /translation="MSDALLAQVLDRLNAMDSTLQKLVEGQERLEREQIAIRQEQDSLR
FT                   AGQTELNGIVAALLHRQDETDAKLEALAADVHQLHREFSSLKQTVDRLEQKMDSRYEQL
FT                   SAQIEDIKLDLNFIAHRTVDNERIIYKLKEMLFR"
FT   gene            complement(344256..344831)
FT                   /locus_tag="GC56T3_0333"
FT   CDS_pept        complement(344256..344831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0333"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   afl:Aflv_0261 endonuclease, Uma2 family (restriction
FT                   endonuclease fold)"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25394"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ADI25394.1"
FT                   /translation="MSLPNQNHPWTYADYVNFPEEKRYEGIDGVLFMTPSPTPRHQRIV
FT                   TALSAQFFDFLQHSSCEVFVAPIDVCLFATKDTPLHDIKDWYIPDFIVVCDKQKIGDER
FT                   IYGAPDLIVEVLSPSTAKHDRITKFHNYEQAGVREYWIVDPVHETVEKYALQDQKFHQA
FT                   GVHYKDETICPHIFPKLFISLPKVFASM"
FT   gene            345196..345486
FT                   /locus_tag="GC56T3_0334"
FT   CDS_pept        345196..345486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0334"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="KEGG: gyc:GYMC61_1153 glutamyl-tRNA(Gln)
FT                   amidotransferase, C subunit; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, C subunit; PFAM: Glu-tRNAGln
FT                   amidotransferase C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25395"
FT                   /inference="protein motif:TFAM:TIGR00135"
FT                   /protein_id="ADI25395.1"
FT                   /translation="MSRISIDQVKHVADLARLAITDEEAEMFAKQLDAIITFAEQLNEL
FT                   DTENVPPTSHVLDMRNVMREDIPEPGLPREEVLKNAPDQQDGQFRVPAILE"
FT   gene            345499..346956
FT                   /locus_tag="GC56T3_0335"
FT   CDS_pept        345499..346956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0335"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /EC_number="3.5.1.4"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; KEGG: gyc:GYMC61_1154 glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25396"
FT                   /inference="protein motif:TFAM:TIGR00132"
FT                   /protein_id="ADI25396.1"
FT                   /translation="MSLFDHSVSELHTLLQKKEVSVSDLVDESYRRIGEVEEKVQAFLT
FT                   LNEEQARAKAKELDDRLAKGEETNPLFGLPIGIKDNIVTKGLRTTCASKILYNFDPIYD
FT                   ATVMERLHAAGAITIGKLNMDEFAMGSSTENSGFQLTRNPWDVERVPGGSSGGSAAAVA
FT                   AGEVPFALGSDTGGSIRQPAAFCGVVGLKPTYGRVSRFGLVAFASSLDQIGPITRTVED
FT                   NAYLLQAIAGVDPMDSTSANVPVPNYVEALTGDIKGLKIAVPKEYLGEGVDEGVRQSVL
FT                   AALAVLEKLGAAWEEVSLPHSKYALATYYLLASSEASANLARFDGVRYGYRTDNAKNLI
FT                   DMYKLTRSEGFGAEVKRRIMLGTFALSSGYYDAYYKKAQKVRTLIKRDFENVFEQYDVI
FT                   IGPTTPTPAFKIGEKTNDPLTMYMNDILTIPVNLAGVPAISVPCGFVDGLPVGLQIIGK
FT                   HFDESTVYRVAHAFEQATDYHKQKPVL"
FT   gene            346970..348400
FT                   /locus_tag="GC56T3_0336"
FT   CDS_pept        346970..348400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0336"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="KEGG: gyc:GYMC61_1155 glutamyl-tRNA(Gln)
FT                   amidotransferase, B subunit; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, B subunit; PFAM: GatB region; GatB
FT                   central domain protein; Asn/Gln amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25397"
FT                   /inference="protein motif:TFAM:TIGR00133"
FT                   /protein_id="ADI25397.1"
FT                   /translation="MNFETVIGLEVHVELKTKSKIFSSSPNAFGAPPNTQTNVIDLGYP
FT                   GVLPVLNRQAVEFAMKAAMALNCEIATETKFDRKNYFYPDNPKAYQISQYDQPLGKNGW
FT                   IEIEVNGKKKKIGITRIHLEEDAGKLTHTGDGYSLVDFNRQGTPLIEIVSEPDIRSPEE
FT                   AYAYLEKLKAIIQYTGVSDCKMEEGSLRCDANISLRPIGSDQFGTKTELKNLNSFNFVR
FT                   MGLEYEAKRQEKILLSGGVIRQETRRFDEATKTTVLMRVKEGSEDYRYFPEPDLVMLYI
FT                   DDEWKERVRASIPELPDARRKRYVEEWGLPEYDAKVLTLTKEMADFFEATVANGADPKL
FT                   ASNWLMVEVSGYLNAEQKELHDIALTPESLAGMIKLIQNGTISSKIAKKVFKELVEHGG
FT                   DPERIVKEKGLVQISDEGALRKIVLEVLDANPQSVEDYKNGKDRALGFLVGQVMKATKG
FT                   QANPPLVNKLLVEEIGKR"
FT   gene            348576..349880
FT                   /locus_tag="GC56T3_0337"
FT   CDS_pept        348576..349880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0337"
FT                   /product="O-acetylhomoserine/O-acetylserine sulfhydrylase"
FT                   /EC_number="2.5.1.47"
FT                   /note="TIGRFAM: O-acetylhomoserine/O-acetylserine
FT                   sulfhydrylase; KEGG: gka:GK0284 O-acetylhomoserine
FT                   aminocarboxypropyltransferase; PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25398"
FT                   /inference="protein motif:TFAM:TIGR01326"
FT                   /protein_id="ADI25398.1"
FT                   /translation="MSHEQTFRPETLAIHAGQKPDAETGARAVPIYQTSSYVFRDSEHA
FT                   ANLFGLKEEGFIYTRIMNPTNDVLEKRIAALEGGIGALALSSGQAAVFYSIINIASAGD
FT                   EIVSSSSIYGGTYNLFAHTLRKFGITVKFVDPSDPENFERAITDKTKALFAETIGNPKN
FT                   DVLDIEAVADIAHRHAIPLIVDNTVASPYLLRPIEFGADIVVHSATKFIGGHGNSIGGV
FT                   IVDSGKFDWKGSGKFPEFIEPDPSYHGLVYVDAVGEAAYITKARIQLLRDLGAALSPFN
FT                   AFLLLQGLETLHLRMQRHSENALAVAKFLEEEEVVESVNYPGLPSHPSHELAKKYLPNG
FT                   QGAIVTFEIKGGVEAGKKLIDSVKLFSHLANIGDSKSLIIHPASTTHEQLSPDEQLSAG
FT                   VTPGLVRLSIGTEAIDDILDDLRQAIRQSQTVGVK"
FT   gene            350505..350894
FT                   /locus_tag="GC56T3_0338"
FT   CDS_pept        350505..350894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0338"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK0287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25399"
FT                   /inference="similar to AA sequence:KEGG:GK0287"
FT                   /protein_id="ADI25399.1"
FT                   /translation="MKKKRKMVAALLASTTFIVVGGVSAASYVTYAGVLPRFQADTELA
FT                   SANKATNSKSKVENSVVGSDYKANMWIQQGSTKVSPTALNVTDNDTRYFTVDQSAVGKK
FT                   VSLVAENASFTYVTVDIAGKFYPDN"
FT   sig_peptide     350505..350582
FT                   /locus_tag="GC56T3_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 26"
FT   gene            351016..351897
FT                   /locus_tag="GC56T3_0339"
FT   CDS_pept        351016..351897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0339"
FT                   /product="NADH dehydrogenase (ubiquinone) chain 4"
FT                   /note="KEGG: gyc:GYMC61_1160 NADH dehydrogenase
FT                   (ubiquinone) chain 4"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25400"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1160"
FT                   /protein_id="ADI25400.1"
FT                   /translation="MYMELLKLLKNKNLYISAACLLLLVIGAVVLGVKDYRENVELFER
FT                   IYHHNPNVSALASPHLEWVGLGGFRFNVLSSLYYFLFPLLLSIPLVDSIDRERKSGNIH
FT                   YQLTRMGRGVYFRRKFVFSYISAFFLFLLPLVLGVVLVNLLTNHWDYSSFSQAYRQLVH
FT                   GALPLPDNSFEGEKKSLFSPLLEISPYWYVLAYYVIGGLFAGGYVCLGLAFSLFLKNRY
FT                   LITLMPQIIYMVCWAALTITNQLGWDPFNFLIPSQPVEGLSYWKIVIVFVLQLLIAVGV
FT                   FSYGVKKSEDVL"
FT   sig_peptide     351016..351114
FT                   /locus_tag="GC56T3_0339"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.827) with cleavage site probability 0.512 at
FT                   residue 33"
FT   gene            351881..352621
FT                   /locus_tag="GC56T3_0340"
FT   CDS_pept        351881..352621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0340"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK0289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25401"
FT                   /inference="similar to AA sequence:KEGG:GK0289"
FT                   /protein_id="ADI25401.1"
FT                   /translation="MKMFSRQIVFFVWQDLLLHRTVIRMILGVMALLMVVSILPLGMVV
FT                   VGKWHSLKDFILLYRYEFFHLPVFLFLLGSTLQTNAWVILRRYRTRGQIGLHKALLVVV
FT                   LAGGVSLWVAVAGGLCTMFVKFLIYPHMPNAHAAFLYVPHSEDKSSFLYFLVMYFFVTA
FT                   IYGLLFIAFIDFGWSRFFAFAAVIILAVLDMFTVHMLPYLFYISEQAAPVWTILVLIVV
FT                   LLLLVYLICLSSSRKNYYVQDDLL"
FT   gene            352618..353319
FT                   /locus_tag="GC56T3_0341"
FT   CDS_pept        352618..353319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0341"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK0290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25402"
FT                   /inference="similar to AA sequence:KEGG:GK0290"
FT                   /protein_id="ADI25402.1"
FT                   /translation="MKPMDLEFTLIKMDIKRIVITCLLFPLLGTLMCSWSEAFSSQHLS
FT                   ELFARLFGAVTTSNWMYWLMICFGYVVLLQIVWKKRDQYFEHKLFILLRDTTSYTMARL
FT                   LAGVLFTVGYVLSSFLITGGFGLFVSHMAFSFDRSLVLMFVSIAVNLYWHASVWMLLNV
FT                   YATYHLANVVILALFFVGVKMPTPFIPLYYSMADLVRSSSMFWSALIVELLSIVVFGYW
FT                   TIKRVKHADYI"
FT   gene            353332..353985
FT                   /locus_tag="GC56T3_0342"
FT   CDS_pept        353332..353985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0342"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gka:GK0291 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25403"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI25403.1"
FT                   /translation="MKAIVLSNVSKTIKAREVLRNINLELESGKIYGFVGPNGSGKTML
FT                   FRVISGLVKPSSGTVAVFGQTLHQDVSFPSDISVLLEKPGFLEQYSGFDNLHFLAMIQN
FT                   KIGEREVKEAIERVGLDPHDKRPVKAYSLGMRQRLAIAQCIMEKPQLMLLDEPMNGLDE
FT                   KSVDQVYQIIREENKRGCTILLTSHNKVDIQSLCHEVYSMNEGVITGVTHIAAE"
FT   gene            354558..355256
FT                   /locus_tag="GC56T3_0343"
FT   CDS_pept        354558..355256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0343"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="manually curated; PFAM: response regulator receiver;
FT                   transcriptional regulator domain protein; KEGG:
FT                   gtn:GTNG_0269 subtilin biosynthesis regulatory protein
FT                   SpaR; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25404"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADI25404.1"
FT                   /translation="MNKKKILLVDDDEDICCTIKQYLELHHYQVETVHSGVEALKMMNN
FT                   DFDLIVLDIMMEGIDGMELCRLIRERVDVPIVFVSAKTLEEDKVQALAIGGDDYITKPF
FT                   SLKELKARIDCHLRREERIRSNERYLLSSKNMTIDLLANEVFCKGKKLPFTKKEYEIVK
FT                   LLMLNQKIVFSKERIFERVWGIDSESQLDTVAESIKNIRKKIKAVDPDTSYIQTLYGLG
FT                   YKWDVTDEKQ"
FT   gene            355243..356661
FT                   /locus_tag="GC56T3_0344"
FT   CDS_pept        355243..356661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0344"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: gyc:GYMC61_1167 integral membrane sensor
FT                   signal transduction histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25405"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADI25405.1"
FT                   /translation="MKNNKTIKRDFYLLVVKVVLATAITSAFTYICIIYLIMTLTTNHV
FT                   VKPTNYFVKDLDLIEKKVKENEEAIFKGRLIPIHRYSEKIKGEVVDISGKHLYGDRGIV
FT                   DGQVDMSKVINREIVKGSYVYRFIPVQHDNAIQAVYVLKAPFGFIINNQHRFGAVLIYA
FT                   LLLISPLIFFIVYLIFFTSRLYKSLFHNVRLLLQASDHIASGDFDFQVSGLKRKEFMKI
FT                   QDSFNTMISALKEMVERLAKTDDERRMMVSSIAHDIRTPLTVIQGQIDLIQDLRKLDHF
FT                   DLTPHLEIIRKNCGKMTMLTDNLSLLYKVENDHFSLNAKEVDVRQILDEKKREITTMVY
FT                   HQKSINICFDVNLQKSCYILDEAMLMRVLDNILYNSLRFTKSGEIKLEVHDEKEGDERK
FT                   IYFRCSDTGTGFKESDTSLLFQPFYQDQQYKHHVGLGLYIAKRIVNHHGGEIWAYNNEK
FT                   GGATVEFYIQELAD"
FT   gene            complement(356748..357284)
FT                   /locus_tag="GC56T3_0345"
FT   CDS_pept        complement(356748..357284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0345"
FT                   /product="SpaI"
FT                   /note="KEGG: gyc:GYMC61_1168 SpaI"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25406"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1168"
FT                   /protein_id="ADI25406.1"
FT                   /translation="MNEPPWFSFNGMFKKEGPKSLDKSTFLEGGFRVAMKNFLLPLMLI
FT                   AILFIGGCSLVSDLKKTATKNMEIDRKLPKYELNKDNLQEIHYQDRTYIIQAAKVDRHQ
FT                   LHKPIGKVAETITINEHHQILSKKELRKIEIIPDQKDEKRTHLNFGWVYSIKGVNPDEE
FT                   VAVTVNHQFLIAKRK"
FT   gene            complement(357277..358065)
FT                   /locus_tag="GC56T3_0346"
FT   CDS_pept        complement(357277..358065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0346"
FT                   /product="lantibiotic ABC transporter (permease)"
FT                   /note="KEGG: gyc:GYMC61_1169 lantibiotic ABC transporter
FT                   (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25407"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1169"
FT                   /protein_id="ADI25407.1"
FT                   /translation="MSFLRLLSSEWIKTKRTAVRIMVIIIPILYPLFMVWYFSHYRHSV
FT                   FWQVKIYQGFFEVMTVSLPIIISLLTGLMSYQEEKAGNFMNILAGPVSKIKWYVGKLTL
FT                   LIFIACADILLAMILMLFGVKYVLNVAPIHDHLFLQGAMLSIVGSLILFSLHLFISLAF
FT                   GMGASIAIGSGGFLISALIGATSLGDHIWSYVPWAWGVRLSQFPILMMPEVKQALGAQL
FT                   FNSYSLSLWGGMAYALLGFIIVTIIGSVWFHRWEGNKPHE"
FT   gene            complement(358067..358813)
FT                   /locus_tag="GC56T3_0347"
FT   CDS_pept        complement(358067..358813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0347"
FT                   /product="putative SpaE"
FT                   /note="KEGG: gyc:GYMC61_1170 putative SpaE"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25408"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1170"
FT                   /protein_id="ADI25408.1"
FT                   /translation="MLNMFQSEHLKYKRTFAKKLIFIAPLFFVLYAMITMPTMNSTRHY
FT                   FEYTVFNWWPLIFVPIGTALTASLSVSREKKSGNDKALRCLDISIVRLWWSKIAVIAYY
FT                   MLLSTIELIVLLVLLKWFLPNSLSSATVAVFASLVIWMSSLSYIPIGLFIAERFGMAAS
FT                   ILVSVIGLALGVVMAAQPYWLFIPWSWGMRMMCPIVGVHPNGVPLEKGNSLLDPSVIPI
FT                   GLTIALVMFLLLSFLTAVWFSRKEVH"
FT   gene            complement(358829..359521)
FT                   /locus_tag="GC56T3_0348"
FT   CDS_pept        complement(358829..359521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0348"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gyc:GYMC61_1171 ABC transporter related
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25409"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI25409.1"
FT                   /translation="MEEYMLETRHISKAFGKQLAVDDVSIKVKKHTIYGLLGPNGAGKS
FT                   TLLKMLTGLLRPTKGEIVINGHPWSRKVLKDIGALIESPALYGNLTAYENLLVHAKLLH
FT                   LPDSRIQEVLNIVGLENTGKKKASQFSLGMKQRLGIAKALLNHPKLLILDEPTNGLDPL
FT                   GIQDLRTLIKSFAENGITVILSSHILSEVKQLADYIGIIQNGKLRYEGKIDESQDLEKL
FT                   FIDVVNKQ"
FT   gene            359832..360671
FT                   /locus_tag="GC56T3_0349"
FT   CDS_pept        359832..360671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0349"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: afl:Aflv_0547
FT                   competence regulatory protein ComQ"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25410"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ADI25410.1"
FT                   /translation="MSEPQLKAHMLLAIEQHMKESDLLFGRSAYLHYDLFSIQGDHSTY
FT                   IAAAIELIVLAGDLLDDIVDQDRFEDTAIPLHIAIGFLLLAQQAIANVPISSNKKLKAL
FT                   SYVTSCLLQSVHGQQTDVACDVQTEADYLKMVEKKAGSLVAMACVIGALLAGKEDIAAI
FT                   ETYARYIGIAAQIDNDLDALYNWDKKADIQAKKKLLPILYMLESKQNNLWKQYFNNDID
FT                   YDRMYVQKEKALQQMEQEGAIYYAKVISQIYKEKALQEIEKLDVDDRYKSVLKTMIL"
FT   gene            360691..360846
FT                   /locus_tag="GC56T3_0350"
FT   CDS_pept        360691..360846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0350"
FT                   /product="competence pheromone ComX"
FT                   /note="PFAM: competence pheromone ComX; KEGG: afl:Aflv_0548
FT                   DNA-directed RNA polymerase specialized sigma factor, ComX"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25411"
FT                   /inference="protein motif:PFAM:PF05952"
FT                   /protein_id="ADI25411.1"
FT                   /translation="MQEIIRFLVEHPEVIEKLQNGTVSLIGLSELEVKAVVKVFSESTE
FT                   PLGYWK"
FT   gene            360874..363117
FT                   /locus_tag="GC56T3_0351"
FT   CDS_pept        360874..363117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0351"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: gtn:GTNG_2064 sensor protein ComP; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   dimerisation and phosphoacceptor region; SMART: ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25412"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADI25412.1"
FT                   /translation="MIVALIAALYLTILNVRHPLIGMDVVENKNGDIIVNDIYEFGWAK
FT                   KHGIHIHDQVLKVDGKPPLSHFTVREYKTIEQAKTITIQRENQIQTLTVDYQSHGTEQW
FT                   LYYIALPAGFFLFAVSLSIFLLRLRPNDKSATVLIYFLLLTGICYISASLSAKYAPFGR
FT                   QIFNGIFFILPAVFLHFVYHYFEKERKVWFAKKIVFSLYGFNFVMFIISLMSISFRSIS
FT                   EVEVLLTTFFINIVIILALLGKGFVDLKKDEQQNTVKGLLFAIGLSAAPFVLFYSLPVL
FT                   IIGKWVLPAELTVTSLFVLPSVFLYLICTDRLFRLPFSINRFVYHAFLSLLPAFFVTLL
FT                   YAKFVHEARRFAELALLFLLIYVINILALYSKGYFDRTLRTKLYVQKNFYQESIYRIGE
FT                   ALKKQKNMQEVIRCMEKEVREVLDIENLAFVQLAVQNRQAPFHCDEKEWMKLIKKMDVQ
FT                   PLSIGKIIENKRLFAVFVGSFRQSPLLLIGKKKHSIPFRAEQKDWLSTIVYYASITIEN
FT                   MLKAEDFIKELDSLKERSHSVWLTRLIFQWSEKERRKLAIDLHDTILQDLIVLKRKVES
FT                   LRFQNMRMEEMKKQLNNIEEEIVDMIDVTRETCHELRPTFLEQVGLREALAELIGRFHL
FT                   RSNIKVDWNVHVSTKLDEERELAIYRMIQELLNNALKHSHASHIQLTLEVQNEEVQLHY
FT                   IDNGIGIDIEKLNHYDGKLGLFGIKERVQGLGGTCEMTSQLGEGLDIRITIPL"
FT   gene            363279..363950
FT                   /locus_tag="GC56T3_0352"
FT   CDS_pept        363279..363950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0352"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: gtn:GTNG_2063 two-component response regulator
FT                   ComA; PFAM: response regulator receiver; regulatory protein
FT                   LuxR; SMART: response regulator receiver; regulatory
FT                   protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25413"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADI25413.1"
FT                   /translation="MIHILVVDDHRLVGEGTKNMLESEQDFQVELVTSGTEAEQMMEQR
FT                   TYDVFLLDWRMPDMSGIELSKRILEKQPNAKIVIYTGYDIVPFLNYFIESGITGFVSKT
FT                   ASSEQLVTAIRCALRDEAVIPVHVLRQLRLFEVKARMEEEVEHITLDMFEQNILIEVAN
FT                   GLSNKEIARKRCMSQRSLERQLSRIFSKLRVSSRIEAVEKAKQLGLIPEHYMLLTSSSD
FT                   G"
FT   gene            364322..365497
FT                   /pseudo
FT                   /locus_tag="GC56T3_0353"
FT   gene            complement(365564..366766)
FT                   /locus_tag="GC56T3_0354"
FT   CDS_pept        complement(365564..366766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0354"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   oih:OB0163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25414"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADI25414.1"
FT                   /translation="MKMSVLESIKIAFSSVNAHKMRSILTIIGIVIGVAAVIVIVSIGK
FT                   GGENMLKSQIVGPGGDTIQVYYEPSNEELNANPDILEESAFTEQDINALKQIQNIKNVV
FT                   AASKDFLPVQYRKKYINGTIYGINDSYINIHKLNIQSGRMFNSTDFIGERRVALISNGL
FT                   KEELFPNKNPIGSIIRIGSQPVEIVGVLEERKNLFSVGLKEVYIPWKTWRTISGKNNFS
FT                   EVTIEVSNPNLLKEVGDEATSMLNRMHNTENRYKVINIKEIEQGIRNITNIMTLIIGSI
FT                   AGISLIVGGIGVMNIMLVSVTERTKEIGIRMSLGATRGQILFQFLTESSILTLIGGTAG
FT                   ILLGSLISYLISLLAGWPFSVSWQVIVGGLVFSVAIGIIFGILPANKASRLNPIECLRY
FT                   E"
FT   gene            complement(366763..367446)
FT                   /locus_tag="GC56T3_0355"
FT   CDS_pept        complement(366763..367446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0355"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bld:BLi01650 YknY; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25415"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI25415.1"
FT                   /translation="MIELKNIEKSYYLGDEPIPILKKINLKISKGEFVSIMGPSGSGKS
FT                   TLMNIIGCLDKPTSGDYIFEGQNVTNFTDKELARIRNRRIGFVFQQFHLLPRLTALKNV
FT                   ELPMIYSGHKSSTFREECAKNELKRMNLEERMFHLPNELSGGQKQRVAIARALINKPSL
FT                   LLADEPTGALDTSTSYEIMDIFKQLNKEGTTIIIVTHDEDIANFADRKIILKDGHIISD
FT                   TKVGK"
FT   gene            complement(367439..368587)
FT                   /locus_tag="GC56T3_0356"
FT   CDS_pept        complement(367439..368587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0356"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: bsu:BSU14350 putative efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25416"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADI25416.1"
FT                   /translation="MENKKRILIGVSVIAIIFLLVGVNVYIAFAGKPTVKTTTLQQRDL
FT                   SKTITTNGTVELKNVYKVYKDPQLGNISEVLVNENQEVKKGDPLLKYSNQQLILEIQQN
FT                   NIDIKSAYIKIDDLNKKEKRLREKLKELKEKNASDQVKENLQEQLDSIDTEKETANLNL
FT                   SYALKKKDILQKQENNLIVKSKITGTVIDVNDPNSQNYTQENLEPEPIIIIGDLNKLIV
FT                   KGYISEYDSLQVQKGQKVTLTSDVSPNKSWYGKIQQIGYLPVNYNSNNPVNNNDTGTAK
FT                   YPVFVEIVGNTEDLKPGFQLMMEIKTETKKVFSLPISSVIQSEGKYYVYVVKNGKLHKR
FT                   EVKVGIITEDNIEIKRGISLKEKVVLNPSKNLKDGMDVKVND"
FT   gene            complement(368705..369373)
FT                   /locus_tag="GC56T3_0357"
FT   CDS_pept        complement(368705..369373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0357"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH3124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25417"
FT                   /inference="similar to AA sequence:KEGG:BH3124"
FT                   /protein_id="ADI25417.1"
FT                   /translation="MVTEINLNQELRPKKGPTPKILGMFWNPSLQFKRIKENPRILFPL
FT                   FVVIVLQTGAMTFNAYTIKFDPSQFHGLNEQQLATAKQFAQITMIISGILLPILLILLF
FT                   SALHILFAKFTSSDVNFKQLFSMNTYIFIIGTAGLILNSLIRFLINGDMTLIVTSLGSI
FT                   IKTDGFSSKLLNAIEVFSIWRVILTYLGLKIVANLSKSFALIVAIIVFLGGILIGAVLG
FT                   "
FT   gene            369543..369656
FT                   /locus_tag="GC56T3_0358"
FT   CDS_pept        369543..369656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25418"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI25418.1"
FT                   /translation="MILEEMHTVDAPGDAAYWGGVAAGALITVGIGWLVFC"
FT   gene            369864..370955
FT                   /locus_tag="GC56T3_0359"
FT   CDS_pept        369864..370955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0359"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: cpy:Cphy_3579
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25419"
FT                   /inference="protein motif:PFAM:PF02163"
FT                   /protein_id="ADI25419.1"
FT                   /translation="MYLKIKDSLQFYKLDNGIYHVYDPTSMKHFRIGEQEVKWLKLLNG
FT                   ENSEEFLKKHIPEEFFEKFINQVKQLGLLEGQKVKKKFDLFKIKFTVLSVNDLLNKLGK
FT                   FSYIFRKFLKYFSGIFLFINFIFIALNFNNIRDILNNFHFDLSIIFFYLISVLTIGFLH
FT                   EFSHALVAKSYGVNVPNIGMMLFYLHPAFYADISGINLLSNKKARVSTLLSGILINNIL
FT                   LSMSVLSYHFLKDNHPNLSLYIIYFSIINLIMIFINIIPFVEFDGYYILINLFDEINFK
FT                   YNSIIQFKTFMKLKSLRGIKLEYLLYYVISNMMGLSMIWLAIIAIKNYVSDIFQFIYLD
FT                   YFFILLIILVTIYFYYIRNRRIT"
FT   gene            370952..372355
FT                   /locus_tag="GC56T3_0360"
FT   CDS_pept        370952..372355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0360"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   cpy:Cphy_3578 UBA/ThiF-type NAD/FAD binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25420"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ADI25420.1"
FT                   /translation="MKRDTKYNVNPYTAFFETDTAFIINSLDENRIVLPKTKRTYIDFL
FT                   LNNKLVSYSDLKTIMEDEEIEELIQKRVLLKDEVPLTEGRYSRQEGFFSLLTDNINKYK
FT                   DQIKNSQVLILGAGAIGTHVLWNLAAMGVKNITVVDYDIIEESNLNRQLFYDSNDIGKY
FT                   KVDVLKQKVNLYNPEVNLTVYNEKISSPKDLEKFIQGKTLVIKAIDSPDQVTEWINKIC
FT                   VKFKVPFIAGGFLDYEGIVGPIYIPNESYCAACTGLNNVKRLNRLFPSFAPLTTITAAK
FT                   LSMIAFKIITSDSINEIKNKVYVYNTKKANWRTISLKPTEKCSVCGNEPQINEKNLQTV
FT                   FYRFLVFLLAITVSLLNIFFRWNFMGIIALSILIGSLFYLRYLLKDNNAKIQKEIFNIS
FT                   CIYSITIIFINSIANIINKGFHLSNINDVFNIIQNIAVSFIQMGITISILFFILHICMS
FT                   GIIKMSGSR"
FT   gene            372361..372543
FT                   /locus_tag="GC56T3_0361"
FT   CDS_pept        372361..372543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0361"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsa:LSA1077 integral membrane cell division
FT                   protein, FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25421"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI25421.1"
FT                   /translation="MNNKKIGIIVCLAGLLTIISASSDKISKHTHIPQSYIIYFNIFCY
FT                   LVLFIFLYIIKRSMN"
FT   sig_peptide     372361..372432
FT                   /locus_tag="GC56T3_0361"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.651 at
FT                   residue 24"
FT   gene            372558..373468
FT                   /pseudo
FT                   /locus_tag="GC56T3_0362"
FT   gene            373468..374733
FT                   /locus_tag="GC56T3_0363"
FT   CDS_pept        373468..374733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0363"
FT                   /product="ABC transporter (permease) (Na+ exclusion)"
FT                   /note="KEGG: gwc:GWCH70_0635 ABC transporter (permease)
FT                   (Na+ exclusion)"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25422"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_0635"
FT                   /protein_id="ADI25422.1"
FT                   /translation="MELFWQVFKFSFIQKIKTRSFFLTTVITILFLSSIAWIPKLYNSL
FT                   VDDNNKKVVIIDEIGYIKQSINIIKKQVIKHYDVQIVSPVDVSKNKKLLNRDKIDCIIW
FT                   YKKKDGLPFLELMINGEKNLPFLNGLITYLRTQYTLTEMQLLNIPQNIQNQLTYQVEYK
FT                   IKDISDRSKEKSNMYAPIYIMSFLLYILIAIYGSNVATSVAGEKSSRIKEILITKVKPI
FT                   YLLYGKILGVGFAGLLQFIIILVGTYSIILMSTDGQEIELFSFKFDLTKLSIDTALFLI
FT                   FFFILGYIFYAALFAATGSLVSRSEDVNQANLPVSIIIMSAMILAILSMTDPTGKLAVF
FT                   GSYIPFFTPFLMFVRVGMVNLTIVQILVPIIIMLISTACVVWLSSKVYQIGVLYYGQPP
FT                   KITKVLKAIISNKQNKNLNYHI"
FT   gene            375022..376435
FT                   /pseudo
FT                   /locus_tag="GC56T3_0364"
FT   repeat_region   375103..376509
FT                   /note="region with at least 95 percent identity another
FT                   region of the genome"
FT   gene            complement(376734..377363)
FT                   /locus_tag="GC56T3_0365"
FT   CDS_pept        complement(376734..377363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0365"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gyc:GYMC61_1174
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25423"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADI25423.1"
FT                   /translation="MELLQTFIERKNDIWIAFQEHVLLSAIAMGIAIVIAVPLGVALTR
FT                   HRKLAEPIIGVAAIIQTIPSLALLGFMLPIFGIGKLPAIIALMLYALLPILRNTYTGIL
FT                   GVDPALVDAGRGMGMTSRQILWMVELPLSLPVIMAGVRTATVLTIGVAALATFIGAGGL
FT                   GDLIDRGLRIADKNLILAGAIPAAILAIAFDWLLRKVEKKVTPKGL"
FT   gene            complement(377588..380648)
FT                   /pseudo
FT                   /locus_tag="GC56T3_0366"
FT   repeat_region   378026..379383
FT                   /note="region with at least 95 percent identity another
FT                   region of the genome"
FT   gene            378194..379861
FT                   /locus_tag="GC56T3_0367"
FT   CDS_pept        378194..379861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0367"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   gyc:GYMC61_1559 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25424"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADI25424.1"
FT                   /translation="MYIRRVTRKNKDGTTVAYLQLAHNEWDPKAKYAKAKVIYSFGRED
FT                   EVDRAVLERLAKSISRFLSPEQAWEIETLTGEVSDDFQFQSSKHLGGVWLLDQLWRQLG
FT                   LGEILHSLFTSRHHQISLERLIFAMVANRALHPSSKLAMEEWVEKDVYIPHLPQAASHQ
FT                   LYRAMDELLAVQPELERQVFHAVADLLNLEVDLIYFDTTSSYFEVDPSETPEGESLRKQ
FT                   GFSKDKRPDLVQIVIGLAVTREGIPIRAWVWPGNTMDMTVIKQVKQDLIGWKLGRVISV
FT                   MDRGFSSEENLRILQQAGGHYIVGEKMRSGKAAVEEALSRRGRYQQVRENLHIKEIIVG
FT                   DGEARQRYVLVYNPSEAERQRKERETLLESLKEELEGLRQLPNEAHHKATCRLRSHPSY
FT                   GKYLRQLKDGTLRIDKQAVREAEKYDGKYLIRTSDDTLSAEDVAIGYKQLVDIEQAFRT
FT                   LKSTLELRPMYHRLEDRIRAHVLLSWLALLLVRIVEIRTHESWPKVRDECERLMLGHFS
FT                   SKNGDLYQRTELTAKQAQLFTALGLEPPPKILGIHPRA"
FT   gene            complement(380665..381567)
FT                   /locus_tag="GC56T3_0368"
FT   CDS_pept        complement(380665..381567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0368"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: gka:GK0315 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25425"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ADI25425.1"
FT                   /translation="MLRKWIRSLLAVGLVFGLAACNGTSDAKGKIVISGKKFTEQVILT
FT                   HLLTEYVKAHTDLDVEVKDSLGGAFMLQQAIENGDVDMYVEYTGTGYLNILKQPYDPKK
FT                   TPEQIYNVTKKLYKEKYNIAWLKPLGFNNTYALALRKDLAEKLGVKTYSDLAKHSSSLT
FT                   FGSDAEFFERSDGYDGLVDTYGFQFKKKVTIDPDLQYEAAKNGEIDVITAYTTDARIKK
FT                   YDLVVLKDDKHYFPPYHAVPIIRQEVLDANPGLEEKLNKLANILTDEKMMELNGQVNLE
FT                   GKRPREVAIDFLKSEGLID"
FT   sig_peptide     complement(381484..381567)
FT                   /locus_tag="GC56T3_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.848 at
FT                   residue 28"
FT   gene            complement(382001..382816)
FT                   /locus_tag="GC56T3_0369"
FT   CDS_pept        complement(382001..382816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0369"
FT                   /product="coiled-coil protein"
FT                   /note="KEGG: gka:GK0316 coiled-coil protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25426"
FT                   /inference="similar to AA sequence:KEGG:GK0316"
FT                   /protein_id="ADI25426.1"
FT                   /translation="MEALLREILHEVKATRAAVESLEQRVGALEGQVAQLNERTGALEA
FT                   QMTKLNERTSVLERQVAQLNERTSALEQQFTQLNERTSNLEHQVAHLNERMGTVEHQVA
FT                   QLNERMGTIEHQVAQLNERMGTVEHQVAQLNERMGTVEHQVAQLNERMGTVEHQVAQLN
FT                   ERMGTVEHQVAQLNEQTATLAQRIDLLDERTNETKAIVEALRHGQEVLTAKYEAMAHDL
FT                   HHMKGDLTHITSILEDKVLPALAEHEAGLHVLNARVFKTESTLHRLVHA"
FT   gene            382962..384452
FT                   /locus_tag="GC56T3_0370"
FT   CDS_pept        382962..384452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0370"
FT                   /product="hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   gyc:GYMC61_1178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25427"
FT                   /inference="protein motif:PFAM:PF09660"
FT                   /protein_id="ADI25427.1"
FT                   /translation="MDATWLKPIVETKYLSTENAHRYRAILRYFYIQHERMRQYLFPEE
FT                   VYAFLKQHEEFADYTEDDLQQDLDQLVKWNNLIARQETAHVRTIEEFKKKRFRYQCSPY
FT                   TVEIERMIRTLEQLGDSFGGSLEKTRFDRLYASLSRMEAIIASDFQEQADEMHQVWEET
FT                   FDYFKKIIQNSADYIAYLHSENLEERMTSESFLVYKEQFTAYLRDFIVALQKTSMQIEQ
FT                   LLEDLPEEGVRQFIEHVVDYERSIPRFADALPPRAVQIEEKWETWRSLCEWFLGRDGRE
FT                   SELSFLQYQTNEAIRRLTRVVQRLGERHHHFRSRKGDYLHLARWFSRLESIEEAHCLSA
FT                   VVFGCFHTKHLVADFGATDNIYRDVWDEPPAEWVTKPRVRHYGEKKKPQAIEDKEREKE
FT                   EARLRYLEEKEREEAALRQLVTDGKIVLADLPEVTPYVRKTLLGWIAKAMGREGQAMKT
FT                   ENGWVVKVVNKDGTICLRAEDGELVMPNYEIHVLSGGE"
FT   gene            384455..385651
FT                   /locus_tag="GC56T3_0371"
FT   CDS_pept        384455..385651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0371"
FT                   /product="hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   gyc:GYMC61_1179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25428"
FT                   /inference="protein motif:PFAM:PF09661"
FT                   /protein_id="ADI25428.1"
FT                   /translation="METAFDDKAKEALAALFEQFWIIRDKEPDLYQLVREREHVLKRYV
FT                   EEKFGYRLIVHRYFAKLEKIPAEPEPWMGIESFQEPLDYALFCCLMAYLEGKAVEEKFL
FT                   LSDVCEEIRAMYPGDLPVDWTNYSHRRALIRVLKTAEQIGLVRRMDGEIEAFAQHVEEE
FT                   ALYEVPVLARYFMRTYPKDLLQYESIDELLAEEWKASPQDYRRHRLYRKLFLSPAVHRT
FT                   EGDEQDFYYLRNFRHRLRDDIEAHTPFRYELYKNAAMLTLPERQAPYTVFPDQKGTSEI
FT                   ILHFAALVRERLREYPPDEYGRIRLTPEQFSAWLADCRRRYGAGWGKTYRDMSAAELVR
FT                   EMLAALNEWRMADVEHDTGMIVLYPLLGRLCGRYPDDFDAKEGEEHGESMGSSSRRID"
FT   gene            385611..389732
FT                   /locus_tag="GC56T3_0372"
FT   CDS_pept        385611..389732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0372"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; KEGG: gyc:GYMC61_1180 SMC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25429"
FT                   /inference="protein motif:PFAM:PF02463"
FT                   /protein_id="ADI25429.1"
FT                   /translation="MANPWVLHRAGLINFWYYDEQYFHFADGKLLLRGSNGAGKSVTMQ
FT                   SLIPVLLDGKKTPDRLDPFGSRARRMEDYLLGEKDVVNRDERTGYLFLEYKRKESDQYV
FT                   TTGIGLRAKRQKSLDFWGFVLFDNRRIGYDLQLYKQEKTGEKIPLTKRELAALLGAGGT
FT                   VVETQKEYMELVNKHVFRFESLEAFQELIELLIQLRSPKLSKDFKPTVIYEILESSLPP
FT                   LTDDELRHLSETIENMDQAKQQLEQLERDERALKRLCDQYRLYNEYMIAEKAAEYVKAV
FT                   KQAEQLAAEQHRLHDEEEQARKTLGELDESIIRLRREEDVLRSREIDLAGHEVFQQAEK
FT                   YEQLKAERERLQERRERHEQTIAEKERLERQHRRRLDESEARLNDLERKLEDELAQLRA
FT                   DAEEGAFSLHETNEDDFHRHRQKQQEFSFAAWKQEADRHIERLEELARLWRRHDDVKRR
FT                   YEEASNEASERRREMEEWRHQQRKWEELFEQEKERFEQAVLAWVEQGGIDVSETDIQAF
FT                   LQQMGSLYEQYSLDDLKRPFVQAYYDAVGKKKDEKWRLEHDIRLLEEKQAEREAELRQW
FT                   REQRDPEPERDEQTTAARLALEQEGIPFVPFYAAVEFVDDVPDDVRERIESALSHAGLL
FT                   DALIAARDVDVDCDRVLIPKPVHMAHTLADYLRPDADAPVSAERIDEVLRSIVITDAEQ
FT                   EGGMTIDETGRYSLGLVRGHAPRRARAMFIGRAARERWRLENIAALEAEIAALGQEIDR
FT                   LSGEHQAVEAAIRALADWFVSFPSDRDVRTAFEEGQEARRQAESKEREWKRQEEKAALL
FT                   AREWKQIKQQLHDESAELDLAFTLDGCEQAQLAMKSYVRHLHELEVLYRETRHTEAMIA
FT                   QQRERLAALETEIDEAKGERNRLRDDEERISLEIAEMERTLAQMGADDIRAEIARIQER
FT                   LAFLRQEIPRLVNERARTEQRLMRLVEEREKGAQREAFACQLAAMWERSFADEAALGLV
FT                   DLDRSRSLLEQAKEAKQRYEAVLKETRSSLLARLNTVFFQESSNLTEYRATFERLAEQK
FT                   EPEWIAAAPDDEMAMKAADWREKQERHVIYLDYKGERATPFAVLAEVERDIALQHEYMK
FT                   EQDRELYEDVILKSVGRILRSRIQRAERWVSDMNKLMGGLDTSSGLVLSIQWKPKTAET
FT                   EAELDTKELVRLLRIDSRLLREEDLQRVTNHFRSKIARARELLEERGQGNTLHQIIKEV
FT                   LDYRKWFAFTLYYEKANEPKRELTNHRFYQFSGGEKAMAMYIPLFAAAYSRYQEAGDDA
FT                   PYIISLDEAFAGVDENNIRNMFGLVEQLGFNYIMNSQALWGDYDTVSALSICELVRPRN
FT                   ASFVTVIHYRWNGRIKQLVIDDKEWELMET"
FT   gene            389729..390949
FT                   /locus_tag="GC56T3_0373"
FT   CDS_pept        389729..390949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0373"
FT                   /product="hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   gyc:GYMC61_1181 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25430"
FT                   /inference="protein motif:PFAM:PF09664"
FT                   /protein_id="ADI25430.1"
FT                   /translation="MSAVKEAAAFFRSEPGFHRLFIEMKRKYESLGRVGGVVSLAAFSE
FT                   EERAAVAAFFGKDVSRVSLSDFEKQLEQTRFAGVGLVELLEHYFGVPLMSNKERRQAEA
FT                   EERERFFARLAEEHHWFAAVRGQRFVQGAYETDRDGLEAAVRLISAALCRLPLSSYMRL
FT                   PLFAQQVASDPHAFDLSTLPGRLLLSALQATTPGQWDVTSVESVNELLQSVGLLREDIL
FT                   NFVTCANILAETEGGPHPVFSAASETNTALNMPLRDVLSLVSVRPARGGTVYIVENAGV
FT                   FSTLLDTRAPLVSTNGQMNLATMKLLDLLAASGAKLYYSGDFDPEGLAMAERLLERYGQ
FT                   SVTLWRFSLDDYAAANPVVDLPSERLAKLASVTSAPLQPLKEEMKRKKKAGYQEAIIGR
FT                   LTEDING"
FT   gene            391094..392008
FT                   /locus_tag="GC56T3_0374"
FT   CDS_pept        391094..392008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0374"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25431"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1182"
FT                   /protein_id="ADI25431.1"
FT                   /translation="MAKQRIDHDRLFKELLSTFFEEFLLLFFPNVYEHIDVHRLSFLSE
FT                   ELFTDVTAGEKHRVDLLVETKVKGEDGLVIVHVEHQSYAQRTFPERMFLYFSRLFQKYR
FT                   RRIVPIAIFSYDEHHDEPSSLIVQFPFLKVLDFRFLTVELRKQPWRQYIHQDNPVAAAL
FT                   LSKMGYNEEEKVEVKKEFLRMLVRLELDEAKQRLLFGFFETYLRLSEEEEAKLRNEVSQ
FT                   METKEAKQVMELIISYEQRGMEKGIQQGMEQGLKQGMKQGRQKGIEEGKLDVVKRMLAK
FT                   GYDVDTIHELTGLPVEKIERVKG"
FT   gene            392530..393579
FT                   /locus_tag="GC56T3_0375"
FT   CDS_pept        392530..393579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0375"
FT                   /product="peptidase S58 DmpA"
FT                   /note="PFAM: peptidase S58 DmpA; KEGG: gyc:GYMC61_1200
FT                   peptidase S58 DmpA"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25432"
FT                   /inference="protein motif:PFAM:PF03576"
FT                   /protein_id="ADI25432.1"
FT                   /translation="MMRRKLRDLGFSIGTLPTGERNQITDVPGVRVGHVTIREDMDERT
FT                   VIRTGVTAVLPHGGNWFLEKVPAACFVLNGFGKTVGLVQVEELGLIESPIMLTNTFSVG
FT                   EVWQGTLEHMLAMTPEIGDTTGSVNIVVGECNDSYLNTARVMAVTKEDAKQAIATARVD
FT                   MEEGAVGAGTGMMCFGWKGGIGSSSRIAGGMYTVGALAVSNFGRREELRLVPYVPPSFD
FT                   ERDVPPGSIMMIVATDAPLDARQLKRLAKRAAVGLARTGSHVHHGSGDIVIAFSNAYMI
FT                   PHFADSSHQPLPPLVRDDAPLMNELFQAAIEAVEEAIWNSLTMAEATTGRNGRVGEAIP
FT                   YSLLQRMGR"
FT   gene            complement(393639..394871)
FT                   /locus_tag="GC56T3_0376"
FT   CDS_pept        complement(393639..394871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0376"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   gyc:GYMC61_1203 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25433"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADI25433.1"
FT                   /translation="MNWKRNVRILWLCNFMVSAGMTMVIPFLSLLLWEMGVTEHHSLSV
FT                   WTGLVFSATFLSAAIMAPIWGMFADKYGQRANLIRAGIGMGLITSCMAFAHSPMALLVL
FT                   RFLVGFFSGFITVSFSYLARVVPKDHSGEALGTLQTGSIAGNIIGPLIGGALSDWFGFR
FT                   PVFLVTGFCILATLLPVVFWLDKDPVAPQTQERHASFKEVFAHRPLVILFVATFLVQIA
FT                   VLGVNSMMTIFVQSLVGDSRNLAFLSGLASSITGIATIIGAPYLGKLGDRIGQEKTLPM
FT                   LLLLSGLFALPQVWTDHLYELYVWRFLQGLVVGGVWPSIQALINAQCPRRIQGRVFGVT
FT                   ASSRFLGNLTGPTAAGAIAGFFSISSIFALSGLFLIATGALVGYATHDRAWREEMKEKI
FT                   AAWAHRLHIRH"
FT   gene            complement(395117..395770)
FT                   /locus_tag="GC56T3_0377"
FT   CDS_pept        complement(395117..395770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0377"
FT                   /product="phage shock protein A, PspA"
FT                   /note="PFAM: PspA/IM30 family protein; KEGG: gka:GK0325
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25434"
FT                   /inference="protein motif:PFAM:PF04012"
FT                   /protein_id="ADI25434.1"
FT                   /translation="MGIFRRMKTIVLAEVNEQIDRWEDPVAMTKQYLRELEKQLERGRQ
FT                   ALAQQWVAERRYETLIAQAEATIEKRSRQAKLALERNEEAVAKLALRDKLLYEKKLEAY
FT                   KQQYDAIKAKTAEVANRLNQLRERYDELAAKQLELATRVNAAQALKQIDSALASFSADE
FT                   ALRGFARMEERVIALEAEAAAARFGTNAVLSPLPFDEEVERELAKWKDAQAHNA"
FT   gene            complement(395730..396260)
FT                   /locus_tag="GC56T3_0378"
FT   CDS_pept        complement(395730..396260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0378"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: gyc:GYMC61_1205 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25435"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1205"
FT                   /protein_id="ADI25435.1"
FT                   /translation="MTRSKKARAVFLLSLVALAGVSLFHVLTPHEVMAHGRPGAMFDGM
FT                   HGGFGHHRPEFGMGPRGGWMMAGLLMWLIPLLLVGAGAIWLAAARSKRWIGWVLVAVGI
FT                   AALLPKWVLILLALAAVYASGRRQARKPSAVEALMPAAPSVSTDWLDEWEKSIQKEDQS
FT                   NGYFSPNEDDRSR"
FT   sig_peptide     complement(396156..396260)
FT                   /locus_tag="GC56T3_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.750 at
FT                   residue 35"
FT   gene            396433..396816
FT                   /locus_tag="GC56T3_0379"
FT   CDS_pept        396433..396816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0379"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1206 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25436"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1206"
FT                   /protein_id="ADI25436.1"
FT                   /translation="MVRSYGFDVVGALLVWLFSFLFSTFNVGYYAYGSFLWFAIGSLIV
FT                   GLARIRWHPQARFGGTLIGSFLIIAVSVLIIRLFPIEIRDVGDLVMPYVNAIVNALIYF
FT                   MITNALHLLHCLTQGNASFWKKR"
FT   gene            complement(396914..397615)
FT                   /locus_tag="GC56T3_0380"
FT   CDS_pept        complement(396914..397615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1207 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25437"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1207"
FT                   /protein_id="ADI25437.1"
FT                   /translation="MRRFSFCFLSSVFLLVIALFSPTSRVGAEQFIQNKVKLKNVFVDI
FT                   HYDKSQVNLVRTEDQNSTKISLVDKKSGKILETYGEIIQPLEQVATKTVGMNDASVANA
FT                   SGTYSISTVYRERNDGPAVSRLSTQLYIYSYDSFRQINKVLNTWWSEASGGSWYLTRDV
FT                   ANTVSMTGSFPTTKVQTSGSATIEVKTSYSITGSFSISALKEAGFTYGYSSGSDIYYRK
FT                   PINLGFVYSLY"
FT   sig_peptide     complement(397532..397615)
FT                   /locus_tag="GC56T3_0380"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.516 at
FT                   residue 28"
FT   gene            397971..398381
FT                   /locus_tag="GC56T3_0381"
FT   CDS_pept        397971..398381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0381"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1208 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25438"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1208"
FT                   /protein_id="ADI25438.1"
FT                   /translation="MKKLYSLLSILLLCVCGAVIFFQTSAKTDFNRKEVEVIRVTSRME
FT                   DFSSIYEIRDKRKVNRIIEIMKFVEWSKTAKVDEGQPDYRFWLEHPKTKDRLFNYNIWF
FT                   KKNNTMIFDKKTGKYGVVPSKYETELKSLLNE"
FT   sig_peptide     397971..398051
FT                   /locus_tag="GC56T3_0381"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.962 at
FT                   residue 27"
FT   gene            complement(399102..401411)
FT                   /locus_tag="GC56T3_0382"
FT   CDS_pept        complement(399102..401411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0382"
FT                   /product="YhgE/Pip C-terminal domain protein"
FT                   /note="TIGRFAM: YhgE/Pip C-terminal domain protein;
FT                   YhgE/Pip N-terminal domain protein; KEGG: gyc:GYMC61_1210
FT                   YhgE/Pip C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25439"
FT                   /inference="protein motif:TFAM:TIGR03062"
FT                   /protein_id="ADI25439.1"
FT                   /translation="MHAFQLWMQELKAVTSNRKVLIPIMAVLFIPLLYSGMFLWAFWDP
FT                   YDHLDELPVAVVNKDKGTTFEGKEFHLGDDLVEKLKEKKQFDWHFVNEREGEKGLKEQK
FT                   YYMLIQIPEDFSQNATTLQDDHPKKLQLIYKPNEGFNFLSAQIGGTAVEKIKTEVAKTL
FT                   TETYAENMFENIQTLADGLTKASDGAKQLHDGLSEAKNGTNKLYDGMKKAQDGSKDLHH
FT                   HLATLAEKSIAFTDGLHQAANGSAQVQTGVQMLDNGIKHMVDGQGQLLDGAKQAQEGTA
FT                   NLALGAKRVYEGMQALDARMPQLLQGSEQLSVGAEKLASSLAQWQQGATQVQTGATQVT
FT                   GGLERLTAQLDALIAQTPDPTQKAVYEQLKENVVKLSLGSKQIENGIAQLNDGTKALQS
FT                   GAASLSGGAKQLHEGHIALDQGVNKLLSGQQQLVNGANALANGQEKLVAGMNTLHEKMK
FT                   EAEQGADKLANGGQTLTSGLQVLAQGADRLQDGAHQLADGSQQLASGMNELTSGTRDLQ
FT                   DGMNRLTDGSEELADKLKEGAKKASDVKANEDVYDMFAEPVKVKNEKVNEVPNYGTGFT
FT                   PYFLSLGLFVGALLLSIVFPLREPAGVPRSPFHWFFAKFGVLIGVGILQALLADSVLLY
FT                   GLDLQVKSVPFFILFSVVTSITFLSVIQFLVTTFGDPGRFIGIVVLILQLTTSAGTFPL
FT                   ELIPRSLQHFNAWLPMTYSVFGFKAVISSGDFSFMWENIGKLLLFIVAMMVGTMAYFTM
FT                   QHRRQFATAVEQASEA"
FT   gene            complement(401489..402058)
FT                   /locus_tag="GC56T3_0383"
FT   CDS_pept        complement(401489..402058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0383"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: gyc:GYMC61_1211
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25440"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADI25440.1"
FT                   /translation="MSDKKKQIIDAATKSFSLFGYKATTMDQVAKMAKVGKGTIYTFFK
FT                   SKEELLEDIVSSVIFEIKREADAAIDHRLSFNENVQRALQRIFTFRKEHELTIKLLQEV
FT                   RDIGTPAVRDVMKRLDREMIAYIREKIEEAMAKGQVRSCDSKLMAFLMFKMYIALNIDW
FT                   GKEYEPLSQQKIAELFDLYLLKGLSP"
FT   gene            complement(402417..403790)
FT                   /locus_tag="GC56T3_0384"
FT   CDS_pept        complement(402417..403790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0384"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: gyc:GYMC61_1212 integral membrane sensor
FT                   signal transduction histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25441"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADI25441.1"
FT                   /translation="MINRWNEWRDWLRRLGSADLFRRAHWRLTALYSGIFTLFLALFIM
FT                   IAAALFYWIATSDQERRISRLAEQEANTIEQVLLKQSNFDLFDDENVILLSEDQLFFYV
FT                   ISPDGGLLAGDEVHPRLRPYFLNALSHLKANERAPVYMSVSLPEHMPGLAREAARDWRV
FT                   LAAARPLVIHGDFVGMLYIGMDVTSFFGVFHWLLIVLIGLAVLFLAVGVALSFFMSKRA
FT                   LAPIEEAYERQRQFVADASHELRTPLSVVFSSVEALSLEEDVMKNDFARRLLDRLRDEL
FT                   KRITKLMNDLLTLARADAKHAALELSKQTFDFRPHAERTFQLMSELAAKKQITMHFHAP
FT                   EQALVTADPDKLTQLLYILLDNAIKYTPEGGEVTLSIRTEPKHVFLSVKDTGIGIPPED
FT                   IGRIFDRFYRVDKARSRQQGGHGLGLSIAKWIVEAHGGKIHVQSQLGQGSEFLVRLPV"
FT   gene            complement(403771..404442)
FT                   /locus_tag="GC56T3_0385"
FT   CDS_pept        complement(403771..404442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0385"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: gyc:GYMC61_1213 two component transcriptional
FT                   regulator, winged helix family; PFAM: response regulator
FT                   receiver; transcriptional regulator domain protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25442"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADI25442.1"
FT                   /translation="MKILLAEDDLHLGELIVHLLKKKGIDHIDWVQEGEDAYDYAMAEF
FT                   YDVVVLDWMLPNGDGVDICRRLRQNGYTGAILMLTAKDAVQDRVTGLEAGADDYLVKPF
FT                   EIDELVARLKALARRTFVPLQEEKVAFHGFTLNRTSHTLHRGDEEIFLTPREFQLLDLL
FT                   VQNQGQVVPRETILDRVWGWDADVSMKTIDATIKLLRKKLKDDVIQTVRGVGYKIDKSM
FT                   E"
FT   gene            404621..405046
FT                   /locus_tag="GC56T3_0386"
FT   CDS_pept        404621..405046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0386"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: gyc:GYMC61_1214 PepSY-associated TM helix domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25443"
FT                   /inference="protein motif:PFAM:PF03929"
FT                   /protein_id="ADI25443.1"
FT                   /translation="MRKMRNLHLWIGLISSIFLLVEAVTGLLLSEPWLIGQAERGEMHR
FT                   AAQEGMNAFGAGQTSGAGASTAPMAPRAEGGGSSLMMFVRQLHEGRIGSLDIRWAVDVA
FT                   AVAMIILTATGIFLSIRTLAAGRRRKQKRMTPAPETT"
FT   sig_peptide     404621..404692
FT                   /locus_tag="GC56T3_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.803) with cleavage site probability 0.727 at
FT                   residue 24"
FT   gene            405236..406441
FT                   /locus_tag="GC56T3_0387"
FT   CDS_pept        405236..406441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0387"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="KEGG: gka:GK0332 serine protease Do; PFAM: peptidase
FT                   S1 and S6 chymotrypsin/Hap; PDZ/DHR/GLGF domain protein;
FT                   SMART: PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25444"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ADI25444.1"
FT                   /translation="MDMMPFEPTPTPEPKRRGRFVSWLAASVAGAVIGSAATWYVAPKW
FT                   MHEETNSQTETAETTAKSEALPLQPTANVKTNMIDAINKVADAVVGVVNIQKQVDFFSD
FT                   QAQDTEAGTGSGVIFKKEGNVAYIVTNNHVIEGANKVEVALANGKKVNAEIVGADALTD
FT                   LAVLKIPAEGVTNVASFGDSSKVKIGEPVAAIGNPLGLDLSRTVTEGIVSGKRTMPVST
FT                   SAGDWEIDVIQTDAAINPGNSGGALINSAGQVIGINSMKIAETGVEGLGFAIPSENVKP
FT                   IVEQLMKDGKIKRPYLGVQLVDVADLSDDVRTDELKLPSNVTYGAAITSVEPFSPAADA
FT                   GLKSKDVIVAINGQKIDSVSALRKYLYTKTLVGDRIKLTIYRDGFETTVSVTLKARDSS
FT                   QS"
FT   gene            406862..407587
FT                   /locus_tag="GC56T3_0388"
FT   CDS_pept        406862..407587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0388"
FT                   /product="Uncharacterized distant relative of cell
FT                   wall-associated hydrolase-like protein"
FT                   /note="KEGG: cbe:Cbei_3683 cell wall-associated
FT                   hydrolase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25445"
FT                   /inference="protein motif:COG:COG3863"
FT                   /protein_id="ADI25445.1"
FT                   /translation="MNKSFLLSSIVALGLIGTSGVPMVYAQGDAQVNKAKIQIEQEMEK
FT                   KQREERQEIINLINEPVDQEAVKKEIEWMKKNAPDKYNQIISGQQTKGVSALASSGALG
FT                   TNGDILITYDSGSSGWNYGHAAIVRWDGEYIIEAWPGDGVRYYVNNWKTRWKTWKGLWV
FT                   KGAMGEDYTSAQSYARAQIGEPYSLTATKGQSSKWYCSLLVWKAWENRGFDLDDDGGII
FT                   VTPSDLDQDPETITYASSN"
FT   sig_peptide     406862..406942
FT                   /locus_tag="GC56T3_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.914 at
FT                   residue 27"
FT   gene            407851..409239
FT                   /locus_tag="GC56T3_0389"
FT   CDS_pept        407851..409239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0389"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25446"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1219"
FT                   /protein_id="ADI25446.1"
FT                   /translation="MGPSAPLWMSIVYDVMCIATLIVGVVMLVKGTIRRWYSLVAVLVV
FT                   PLFFLNNFNTIARVGVDPFAYWQQSLIEGQWWAWLSLALFLYIVWYWGWLVQCIGDKKE
FT                   GKAWWKRQRWIWVVLAAAAPVIVYGVQSLDDSVVSSVRTYEPSKSHSANDPSARIFFLY
FT                   SHPLGRESYIVETDGRRVRNVVTLKAVGISHLSPASSTKELLLWSDYTGRYVYQLNPDT
FT                   WTVVDQEAVSVPLSFASLEGEWEIRSLNQDVKTNKLEVRKEGKLLFSKRFPPYVLQVLR
FT                   AEPYFYVFVDVVEKEQGVLYVVDQRGALVKEIPLLTSSARSMARFHDRIVIATKPRLTI
FT                   VDPHSWRVTYWDMGQEEARFDQLYVKGDTLWVSYVQRGKSGWLALNDQFKVMEKHELPS
FT                   VYWEARFHDDYVYVLFEPQEGNKADHAGEMNIFQLRTAQLAAKFTVPKQKHHLQTFQVM
FT                   DEIQ"
FT   gene            409250..409618
FT                   /locus_tag="GC56T3_0390"
FT   CDS_pept        409250..409618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0390"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25447"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1219"
FT                   /protein_id="ADI25447.1"
FT                   /translation="MTIGPSMPLWMSIVYWAIGIDTFIAGMVTLIAGTIHRLYTLAVVL
FT                   AVLLFFLNNFHTIARVGVDEFDYWQQSLVEGQWWAWLSLALFLCMIGYWVLLARRIRER
FT                   RAASAEAKGGKEDGIPRL"
FT   gene            409599..409961
FT                   /locus_tag="GC56T3_0391"
FT   CDS_pept        409599..409961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0391"
FT                   /product="Protein of unknown function DUF2253, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2253, membrane;
FT                   KEGG: gyc:GYMC61_1220 protein of unknown function DUF2253,
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25448"
FT                   /inference="protein motif:PFAM:PF10010"
FT                   /protein_id="ADI25448.1"
FT                   /translation="MEFRDYEEFWPFYLTQHRKPATRRWHFAATSFVFLFVIIAIVTKN
FT                   AWWLLGAPIAAYALAWFSHFFIEGNKPATFGHPLWSLRADFHMYGLMLTGRLGRELERI
FT                   GLSEDRAVSQNGWEQR"
FT   gene            complement(410059..410937)
FT                   /locus_tag="GC56T3_0392"
FT   CDS_pept        complement(410059..410937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0392"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25449"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1221"
FT                   /protein_id="ADI25449.1"
FT                   /translation="MSETRIDHDRLFKELLSTFFEEFVLLFFPHVHEQIDFHYLSFLSE
FT                   EVLTDVTAGEKHRVDLLVETKLRGEDGLIVVHIEHQSYIQSSFSERMFIYFSRLFQKHR
FT                   RRILPIAIFSYDAIRDEPSSFTVSFPFLTVLDFRFLTVELSKLPWRTYIRHDNPVAAAL
FT                   LSKMGYNEEEKVEVKKEFLRMLTRLELDEARQRLLFGFFETYLRLSEEEEVRLRDEVKT
FT                   MEEKEAAKVMELIVSYEQKGMEKGIEKGMEKGMEKAKLDVAKRMLAKGFDADTIHELTG
FT                   LPLEKIEQLKK"
FT   gene            411143..411679
FT                   /locus_tag="GC56T3_0393"
FT   CDS_pept        411143..411679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0393"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK0339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25450"
FT                   /inference="similar to AA sequence:KEGG:GK0339"
FT                   /protein_id="ADI25450.1"
FT                   /translation="MFSHSPEVVYGWVLVVSALLTVLYFFFSDVLDGLFDVADHPLFSP
FT                   QLVLSFFIVGSAVGLLAEWYTDWASSLVLWLAIGAALVVVLLLHFFVFLPLRSAEASLG
FT                   YTDADLEGALAKVIVSVPPDGFGEILISRKSGAVAKPAKSANNEAIPSGEEVIIVQMEN
FT                   GVAVVARHDPYQLSI"
FT   gene            411701..413221
FT                   /locus_tag="GC56T3_0394"
FT   CDS_pept        411701..413221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0394"
FT                   /product="band 7 protein"
FT                   /note="KEGG: gyc:GYMC61_1223 band 7 protein; PFAM: band 7
FT                   protein; SMART: band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25451"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ADI25451.1"
FT                   /translation="MTVAPWLIVIGVVVLLLVGLIAIFIARYRTVGPDEALIVTGSYLG
FT                   SKNVHVDESGNKIKIVRGGGTFVVPIFQQAEPLSLLSIKLDVQTPEVYTEQGVPVMADG
FT                   VAIIKVGSSIGEIATAAEQFLGKTRQDMENEAKEVLEGHLRSILGSMTVEEIYKNRDKF
FT                   SQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLDALGKPRIAQVKRDADIATAEAEKE
FT                   TRIKRAEADKEARKAELERLTEIAEAEKINQLKLAEFRREQDIAKARADQAYHLEEAKA
FT                   KQEVMAQQMQIKIIERQKQIELEEKEILRRERQYDSEVKKKADAERYAIEQKAAAEKAK
FT                   QIAEADAQKYRVETLAKAEAERVRLDGLAKAEAEKAKGEAEAEIIRLKGLAEAEAKQKI
FT                   AEAFERYGQAAVLDMIIKMLPEYAKQVASPLSNIEKLTIVDTGSGSGGGANRVTGYATN
FT                   LMASLQETLKASTGIDVKQLLENLTASGASSAVTAKPTVSEEANGSQS"
FT   gene            413361..414284
FT                   /locus_tag="GC56T3_0395"
FT   CDS_pept        413361..414284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0395"
FT                   /product="diacylglycerol kinase catalytic region"
FT                   /note="KEGG: gyc:GYMC61_1224 diacylglycerol kinase
FT                   catalytic region; PFAM: diacylglycerol kinase catalytic
FT                   region; SMART: diacylglycerol kinase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25452"
FT                   /inference="protein motif:PFAM:PF00781"
FT                   /protein_id="ADI25452.1"
FT                   /translation="MMKRARIIYNPTSGRELFKRHLPDVLVRLEKAGYETSCHATEGPG
FT                   DATNAARQAVLREFDLVVAAGGDGTINEVVNGIADQPHRPTLGVIPVGTTNDFARAIGV
FT                   PRSIEGACDVIATGEPVPIDIGCVTNEDKTRYFINIAGGGRLTELTYEVPSKLKTMLGQ
FT                   LAYYLKGIEMLPSIKATEAQIEYDGKLFEGEIMMFLVSLTNSVGGFEKLAPDSSLNDGL
FT                   FDFIIVKKTNLAEFIRLVTLAARGEHINDPHIIYTKANRVKVRSPMQLNLDGEFGGMLP
FT                   GEFVNLYRHLEVIMPKDKAEQVRTGR"
FT   gene            414363..415736
FT                   /locus_tag="GC56T3_0396"
FT   CDS_pept        414363..415736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0396"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="KEGG: gyc:GYMC61_1225 RNA methyltransferase, TrmA
FT                   family; TIGRFAM: RNA methyltransferase, TrmA family; PFAM:
FT                   deoxyribonuclease/rho motif-related TRAM; Methyltransferase
FT                   type 11"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25453"
FT                   /inference="protein motif:TFAM:TIGR00479"
FT                   /protein_id="ADI25453.1"
FT                   /translation="MTKQQAPVAKNEYYDVVFTDLTHDGLGVAKVDGFPLFVKNALPGE
FT                   RANVKVVKVKKGYGYGRLIELYEPSPDRVEPPCPVYRQCGGCQLQHVSYEGQLKAKEKQ
FT                   VKEVLARIGKLDGVTVHPVIGMKNPWRYRNKAQVPIGEREGGLVAGFYKERSHEIIDMD
FT                   ACLIQQEKNDVVVQTVKRIAERYGIPPYDETTHKGVLRHIVARYGAATGEVMVVLVTRT
FT                   EHLPHEQEIVRAIVREIPDVTSIVQNVNPERTNVIFGAKTRVLWGSEFITDRIGGIQFA
FT                   ISARSFYQVNPEQTKVLYDKALEYAELTGRETVIDAYCGIGTISLFLARKAKHVYGVEI
FT                   VPEAIEDAKRNAKPNGIQNVTFEVGAAEDVIPRWYEEGIRADCLVVDPPRKGCDASLLE
FT                   TIIAMKPPRVVYVSCNPATLARDLRILEDGGYETIEVQPVDMFPHTAHVECVAKIRLR"
FT   gene            416080..417534
FT                   /locus_tag="GC56T3_0397"
FT   CDS_pept        416080..417534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0397"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: gka:GK0343 type I
FT                   restriction modification system M subunit (site-specific
FT                   DNA-methyltransferase subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25454"
FT                   /inference="protein motif:PFAM:PF02384"
FT                   /protein_id="ADI25454.1"
FT                   /translation="MLTGELRHKVDKIWETFWTGGITNPLTVIEQFTYLLFIKGLDEVE
FT                   TQREQEDALLGIESERIFPPDKQHLRWSKFKHFEAAHMYDVVSNEVFPFIKNLHGNRES
FT                   AYAKYMGDAIFMIPTPQMLVKIVDGIDRIPMKDRDTKGDLYEYLLSKIATAGTNGQFRT
FT                   PRHIIHMMVELMKPTPEDIIVDPAAGSAGFLVAAGEYLRKHRSDLFLVQSLKEHFNNHM
FT                   FYGFDMDRTMLRIGAMNMMLHGIENPNIEYRDSLSEQNKDKDKYTLVLANPPFKGSLDY
FT                   DAVSNDLLKVVKTKKTELLFLALFLRILKTGGRCACIVPDGVLFGSSKAHKDIRKEIVE
FT                   NHKLEAIISMPSGVFKPYAGVSTAIMIFTKTGVGGTDHVWFYDMKADGYSLDDKRTPIE
FT                   ENDIPDIIERFHNREAEKERKRTEQSFFVPVEEIRENDYDLSINKYKEIEYEEVEYEAP
FT                   MEIIKRIKVLEEEIREGIVELEGMIK"
FT   gene            417531..418745
FT                   /locus_tag="GC56T3_0398"
FT   CDS_pept        417531..418745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0398"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: mmw:Mmwyl1_3199 restriction
FT                   modification system DNA specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25455"
FT                   /inference="protein motif:PFAM:PF01420"
FT                   /protein_id="ADI25455.1"
FT                   /translation="MIRTKYKVLKLEDIAVNSKNAIVDGPFGSALKVKDYVDDGIPVLQ
FT                   GKNISNFQFNFSDIRYITPQKAQELIRSKVEVGDILFVKIGSIGYSAEVTDLNGYPFAI
FT                   IPANLAKVSIDYSKVDKNYLLFWLRSDTVVNYLKKNASKTAQPALSLGKIKQIPVVMPS
FT                   LETQKKISAVLLKAQELIDKRKAQIEALDQLTQSVFLEMFGDPVTNKTWERRPLKDIAD
FT                   VRDGTHDSPKYVPNGYPLVTSKNIKNGKIDLSNVNYISEEDFININKRSKVDVGDIIMP
FT                   MIGTIGNPIIVDEQPNFAIKNVALIKFNNPLVVNIYLKYLLDSHYLDYILNKNKRGGTQ
FT                   KFLSLTDIRNMEIPLPPRDLQDKFSEIVKKIDSQKSILHKSLRELEKNFNSLMQRAFKG
FT                   ELFND"
FT   gene            418789..422130
FT                   /locus_tag="GC56T3_0399"
FT   CDS_pept        418789..422130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0399"
FT                   /product="Type I site-specific deoxyribonuclease"
FT                   /EC_number="3.1.21.3"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   protein of unknown function DUF450; helicase domain
FT                   protein; KEGG: gka:GK0346 type I restriction-modification
FT                   system R subunit (endonuclease); SMART: DEAD-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25456"
FT                   /inference="protein motif:PRIAM:3.1.21.3"
FT                   /protein_id="ADI25456.1"
FT                   /translation="MLSNFHFLIGKPHYESFTNACLEAEKSLVVSPATCAILTRRALEL
FT                   AVKWVYSFDSALKVPYQDNLSSLIHDNVFLSIIDEDLLPLLRYIVKLGNVAVHTNSMIT
FT                   REEAILSLHNLHQFVSWIDYCYSDEYTATDFDESLLPIGEEKRERPEELKDLYERLSSK
FT                   DKRLEEMMKENEQLRALLTAKREANTKEYHFQVDELSEWETRKKYIDLDLKLAGWEFKK
FT                   DVIVEYPVVGMPNQEGVGYVDYVLFGDNGKPLAVIEAKRTTADPNKGKQQAKLYADCIE
FT                   KMHGQRPIIFYTNGFETYIWDDLNYPARRVSGFYNKEELSLLIDRRTMKRPLRNVQIND
FT                   NITNRYYQKEAVLAVCDALENKRRKALLVMATGSGKTRTAISIVDVLTRHNWVKNILFL
FT                   ADRKTLVTQAKNSFSHLLPNLTLCNLLDNKDNPEESRMVFSTYPTMMNAIDEAKRKDGK
FT                   RLFTVGHFDLIIVDESHRSIYKKYRAIFDYFDAILLGLTATPKDEIDRNTYEVFDLENG
FT                   VPTYAYELDQAVQDGYLVDYRTIETKLKFLEEGIHYDELSDEEKERYEETFDEEVGEDI
FT                   DSAALNEWLFNDDTIDTVLRDLMEKGIRVEGGDKLGKTIIFAKNHRHAERIVERFDQLF
FT                   PEYKGGFARVIDYSVNYYQTLIDDFSDRNKWPQIAVSVDMLDTGVDIPEVVNLVFFKKV
FT                   RSKSKFWQMIGRGTRLCKDLFGVGQDKTHFLIFDYCGNFEFFRENPKGIEGKTVESLTE
FT                   RLFNAKIEIIKELQHLQYQEEEYIAHRNELIDEVLAEINKLNEENFRVRQHIQYVHKFK
FT                   SRAKWDSLTAIDVNEIKEHISPLIVPLNDDEFAKRFDLLMYTIELAKLQTKNATKPIRS
FT                   VIRTAEALSKLGSIPQVMEQKYIIEKVQTEEFWSEADIFELEAVREALRDLVKFLEKET
FT                   QKIYYTNFKDQVLEVKENGPMFNVNDLKNYRKKVEHYLHEHRDQMAIYKLRNNKKLTVQ
FT                   DVKTLEHILWNELGTQEDYKREFGDTPITKLVRQIVGLDPQAANEAFSEFLSSERLNIQ
FT                   QSRFVKLIVDYFVKNGVMDKRVLQEEPFKTVGSIVELFQDNMDDARKIIRIIDEINRNS
FT                   EEIAGA"
FT   gene            422252..422416
FT                   /locus_tag="GC56T3_0400"
FT   CDS_pept        422252..422416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0400"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK0353 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25457"
FT                   /inference="similar to AA sequence:KEGG:GK0353"
FT                   /protein_id="ADI25457.1"
FT                   /translation="MSISSLILLLLIMSIVLFVYGVVQKSKAAKRIAFGLFVASVGLAG
FT                   FVVFLIGYM"
FT   sig_peptide     422252..422317
FT                   /locus_tag="GC56T3_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.859 at
FT                   residue 22"
FT   gene            422802..424271
FT                   /locus_tag="GC56T3_0401"
FT   CDS_pept        422802..424271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0401"
FT                   /product="amino acid carrier protein"
FT                   /note="KEGG: gyc:GYMC61_1231 amino acid carrier protein;
FT                   TIGRFAM: amino acid carrier protein; PFAM: sodium:alanine
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25458"
FT                   /inference="protein motif:TFAM:TIGR00835"
FT                   /protein_id="ADI25458.1"
FT                   /translation="MIEKLVETVNGWLWSPFLIAFIVGCGLYFSIRTRFLQIRHVKEMI
FT                   RLLTTGKGSDAGVSSFQALTMSLSGRIGVGNVAGTATGIAYGGPGAVFWMWVITFIGAA
FT                   TAYVESTLAQIYKEEQDGQYRGGPAFYIEKGLGWKWFAVVIAGAILLSMAVLMPGIQAN
FT                   SIADGFSNAFGIPKLVTGIFVIAVLGFTIFGGVKRIAKTAEIVVPFMAVGYLLVAIAII
FT                   AVNIEKVPDVFGLIFKSAFGADQVFGGILGSAVMWGVKRGLYANEAGQGTGAHPAAAAE
FT                   VSHPAKQGLVQAFSIYLDVFLVVTATALMILFTGQYNVINEKTGEPIVVHLKGVEPGAG
FT                   YTQAAVDTLFPGFGSAFIAIALFFFAFTTMYAYYYIAETNLAYLVRSEKRGTAFFALKL
FT                   VFLAATFYGTVKTATTAWAMGDIGLGIMVWLNLIAILLLFKPAYMALKDYEEQLKQGKD
FT                   PEFNASKYGIKNAEFWENGYKRWEEKKEKAL"
FT   gene            complement(424454..424801)
FT                   /locus_tag="GC56T3_0402"
FT   CDS_pept        complement(424454..424801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0402"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1232 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25459"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1232"
FT                   /protein_id="ADI25459.1"
FT                   /translation="MDPFISCPQCTNPITVKDVMRFSSPWTMKCPYCDVKLKETRVTPF
FT                   LLLAAACIVPLFIFVTVQIKTYAAAYWPIIDHVPTIIVFLVTLYPIYWLYERANATILC
FT                   KKGRFQVKKRM"
FT   gene            complement(424901..425221)
FT                   /locus_tag="GC56T3_0403"
FT   CDS_pept        complement(424901..425221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0403"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: gyc:GYMC61_1233 transcriptional regulator,
FT                   ArsR family; PFAM: regulatory protein ArsR; SMART:
FT                   regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25460"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADI25460.1"
FT                   /translation="MPKHDVFHAIADPTRRQMLQLLADNELSIAAISKSFPISRTAVNK
FT                   HLRVLSEAGLVSCRKTGRETRYRLEPEPLAELKTWLSFFEPYWDERLAALKHLVEADEE
FT                   SS"
FT   gene            complement(425235..425660)
FT                   /locus_tag="GC56T3_0404"
FT   CDS_pept        complement(425235..425660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0404"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: gyc:GYMC61_1234 activator of HSP90 ATPase 1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25461"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ADI25461.1"
FT                   /translation="METKQTLPEIRKTIVLNAPIEKVWKAVATSEGIAAWWMPNTFEPI
FT                   LGHQFVLHAGPFGDSPCKVTELDPPNRLGFDWGKDWHLTFELKALEDGKTEFTLIHSGW
FT                   DADKTTEFGQPHTVVRKIMDDGWENIVNQKLPAYLEG"
FT   gene            425945..427333
FT                   /locus_tag="GC56T3_0405"
FT   CDS_pept        425945..427333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0405"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="KEGG: gyc:GYMC61_1235 RNA methyltransferase, TrmA
FT                   family; TIGRFAM: RNA methyltransferase, TrmA family; PFAM:
FT                   (Uracil-5)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25462"
FT                   /inference="protein motif:TFAM:TIGR00479"
FT                   /protein_id="ADI25462.1"
FT                   /translation="MTDSAKQSFITDIHQLDKKGAGQAVVWQEEEGRRKKLKLTVPSTL
FT                   PGEKVRVLIDRPKRRRAHARVEEVIERHPERLDPPCPHFDRCGGCVWQHWHYEGQLRHK
FT                   TEQVKALLAQRGFDPDVVRETIGMERPWHYRNKMEFTFSPEGLLGLHEQGNFRQVISLE
FT                   TCLIAGEKIVKAAMEVARWARDHQLPGYHKDTHEGLLRHVMVRESFATGEVMVALFATE
FT                   APEGELKEAAADLTERITKALPEVKSLLWLENRAWADRTQAEQTHVLAGRDFIYDELCG
FT                   FRYRLWFDTFFQTNPVQAAKLVELALEMGEPQPHENMIDLFCGVGTFSLPFAKRVKALA
FT                   GIEIVETSIESAKRNAKDNGIDNTYFLARDARRGIDEVLEQFGRPELLLLDPPRSGAGG
FT                   KVMRKIGRARPERVVYVSCNPETFASDITELVPFGYTLETVQPVDMFPHTAHVECCALL
FT                   VRGS"
FT   gene            complement(427506..428267)
FT                   /locus_tag="GC56T3_0406"
FT   CDS_pept        complement(427506..428267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0406"
FT                   /product="SpoOM family protein"
FT                   /note="PFAM: SpoOM family protein; KEGG: gyc:GYMC61_1236
FT                   SpoOM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25463"
FT                   /inference="protein motif:PFAM:PF07070"
FT                   /protein_id="ADI25463.1"
FT                   /translation="MFKKLLSSIGIGAATVDTKLAKAQYVQGETVEGVVDIRGGSIEQH
FT                   IDEIYLALVTTYLREIDDKKHEEKAVLARYKVSGSLTIGPNETKTIPFQFALPYNVPVT
FT                   LGSSRVWLQTGLDIKMALDPQDRDHLTIEPHPLVAAFLEAARQLGFRLHHVQCEQARRY
FT                   GQRRLPFVQEFEFKPASGPFKGCLDELEAIFFLSENSVEVLLEIDRKARGLSGLFAEAL
FT                   DMDETFVRFTYGTGDIPALPQLLADAIQKYS"
FT   gene            428697..429110
FT                   /locus_tag="GC56T3_0407"
FT   CDS_pept        428697..429110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0407"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: gyc:GYMC61_1237 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25464"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADI25464.1"
FT                   /translation="MKRTIYVVGAAIRNERGDILCALRAPDMSLPNVWEFPGGKVEEGE
FT                   SPEAALVREIREELGCTISIGKLLADVCHEYEHAIVHLRSYEARLVDGEPRAREHAELR
FT                   WVPLQALRSLEWAPADISTVEALLHKRKVGRNV"
FT   gene            complement(429303..430484)
FT                   /locus_tag="GC56T3_0408"
FT   CDS_pept        complement(429303..430484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0408"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: gyc:GYMC61_1238 oxidoreductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25465"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADI25465.1"
FT                   /translation="MISSSSFRYHVGIAGAGAFAEFLAGALAPLPSFHLAAVAGRTDEK
FT                   RQRVIDAYRRRQPQAGDVREYREAEELIVDPHVDIVILTTPPHLHAPLAERALEEGKHV
FT                   LLEKPGGLTAEALRANIQLAARQNRALAVNLVLRYHPLAEAVKQLIHRALLGPVDYASL
FT                   HNAAHRVAEGHWFWDERRSGGILIEHGVHFFEVGRDWFGEAVSAHGFALRETDGTRPRV
FT                   GATVIHEGNGRRIPVHYYHGFTMDPAASESTHWDIHTARGRIVLEGWIPTQLSVSGLVS
FT                   DEEAACIDAWLDAIPTKPSSGAIEQLQQAADQLLSSAELSAAPRRPYKRTVVLSDRHGW
FT                   YEAIAQTRFLDFCRLIENPSWRVLVTAEDAAADLALAEACTVADEAIDPLGIR"
FT   gene            430776..431819
FT                   /locus_tag="GC56T3_0409"
FT   CDS_pept        430776..431819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0409"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; transferase
FT                   hexapeptide repeat containing protein; KEGG:
FT                   gyc:GYMC61_1239 nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25466"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ADI25466.1"
FT                   /translation="MKALLLAGGLGTRLRPLTENIPKPMAPIANRPWLEHLIVHLRDQG
FT                   VNEFVIAAHHCSEVIRRYFEDGKRWNVKITYALEPFPLGTAGAIKNAERWLKERFLVFN
FT                   ADIVHLPQLILLLDFHRQHGGLATIVLTEVDDPSSYGVVEQDDRGQILRFVEKPRREEA
FT                   PSNRINAGMYIFEPDVMRYIPAEREVSIERETFPLLIEKNVGVYGIVSNGYWRDMGTPA
FT                   RYRQVHWDALRREFPIPLKGREIQPGVFVGENVEIGSGVLFVPPVLIGDHVKIGPQAVI
FT                   GPNAVIGDRCQIGARVHCAQTIVWDRSVIRDRSRLQNSIFGYRTVTPAGEVFEDSIINQ
FT                   FKEAVQA"
FT   gene            431816..433003
FT                   /locus_tag="GC56T3_0410"
FT   CDS_pept        431816..433003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0410"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   gyc:GYMC61_1240 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25467"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADI25467.1"
FT                   /translation="MIRIAYVSTYPPRRCGLATFTEHLRQSIDGVRGPSDGDRVIVLYN
FT                   ESDGDDAYRNDPAYWPLPAQNRAAYAEMAKRVNESDIDVVLLQHEFGIFGGEAGEYILD
FT                   FIAALNKPLVTTFHTVFADPPLPYRPIQEKIAAASDAIIVMNRQAIPYLVKAFGLPEEK
FT                   IVYIPHGAPGPSSENCDSLRRRLGFSGRKVMLTFGLLSRGKGIESVLAALPGVVRKVPE
FT                   ALYVIAGQTHPEVKKREGEAYREELKSLIHRLGLERHVHMEDRYFSEEELIDYLTACDL
FT                   YVTPYPGMQQITSGTLAYAVGVGRPVVSTPYEHARDLLQGCEELLLPYGDTTAWEERLG
FT                   QLLADEAALKRWEEKVRQIGANTHWPRVGEQHVALFARMCAAKRGEVKTIGTVSH"
FT   gene            432984..434099
FT                   /locus_tag="GC56T3_0411"
FT   CDS_pept        432984..434099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK0362 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25468"
FT                   /inference="similar to AA sequence:KEGG:GK0362"
FT                   /protein_id="ADI25468.1"
FT                   /translation="MAPSVIKFDHLERMTDDTGLLEHSLGRIPRRREGYSTDDNARAIW
FT                   ACLEWMALCEDKGEKERLHRLLDRYLAFLLWAQNDDGTFHNNFFFDRTKEEETPSDDCF
FT                   GRSFWAAALAYVRLSDPARREAAADMLRRAMPAAWELRSLRGVAWGVATCGVLLTEGRP
FT                   LGVDQEEVAALAARLEQRLLAAYWEHAGDDWHWYEPELTYANGVLPWALWTAYRRAPRD
FT                   EVKEVAEKSLAFLIEKMSGPGGVIRPVGNRGWCSRRYRADWDQQPLDVMKLALAAREAY
FT                   WATDDERYRGVVRRCLAWFYGQNDGNAPLADPSDGSCCDGLGPNGPNPNRGAESTLSYL
FT                   LTAAIAQSISVEVVVDEYVNNETVRMAGTRV"
FT   gene            434050..435459
FT                   /locus_tag="GC56T3_0412"
FT   CDS_pept        434050..435459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0412"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase; KEGG:
FT                   gyc:GYMC61_1242 phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25469"
FT                   /inference="protein motif:PFAM:PF02879"
FT                   /protein_id="ADI25469.1"
FT                   /translation="MNTSTTKPFAWPAHVFKEYDIRGRAGEELDESFAYWLGRAFADMM
FT                   QKEGEKRAVVGHDNRLSSPGLHRALKDGLLDGGCDVVDIGLSTTPMFYYSLYYTNIPCG
FT                   MIITASHNPGDENGFKIAMGKTTIYGERIQALRRAMERLSQEQPRPETARGREETLDLA
FT                   PAYIKMLKEKIKLGPRKLKVVVDCGNGTPSIIAPQVLKEWGCDVIPLYCESDPTFPNHH
FT                   PDPVVPENLTDLIEMVRKEQADLGIAFDGDGDRIGVVDETGTIRWGDQLMVLFWREILK
FT                   RHPGADAPVEVKCSQALVEEIERLGGKPFFHRTGHSHVKATLRRRPEIPFAGEMSGHLF
FT                   FNDEFYGYDDALYAAGRLLRLLSHDERPLSEWFADVPRYAATPETRVACPEEKKPAAIA
FT                   TVKNRFAGRYPVVDVDGARIQFPEGWGLVRPSNTQPILVLRAEAKTEAALAEIKRQLAD
FT                   CLATLELRIDW"
FT   gene            435648..437300
FT                   /locus_tag="GC56T3_0413"
FT   CDS_pept        435648..437300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0413"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="KEGG: gyc:GYMC61_1243 transcriptional regulator,
FT                   LuxR family; PFAM: regulatory protein LuxR; SMART:
FT                   regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25470"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADI25470.1"
FT                   /translation="MVIRESLQYIQDAYAALTELSMLIVDDHGTPVTKVSNMTELAELV
FT                   LFAAKREAPSFFCPRELVIDGWQRPSVVPVGRFGMKSIVAPVFVDEKAEYWIWAGVFIE
FT                   EETKWLICEQPLVDGGKWVSAIERSVALPARAVEAKLKDIEKMAVICGELISGERRKQQ
FT                   CHEYGKRLEAVVADSSALADVDKLLFELRAFDERVDMALYIAKCPQGWMVTAASGEKAG
FT                   KLRGKMIDALFPPLSSSEPPLRSVYVQDAALDPRFSFFVRHGIRPKAMIAYPAMYGKTM
FT                   EGWVMIGSEAASSLPAALRSVGSTLVQHWLLLAKCTEADMKMDRHLMRLSMLVEIGRAM
FT                   RVVQNEEEIIRIMAEFAAEFAYGDFVCVVWSNDGQTAVVHEGAMDIEMAVRYRDDVCRR
FT                   YGCHGEKAKSEVPALLDVEGKSVMEVPFFVGDGRYGVLAVHIKKEREAKEAEVYMTALA
FT                   AIGAMMISGKSHGGNDGTVNIDMLSEQLTAREMDVLELLIQGCSNREISERLFISVHTV
FT                   KNHITNIFQKIGVNDRSQLIALVYQLNHRRQRR"
FT   gene            437545..437943
FT                   /pseudo
FT                   /locus_tag="GC56T3_0414"
FT   gene            437966..438298
FT                   /locus_tag="GC56T3_0415"
FT   CDS_pept        437966..438298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0415"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="KEGG: gyc:GYMC61_1245 anti-sigma-factor antagonist;
FT                   TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25471"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADI25471.1"
FT                   /translation="METKQGAICTLTWTEDITLNNVESFRQALEKLLDKRADQLIVNME
FT                   RVKYINSAGLGVIADSVMAARARQKELVIAGVEGSLAEIFHIVKFSSFIKLFATEKEAM
FT                   DYFSGE"
FT   gene            438305..439831
FT                   /locus_tag="GC56T3_0416"
FT   CDS_pept        438305..439831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0416"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /EC_number="3.1.3.3"
FT                   /note="SMART: protein phosphatase 2C domain protein; PAC
FT                   repeat-containing protein; PAS domain containing protein;
FT                   TIGRFAM: PAS sensor protein; KEGG: gyc:GYMC61_1246 putative
FT                   PAS/PAC sensor protein; PFAM: Stage II sporulation E family
FT                   protein; PAS fold-3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25472"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADI25472.1"
FT                   /translation="MVDGFWEHVQRYDHLAWRELLLGLEKMNVFVGPGDYVYWLAAPEQ
FT                   RRLLFISSSCEQLYGLPPDDFYRDQDIWAKVSYPDDRAKAERKWSLLSGADAGAQTYRI
FT                   INQRDGSVRWVLERTFPVLGQFGEVRLVSGVVADLTEAKRNENERQLAEQVYKAMEQAM
FT                   LVTDGQFVVQFVNPAFTKITGHGVEIVGQPLHALYAGYYEAWLYEVIQAGTGESGEWRG
FT                   WVRWRRKNGSVYVRQTTVRAVPGHDGGIAFYLFLFAGPTYENPYIAAMKDDLRLAREVQ
FT                   KRVLSKPLSAKGIKIAGTYIPSRELGGDMYAWYPIDKQRYGIFLMDVMGHGAAASLICM
FT                   SVRSLLNGVIRKGIVPTEVFRELNRHMRQLYHENGRMTYYFTAVYVLVDVKERMIEYAS
FT                   AGHPPGFLFQPDGTVAELDRGCAPIGLLPRLLVDSGRLRYAPGATLVLYSDGAIEGETG
FT                   SVRQKIEAFRDALAPHILLDEQVLLDHLRRHFAQKGPLPDDFSAVVAKLG"
FT   gene            440022..440435
FT                   /locus_tag="GC56T3_0417"
FT   CDS_pept        440022..440435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0417"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein; KEGG:
FT                   gka:GK0368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25473"
FT                   /inference="protein motif:PFAM:PF06271"
FT                   /protein_id="ADI25473.1"
FT                   /translation="MAVTNPAGFWKRLLANLLDAIVVGIPISIIGYFITGSWETNWFTS
FT                   LANILYALIVPAVWYGYTVGKRMLGIRIAKVNGGKVGVGTMFLRSFVGGLVYFITFGIG
FT                   LIISAIMVAAREDKRSIHDFIAGTYVTTEKPTV"
FT   gene            complement(440478..441683)
FT                   /locus_tag="GC56T3_0418"
FT   CDS_pept        complement(440478..441683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0418"
FT                   /product="Orn/DAP/Arg decarboxylase 2"
FT                   /note="PFAM: Orn/DAP/Arg decarboxylase 2; KEGG: rso:RS00881
FT                   diaminopimelate decarboxylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25474"
FT                   /inference="protein motif:PFAM:PF02784"
FT                   /protein_id="ADI25474.1"
FT                   /translation="MERLNTVIQAIIERKAKQQGPLCAYVYDLDNLRVHTASLSASLPP
FT                   SVRLFYAVKANADERILKTVAPYVTGFEVASGGELQKVRRLFADSPVIFGGPGKTDEEL
FT                   TAAIEERVALIHVESVWELQRLNWIAARRQTTVRVLLRVNLRQAASGATLHMAGKPTQF
FT                   GIDEQHIAEAIHTALTLPSIDLQGFHFHSMSNHTDEQAHLSFIETCLSFVAQAETTYGR
FT                   RFSVVNVGGGVGVHYNEPDRQFRWNWFSKELNLLLRRQAPPHWTVIFELGRFIAAHNGY
FT                   YAAEVLDLKTNYGTHFAIIRGGTHHLRLPAAWKMNHPFLVIPIDEWPYPFNRPSLHNQR
FT                   VTLAGELCTPNDILARDVPCARLRVGDIVLFRCAGAYGWDISHHDFLSHPHPEFIYLES
FT                   SM"
FT   gene            complement(441671..442909)
FT                   /locus_tag="GC56T3_0419"
FT   CDS_pept        complement(441671..442909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0419"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dau:Daud_0476 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25475"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADI25475.1"
FT                   /translation="MLLTSKKPSPSFALFWRPFRIYWSGTLPARIGEWADFVILNWAVL
FT                   QLSRSSLDLGVLNVCRLLPIFLFSWLGGVLADRLSRRQVLAASLLGMAGFTLVIAWLLR
FT                   EPSSLIWLFAAVFVRSIFMAMETTARNAYIADLVPIEALSSAISLHTAALHIGKIIGPA
FT                   AAGWGLSSLGGVSLLIVYSTMLVIAAFAVLSLEESRPRRPAARPTDGSKGEAIRYIKRT
FT                   PLVRGLLLLSIIPMTFGFAYSAVTPLLVDALANGDAGDFAVLLSVSSAGALLGTIWLSF
FT                   RPVEAIGKWLIVSLLAFSLSLLLWIVLFEHWLLCLAAMALAGLTGQLYRTLCRLAIQLV
FT                   VPDRLRGRVMSIALMDRGFIPLGTLLLTTLAEYVGAKIAGYAMGWLCLLCALAFWRRKE
FT                   LWNISTGGRIWND"
FT   gene            complement(442922..444928)
FT                   /locus_tag="GC56T3_0420"
FT   CDS_pept        complement(442922..444928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0420"
FT                   /product="IucA/IucC family protein"
FT                   /note="PFAM: IucA/IucC family protein; KEGG: ser:SERP1781
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25476"
FT                   /inference="protein motif:PFAM:PF04183"
FT                   /protein_id="ADI25476.1"
FT                   /translation="MNTRLSLRTADIILYPYEQECVEFIQKRFPERLSAYVRHVMRART
FT                   TILQRTVAALLREDVFGLYSHSYDLQVIGSVYMTNWHGLAPEWEPVVRRLPDANLQEGI
FT                   TYKLFPVASGQCFLIPIRGESAFRQCDIGEEVVWIGEGIQTVRDALTFLSLLTPLIKAA
FT                   GEEQAWAQLAKELENGTSNLALAYWHFEKECQTMRKEADNLFTYIEQRQSDPSFCPALF
FT                   FEQLCIEGHHLHPGAKTKLPMSPKDVFAYSAEFGGQPQLRIVAVRRNLCDFHFDGYEDP
FT                   NTFLLDHFPSLRGPVAECFQQTKKKLEDYVLVPVHPWQYEHVIPNVYRAELRDGRLWLI
FT                   EGAVIPTQATASFRTVLAKEAPLYIKTAVHSQMTSTVRSISPQSANNGATYSRLLRAIL
FT                   ERERDLSAIFLPVCEIGGCSFRSEDPNKARNLSVIYREGLDRFVDEGEIAIAGTALYAS
FT                   SPFSGQPIINDIIEAYAKGIGRPSSQETALSFLREYVGIAVRGFLTLLVKYGIGLEGHL
FT                   QNTVPVFRQGKPMKLLFRDWGGIRLYRPRLERQGFNIDVRPDSITITDDLREAQNKVFY
FT                   TVFQNQLGEIIRHISRQWGIAEEQCWICVRRQCDEVFAKLAKDPNLKRAVDEDRQALYR
FT                   PHIEHKALAKMRLQPEAKTYCFVSVPNPLATSR"
FT   gene            complement(444925..446856)
FT                   /locus_tag="GC56T3_0421"
FT   CDS_pept        complement(444925..446856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0421"
FT                   /product="IucA/IucC family protein"
FT                   /note="PFAM: IucA/IucC family protein; KEGG: ftn:FTN_1682
FT                   siderophore biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25477"
FT                   /inference="protein motif:PFAM:PF04183"
FT                   /protein_id="ADI25477.1"
FT                   /translation="MNSSILFLTEEEETYRYLQTVDPSLARSFLAVLPNSRQRIANRLL
FT                   QALIREQLISPDRVVWEQTGHKLELSILLSMKKQITAAVMERFSLGQFTVARLWLLDQK
FT                   ERKSLSSPLELLELLQREGLISCAPNWDEFCAEIANSVINDALAQAAAERRRCRWRDTY
FT                   GATYSSSLEWVRAQPRPFSPLTFYEQTVIDGHTLHPCAKTRLGFSVQDMIDYSPEWEAK
FT                   VTLPLLAVRRSHCRFVSFSYGRMADWVYEQDKTLQSVVQNALRAYGLSECEYDVIPVHP
FT                   WQWKHVIQQRFQNELAAQTIVPIDGGVLPAYPLVSVRTFMIPGASGDHLKTPINVQMTS
FT                   AIRTVSPAAAANGPRLSLWLNDVLVKERLAPRFRVVSETAGISFSPQGRTDNEDAALAK
FT                   QLSAIVRTNPERDLAEGDIMMPAVTLLAPSFLSGKPVAAELVEEYAANQGASSVREAAV
FT                   WFFRQYAEMLVPPLLLLLCKYGISLEAHLQNSLPVFRSGAPQSMHVRDLGGIRLHCGRF
FT                   GRHRYPLDELAPSSIVTADLNELRHTFTHAVIHNHLGELIACLSRTFSIDETLLWQATA
FT                   DVMENAFAALTRDSETEEQARQDRDALFSPVLPMKALVAMRLTDDLRNRFIETANPLAK
FT                   WKREEWER"
FT   gene            447341..448594
FT                   /locus_tag="GC56T3_0422"
FT   CDS_pept        447341..448594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0422"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: gka:GK0369 methyl-accepting chemotaxis
FT                   protein; PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25478"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADI25478.1"
FT                   /translation="MSLSAYIIRTMFVVIPGTAAIGMATCLVNGIRGAAFWWTLVATVL
FT                   FGAMLGFVSATLNYRRFVAPIAVINEHLGKMTGGDLTVRIPLDRVQQLRPIAASLNDMA
FT                   NAWQSVMGQIQHHAEEVAQYSQQLAAVAEQTTKATEQIATTMETLAASGEEQADAVRTT
FT                   AASVHDISQTLSDVAFHTKEVAHRAEKTSAKAEDGKQSIGQMSEQMQFIYDHVQTLGQV
FT                   VKGLGERSNEIGQITEAITGIASQTNLLALNAAIEAARAGEQGKGFAVVADEVRKLAEQ
FT                   SARSAQQISELIGYIQEETKRAVASAEQVISEVAKGLNVAAACGQSFAHIREEVGQVSK
FT                   QIGQVSSAIEQMTEHARQVNDALQQMTNIVEQSASGAANVSAATQEQMASVEEIASSST
FT                   SLGQMADEMRAMLKKFSV"
FT   misc_binding    448730..448843
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 85.28"
FT   gene            449015..450703
FT                   /locus_tag="GC56T3_0423"
FT   CDS_pept        449015..450703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0423"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="KEGG: gka:GK0370 thiamine biosynthesis protein ThiC;
FT                   TIGRFAM: thiamine biosynthesis protein ThiC; PFAM: thiamine
FT                   biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25479"
FT                   /inference="protein motif:TFAM:TIGR00190"
FT                   /protein_id="ADI25479.1"
FT                   /translation="MENIRSFMSFPESRKVYIEGSRPDVRVPMREIALSPTKTPQGMVE
FT                   NKPVRVYDTTGPYTDPDFEPDVEKGLPPLRRRWIVERGDVEEMERSSVAIQRSLPFVRR
FT                   PLRAKPGKTVTQMHYAKRGIITPEMEFVAIREQINPEIVRQEVAAGRAIIPANINHPES
FT                   EPMIIGRRFHVKINANIGNSAVSSSIEDEVEKLLWAVRWGADTVMDLSTGKHIHETREY
FT                   IIRNSPVPVGTVPIYQALEKVGGVPEKLTWDVYRETLIEQAEQGVDYMTIHAGVRLHYI
FT                   PLTANRTTGIVSRGGSIIAQWCLAHHEENFLYTHFEEICEILKQYDVAISLGDGLRPGS
FT                   IADANDEAQFAELKTLGELTKIAWKHDVQVMIEGPGHIPMHKIRENVEQEQEICHEAPF
FT                   YTLGPLVTDIAPGYDHITSAIGAAIIGAYGTAMLCYVTPKEHLGLPNKEDVRAGVVAYK
FT                   IAAHAADLAKGHPAAQQRDDALSKARFEFRWNDQFNLSLDPERAREYHDETLPAEAAKT
FT                   AHFCSMCGPKFCSMNISHELQRKIKEEGMKEKAQQFIRQGSSLYQ"
FT   gene            450933..452051
FT                   /locus_tag="GC56T3_0424"
FT   CDS_pept        450933..452051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0424"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="KEGG: gyc:GYMC61_0563 transposase, IS605 OrfB
FT                   family; TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   transposase IS605 OrfB; putative transposase
FT                   IS891/IS1136/IS1341 family"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25480"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADI25480.1"
FT                   /translation="MDMTLTAKIKIYPTAEQAEVLKATLSAYRQACNAVSVVILDTKVL
FT                   AQAKLHDMTYRLLRSNYALRSQMAQSVIKTVIARYRSLKSNGHEWTLVRFKKPEYDLVW
FT                   NRDYSIVQGLFSVNTLEGRIKVPFEPKGMEQYFDGSWTFGTAKLVYKHNKFFLHIPMTK
FT                   TIPTVDEHNIRQVVGVDVGVNFLAAAYDSQGKTIFFNGRKIKHMRAKYKRMRKTLQQKG
FT                   TASARRKLKTIGQRENRWMTDVNHAVTKALVRQYGERTLFVLEDLTGIREKTERVRIHD
FT                   RYETVSWAFYQFRQMLEYKARLHGSKVMVVAPHYTSLTCPKCGHTEKANRKKRTHTFCC
FT                   RTCGYTSNDDRIGAMNLQRKGIEYIVEGTTQA"
FT   gene            452662..453840
FT                   /locus_tag="GC56T3_0425"
FT   CDS_pept        452662..453840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0425"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   gyc:GYMC61_1251 aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25481"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADI25481.1"
FT                   /translation="MNTFSDIVQTMPPYLFSRFQKKKEELLKLGVDVIDLGIGAPDLPP
FT                   PSFVIEALKEALDAPEHYTYSPYGGCREYREAVARFYEREYGVKLDPETEVLALIGSKE
FT                   GIVHLLQAVLNPGELALVPDPGYPVYRTAVHFARGQSLSLPLDAQHGYIPRFDALPSSV
FT                   YDQAKIMFLNYPSNPTAAAVDLDVFAEAVSLARQHQMFIAHDAAYSFVTFAGFQAPSIL
FT                   QVDGAKEVAVEFGSLSKSYNMAGCRIGYVVGNRDMIRALSVIKSNTDTCQFIPIQKAAV
FT                   AALTNGRTFIRENSRIYEQRMNMMVERLRELGIDVQRPKATFFLWIPVYDGYSSERFAA
FT                   KLLEEAGVIVTPGTAFGSAGEGYVRVSLSAPMERLQQAVERWKQVDWEESAR"
FT   gene            453837..455492
FT                   /locus_tag="GC56T3_0426"
FT   CDS_pept        453837..455492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0426"
FT                   /product="thiamine pyrophosphate protein TPP binding domain
FT                   protein"
FT                   /note="PFAM: thiamine pyrophosphate protein TPP binding
FT                   domain protein; thiamine pyrophosphate protein central
FT                   region; thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: gyc:GYMC61_1252 thiamine pyrophosphate
FT                   protein TPP binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25482"
FT                   /inference="protein motif:PFAM:PF02776"
FT                   /protein_id="ADI25482.1"
FT                   /translation="MKRTMRHITVAQAIVECFKQEQIRYVFGVPGESYLPLLDAIYDEP
FT                   SIEFISARHEGGASFMAEGYAKASRKCGVVLATRAVGGANLTIGVHTARQDSTPMVVFL
FT                   GQVNSRFLGREGFQEVDMEAFFRPIAKWVVEIREAERVPELVQRAFRTAKTGRPGPVVV
FT                   SLPEDVFSKTITEAVMAETYVPKPAPRQEDIRNIKERLERAKRPLVIAGGGVKWSGAEQ
FT                   LLRLWAEKYALPVMAAFRRHDVFPHNHPCYVGHLGLGAPKAVMETAEQADVVMALGTRL
FT                   SEVTTQDYRLLSPNQTLIHIDIDSDGFGKVYAPDLAVWADCQEVLSRLLDIAVRPSWQE
FT                   WAAERRKRYEQTARLPVEHRNLYEVVMASLARHLPKNAVITNDAGNFAGWLHAFFPFGD
FT                   GHTYIGPTSGAMGYGMPAAIGAKLAFPDRTVVSLSGDGGFMMTVQELETAARYDIPIIS
FT                   IVFNNHMYGTIRMHQELQFPGRVIGTDLGRVSFARLAECLNGRGFQVQTEQQFTEALLL
FT                   ALEAKKPTVIEVLTDPDHISVAATIQDLRAKRKS"
FT   gene            455563..457044
FT                   /locus_tag="GC56T3_0427"
FT   CDS_pept        455563..457044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0427"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: gyc:GYMC61_1253
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25483"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADI25483.1"
FT                   /translation="MKIQNYINGEWKEPSTGQFAPVINPATGETIAEVAMSGPNDIDEA
FT                   VQAAKEAQKQWALVPAPKRAEILYKVGMLLKERKEQLARLLTMEMGKVIEEARGEVQEG
FT                   IDMAFYMAGEGRRLFGDTTPSELKDKFAMSVRTPVGVVGIITPWNFPIAIATWKSFPAI
FT                   VAGNAVVWKPAPETPIMAQELARIFEEAGLPPGVFHVVHGDGPTVGNALVEHPDVKVIS
FT                   FTGSNEVGRMIAEKCGRLLKKVSLEMGGKNAVIVMDDADLTLAVDGIIWSAFGTSGQRC
FT                   TACSRVIVHERVKQELERRLLEAVKTLKIGNGLDETVKVGPVIHEEALQKIDRYVRIGV
FT                   EEGAKLLVGGYILREGDYARGFYYAPTIFTDVTPNMRIAREEIFGPVVSIISVRSLEEA
FT                   IAVNNSVDYGLSSAIFTRDVNNVFRAMRDLDTGIVYVNAGTTGAEIHLPFGGTKGTGNG
FT                   HRDSGVAALDVFTEWRSIYVDFSGKLQRAQIDTDD"
FT   gene            457202..458359
FT                   /locus_tag="GC56T3_0428"
FT   CDS_pept        457202..458359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0428"
FT                   /product="Saccharopine dehydrogenase"
FT                   /note="PFAM: Saccharopine dehydrogenase; KEGG:
FT                   gyc:GYMC61_1254 saccharopine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25484"
FT                   /inference="protein motif:PFAM:PF03435"
FT                   /protein_id="ADI25484.1"
FT                   /translation="MKVLVLGAGLMGKEAARDLVQSQDVEAVTLADVDLAKAEQTVRQL
FT                   HSKKLAAVRVDASDKRQLSAFMKGHDVVVNALFYQFNETVAKTAIAAGVHSVDLGGHIG
FT                   HITDRVLELHEQAQAAGVTIIPDLGVAPGMINILSGYGASQLDEVESILLYVGGIPVRP
FT                   EPPLEYNHVFSLEGLLDHYTDPALIIRNGQKQEVPSLSEVEPIYFDRFGPLEAFHTSGG
FT                   TSTLSRSFPNLKRLEYKTIRYRGHAEKCKLLVDLNLTRHDVEVEINGCRVKPRDVLLSV
FT                   LKPLLDLKGKDDVVLLRVIVGGRKDGKETVLEYETVTFNDRENKVTAMARTTAYTISAV
FT                   AQLIGRGVITKRGVYPPEQIVPGDVYMDEMKKRGVLISEKRTVHS"
FT   gene            complement(458546..459703)
FT                   /locus_tag="GC56T3_0429"
FT   CDS_pept        complement(458546..459703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0429"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   gyc:GYMC61_1255 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25485"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADI25485.1"
FT                   /translation="MEEGRKTRARWITVAAAFLAFMGIGIVDPILPVIAESIGATHWQV
FT                   EMLFTAYILTMAVMMIPVGFVVSRIGDKQMMVIGLGLVTIFSLLCGFASTIPQLSLFRA
FT                   GWGLGNATFFATAMTLLIALTPQASTAVGLYEAAIGLGMAGGPLVGGLLGQHSWRYPFL
FT                   GTSVLIFIAFLLVTFFVYDPNKGKPKKAVGLQEMRRLLSFPPFLKGAVGGMLYYYGFFV
FT                   VLTYSPLIIGLSAIQIGLVFFGWGLCLAYGSAVLAHHLEKQYEPRGILPYGLLMFAALL
FT                   LLLVAAKPTWLMVTLIILSGLVSGLNNALFTSYVMETSPYERGVTSGTYNFVRWLGAAI
FT                   APVLSGIIGHTISSKAPFMVAMALALIAFLFLSWRKRKTSAPKTA"
FT   gene            complement(459703..460131)
FT                   /locus_tag="GC56T3_0430"
FT   CDS_pept        complement(459703..460131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0430"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: gyc:GYMC61_1256 transcriptional regulator,
FT                   MerR family; PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; SMART: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25486"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADI25486.1"
FT                   /translation="MERFKIDDVAKATGLTKRTIRYYEEIGLIKPPARSEGGTRLYTAE
FT                   DIERLKNIVAAREVLGFSLQELQHFLALKETMETHRAEYRHEAAGSEKRRELEQISAGL
FT                   RRQIAMLEEKMKKMAMLKQELEQMAERVDALLQERREE"
FT   gene            complement(460286..460771)
FT                   /locus_tag="GC56T3_0431"
FT   CDS_pept        complement(460286..460771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0431"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: [2Fe-2S]-binding domain protein; ferredoxin;
FT                   KEGG: gka:GK0377 carbon monoxide dehydrogenase small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25487"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="ADI25487.1"
FT                   /translation="MEETTKRELVLHINGERRSIVARQSETLLFVLRDGLGLTGAKPGC
FT                   LNGDCGACTVLVDGTPIKSCMMLAIETVGKEITSIEGLDDAPIQHAFVRHFAFQCGYCT
FT                   PGFIMNAHALIERHPNADEATIQEWLESNICRCTSYQEIEVAVKEVLEAKKAKPTDP"
FT   gene            complement(460793..461635)
FT                   /locus_tag="GC56T3_0432"
FT   CDS_pept        complement(460793..461635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0432"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; KEGG:
FT                   gyc:GYMC61_1258 molybdopterin dehydrogenase FAD-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25488"
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /protein_id="ADI25488.1"
FT                   /translation="MVPFDFAYYRPQSIAEATALFAALERDGKRPLYYGGGTEIITLSR
FT                   LNLVRTAAVIDIKAIPECRALDVGHDSLVLGAALSLAELEEANPFPLLTKAAREVADRT
FT                   ARNQITLGGNICGQIFYRETALPLFVAEADVIIAGPYGIRQCRFLDMFHQQLQLGRGEF
FT                   VVQFKVDRAAATLPHFHRKRRKQGEVGYPLVTIAALKKDGTVRVALSGVCPFPFRSAEV
FT                   EAHVNDRSRPVGERIQAAVDAFPRPILHDIEGSADYRLFVAAQLLEDMLRELGDGETV"
FT   gene            complement(461622..463949)
FT                   /locus_tag="GC56T3_0433"
FT   CDS_pept        complement(461622..463949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0433"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; aldehyde oxidase and xanthine
FT                   dehydrogenase a/b hammerhead; KEGG: gyc:GYMC61_1259
FT                   aldehyde oxidase and xanthine dehydrogenase molybdopterin
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25489"
FT                   /inference="protein motif:PFAM:PF02738"
FT                   /protein_id="ADI25489.1"
FT                   /translation="MAVGKSIIRKEAWDKVTGRAKYTNDFKEQGMLHAALVTSPYAHAR
FT                   ILSLDARRALAAPGVHAVVTGEGLPLTGEDMRDRPPIAVDKVRYYGEVVAVVVADTLAQ
FT                   AEQAARLVRVVYEPLPAVGSPSEALKEGAPLLHEHLDHYEKNKTTHPEPGTNVAHRTKI
FT                   RKGNIEQGFAESDVIVETSVSFAPSDHIAMETRCATAEIWPDGTIHISASSQSPFMIKK
FT                   LLHTYFGEETGKVIVHTPLVGGAYGGKAPVQLELLAYLASKAVGGRKVSVWNSREHDMV
FT                   TSPVHIGLEATVKIGATKDGLFKAMEILFLFDGGAYSDKAIDVSRAAAVDCTGPYHVEN
FT                   VFCDSLCVYTNRPYATPFRSFGHCEQAFAIERAIDELAQELQLDPWEVRRKNAIRPGHT
FT                   TPTQVRLTKSNVGNMPSCLDRLRELMRWDEWQRVEVDAYTVRAKGIGAGWKTSTIDTDA
FT                   SSGVILTFNSDGSVNVISGVVEIGTGTKTVLAQIVAERLKMDVDQVHVKMDIDTQTTPE
FT                   HWKTVASRGTFMAGRAALAAADDAIRQLKDIAACVLRASPDDLEVGFGRVFLRDDPAIF
FT                   LPIKDIAYGYKFPNGNAIGGQVIGRGHYILRRLTPLDPETGAGQPGPEWGVCAEGVEIE
FT                   FNRRDYTYRIVKAYAVIDAGKVLNPKAALGQAMGAMSMGLSFASREGFLFDNEQRVLNP
FT                   QLRTYRPIRFGEHPEYIVEFVETPQIDAPYGARGIGEHGLIGMPAALANALSLAAGVPL
FT                   NELPLVPELIWRKQKGDSYGSV"
FT   gene            complement(463936..464574)
FT                   /locus_tag="GC56T3_0434"
FT   CDS_pept        complement(463936..464574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0434"
FT                   /product="xanthine dehydrogenase accessory protein pucB"
FT                   /note="TIGRFAM: xanthine dehydrogenase accessory protein
FT                   pucB; KEGG: gyc:GYMC61_1260 xanthine dehydrogenase
FT                   accessory protein PucB"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25490"
FT                   /inference="protein motif:TFAM:TIGR03202"
FT                   /protein_id="ADI25490.1"
FT                   /translation="MNCPTIAGIYLAAGESRRMGTDKRALPWGESTLGAAGLQAALHSC
FT                   LAPVIVVVPPDDALAWLPAELQNHEKCRFTRCADHCRGQAHSLACGLRESLASGADAAV
FT                   VLLADQPFVTADVINALTDLYRRHRPDYVAFTRFGTPMPPVIFGKQMFPALLSLRGDAG
FT                   GRTLFHHPRWRGLLYEGDETIGIDIDTKDGYKRAVMDRGEKEGRHRGRR"
FT   gene            complement(464571..465596)
FT                   /locus_tag="GC56T3_0435"
FT   CDS_pept        complement(464571..465596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0435"
FT                   /product="Xanthine dehydrogenase"
FT                   /EC_number="1.17.1.4"
FT                   /note="KEGG: gyc:GYMC61_1261 xanthine dehydrogenase; PFAM:
FT                   protein of unknown function DUF182"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25491"
FT                   /inference="protein motif:PRIAM:1.17.1.4"
FT                   /protein_id="ADI25491.1"
FT                   /translation="MESYYAVLEAIAGAPGDGVLAIIIDVEGSAYQKEGTCMWIGANGE
FT                   TVGLLSGGCLEEAVAAYAREVLANRHSAAISFDLRTEDDLSWGQGAGCNGLIRVWFEPV
FT                   TGDTKPVWLALKRCLEHGEHVLMARSLSNRNEPPFFQSETGERFGNGPMPRPEWTEWLR
FT                   DAPPFRGWNGWYEADGEAFYVQHFWPKPRLIVFGAGPDAPPLVSAAKAAGFSVTVSDWR
FT                   PAFCHPSHVPDADAFVMGFPHETVPRLRLNERDFVVIMTHQFERDRELVSLLADMPLAY
FT                   LGVLGPRRRTDRLFPSGSTPPFVRSPAGLSIGARGPHEIAISITAELISVLRGRSTERV
FT                   S"
FT   gene            complement(465801..465980)
FT                   /locus_tag="GC56T3_0436"
FT   CDS_pept        complement(465801..465980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0436"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25492"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1262"
FT                   /protein_id="ADI25492.1"
FT                   /translation="MAKKKQFPLRIDYDLYAILEQWAQDEFRSVNAQIEYLLREAAKRA
FT                   GRLGKGKNDPKQGS"
FT   gene            complement(465996..466841)
FT                   /locus_tag="GC56T3_0437"
FT   CDS_pept        complement(465996..466841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0437"
FT                   /product="band 7 protein"
FT                   /note="KEGG: gyc:GYMC61_1263 band 7 protein; PFAM: band 7
FT                   protein; SMART: band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25493"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ADI25493.1"
FT                   /translation="MREQEAWRMDGFIGIGCIALLLVAGFISLIQAQLLLAIVCFVLAA
FT                   LLATGITIVQPNQAKVLTFFGRYFGTIRDSGLFFTVPLTVRKKVSLRVRNFTSNKLKVN
FT                   DVQGNPIEIAAVVVFRVIDSAKAVFDVDDYEQFVEIQSEAAIRHVATKYPYDTFEDDND
FT                   ITLRGNADVISDVLAAELQERLRIAGVDVMEARLTHLAYSPEIAGAMLQRQQAAAILAA
FT                   RKKIVEGAVSMARMAIEQLDKENVLELDDERKAAMVNNLMVAIVSERAAQPVINTGSLY
FT                   "
FT   gene            467113..467559
FT                   /locus_tag="GC56T3_0438"
FT   CDS_pept        467113..467559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0438"
FT                   /product="HutP family protein"
FT                   /note="PFAM: HutP family protein; KEGG: gyc:GYMC61_1264
FT                   HutP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25494"
FT                   /inference="protein motif:PFAM:PF09021"
FT                   /protein_id="ADI25494.1"
FT                   /translation="METRQARIGRLALLLAMLDEGEEDPILNQLEALAWRYCQGRVGAM
FT                   EPQKIVAAIETAAKRHGVVDGGLYREMHALYHAILEAVHGVTRGQVELGDLLRTAGLRF
FT                   AVVRGMPYEQPNEGEWIAVALYGTIGAPVRGLEHEAAGLGINHI"
FT   gene            467677..469191
FT                   /locus_tag="GC56T3_0439"
FT   CDS_pept        467677..469191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0439"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="PFAM: phenylalanine/histidine ammonia-lyase;
FT                   manually curated; KEGG: gyc:GYMC61_1265 histidine
FT                   ammonia-lyase; TIGRFAM: histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25495"
FT                   /inference="protein motif:TFAM:TIGR01225"
FT                   /protein_id="ADI25495.1"
FT                   /translation="MIVLTGHTLTIDEVRRVVYERERVAADEESMRAVEKSRAAVEQAI
FT                   SNGRTIYGVNTGFGKLADVRIEGSDLEQLQINLLRSHACAVGEPFAEEVVRAMLLLRAN
FT                   ALLKGYSGVRPAVIEQLLAFLNAGIHPIVPQQGSLGASGDLAPLAHLALAFAGEGEAMY
FT                   QGRRMPAAQALSQAGISPLSLQEKEGLALINGTQAMTAVGALAYLEAEQLAYDSEWIAA
FT                   LTIEALYGIVDAFDARIHAARGFQEQAEVAERLRRYLAGSQLTTRQGERRVQDAYSIRC
FT                   LPQVHGASLRALRYVKETLEIEMNAATDNPLIFADGTVLSGGNFHGQPVAIVMDLLKIA
FT                   VAEMANISERRIERLVNPQLSEGLPPFLSPQPGLQSGAMIMQYVAASLVSENKTLAHPA
FT                   SVDSIPSSANQEDHVSMGTTAARHAYMIVQNARKVLAIELICALQAVEERGIERMAPST
FT                   RRFYHEARRLVPSIVVDRVFSDDIEAMARWLGERAKHRVLPDEARA"
FT   gene            469880..470578
FT                   /locus_tag="GC56T3_0440"
FT   CDS_pept        469880..470578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0440"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   gyc:GYMC61_1266 integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25496"
FT                   /inference="protein motif:PFAM:PF03741"
FT                   /protein_id="ADI25496.1"
FT                   /translation="MGISLTISAAALLALWKIIAIDIILSGDNAVVIAMATRRLPNDQR
FT                   NKAIFFGTAGAVLLRILFAVVIVFLLNIPFVHFAGGLLLVWIAYKVLVEREEEANVRSA
FT                   DRLLKAIMTIMIADAVMSLDNVVAVAGAAEGHLGMLALGVAISIPIMVFGSKAIVHIME
FT                   KHRWIAYVGSGILAWTAGKMMAGDEGVLHWFHLSYGPFVYAVAAGVTILVVSAGYITNK
FT                   KAEREEGTLI"
FT   gene            470575..471534
FT                   /locus_tag="GC56T3_0441"
FT   CDS_pept        470575..471534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0441"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: gka:GK0387 D-isomer specific
FT                   2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25497"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADI25497.1"
FT                   /translation="MSGWGWCDAMNIQRILVTGRLYAELAALLPDKRPDKAFRFVAEEE
FT                   LTANDFAWADAYVGFRPAGPFSLANLRWVHSLGAGVDAFLWKREWKKNVLLTRTIGSFG
FT                   EQIAEYCLSYLLRDAQCHDVYAWYQEQRQWKPLAPKRLGEQRVVIYGTGEIGRRIAETL
FT                   RLFGVSPIGVSRSGRETPPFSAVCRHEEAGEALACADWVIAALPLTEETHHLFDETFFA
FT                   CLHNAGFINVGRGATVDETALVGALENRNVRLAVLDVFEEEPLPPHLPLWVHPNVIITP
FT                   HIAALTSPEDAAQSILDTLRRIEAGEPLDNAVDVSRRY"
FT   repeat_region   471829..473538
FT                   /note="region with at least 95 percent identity another
FT                   region of the genome"
FT   gene            474029..475168
FT                   /locus_tag="GC56T3_0442"
FT   CDS_pept        474029..475168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25498"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI25498.1"
FT                   /translation="MFRPLHWKRLVISLIVFVAGLTSLFISGGGSTATAFSLVASPSSD
FT                   RDLVAVQQTIVRALEARWRLMIDPQVNMKSFYDPDTSEQEESRERAYVRRHYLEPAARA
FT                   GFQYTSVKVHPVFENVEISGKTAKVQVLVSVEYESMFPGSNEVVITKEANIPYFAALTK
FT                   RDGHWLIVKMSGQDTYSKRGQENGATIRASRSETLPASITGGDVVTQGFYTYYSRQGAV
FT                   NYANRWWNGRNPKYRSFSNDCANFVSQSFYEGGSARQAWAEPYVWWYNTKGTSGTGDDA
FT                   WTYSWSVAHDQAYHLSRNNETDEHRSTYVAKATDLQLGDSIYYDFDGDGILDHSAIVVE
FT                   IKNGQPYVNYHTNDTYHRHWDLGAKTTRFLHVTDYYWVN"
FT   sig_peptide     474029..474136
FT                   /locus_tag="GC56T3_0442"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.480 at
FT                   residue 36"
FT   gene            475271..475609
FT                   /locus_tag="GC56T3_0443"
FT   CDS_pept        475271..475609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0443"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25499"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1271"
FT                   /protein_id="ADI25499.1"
FT                   /translation="MRIGIPLVLILVIAFFSGCQQQQTVPGYQDIPLHPQASDIRSVDE
FT                   RVEFVVASSSAEEVADYYLDELEKRQWTQVDRWGSAFVYEKKGRQILLVVTDVKNHAKV
FT                   SVSPFHPN"
FT   sig_peptide     475271..475339
FT                   /locus_tag="GC56T3_0443"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.868) with cleavage site probability 0.554 at
FT                   residue 23"
FT   repeat_region   475800..477727
FT                   /note="region with at least 98 percent identity another
FT                   region of the genome"
FT   repeat_region   477986..479694
FT                   /note="region with at least 95 percent identity another
FT                   region of the genome"
FT   gene            complement(480014..480428)
FT                   /pseudo
FT                   /locus_tag="GC56T3_0444"
FT   gene            complement(480552..481274)
FT                   /locus_tag="GC56T3_0445"
FT   CDS_pept        complement(480552..481274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0445"
FT                   /product="protein of unknown function DUF162"
FT                   /note="PFAM: protein of unknown function DUF162; KEGG:
FT                   gyc:GYMC61_1272 protein of unknown function DUF162"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25500"
FT                   /inference="protein motif:PFAM:PF02589"
FT                   /protein_id="ADI25500.1"
FT                   /translation="MTRGAIHNRDAFLENIAHRLGRAPRLSGVSRPQWDCAPQWTVFAG
FT                   YSQDDLLAVLREQCKLIHTDYIETTNAGLAGVLKQQVTAYGGGPVIVPDDPRFAEYGLS
FT                   TLLQDEWPAEQIAVHTWNPALGRQNIDAAEQANVGIAFSDITLAESGTVVLFSRNEQGR
FT                   AIHFLPKTYIAIVPKSTVVPRMTQAAAIIHEQIEKGVLIPSCINFITGPSNSADIEMNL
FT                   VVGVHGPMKAAYIVVTDR"
FT   gene            complement(481271..482701)
FT                   /locus_tag="GC56T3_0446"
FT   CDS_pept        complement(481271..482701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0446"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /note="KEGG: gyc:GYMC61_1273 iron-sulfur cluster binding
FT                   protein; TIGRFAM: iron-sulfur cluster binding protein;
FT                   PFAM: protein of unknown function DUF162"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25501"
FT                   /inference="protein motif:TFAM:TIGR00273"
FT                   /protein_id="ADI25501.1"
FT                   /translation="MPMKIENGPFWKRVEENLQNDFMRGAVAGMQDRGYVRRLGVIEEL
FT                   GHWEEWRSLAEQIRKHTLENLDYYLMQLSENVAKRGGHVFFAQTAEEANDYIRRIALEK
FT                   QAKKIVKSKSMVTEEINLNPVLEAIGCQVVETDLGEYILQIDDHDPPSHIVGPALHKNK
FT                   EQIRDVFRRKLGYTKSSDPVELARHAREMLRRDYLTADIGITGCNFAIAESGSITLVTN
FT                   EGNADLVTALPKTQITVMGMERIVPTFEEMEVLVSMLTRSAVGQKLTSYITVLTGPRDE
FT                   GDADGPEEFHLVIVDNGRSSILGTEFQPILQCIRCAACVNVCPVYRHIGGHSYGSIYSG
FT                   PIGAVLSPLLDGYDDYKELPYASSLCAACTEACPVKIPLHELLIKHRQIIVEREGKAPA
FT                   AEKLAMKAFRLGTASSSLYRFGTKFAPSAFAPFVEDGRITKGPGPLKAWTESREFPAPS
FT                   KERFRDWFRDRQKGGNPS"
FT   gene            complement(482719..483438)
FT                   /locus_tag="GC56T3_0447"
FT   CDS_pept        complement(482719..483438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0447"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: gyc:GYMC61_1274
FT                   protein of unknown function DUF224 cysteine-rich region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25502"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ADI25502.1"
FT                   /translation="MKVSLFVTCLIDLFYTNAGKATVELLERLGCEVDFPEAQTCCGQP
FT                   AYNSGYVKESKEAMKQMMRAFAHADYIVTPSGSCAAMLKEYPHIFHGDPEWEAEAKRLA
FT                   AKTYELTQFLVDVLKVEDVGASLHGRATYHTSCHMTRLLGVKDAPLRLLEHVKGLELVP
FT                   LPNAHQCCGFGGTFSVKMGPISEQMVDEKIEHIEEVEADYLIGADCGCLMNIGGRIGRL
FT                   GKPIRVMHIAEVLNHQK"
FT   gene            complement(483547..484272)
FT                   /locus_tag="GC56T3_0448"
FT   CDS_pept        complement(483547..484272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0448"
FT                   /product="GntR domain protein"
FT                   /note="KEGG: gyc:GYMC61_1275 GntR domain protein; PFAM:
FT                   GntR domain protein; regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25503"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADI25503.1"
FT                   /translation="MAFKRIKTKKIYEEVAEAIFDMIKNGELKPGDKLDSVQQLAEQFQ
FT                   VGRAAIREALTALKAMGLIELRQGEGTYVREFDPTMMTFPLSMAVLMNKEDIWHLLEVR
FT                   KLLEAGAASLAASKRTERDLEAMAQALRQMKEGIGSGELGEKADWAFHMAIAEASQNPM
FT                   LTSIMNSVSGMIVETMRETRRIWLFSKQTTTEKLLAEHQAIFEAIRDQNPDAARARMLE
FT                   HLTNVENVLRRYVRTQQPN"
FT   gene            484584..486257
FT                   /locus_tag="GC56T3_0449"
FT   CDS_pept        484584..486257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0449"
FT                   /product="L-lactate transport"
FT                   /note="KEGG: gyc:GYMC61_1276 L-lactate transport; TIGRFAM:
FT                   L-lactate transport; PFAM: L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25504"
FT                   /inference="protein motif:TFAM:TIGR00795"
FT                   /protein_id="ADI25504.1"
FT                   /translation="MWKQDFTPIADQLWLSAIVALIPILYFFWALAVKRMKGHIAGLTT
FT                   LLLAVALAVIAYRMPAGKAVMSVTQGAVYGLLPIGWIIITSVFLYKLTVKTGHFDIIRN
FT                   SVVSLTEDRRLQALLIAFSFGAFLEGAAGFGAPVAISAALLAGLGFNPLYAAGICLIAN
FT                   TAPVAFGAVGIPIISMEGPTGVPAMEISKMVGRQLPFLSVFIPFYLVLIMAGWKKTVEV
FT                   LPAIIVSGVSFALTQYFTSNFLGPELPDILSSLVSIVALAVFLKYWKPKSTFRFATESE
FT                   VAAAGQVARATQRGGEVFRAWSPFLVLTALISLWGIPQVKAALTGHYEGTNSLLKLVNA
FT                   IGVHLTFMPPVPGLNNQILNPSGQPIAAVYKLELLGAAGTAILLAAVVTKFIIGISWKD
FT                   WARTFVETLNELKFPIITIASVVGFAYIANSSGMSTTLGMALAKTGPLFPFFSPILGWL
FT                   GVFITGSDTSSNLLFGNLQKVTATSIGMDPVLALAANSSGGVVGKMISPQSIAVACAAV
FT                   GLTGKESDLFRFTVKHSVFLIILIGVLVYLQSTVLSWMIP"
FT   gene            complement(486553..486663)
FT                   /pseudo
FT                   /locus_tag="GC56T3_0450"
FT   gene            complement(486880..487332)
FT                   /locus_tag="GC56T3_0451"
FT   CDS_pept        complement(486880..487332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0451"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: gka:GK0400 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25505"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADI25505.1"
FT                   /translation="MKKWYSLLFVSMIVLFSSFFVSTSNSDAAANKARLIIEAKKLIGT
FT                   PYRYGGTTPKGFDCSGFVYYTHKKVGVILPRTSREMYKEGTYVHKSQLQPGDLVFFDTS
FT                   KQTKGVSHVAIYIGNNQVIHAVSRGVKIDSLNSNYWKTKYVGAKRL"
FT   sig_peptide     complement(487246..487332)
FT                   /locus_tag="GC56T3_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.665 at
FT                   residue 29"
FT   gene            487677..490133
FT                   /locus_tag="GC56T3_0452"
FT   CDS_pept        487677..490133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0452"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   PAS fold domain protein; KEGG: gyc:GYMC61_1280 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); SMART:
FT                   EAL domain protein; GGDEF domain containing protein; PAS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25506"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADI25506.1"
FT                   /translation="MMSNQLEYILYIFGLFLTVGGVYVYGHWMAKRHWGGIPWLAAPRL
FT                   TVVFATVSLLFLGAGMIYIHYAEKQEHREYEEAAKQIAGMIAGDLAAMGHERLDERAEH
FT                   LPAYHTVMAVLERWQHYGRVLSVYTLKKNERGELYFVAAPATDYNRNGRIDGEKEQAVP
FT                   PGTVYRRHFPEIEEAFHGRFAMEQHPTTDEWGRSISAFMPIRQPDGTVDAVVGIDFDAK
FT                   TYEQHLQRGRKQAMWTMMAMFLASAVAYLLALHQQMERKALAVYKKTLASNEHRLRRLA
FT                   EMTMEGLIVYAHGKVVEVNEAVCRLLGYSESELIHLPIGELVVDGSMKLNRPHEEPERL
FT                   EIELRRKDGTTFPAEIVRRRYDYEGEKVTVAAVRDLTEQKQNEERMRYIANHDELTGLP
FT                   NKEAMYKAVERCLVEAKQHRHEAAVIFLEVSGMKTINDFYGYAVGDEVLLHLAQEWKEK
FT                   QGMTVGRWSGNEFIALVPNSTHQKAEEMAKQLIEAADEPIVVNGMELYVTVNIGISVYP
FT                   KDGEDAKTLIRKADIARYEARKKAASDFLFFTEPMAIRLNEKMAMERDLRRALENEEFE
FT                   LYYQPQIRLHDRQVIGMEALIRWRHPEKGMVSPSLFIPVAEQTGMIIPINEWVIRTACE
FT                   QTKQLLDRFPDLSVSINLSPYEFESRRFVDKLARLLADAGLPPHHLDLEITERMTMDTE
FT                   RALDILSKLKGLGVTISMDDFGTGYSSLSYLTDLPIDRLKIDRSFVQHIQGKKDVILPA
FT                   IIRLGHNIGVKVLAEGVETETEAAYLQGKRCDEAQGYYFSPPLPYDELVRFLNEQRVRR
FT                   QAQELT"
FT   gene            490135..490506
FT                   /locus_tag="GC56T3_0453"
FT   CDS_pept        490135..490506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0453"
FT                   /product="DnaJ-like, subfamily C, member 28, conserved
FT                   domain protein"
FT                   /note="PFAM: DnaJ homologue, subfamily C, member 28,
FT                   conserved domain; KEGG: gyc:GYMC61_1281 DnaJ-like,
FT                   subfamily C, member 28, conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25507"
FT                   /inference="protein motif:PFAM:PF09350"
FT                   /protein_id="ADI25507.1"
FT                   /translation="MDGFWRIAEEKIREAMKNGEFDNLPGFGKPLEIEDLSRIPEELRL
FT                   GYLLLKNAGYVREEAELRKELLTLEDLLRCCEDDEEKRELEKKRTEKQLRFAELMKKRG
FT                   QTNSKALRDYGRRIEEKFR"
FT   gene            490712..491281
FT                   /locus_tag="GC56T3_0454"
FT   CDS_pept        490712..491281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25508"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1282"
FT                   /protein_id="ADI25508.1"
FT                   /translation="MRKLWVAFFASLVLAMPSWVSARSHAGGGADVHLPVGHMWKHEGL
FT                   DEQKWMEMVQKYTPEQEEEWKKVLDERNALRQQLNDENVKQAIKEKCKKMKKEREAALD
FT                   RLIDQLVDKKITKEQFKKEWKQLHKKKQWMTKEEKQQLHLLHEQTRQAMENNDQEAMKK
FT                   LLPQWLDHMKKKNERLAKWLQEVKQG"
FT   sig_peptide     490712..490792
FT                   /locus_tag="GC56T3_0454"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.950 at
FT                   residue 27"
FT   repeat_region   491346..493232
FT                   /note="region with at least 98 percent identity another
FT                   region of the genome"
FT   gene            complement(493468..494247)
FT                   /locus_tag="GC56T3_0455"
FT   CDS_pept        complement(493468..494247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0455"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25509"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3132"
FT                   /protein_id="ADI25509.1"
FT                   /translation="MKGKFKKFLVASSFVTLLSGLNLVNYAFADSKVVNNESKEVKEVK
FT                   EVLEQKEKLKQSVNIDKYDLVRKSELGVKEGYDKDDPEPDWAPGDSFGSPKGTNNISFA
FT                   AFAPGDIIGVHDGSVAWGYYRHAAVWDGTYYTGSLDSYAFIEANVENQPGDGQSNVHYS
FT                   TARKFRNYDQAVGLYVYTLEQQFRTLARNYIRNQLGEPYKFVGSYKSDTSTWYCSKLAW
FT                   KAYYDMGNRDLDYDGGLYVYPDDIYQDGDTKIFATGS"
FT   sig_peptide     complement(494158..494247)
FT                   /locus_tag="GC56T3_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.973 at
FT                   residue 30"
FT   gene            494645..496141
FT                   /locus_tag="GC56T3_0456"
FT   CDS_pept        494645..496141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0456"
FT                   /product="Carboxylesterase type B"
FT                   /note="PFAM: Carboxylesterase type B; KEGG: gyc:GYMC61_3129
FT                   carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25510"
FT                   /inference="protein motif:PFAM:PF00135"
FT                   /protein_id="ADI25510.1"
FT                   /translation="MEPTVVETRYGRLRGGTKEGVFVWKGIPYAKAPVGERRFLPPEPP
FT                   DAWDGVREAAAFGPVVMQPSDTIFSGLLGRMSEAPSEDGLYLNIWSPAADGKKRPVLFW
FT                   IHGGAFLFGSGSSPWYDGTAFAKHGDVVVVTINYRMNVFGFLHLGDLFGEEYAQAGNLG
FT                   ILDQVAALRWVKENIEAFGGDPDNVTIFGESAGAASVGVLLSLPEARGLFRRAILQSGS
FT                   GSLLLRSPKTAMAMTERILERAGIRPGDRGRLLSIPAEELLRAALSIGPGIMYGPVVDG
FT                   RVLRRHPIKALHDGAASGIPILIGVTKDEYNLFTLTDPSWMKLGEHELLDRINREVGPV
FT                   PEAAIRYYAETAEPSTPAWQKWLRIMTYRVFVEGMLRTADAQAAHGADVYMYRFDYETP
FT                   VFGGQLKACHALELPFVFHNLHQPGVANFVGNRPEREAIADQMHYAWLAFARTGNPNGD
FT                   HLPEAWPAYTSERKAAFVFSAASHVEDDPFGRERAAWQGR"
FT   gene            complement(496242..496457)
FT                   /locus_tag="GC56T3_0457"
FT   CDS_pept        complement(496242..496457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25511"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3128"
FT                   /protein_id="ADI25511.1"
FT                   /translation="MARPDERVVIAIDGYQFKRAREAKKGKIFVTSPIGANFTFDVNVM
FT                   RKLIEAIDRDPALAEQFGLPSQGANE"
FT   repeat_region   496639..496779
FT                   /note="region with at least 98 percent identity another
FT                   region of the genome"
FT   gene            497091..497327
FT                   /locus_tag="GC56T3_0458"
FT   CDS_pept        497091..497327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0458"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="KEGG: gyc:GYMC61_3127 preprotein translocase, SecG
FT                   subunit; TIGRFAM: preprotein translocase, SecG subunit;
FT                   PFAM: Preprotein translocase SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25512"
FT                   /inference="protein motif:TFAM:TIGR00810"
FT                   /protein_id="ADI25512.1"
FT                   /translation="MHALLVTLLVIVSIALIAVVLLQSGRSAGLSGAITGGAEQLFGKQ
FT                   KARGLDAVFQRVTVVLAVLFFVLTILVTYVQPS"
FT   sig_peptide     497091..497177
FT                   /locus_tag="GC56T3_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.855) with cleavage site probability 0.201 at
FT                   residue 29"
FT   gene            497399..498142
FT                   /locus_tag="GC56T3_0459"
FT   CDS_pept        497399..498142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0459"
FT                   /product="carboxylesterase"
FT                   /note="KEGG: gyc:GYMC61_3126 carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25513"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3126"
FT                   /protein_id="ADI25513.1"
FT                   /translation="MMKIVPPKPFFFEAGERAVLLLHGFTGNSADVRMLGRFLESKGYT
FT                   CHAPIYKGHGVPPEELVHTGPDDWWQDVMNGYQFLKNKGYEKIAVAGLSLGGVFSLKLG
FT                   YTVPIQGIVTMCAPMYIKSEETMYEGVLEYAREYKKREGKSEEQIEQEMERFKQTPMKT
FT                   LKALQELIADVRAHLDLVYAPTFVVQARHDEMINPDSANIIYNEIESPVKQIKWYEQSG
FT                   HVITLDQEKDQLHEDIYAFLESLDW"
FT   gene            498165..500441
FT                   /locus_tag="GC56T3_0460"
FT   CDS_pept        498165..500441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0460"
FT                   /product="ribonuclease R"
FT                   /note="TIGRFAM: ribonuclease R; VacB and RNase II family
FT                   3'-5' exoribonuclease; PFAM: ribonuclease II; Ribonuclease
FT                   B OB region domain; RNA binding S1 domain protein; KEGG:
FT                   gyc:GYMC61_3125 ribonuclease R; SMART: Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25514"
FT                   /inference="protein motif:TFAM:TIGR02063"
FT                   /protein_id="ADI25514.1"
FT                   /translation="MDHMLAERILTFMRDEAYKPLTVEELEEAFGIADAEEFKTFVKTL
FT                   VAMEEEGLVVRTRSNRYGVPERMNLVRGKVIGHPKGFAFVTPEEPGLDDIFIPPSELKN
FT                   AMHGDTVLVRVQADSSGARREGTIVRILERGVKEVVGTYTESKYFGFVIPDDKRIVNDI
FT                   FIPKNAANGAVEGHKVVVRLTSYPEGRMSAEGEVVQILGHKNDPGVDILAIIYKYGLPL
FT                   QFPEDVIEHANRVPDVITEKDLEGRRDLRGEMIVTIDGEDAKDLDDAVTVTKLENGNYK
FT                   LGVHIADVSYYVEEGSPIDREAYERGTSVYLVDRVIPMIPHRLSNGICSLNPKVDRLTL
FT                   SCEMEITPQGEVVRHEIFPSVIRTAERMTYSDVNKILVDKDEALREKYGPLVPMFELMA
FT                   ELADILRAKRMKRGAIDFDFKEAKVLVDENGKPYDVVLRERSVAEQLIEEFMLAANETV
FT                   AEHFHWLNVPFIYRVHEDPKPEKLQRFLEFITNFGYVVKGTGNQIHPRALQQILEAVRG
FT                   EPEEMVISTVMLRSMKQARYDAESLGHYGLSTEFYTHFTSPIRRYPDLIVHRLIRTYLI
FT                   NGQMDLDTQQKWAEKLPEIAEHASDMERRAVEAERETDDLKKTEFMEDKIEMEFDGIIS
FT                   SVTNFGLFVELPNTIEGLVHVSYLTDDYYRYDERHYALIGERTGKMYRIGDEITVRVIN
FT                   VNKDERIVDFEVVGMKGRRPPKAKAAPVVIEGKKQKKGKAKAEPKAQSGSNRSAKPKKK
FT                   KKKKR"
FT   gene            500523..500990
FT                   /locus_tag="GC56T3_0461"
FT   CDS_pept        500523..500990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0461"
FT                   /product="SsrA-binding protein"
FT                   /note="KEGG: gyc:GYMC61_3124 SsrA-binding protein; TIGRFAM:
FT                   SsrA-binding protein; PFAM: SmpB protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25515"
FT                   /inference="protein motif:TFAM:TIGR00086"
FT                   /protein_id="ADI25515.1"
FT                   /translation="MPKGEGKVIAQNKKAHHDYFIEETYEAGLVLQGTEIKSIRNGRVN
FT                   LKDSFAKVEKGEVFLHNMHISPYEQGNRYNHDPLRTRKLLLHRREINKLIGYTKEQGYT
FT                   LVPLKLYIKNGFAKVELGVAKGKKKYDKREDMKRKEAQREIERAFRERQKL"
FT   gene            501356..501706
FT                   /gene="ssrA"
FT                   /locus_tag="GC56T3_R0051"
FT   tmRNA           501356..501706
FT                   /gene="ssrA"
FT                   /locus_tag="GC56T3_R0051"
FT                   /note="tmRNA as predicted by Rfam (RF00023), score 236.24"
FT   gene            complement(501899..502348)
FT                   /locus_tag="GC56T3_0462"
FT   CDS_pept        complement(501899..502348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0462"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25516"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3121"
FT                   /protein_id="ADI25516.1"
FT                   /translation="MKHLSIDRLHTQFAAGTTHTFPLIGRMYTLTHSDATGDLYLAIGR
FT                   SFATTRLNAMRDEVLGEWKQAGQHLALFIYVFVGSKQMGKEENIRRKQVFEKELPLALE
FT                   AIRYGDRHFFRHFPSCDGSPILVHFTSEYPELNRTETYGIPYMYR"
FT   gene            complement(502517..502942)
FT                   /locus_tag="GC56T3_0463"
FT   CDS_pept        complement(502517..502942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0463"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25517"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3120"
FT                   /protein_id="ADI25517.1"
FT                   /translation="MGIIRSSWQAFGRWRKRRPFWGATFLLLSSLVILWIPMQLYEISL
FT                   VPGSMVFAGFFLGGMVMLMGILSYAMPRLSTLLGIIGMFSAILSIMGALGGFLVGTILG
FT                   IIGGALCIAWRPQWAEADTPAAHREAAADKEPSAATD"
FT   gene            complement(502964..503554)
FT                   /locus_tag="GC56T3_0464"
FT   CDS_pept        complement(502964..503554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0464"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25518"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3119"
FT                   /protein_id="ADI25518.1"
FT                   /translation="MEMATKPVIIGGRTAKKPLIAALLGGFLLLGALLSIFGLTGVAYA
FT                   VPISGVGEFTVQFDKLNGSGFKMYGGVAEAGNAPQTPVFVNEMDKATIQGLRISKDFPA
FT                   LGIRVVIVASEPVSIDGLVQKATQINGNISFGSLTMKESYVGDTSNPVEKAAKEFTQGA
FT                   DSITIENGDIKTVYLFQQKVSLPGMKVYFEKLN"
FT   sig_peptide     complement(503417..503554)
FT                   /locus_tag="GC56T3_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.981 at
FT                   residue 46"
FT   gene            503782..504957
FT                   /locus_tag="GC56T3_0465"
FT   CDS_pept        503782..504957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0465"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="KEGG: gyc:GYMC61_3118 transcriptional regulator,
FT                   LuxR family; PFAM: regulatory protein LuxR; SMART:
FT                   regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25519"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADI25519.1"
FT                   /translation="MSKELNDHLLRLLHEAADILHRYAAELNREWKRIGEALGKRNARV
FT                   QEVFSTLCAFVQARLLPYGGEHPANGHLERIAAFHPEMIIFSLNLMENTVHQVLKAHAS
FT                   AAAALHPAVRYLFFKWNEWLLYEVNEQSFKIGGDSSWKKESLWKDAVILFNEWILRAQT
FT                   FEESAAHICFGFSYFLPFSRCALFQFVNQESTAIGLHGHGVDNGQIQRLRVELDSIPML
FT                   KESVGKLKAEVHEFRHFRPIYVPRASEQFPRLYVDPFGLASLVIVPVYVPTEGRMIGGV
FT                   VLDRGPGRFFAVDRRLFPALMKFGQSAGELLLKWIKAPKKEWEGMAESLSPREIEILKL
FT                   LADGASTLEAACQLYLSEFTVRDYISSALRKLNAKNRTEAVAKALRLGLIG"
FT   gene            505083..506453
FT                   /locus_tag="GC56T3_0466"
FT   CDS_pept        505083..506453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0466"
FT                   /product="Propeptide PepSY amd peptidase M4"
FT                   /note="PFAM: Propeptide PepSY amd peptidase M4;
FT                   PepSY-associated TM helix domain protein; KEGG:
FT                   gyc:GYMC61_3117 propeptide PepSY amd peptidase M4"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25520"
FT                   /inference="protein motif:PFAM:PF03413"
FT                   /protein_id="ADI25520.1"
FT                   /translation="MEQTVKAADKQRPMYAAVWRWHFYAGIIFAPFLIILALSGAVYLF
FT                   KPQIESALYGHLYEVDKVGEKRLSLVELTERVKEKYPHDSVVSVTLEKEANRTVKIGMM
FT                   DKGEMVFAFVNPYTGEIQGTLRADENWTEIAKKIHSELLIGGTAANRFVELAACWGFIL
FT                   LATGLYLWWPRQSFSVLGTFWPRWRAKKRLAWRDWHAVTGIWLSIGILLLIVTGMPWTG
FT                   VMGEVINRVATATNTGYPPFAFSFGPKPESKVVTKEVAQDVPWAAEQLPVPSVRKRKAA
FT                   PLSLDEVYAIAEAKKVKKPFTISLPQGEKGVFTVATSKTKPWDNATLHIDQYSGRVLSD
FT                   VRFSDYGALAKAITIGIAFHEGRLFGLANQLVNLVFCLGLVFLCVSGFVMWRKRKPKDG
FT                   FGAPARVKDPQAAKTVWGGMIAAAVVMPLFALSLAAIWLFDRFVVQKIPSIRRFLAA"
FT   gene            506598..506834
FT                   /locus_tag="GC56T3_0467"
FT   CDS_pept        506598..506834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0467"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25521"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3116"
FT                   /protein_id="ADI25521.1"
FT                   /translation="MNQPYASHASSPQLIALVDPYVYHAFQALNGKEVVVETVRGSIQG
FT                   TVRDVKPDHIVISAHQAVYYIRLAQVVSVRLSN"
FT   gene            506855..507754
FT                   /locus_tag="GC56T3_0468"
FT   CDS_pept        506855..507754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0468"
FT                   /product="manganese containing catalase"
FT                   /note="PFAM: manganese containing catalase; KEGG:
FT                   gyc:GYMC61_3115 manganese containing catalase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25522"
FT                   /inference="protein motif:PFAM:PF05067"
FT                   /protein_id="ADI25522.1"
FT                   /translation="MVFQRIDRLAIELPKPKYADPNAAAAVQELLGGRFGEMSTLNNYL
FT                   FQSFNFRQKKKLRPFYELVASITAEEFGHVELVSNAINLCLTGSTHPGDPDTAPMKDAK
FT                   DKRNTYHFIATAQTAFPGDSMGKAWTGEYVFNSGNLILDLLHNFFLECGARTHKMRVYE
FT                   MTDHPTAREMIGYLLVRGGVHILAYAKAIEVATGVDVTKLLPIPKLDNRVFDEARKYED
FT                   QGVHRRLYTFSDRYYKEIVRIWQGTHPSDGQPLEVVEGAPQGGAIPDLDEVPEEFAPGI
FT                   SAEDFFEIAKRLQRSAGL"
FT   gene            complement(507882..508796)
FT                   /locus_tag="GC56T3_0469"
FT   CDS_pept        complement(507882..508796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0469"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: gyc:GYMC61_3114 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25523"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADI25523.1"
FT                   /translation="MIDVKQLKYFVTIAEEGQITKAAQKLHIAQPPLSQQLKQLEEELG
FT                   VPLFDRKAKKMELTAPGKAFYEKAKRLLAQLDDAVAEVKDIEEGTAGTLSIGCVKSCFY
FT                   YLAQAIRRFHEQAPNVTFHLREGDTFSICQLLYERRIDIGIVRLPIDSADYDVIRLPGE
FT                   RYVGVLPAQWKTGQPSLCMRDFADWPLLLLHRVHGAGQYERVIEECRRHGFEPNVLCEC
FT                   PDATILLSLVAQGLGATIVPQSTVALFRLPGIKVLEIIDSSMTAEAAAILDRQRYLPKS
FT                   ARTFLDVLQTVAARAAGGQHEER"
FT   gene            508953..510431
FT                   /locus_tag="GC56T3_0470"
FT   CDS_pept        508953..510431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0470"
FT                   /product="4-hydroxyphenylacetate 3-monooxygenase, oxygenase
FT                   subunit"
FT                   /note="KEGG: gka:GK3034
FT                   4-hydroxyphenylacetate-3-hydroxylase; TIGRFAM:
FT                   4-hydroxyphenylacetate 3-monooxygenase, oxygenase subunit;
FT                   PFAM: 4-hydroxyphenylacetate 3-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25524"
FT                   /inference="protein motif:TFAM:TIGR02309"
FT                   /protein_id="ADI25524.1"
FT                   /translation="MPAKTGQEYMERLKRAKSSVYIHGEKVEDVTVHPAFRNVVRSMAA
FT                   LYDRQYEKPKKMLYRSPTTGQLVGMTFIQPTTIDELIARREATQEWARMSAGMMGRSPD
FT                   YLNAEVMAMGVANDLFAEDDPMFAENAKNYYEYARENDISLTHTLIHLQMNRAKALHEQ
FT                   NDADVPLHLVERRKDGIIVSGIRLLATQGGITDEILVFPSTVKKSTAGEDPYALAFAIP
FT                   NNTPGVKFICREAFDYGRSSWDHPLASRFEEGDAIVSFENVFVPWERVFVCGNSSICNR
FT                   TFRETNAVIHMSHQVVAKNIVKTEFLLGVTLCLIEAIGIGEFQHVKDKGAEIMLVLETM
FT                   KSHLYRAEHNAKPDRWGTMTPDFAALDAARNWYPRIYPRLAEIIRILGASGMMAIPTEA
FT                   DFDNEEIGDIVRRAMQGATVDGYERVQLFRLAWDLTMSAFGARQTHYEYYFFGDPVRMG
FT                   MAYFDGYEKEPYKQFVREFLRGAKSVFIPSDSQR"
FT   gene            510475..511458
FT                   /locus_tag="GC56T3_0471"
FT   CDS_pept        510475..511458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0471"
FT                   /product="3,4-dihydroxyphenylacetate 2,3-dioxygenase"
FT                   /note="KEGG: gyc:GYMC61_3112 3,4-dihydroxyphenylacetate
FT                   2,3-dioxygenase; TIGRFAM: 3,4-dihydroxyphenylacetate
FT                   2,3-dioxygenase; PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25525"
FT                   /inference="protein motif:TFAM:TIGR02295"
FT                   /protein_id="ADI25525.1"
FT                   /translation="MTFSIIRCARVVLHVTDLAAARDFYERVLGFVVTEADESHLYLRG
FT                   LEEYHHHSLLLKKGPRPAVEALGYKVGSEQELEALYEWFAAQTLQPKWLEAGSQNAIGR
FT                   AFRVQDPSGLPLEFFAQMEKTERLLQRYDLHRGARVQRIDHFNCAVRDVKNAYDFYVHG
FT                   LGFACSEYTETEDGKLWAAWLHRKQNVHDLALMNGKGPRLHHIGFWLPDPLSLIHACDV
FT                   LAAAGYAPNIERGPGRHGLSNAFFVYLRDPDGHRIELYNGDYLTSDPDFPPIRWDLDDP
FT                   RRQTFWGHAAPDSWFEEASVVLDVHSGQPIEPNEPTLAKQKPTFLI"
FT   gene            511592..512533
FT                   /locus_tag="GC56T3_0472"
FT   CDS_pept        511592..512533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0472"
FT                   /product="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase"
FT                   /note="KEGG: gyc:GYMC61_3111
FT                   2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase; TIGRFAM:
FT                   2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase;
FT                   dihydrodipicolinate synthase; PFAM: dihydrodipicolinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25526"
FT                   /inference="protein motif:TFAM:TIGR02313"
FT                   /protein_id="ADI25526.1"
FT                   /translation="MAYREAKERLRGSIAPVVTPFDEEGNVDFAALAALIDWHIESGTH
FT                   GISVTGTSGEPSSLTLEERKQVMETAKKAVAGRVPFVPGTGSTNHAETIELTKFAQEIG
FT                   ADAAMVIVPYYNRPSQQALYKHFKAVAEAVDIPIIVYNIPGRTAVNLEVKTLARLAEDC
FT                   PNIIGVKESNKDFEHVNRVLWHCGRDFLLFSGIELLCYPMLAIGGAGSISATANVVPHK
FT                   VAELHDAWFEGDIKRAQDLHFELMELNDVLFIETNPGPVKAALGMMGKITPKLRLPLDL
FT                   PSEEHQRQIRRTLVKYGLLAEETQDEEMQKAT"
FT   gene            512890..513669
FT                   /locus_tag="GC56T3_0473"
FT   CDS_pept        512890..513669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0473"
FT                   /product="4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase, HpaG1 subunit"
FT                   /note="KEGG: gyc:GYMC61_3110 4-hydroxyphenylacetate
FT                   degradation bifunctional isomerase/decarboxylase, HpaG1
FT                   subunit; TIGRFAM: 4-hydroxyphenylacetate degradation
FT                   bifunctional isomerase/decarboxylase, HpaG1 subunit; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25527"
FT                   /inference="protein motif:TFAM:TIGR02305"
FT                   /protein_id="ADI25527.1"
FT                   /translation="MANVRLRLAGMRRTIEAKADPRGGTVSFGGLTHRIDELEWDAPIG
FT                   RAMYGVALNDGKEWAALSKEMNAPPYEKPPEGPVLYMKPANTINAHRRPVLLPRGVKHL
FT                   QAAPALGLVIGRTAARVRREQALDFVFGYTIVNDLSIPHEQRHRPAVKEQARDGFAPVG
FT                   PWIVPKEEASPLSSLTARVYVNGRLVQRADPSRFRLPVEQWLAEVTEFMTLYPGDVLFF
FT                   SWPADAPLVTAGDVVRIEIERIGVLENEIALEQGGDE"
FT   gene            513666..514406
FT                   /locus_tag="GC56T3_0474"
FT   CDS_pept        513666..514406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0474"
FT                   /product="4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase,HpaG2 subunit"
FT                   /note="KEGG: gka:GK3030 hypothetical protein; TIGRFAM:
FT                   4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase,HpaG2 subunit; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25528"
FT                   /inference="protein motif:TFAM:TIGR02303"
FT                   /protein_id="ADI25528.1"
FT                   /translation="MMRRARVAWNGIVTEAEPLDDGRLRLPDGTIVGELEVMWLPPVEP
FT                   GVIVALGLNYAEHAGELSFVAPKEPLLFFKGKNTLIGHRGRTVRPEGVNMMHYECELAV
FT                   VIGRPASRVKAERAYDYIFGYTIANDYAVRDYLENYYRPNFRVKNRDRTTPLGPWIVSH
FT                   EEVGDPMALRLRTYVNGAVVQEGYTGDMIFSIPYLLEYITEFMTLAPGDVILTGTPKGA
FT                   VNVQPGDEVVAEIERIGRLINYIV"
FT   gene            514424..514810
FT                   /locus_tag="GC56T3_0475"
FT   CDS_pept        514424..514810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0475"
FT                   /product="5-carboxymethyl-2-hydroxymuconate isomerase"
FT                   /note="PFAM: 5-carboxymethyl-2-hydroxymuconate isomerase;
FT                   KEGG: gyc:GYMC61_3108 5-carboxymethyl-2-hydroxymuconate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25529"
FT                   /inference="protein motif:PFAM:PF02962"
FT                   /protein_id="ADI25529.1"
FT                   /translation="MPHFILEYTANLGEEADIRGLLGKIHRVLIKRSDWFPVGGIRSRA
FT                   IRLDEYYVADGAEDDAFVHGTLKIGAGRPEQVKKEVGDELFAVMKDHFAPLFAKRYLAL
FT                   SLELYEFNEAGTYKHNNIHARYRT"
FT   gene            514827..516338
FT                   /locus_tag="GC56T3_0476"
FT   CDS_pept        514827..516338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0476"
FT                   /product="5-carboxymethyl-2-hydroxymuconate semialdehyde
FT                   dehydrogenase"
FT                   /note="KEGG: gyc:GYMC61_3107
FT                   5-carboxymethyl-2-hydroxymuconate semialdehyde
FT                   dehydrogenase; TIGRFAM: 5-carboxymethyl-2-hydroxymuconate
FT                   semialdehyde dehydrogenase; PFAM: Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25530"
FT                   /inference="protein motif:TFAM:TIGR02299"
FT                   /protein_id="ADI25530.1"
FT                   /translation="MAVQPKVLHYINGQFMEGVAGAYFDNINPFTNEPINEVAEGRKED
FT                   IDAAVRAAKEAFDHGPWRTMPVERRLRYLFRIADLIEQYADDIAYLEALDTGIPISQAK
FT                   KQAARAAENFRFYAEMVKTRLVGEAYHVNGQFLNYTVYKPVGVAGLITPWNTPFMLETW
FT                   KVAPALATGNTVVLKPAEWSPLTANKLAEIIDEAGLPRGVFNVVHGFGETAGAALVAHP
FT                   DVRLISFTGETTTGMEIIRNSAATLKKTSMELGGKSPLIVFADADLERALDAAVWGVFS
FT                   LNGERCTANSRLLLEQSIYDEFVARLKERVDRIVIGDPMSPATELGPLIHRDHWERVNR
FT                   YIDIAKQEGADVYAPSVPTGLEKGNFVPPTLLLGCHNGMRVAQEEIFGPVMAVMSFADE
FT                   EEAIRLANDVKYGLAAYVWTNDMKRGHRVAQAIESGMAWVNSPNVRDLRIPFGGTKYSG
FT                   IGREGGHYSFDFYTEVQVVHVAVGDPPIPAFGKGEKPTALSAEQA"
FT   gene            516378..517025
FT                   /locus_tag="GC56T3_0477"
FT   CDS_pept        516378..517025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0477"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: gyc:GYMC61_3106 transcriptional regulator,
FT                   GntR family; PFAM: GntR domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25531"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADI25531.1"
FT                   /translation="METKAKNKTQLAYEYILSRIENGVYGPGYRVVIDQIARELGLSSI
FT                   PVREAIRQLEAEGLVEFKPYTGAVVSNINEKEYIETLSVLAVLEGYATALGSANLTKEA
FT                   INELERLNERMERALEELELERFSELNYEFHSLIYAHCGNAYLEEQIKQIWQRMKRIRV
FT                   YGFTFVPQRAKASIEEHREIVRLLHEQAPPHEIEQYVRQHKINTAEAFKRRR"
FT   gene            517103..518272
FT                   /locus_tag="GC56T3_0478"
FT   CDS_pept        517103..518272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0478"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   gyc:GYMC61_3105 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25532"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADI25532.1"
FT                   /translation="MKKGMSLLMAALLLIFLAACGKTATSGGEDEIKIGAIFSASGGAA
FT                   PLGKPEMETVKMLVEQWNKQGGIDGKKIKLIAYDDKSNQNEAVLSTKKLIEQDKVTAII
FT                   GGTISGNSLAMIPLIEKAGIPYISLAASKQIVNPSDGSSRHWTFKTAQGDNIVIQKLLG
FT                   FLKEKGWTNVAWLNVANAYGTSGHEEFVHYAPEYGVKAVIEEEFEATVDDAKAMLTKVK
FT                   KANPQAIIVWGTAQESAVVTKNIRQLGIEAPIVESHGIGTKSFIDLAGEAANGVWFPAG
FT                   RILVADQLPDSDPQKETLLKYKEQFEKAYGYAPTTFGGHAWDAFHLLVNAIKEGGADQE
FT                   KIRSVLENTRKFIGISGVFHMSKDDHTGLDADSLVMVQIQDGKFVLAEQ"
FT   sig_peptide     517103..517168
FT                   /locus_tag="GC56T3_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.921 at
FT                   residue 22"
FT   gene            518334..519215
FT                   /locus_tag="GC56T3_0479"
FT   CDS_pept        518334..519215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0479"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   gyc:GYMC61_3104 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25533"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADI25533.1"
FT                   /translation="MEAWSQFVQLLFSGLTVGSIYALVALGFVITYSVTGILNLAQGDF
FT                   AMLGALFCITLVNNGVPFAAAIGLSMLAVMAVGTLFERLAIQPARRSPVAVLIIITIGV
FT                   SFVFRGFALLVWGTDPYALRPFTGHGALEVFGAVIQWQSVWAIVISLASFAALHLFFHR
FT                   TYIGKAVAACVINPFAARLMGIDIRKMSLGAMAVSAGLGALAGIIIAPISGASYDMGMM
FT                   IGLKAFIAAVVGGLTNAPAAIAGAFLVGLLESFAEGYLSSGYKEAISFGLLLLVLLFMP
FT                   NGLFAKMTGKRV"
FT   gene            519229..520293
FT                   /locus_tag="GC56T3_0480"
FT   CDS_pept        519229..520293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0480"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   gyc:GYMC61_3103 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25534"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADI25534.1"
FT                   /translation="MERVQQMADGRKRWPLLAGAAVWLGLPWLVFGNNYVLSTLILIGL
FT                   YALVSTGMTMLMGYAGQISLGQAAFYGIGAYASAYLTAHAGWPSWLALAAGAVLAASVA
FT                   LVVGIPVFRLREHYLALATLGFGVIMFTFFKEWKGITGGLNGFFGIPPIRIAGVPLQSD
FT                   LQFYYLVSLFVLVGLWFAHNIVRSRVGRALRAIHGSEVAASSLGVNIMKYKLQIFMLSA
FT                   VYASIAGSLYAHYVTFINPDLFGIVPSISFLIMVVIGGSAHVWGGLVGAAVYVCLGEWL
FT                   KAVVPLLLPNAGGEFEIVFFGLLLVVMLIYMPNGLTGVMQKRMRRFFEMGGRQEKQIAT
FT                   VERHKARSIGGERG"
FT   gene            520290..521060
FT                   /locus_tag="GC56T3_0481"
FT   CDS_pept        520290..521060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0481"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gyc:GYMC61_3102 ABC transporter related
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25535"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI25535.1"
FT                   /translation="MSAVLLEVEQLSKSFGGVQAVQNVSFHVKKEEIVAVIGPNGAGKT
FT                   TLFNMISGIIPPTSGLVRFQGAMVSGKQPHELAMLGMTRTFQNLQLFAEMTVLENVMVG
FT                   FHSRLKSGILSAGFRLPRTVKEEKQAQKQAFSCLEQVGLAHLAWERAGTLPYGMQRLVE
FT                   IARAAVSRPSLILLDEPMAGLNPQESKQLVDVLLAMREQGFTFLFVEHDMETVMAIADR
FT                   IVVLDYGKKIAEGAPEEIARHPDVLKAYLGEEAV"
FT   gene            521060..521785
FT                   /locus_tag="GC56T3_0482"
FT   CDS_pept        521060..521785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0482"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gyc:GYMC61_3101 ABC transporter related
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25536"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI25536.1"
FT                   /translation="MLVLRNVHVYHGHLHVLKGIDLHVGQGEIVAIVGANGAGKSTLLG
FT                   TIAGVYAPTEGEILFEHKPLPYGKVEQIVEKGICLVPERRQIFDSLSVRDNLLLGAYRR
FT                   HRRDGQEVKRDYERVLELFPKLQTMIDRPGGLLSGGEQQMLAIARGLMARPKLLLLDEP
FT                   SLGLAPLVVKEVMGMLTQLCDQFQTAMILVEQNVRAALQTADEAYVLERGSIVVHGKAA
FT                   ELLADERVAEAYLGAACRR"
FT   gene            521996..522463
FT                   /locus_tag="GC56T3_0483"
FT   CDS_pept        521996..522463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0483"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: gyc:GYMC61_3100 flavin reductase domain protein
FT                   FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25537"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ADI25537.1"
FT                   /translation="MDDRTFRRAMGKFATGVTVVTTEFQGEAKGMTANAFMSVSLDPKL
FT                   VVVSIGHKARMHDIVKQTGKFAVNILRRDQEELSRLFAGQLKEERPVSFDWVNGHPILP
FT                   EALANILCNVHSTYVAGDHTLYFGEVTDIFMKDEPGDPLLFFEGKYRSIGQ"
FT   gene            complement(522600..523163)
FT                   /locus_tag="GC56T3_0484"
FT   CDS_pept        complement(522600..523163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0484"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: gyc:GYMC61_3099 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25538"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADI25538.1"
FT                   /translation="MYDIAIIGAGPAGASAAIFAAKAGKKTVLFDSDKGMTKRAWVENH
FT                   YGVPEISGPELVETGKKQAAKFGAELVETQVTNVQKTDGGFRLETETGSYEAKHVIFAT
FT                   GVATDLAEKIGLRTKPGTEPRIKTVIDVDANGKTNIDGIWAAGTVAGVSVHTIITAGDG
FT                   AKVAINVISELNGERYVDHDVLKK"
FT   sig_peptide     complement(523101..523163)
FT                   /locus_tag="GC56T3_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.647) with cleavage site probability 0.394 at
FT                   residue 21"
FT   gene            523568..525400
FT                   /locus_tag="GC56T3_0485"
FT   CDS_pept        523568..525400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0485"
FT                   /product="Pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="KEGG: gyc:GYMC61_3098 pyruvate kinase; PFAM:
FT                   Pyruvate kinase barrel"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25539"
FT                   /inference="protein motif:PRIAM:2.7.1.40"
FT                   /protein_id="ADI25539.1"
FT                   /translation="MHDKRDLGARLAAFYRGMAEWVGQKQKYFPLPSHEESRDQLLAYL
FT                   YMREHMPSDLREAMEDAGWRLEGQEAHLIDAIEQVLAYLRTRVDGGWELRKMTRKEAKQ
FT                   LLHKRAEAVFGSPSSVRPTRIMVTMDEAWVDEPGLIERLLLYGMDIARINCAYGSPETW
FT                   EALVAIIRQAEKQLEPQLQARRCRIYMDLPGPKIRVDRLAVNAGPMKLSVKKNLYGEPM
FT                   EPLFGLVSFSSSPPPSPLPRDVSFLWQLTAEDGATVEEGDELLFTDVRGKKRKLRVAEQ
FT                   IAPSCFKVLLSRTAYVQKGMKLRRGSASFTLCSVLFIPMKAFVTVGTPLYIYFDDAAFA
FT                   EAQNGCGVKMTTTLAKAWRNVRAGDRLYLNDGQIAARVVKVHERHVEAKVVADGGKRKA
FT                   IKQGTGIHLPDSFLHLAVPPLTDRDLEWIPFIARWADIVGLSFVQSPYDLRKLYHLLAE
FT                   QGAGSLPVIAKIETRAALHNFVRILLEGLKFPAFGVMIARGDLALEIGFEHLAAAQNDI
FT                   LALCRAAHIPVIWATQVLEQMAKKGIPSRAEISDVFLGKQAQCIMLNKGRHIAEAVRLL
FT                   SSLLEKEERQSEPLAMPKKDGERMNLLHLWEDEG"
FT   gene            525578..526141
FT                   /locus_tag="GC56T3_0486"
FT   CDS_pept        525578..526141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0486"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: gyc:GYMC61_3097 BioY
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25540"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ADI25540.1"
FT                   /translation="MHIRSFVWAAFFAALTAVGGFIKIPVPYVPFTLQIAAVYLSGCLL
FT                   GPRTGALSQMLYVLIGLAGAPVFAEGGGLGYIWKPTFGYLLGFIAGAYTCGSLVHRFQW
FT                   TRAQDIWKANLAALFVVYAFGCTWLYIAMKWIAETPLSIGQTLWFGFLLPVPGDLVLCA
FT                   VCSVVAARVWPRVRPIMMTRGMGG"
FT   gene            526146..526862
FT                   /locus_tag="GC56T3_0487"
FT   CDS_pept        526146..526862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0487"
FT                   /product="dethiobiotin synthase"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG:
FT                   gyc:GYMC61_3096 dethiobiotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25541"
FT                   /inference="protein motif:TFAM:TIGR00347"
FT                   /protein_id="ADI25541.1"
FT                   /translation="MGQAIFMTGTGTEIGKTVVTSIVALALERLGMKVGVFKPVQTGLA
FT                   EDGVSFAEQYWYERVAKIPTSEGMYYMEPAMSPHLAAKLTGTSIEPERVAERLEWLTQR
FT                   YDVVLVEGAGGLAVPWCERDGRWYMTSDFVRDYEVPAILVSLSSLGAIHHAVTTAAYAD
FT                   AQGIRLLGLMFNQFQEQEIIHQNNVETIAALLRLPVLAVVPLLPAVSRRELETLAQRWI
FT                   EQGKAKQLLEVLSVGV"
FT   gene            526852..528231
FT                   /locus_tag="GC56T3_0488"
FT   CDS_pept        526852..528231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0488"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   gyc:GYMC61_3095 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25542"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ADI25542.1"
FT                   /translation="MAYSYEQLEQWDKQYVWHPFTQMKQYAKERPLIIERGQGSYLYDV
FT                   DGNRYLDGYASLWVNVHGHNDPELNAALREQLEKIAHSTLLGSANVPSILLAKRLLEYW
FT                   PHMSKVFYSDTGAAAVEIALKIAYQYWKNIDPVQYAKKNKFVSLKEAYHGDTVGAVSVG
FT                   GMETFHRIFAPLLFERIEVPSPYVYRMDEYGSEQEIVGYCLRELERVLEEQHDQIAAVV
FT                   IEPLVQGAAGIIVHPRGFLKGVERLCRRYGVLFICDEVAVGFGRTGTMFACEQEEVQPD
FT                   LVCLGKGITGGYLPLAATLVTEEIYAAFLGDVDEDKTFYHGHTYTGNQLTCSVALKNIE
FT                   LIEKRGLIDSVKRKARRLAEWLEQLYEIPIVGDIRQKGLMCGIEIVKDRRTKEVFPRAA
FT                   MVEHRIILEARRRGLVIRPLGPVLTFIPVLSMSEDEMAEAVRILFDSIACLYEQARAEL
FT                   L"
FT   gene            528462..528656
FT                   /locus_tag="GC56T3_0489"
FT   CDS_pept        528462..528656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0489"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25543"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3094"
FT                   /protein_id="ADI25543.1"
FT                   /translation="MSHLQVADERIWRPWGWWFWRPRPFFFGAPFFGAPFFGGFLGGLL
FT                   GSALVPPFFYPWWYGPIWW"
FT   gene            528755..528898
FT                   /locus_tag="GC56T3_0490"
FT   CDS_pept        528755..528898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2968 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25544"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2968"
FT                   /protein_id="ADI25544.1"
FT                   /translation="MLFPGLLFGAPFVGGFLGGLLGGALAPRPFYPYPPYPPYPPYPGW
FT                   WY"
FT   gene            complement(529114..529449)
FT                   /locus_tag="GC56T3_0491"
FT   CDS_pept        complement(529114..529449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0491"
FT                   /product="Coat F domain protein"
FT                   /note="PFAM: Coat F domain protein; KEGG: gka:GK3012
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25545"
FT                   /inference="protein motif:PFAM:PF07875"
FT                   /protein_id="ADI25545.1"
FT                   /translation="MNTKQVQNPEMQVPKTPQMNERDFLNDMLTTEKYMTLSYSVFLHE
FT                   ASNQPLYQDMMNIFTETQNCQRDLYNLMFKKGWYKLEAADPQKLQQTYQQFQGYTNQLP
FT                   YQRNAMQ"
FT   gene            complement(529465..529722)
FT                   /locus_tag="GC56T3_0492"
FT   CDS_pept        complement(529465..529722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK3011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25546"
FT                   /inference="similar to AA sequence:KEGG:GK3011"
FT                   /protein_id="ADI25546.1"
FT                   /translation="MQQQPQMNPQAAMPEPPQMVSTKDAMYFSDMMSWNLLAAKKAHFF
FT                   ASQCRDPEVVQAIERAGQMHQRHYDMILRHLQNPPQPPVM"
FT   gene            529887..530804
FT                   /locus_tag="GC56T3_0493"
FT   CDS_pept        529887..530804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0493"
FT                   /product="Proline dehydrogenase"
FT                   /EC_number="1.5.99.8"
FT                   /note="KEGG: gyc:GYMC61_3090 proline dehydrogenase; PFAM:
FT                   Proline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25547"
FT                   /inference="protein motif:PRIAM:1.5.99.8"
FT                   /protein_id="ADI25547.1"
FT                   /translation="MEQLMRDFFLFLSKNKTLTKWAKRYGLRFGASRFVAGETIEEAVR
FT                   VIRQLNEKGLAVTVDYLGEFVDNEQEANEMARHCLEAIEAISREKLNSQLSLKMTSMGL
FT                   DISDELVMRNMRRILDAAKQRGVFVTIDMEDYSRCQKTLDIFKTLKKEYDNVGTVLQAY
FT                   LYRTEQDIEDLKPYRPNLRLVKGAYKESPEVAFPDKKDVDENFKKIIKMHLLNGNYTAV
FT                   ATHDDAIIEYTKQLVKEYNIPNSQFEFQMLYGIRPERQVQLAREGYTMRVYVPYGTDWY
FT                   GYFMRRLAERPANVAFVLKGILRK"
FT   gene            complement(531036..531185)
FT                   /locus_tag="GC56T3_0494"
FT   CDS_pept        complement(531036..531185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0494"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3089 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25548"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3089"
FT                   /protein_id="ADI25548.1"
FT                   /translation="MARLKKNPSERGVSAASVKGNAGPTVEADGGGKRTSQNQQYKKHN
FT                   MQGD"
FT   gene            531373..533760
FT                   /locus_tag="GC56T3_0495"
FT   CDS_pept        531373..533760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0495"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein; Enoyl-CoA
FT                   hydratase/isomerase; KEGG: gyc:GYMC61_3088
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25549"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ADI25549.1"
FT                   /translation="MVKRIRRAAVLGSGVMGSGIAAHLANVGIPTLLLDIVPRELTKEE
FT                   EAKGWTLEHKQVRNRLANQALERLLKQKPAPLMSKDNIALIETGNFEDDFHRLAEVDWI
FT                   IEAVVEKLEVKKEVFARVDEVRTPGTIVSSNTSGISIAAMAEGRSDDFKKHFLGTHFFN
FT                   PPRYLKLLEIIPTEHTDPDVVAYMKSFGEDVLGKGVVMAKDTPNFIANRIGTYGLLVTV
FT                   REMMQGGYSVGEVDSVTGPLIGRPKSATFRTLDVVGLDTFVHVANNVYENVEGEEKEAF
FT                   RVPEFMKTMLENGWLGSKSGQGFFVKQGKDILELNYVTMQYEPRKKLVTPAVEMAKQAK
FT                   GAAAKLQTLVYADGDRAGTLLWNIIAPTLLYTARLVGEIADDIVAIDQAMKWGFGWEQG
FT                   PFELWDAIGLEKSVRKMQAEGRDIPSWITDMLADGATSFYKTENGRLFYYAPGGYKTVE
FT                   ENEKVIHIRRLKEARGVIKKNAGASLIDLGDDVALLEFHSPNNAIGADIVQMINEALEE
FT                   VNRNYKGLVIGNQGKNFCVGANLAMMLMEAQDENFFELELAVRQFQQALLKMKYNPKPV
FT                   VVAPFAMTLGGGAEVSLAASRIQAAAETYIGLVEVGVGLIPGGGGNKELYIKRLNSLPR
FT                   GVDVDYVKIAASVFETIAMAKVSTSAAEARELGFLNHRDGITMNGDHLLYEAKQAVLSM
FT                   YEEGYRPPVRKKVPVAGESGYAAMLLGAQSMFHSGYISEHDLKIAKKLAYVLAGGKVPY
FT                   GTEVDEQYLLDLEREAFLSLIGEPKTQARMQHMLVKGKPLRN"
FT   gene            533789..534961
FT                   /locus_tag="GC56T3_0496"
FT   CDS_pept        533789..534961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0496"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: gyc:GYMC61_3087 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25550"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADI25550.1"
FT                   /translation="MREAVIVAGARTPVGKAKKGTLAHVRPDDLGALVVKETIKRAGNY
FT                   EGNIDDLIIGCAMPEAEQGLNIARNIGALAGLPYTVPAITINRYCSSGLQAIAYAAERV
FT                   MLGHSDTVIAGGVESMSMVPMMGHVVRPNARLAEEAPEYYMSMGHTAEQVAKKYGVSRE
FT                   DQDAFAVRSHQRAAKAIAEGKFNEEIVPVEVTVRKVEGNKLVEEKVVFTQDEGVRPDTN
FT                   METLAKLRPAFAVNGTVTAGNASQMSDGAAAVMVMDREKAESLGLKPLGKFRSFAVAGV
FT                   PPEVMGIGPVAAVPKALKLAGLELSDIGLIELNEAFASQSIQVIRELGLDEDIVNVNGG
FT                   AIALGHPLGCTGAKLTLSLLYEMRRRNVQFGIVTMCIGGGMGAAGVFELL"
FT   gene            535099..536883
FT                   /locus_tag="GC56T3_0497"
FT   CDS_pept        535099..536883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0497"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   gyc:GYMC61_3086 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25551"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADI25551.1"
FT                   /translation="MAKTMEEAIKGGSFLIEDIPAERVFTPEDFTDEHHMIAKTTEEYV
FT                   NNEVLPQLEHLENHEFDRSVKLLRKAGELGLLSADIPEEYGGLGLDKVSSAIIAEKMAP
FT                   AGGFAISHGAHVGIGSLPIVLFGTEEQKQKYLPYLATGEKIAAYALTEPGSGSDALGAK
FT                   TTARLNAEGTHYILNGEKQWITNSGFADVFVVYAKVDGEHFTAFIVERDFPGVSTGPEE
FT                   KKMGIKSSSTRTLILQDVPVPKENVLGEIGKGHVIAFNILNIGRYKLGLGAVGGAKRAL
FT                   EITLKYANQRQQFKRPISQFTLTQEKFATMASRLYAAESSVYRTVGLFDERMGLLDAEK
FT                   AKDGKEVAKSIAEYAIECSLNKFFATEVLDYIVDEGVQIHGGYGFMQEYEIERAYRDSR
FT                   INRIFEGTNEINRLLVPGMYLKKALKGELPLFQKAQQLQEELMMMAAEEPGSGVLEQEK
FT                   YLVRNAKKIALMVAGLAAQKYGQRIEEEQEVLVNIADIVSNIYAMESALLRTEKAIQAS
FT                   GEEKNKQKLLYTQIFCQEAFNEIEAHAKETLVAVEQGDTLRMMLAALRRLTRHTPINVI
FT                   AKKREAAAALIEAERYIV"
FT   gene            536962..537327
FT                   /locus_tag="GC56T3_0498"
FT   CDS_pept        536962..537327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0498"
FT                   /product="arsenate reductase-like protein"
FT                   /note="PFAM: arsenate reductase and related; KEGG:
FT                   gyc:GYMC61_3085 arsenate reductase and related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25552"
FT                   /inference="protein motif:PFAM:PF03960"
FT                   /protein_id="ADI25552.1"
FT                   /translation="MALTLYWYPKCGTCRKAKRWLDEHGVDVRTVNLVDEPLTKEELAR
FT                   LHRQSGLPLKKFFNTSGMKYRELGLKDKLDRASEDEMLDWLASDGMLVKRPILTDGERV
FT                   VVGFREQEYEAFFAAGT"
FT   gene            537423..537806
FT                   /locus_tag="GC56T3_0499"
FT   CDS_pept        537423..537806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0499"
FT                   /product="glycine cleavage system H protein"
FT                   /note="KEGG: gyc:GYMC61_3084 glycine cleavage system H
FT                   protein; TIGRFAM: glycine cleavage system H protein; PFAM:
FT                   glycine cleavage H-protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25553"
FT                   /inference="protein motif:TFAM:TIGR00527"
FT                   /protein_id="ADI25553.1"
FT                   /translation="MNTPKELRYTKEHEWVRVEGENVRVGITDYAQSELGDIVFVELPE
FT                   VGAEVAANEPFGSVESVKTVSELYAPISGTVVEVNEALNDHPEYVNESPYDKAWMIVVK
FT                   PNDLSEIDNLLTAEQYEAMINEG"
FT   gene            537882..538118
FT                   /locus_tag="GC56T3_0500"
FT   CDS_pept        537882..538118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0500"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25554"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3083"
FT                   /protein_id="ADI25554.1"
FT                   /translation="MALQTTRIDVTDRIIGKLNGRSLELYEEGELIGRLPLPAAVPLKN
FT                   GYTEQNGRIYKQVTATVEPDQKYVDCDGEAGWC"
FT   gene            538217..538576
FT                   /locus_tag="GC56T3_0501"
FT   CDS_pept        538217..538576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0501"
FT                   /product="TOPRIM domain protein"
FT                   /note="KEGG: gyc:GYMC61_3082 toprim domain protein; PFAM:
FT                   TOPRIM domain protein; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25555"
FT                   /inference="protein motif:PFAM:PF01751"
FT                   /protein_id="ADI25555.1"
FT                   /translation="MRRVEKVIIVEGRSDKQKVAAVLNEPVVIVCTNGTISDARLEELA
FT                   DELEGCDVYVLADADEAGEKLRRQFRRMFPEAEHLYIDRAYREVATAPPWHLAQVLLRA
FT                   RFDVRIELLMRGRGE"
FT   gene            538573..538890
FT                   /locus_tag="GC56T3_0502"
FT   CDS_pept        538573..538890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0502"
FT                   /product="thioredoxin"
FT                   /note="KEGG: gyc:GYMC61_3081 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25556"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3081"
FT                   /protein_id="ADI25556.1"
FT                   /translation="MKAIDRNDVKRVVEVEPLLALYLYTPLCGTCQLARRMLTVVEQLF
FT                   PALPFYETDINYIPEQAVAWKIESVPCLLLFRDGTIAGKWYAFHSVPYLYEVIQACLPP
FT                   R"
FT   gene            539037..539384
FT                   /locus_tag="GC56T3_0503"
FT   CDS_pept        539037..539384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0503"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25557"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3080"
FT                   /protein_id="ADI25557.1"
FT                   /translation="MEMRELVGQFVERMQVLRHLVPILPDEQLYVRFESDDETALLLIG
FT                   KESAARGMENDERKTLTVRGSKEALASLLNGELKLQQLVRLQEVHVSGSFRHMLLLESL
FT                   LHLAKPYRHVG"
FT   gene            539655..540683
FT                   /locus_tag="GC56T3_0504"
FT   CDS_pept        539655..540683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0504"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gka:GK2999 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; NIL domain; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25558"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI25558.1"
FT                   /translation="MITLEQVTKIYQAANGSVTAVDNVSLEIREGEIFGIIGYSGAGKS
FT                   TLIRLLNGLEKPTSGRVVVAGRDMTRVKGRELRKARQEIGMIFQHFNLLWSRTVRENIA
FT                   FPLEIAGVPKEERNKRVDELIELVGLSGREDAYPSQLSGGQKQRVGIARALANNPKVLL
FT                   CDEATSALDPQTTDAILDLLVDINKRLGLTIVLITHEMHVIRKICDRVAVMESGRIVEQ
FT                   GEVLHVFRNPQQPITKRFVKQLIEPEETEEAISHLFGQYPSGLIAQLTFVGAAAGKPLI
FT                   TEVVRQFAVDVNILQGKISQTHQGAYGVLFVHLDGARDEIDRALDYIQRQQVAVEVIHD
FT                   AR"
FT   gene            540673..541341
FT                   /locus_tag="GC56T3_0505"
FT   CDS_pept        540673..541341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0505"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gyc:GYMC61_3078
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25559"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADI25559.1"
FT                   /translation="MLANLLPNVQWETMWAATVETLYMTGVAVAATFVLGIVLGLLLFL
FT                   TAKGNLWENRFVNTVIAAFVNIFRSIPFIILIILLIPFTTWLVGTMLGANAALPALVIG
FT                   AAPFYARMVEIALREIDKGVIEAAQAMGASTWTIIWKVLLPESLPALVSGITVTAVSLV
FT                   SYTAMAGAIGAGGLGNLAYLEGFQRNHNDVTFVATVLVLVIVFVIQAIGDFVTSKIDKR
FT                   "
FT   gene            541357..542208
FT                   /locus_tag="GC56T3_0506"
FT   CDS_pept        541357..542208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0506"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: gka:GK2997 amino acid
FT                   ABC transporter (substrate binding protein) (lipoprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25560"
FT                   /inference="protein motif:PFAM:PF03180"
FT                   /protein_id="ADI25560.1"
FT                   /translation="MKKWLGVLLAAILVLALAACGGNNNDNAEGGKDGKLVKLKVGASN
FT                   VPHAEILEKAKPILKKKGIDLEIITFQDYILPNKALAEKQIDANYFQHIPYLESQKKEY
FT                   GYDFVNAGGIHIEPIGLYSKKYKSIEELPDGATIIMSNSVADHGRILSMLQEKGLIKLK
FT                   PGVDKTKATVNDIIENPKHLKFKADVDAGLLPQIYKNGEGDAVLINANYALDAGLDPAK
FT                   DPIAVESPKNNPYVNIIAVRKGDENRKEIKTLVEVLQSKEIQNFIKEKYHGAVIPAAEN
FT                   NQ"
FT   sig_peptide     541357..541422
FT                   /locus_tag="GC56T3_0506"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.667 at
FT                   residue 22"
FT   gene            complement(542202..542330)
FT                   /locus_tag="GC56T3_0507"
FT   CDS_pept        complement(542202..542330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25561"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI25561.1"
FT                   /translation="MKQVGRGALGFRIVLTFAAFVSFKRSGFLETKKETEAKCSRY"
FT   gene            complement(542327..542512)
FT                   /locus_tag="GC56T3_0508"
FT   CDS_pept        complement(542327..542512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25562"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3076"
FT                   /protein_id="ADI25562.1"
FT                   /translation="MIRWVVFALTAAFASFLAWIIIGNTLGEQGDGAFSLTAVIVLQNC
FT                   VIIVMLAAVLARLNGR"
FT   sig_peptide     complement(542429..542512)
FT                   /locus_tag="GC56T3_0508"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.869 at
FT                   residue 28"
FT   gene            543098..543460
FT                   /locus_tag="GC56T3_0509"
FT   CDS_pept        543098..543460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0509"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="KEGG: gka:GK2996 hypothetical protein; TIGRFAM:
FT                   alkylhydroperoxidase like protein, AhpD family; PFAM:
FT                   Carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25563"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ADI25563.1"
FT                   /translation="MNNGTHASVESALRRYKEGIGAFTQKLPNVAERFNAFTEACFAEG
FT                   ALSKKEKQLIALGISLAAQDEYCTIYHTKGCLDEGASEQEILEACAVAAAFGGGAAMSQ
FT                   AVTLVQECLRELRTAH"
FT   gene            543694..544473
FT                   /locus_tag="GC56T3_0510"
FT   CDS_pept        543694..544473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0510"
FT                   /product="FeS assembly ATPase SufC"
FT                   /note="TIGRFAM: FeS assembly ATPase SufC; PFAM: ABC
FT                   transporter related; KEGG: gyc:GYMC61_3074 FeS assembly
FT                   ATPase SufC; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25564"
FT                   /inference="protein motif:TFAM:TIGR01978"
FT                   /protein_id="ADI25564.1"
FT                   /translation="MAVLTIRNLHVAVEGKEILKGVDLEVKGGEIHAIMGPNGTGKSTL
FT                   ASAIMGHPKYEVTEGSVTLDGQDVLEMEVDERARAGLFLAMQYPSEISGVTNADFLRAA
FT                   INARLGEGNEISLMKFIRKLDEKMAFLEMNPDMAHRYLNEGFSGGEKKRNEILQLMMLE
FT                   PKIAILDEIDSGLDIDALKIVAKGVNEMRSSEFGCLIITHYQRLLNYITPDYVHVMMQG
FT                   RIVKSGGPELAQRLEAEGYDWIKKELGIEDETVGQEA"
FT   gene            544491..545801
FT                   /locus_tag="GC56T3_0511"
FT   CDS_pept        544491..545801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0511"
FT                   /product="FeS assembly protein SufD"
FT                   /note="KEGG: gyc:GYMC61_3073 FeS assembly protein SufD;
FT                   TIGRFAM: FeS assembly protein SufD; PFAM: SufBD protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25565"
FT                   /inference="protein motif:TFAM:TIGR01981"
FT                   /protein_id="ADI25565.1"
FT                   /translation="MATETKIPFDETYIRTFSSGRGEPDWLTARRLEALRLAERLPLPK
FT                   PEKTKIDKWNFTEFARHTVDSAPYDGLDDLPEAVKALIEAGEGTKNLYVQRNHTPAYVS
FT                   LSDELKEKGVIFTDIFTAAREHGDLLKNYLMTAVKPDEHRLAALHAALLNGGVFVYVPK
FT                   NVEIETPLQAVYIQDEDDIALFNHVIVVAEDNSRVVFVENYISASREGKAVVNVVAEVF
FT                   AQANASVFFAAVDHLAKGTTTYVNRRGIAGRDGRIEWALGLMNDGNTVSENITRLVGDG
FT                   SFGDTKTVAVSRGEQVQNFTTSVVHYGRHTEGYILKHGVVRDSATSIFNGIGKIEHGAS
FT                   KSNAEQESRVLMLSEKARGDANPILLIDEDDVMAGHAASVGRVDPIQLYYLMSRGIPRR
FT                   DAERLIIHGFLAPVVEAIPIEGVKNQLIEVIERKVQS"
FT   gene            545798..547018
FT                   /locus_tag="GC56T3_0512"
FT   CDS_pept        545798..547018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0512"
FT                   /product="cysteine desulfurase, SufS subfamily"
FT                   /note="KEGG: gyc:GYMC61_3072 cysteine desulfurase, SufS
FT                   subfamily; TIGRFAM: cysteine desulfurase, SufS subfamily;
FT                   PFAM: aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25566"
FT                   /inference="protein motif:TFAM:TIGR01979"
FT                   /protein_id="ADI25566.1"
FT                   /translation="MNVNEIRTLFPILHQDVNGHPLVYFDSAATSQKPLPVIEALDRYY
FT                   REYNSNVHRGVHTLGTKATDAYEGAREKVRRFLNAQSAQEIIFTRGTTAALNLVAASYG
FT                   RANVKEGDEIVITYMEHHSNLIPWQQLAKQTGATLKYIPLQEDGTIDLRDVEAAITKAA
FT                   KIVAIAHVSNVLGTINPVREIARIAHERGAVVVVDAAQSAPHMKVDVQELDCDFLALSG
FT                   HKMCGPTGIGVLYGKKKWLAQMEPIEFGGEMIDFVELYDSTWKELPWKFEGGTPIIAGA
FT                   IGLGAAIDFLEQVGLDAIAAHEHELAQYALSRMADIEGVTVYGPKERAGLVTFNIDGVH
FT                   PHDVATVLDAEGIAIRAGHHCAQPLMKWLGVTATARASFYLYNTKEEIDRFIAALQKAK
FT                   EYFSHVF"
FT   gene            547008..547457
FT                   /locus_tag="GC56T3_0513"
FT   CDS_pept        547008..547457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0513"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /note="KEGG: gyc:GYMC61_3071 SUF system FeS assembly
FT                   protein, NifU family; TIGRFAM: SUF system FeS assembly
FT                   protein, NifU family; PFAM: nitrogen-fixing NifU domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25567"
FT                   /inference="protein motif:TFAM:TIGR01994"
FT                   /protein_id="ADI25567.1"
FT                   /translation="MSSNHPLDQLYRQVIMDHYKNPRNRGVLEGTNVDVNMNNPTCGDR
FT                   IHLTMKVEDGKVADVKFEGEGCSISMSSASMMTQAIKGKTVEEALRLAHIFSDMIQGKE
FT                   YDDSVDLGDIEALQGVSKFPARIKCATLAWKALEKGLHNHEHEGR"
FT   gene            547464..548861
FT                   /locus_tag="GC56T3_0514"
FT   CDS_pept        547464..548861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0514"
FT                   /product="FeS assembly protein SufB"
FT                   /note="KEGG: gyc:GYMC61_3070 FeS assembly protein SufB;
FT                   TIGRFAM: FeS assembly protein SufB; PFAM: SufBD protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25568"
FT                   /inference="protein motif:TFAM:TIGR01980"
FT                   /protein_id="ADI25568.1"
FT                   /translation="MAKKAPEIGEYKYGFVDKDVSVFRAQRGLTREVVEEISRMKNEPQ
FT                   WMLEFRLKALDIFYSKPMPQWGGDLSSLDFDEITYYVKPTEKSGRSWDEVPAEIKATFD
FT                   KLGIPEAEQKYLAGVSAQYESEVVYHNMKEDLEKLGVIFKDTDSALKENEDLFREYFAK
FT                   VVPPTDNKFAALNSAVWSGGSFIYVPKGVKVDTPLQAYFRINSENMGQFERTLIIVDEG
FT                   AHVHYVEGCTAPIYTTNSLHSAVVEIIVKKGAYCRYTTIQNWANNVFNLVTKRAVCEEN
FT                   ATMEWIDGNIGSKLTMKYPAVILKGEGARGLTLSIAIAGKGQHQDAGAKMIHLAPNTSS
FT                   TIVSKSISKQGGKVTYRGMVHFGRKASGSRSNIECDTLILDNQSTSDTIPYNEILNDNV
FT                   SLEHEAKVSKVSEEQLFYLMSRGISEQEATEMIVMGFIEPFTRELPMEYAVEMNRLIKF
FT                   EMEGSIG"
FT   gene            549365..549553
FT                   /pseudo
FT                   /locus_tag="GC56T3_0515"
FT   gene            549891..550217
FT                   /locus_tag="GC56T3_0516"
FT   CDS_pept        549891..550217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0516"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25569"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3068"
FT                   /protein_id="ADI25569.1"
FT                   /translation="MKLIFSGKSGIFIKVLLLVISWFIILFSLMIQNSDAFIYWFNPSV
FT                   VSISDERYFYTLVPTFFNILLLFFQIKFLGVRERKTTIYKILFVTLVINTILFLYYAIY
FT                   QFFG"
FT   sig_peptide     549891..550001
FT                   /locus_tag="GC56T3_0516"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.889) with cleavage site probability 0.612 at
FT                   residue 37"
FT   repeat_region   550335..552793
FT                   /note="region with at least 97 percent identity another
FT                   region of the genome"
FT   gene            552985..554040
FT                   /locus_tag="GC56T3_0517"
FT   CDS_pept        552985..554040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25570"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3065"
FT                   /protein_id="ADI25570.1"
FT                   /translation="MKKVLSFSLFMFVMLFLAMGSSVSASSITNDKNTKNVNGMLELLG
FT                   FSKEDIKDLKTNKFDVADIDFKNKDVRNLKLKKKDILFLAHFGFTKERIEHFTLNDWDH
FT                   FKNMEEPELVDVNVSYFKVDENNGELIPITKYEFEGNKKQREAYYEEIKKDPKAVALIT
FT                   SLCDPDNTCNGSNSSSMVKLTVAVTHSSKYAIVSDFDWVNDSNERHVDLFGTGHKEALT
FT                   VDYGSIFGSWTTEYYDNYGYVAERTSYFNGATYKFSTGYVHKLDRNSSTHQEFWQYNGK
FT                   WIHAQDDSGYTYAEFVWSSGTSSSAYANYTHMKTGWSSSFSVSMPLGASISVSGTTSYI
FT                   QIPNAAVSFTR"
FT   sig_peptide     552985..553062
FT                   /locus_tag="GC56T3_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.835 at
FT                   residue 26"
FT   gene            554037..554999
FT                   /locus_tag="GC56T3_0518"
FT   CDS_pept        554037..554999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3064 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25571"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3064"
FT                   /protein_id="ADI25571.1"
FT                   /translation="MTIRLRLIYCESIFTVKGGLSLKRILRYVLLCTMLAGCDHQEMNL
FT                   QAHHLDAKRQGFDQEEIENLIREPENANKVNRQLKNKEAAAFFRLGMTKEEIRHLDREE
FT                   MDFFRARSAANQWHELDEQTVKEIFKKQADHQMIRCHIEKQKLCTASTIYTDQKKNIME
FT                   LTISVSLLSREEHRYAVVLSYEWLIDPKEKETDFYGILTTENAVVDYHQLYSSYKTYRD
FT                   ASHVSIQHSRKPYQSSVVGYMIKNSLHKENNRHFGYVYSEIVPSDHAQTYMDVEGFYVH
FT                   ANRTWREKDLFSFQDVYNWNEKADAVMFKSPVIRISIRP"
FT   gene            complement(555110..555742)
FT                   /locus_tag="GC56T3_0519"
FT   CDS_pept        complement(555110..555742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0519"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   gyc:GYMC61_3063 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25572"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADI25572.1"
FT                   /translation="MIHLYPFLLLSMFLIVLPGPDTAVVTKNTISAGKIGGLKTALGVC
FT                   CALFLHTAAASLGLSAVIMQSALLFSILKYVGAVYLTYLGVKALYGVIKKGEALGVETD
FT                   VNSGEKQPACFRQGFLTDFLNPKVAAFFLTFLPQFVAPGAHSFAPFLLMGAAYTAMTAI
FT                   WFLFYISFIHYISDFMKRPKTKKWIEGITGAVMIGFGIKLALEKVQR"
FT   sig_peptide     complement(555671..555742)
FT                   /locus_tag="GC56T3_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.724) with cleavage site probability 0.720 at
FT                   residue 24"
FT   gene            555918..556775
FT                   /locus_tag="GC56T3_0520"
FT   CDS_pept        555918..556775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0520"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   gyc:GYMC61_3062 protein of unknown function DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25573"
FT                   /inference="protein motif:PFAM:PF01904"
FT                   /protein_id="ADI25573.1"
FT                   /translation="MIDMIYIGLTGWGDHDNLYPPGLAAKDKLLEYAAHFPTVEVDSYF
FT                   YAIQPRSNVEKWIRETPPSFQFIVKAYQGMTGHERGPIPYESKEAMFAAFLESIAPFQE
FT                   AGKLAMVLFQFPPWFDCRREHVAYLRWVKARMGEVPAALEFRHQSWFSPRFYEKTLRFM
FT                   EEEGWIHAICDEPQAGEGSVPTVLHPTDREKTLIRLHGRNVHGWNKATAGENWRAVRYL
FT                   YRYNERELREWARHIEALKKKTKQIYVLFNNNSGGDAADNAKQLIDLLGIEYTGLAPRQ
FT                   LGLF"
FT   gene            556794..557696
FT                   /locus_tag="GC56T3_0521"
FT   CDS_pept        556794..557696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0521"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   gyc:GYMC61_3061 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25574"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ADI25574.1"
FT                   /translation="MAYMLLFLIGFIAGTVGSLAGLGGGVIIVPSLLFFGALGWLSAVT
FT                   PQTAVGTSLVVIIFNGLSSTLSYMKDKMVDYQSGLLFCLGSVPGAVIGAWVNNTLSAAH
FT                   FSLYFGLFLIAMSLFLSLSQKKTKRSADETAAATENERESSRTETKAETRLKPASWWAR
FT                   KVMRTYTERNGETFVYGYYPLAAIAIAFVVGFFGGLFGIGGGSLMVPAMIVLFRFPPHV
FT                   AVATSMLMIFLSSLVGSLTHVVMGNVQWSFALALIPGVWIGAKTGAWINKRMPSRTLVV
FT                   VLRMVLVLLGLRLVIESFS"
FT   sig_peptide     556794..556856
FT                   /locus_tag="GC56T3_0521"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.707) with cleavage site probability 0.633 at
FT                   residue 21"
FT   gene            557714..559096
FT                   /locus_tag="GC56T3_0522"
FT   CDS_pept        557714..559096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0522"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; 5'-Nucleotidase domain
FT                   protein; KEGG: gyc:GYMC61_3060 metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25575"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADI25575.1"
FT                   /translation="MKQTVYIYHTNDVHSHFEHWPQIARFLSERRREHRARNEAMLLFD
FT                   VGDFLDRVHPITEATRGKANVDLLNDLHYDAVTIGNNEGITLDHDELDTLYEQARFPVV
FT                   VANLFRRDGVRPHWALPYVVIPATETFRIGVVGATAPFSHFYELLGWKIVPPFDMLAAA
FT                   VEEVRQKADCVVVLSHLGVNEDEKIAATIPGVDIILGAHTHHVFPEGKTLNQTLLCAAG
FT                   KYGKYVGVVKLEIDQNRLSRASATVVDVEPLPRSEAVERHLVCLEQESLARLEAEQVAV
FT                   LHDDLPLDWFAPSPLANLLASALREWCQADIGMVNAGVLLAPLARGPVTKKDLHRICPH
FT                   PLNPCKVKLRGAELKEIILEANTEWMKHLQFKGFGFRGEVMGEMVYDGVDIEAGLEEDG
FT                   QWHIRRIMINGEPLNPERTYEVATTDMFAIGHFYPQIQRAAEKTYYMPEFLRDLLAWKL
FT                   AQ"
FT   gene            559158..559460
FT                   /locus_tag="GC56T3_0523"
FT   CDS_pept        559158..559460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0523"
FT                   /product="Domain of unknown function DUF1805"
FT                   /note="PFAM: Domain of unknown function DUF1805; KEGG:
FT                   gyc:GYMC61_3059 domain of unknown function DUF1805"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25576"
FT                   /inference="protein motif:PFAM:PF08827"
FT                   /protein_id="ADI25576.1"
FT                   /translation="MVEVKPIIIDGHPFIAVSVQLPKTNLLAVAGEKGYIMCGALDVAL
FT                   LNEKLRDRGIIAGRAVGVRTIEQLLEAPLESVTVAALELGIEEGMKGREALLKMR"
FT   gene            559513..560259
FT                   /locus_tag="GC56T3_0524"
FT   CDS_pept        559513..560259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0524"
FT                   /product="sporulation protein YunB"
FT                   /note="KEGG: gyc:GYMC61_3058 sporulation protein YunB;
FT                   TIGRFAM: sporulation protein YunB; PFAM: Sporulation
FT                   protein YunB-like"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25577"
FT                   /inference="protein motif:TFAM:TIGR02832"
FT                   /protein_id="ADI25577.1"
FT                   /translation="MLRPRFVRKGPLPFRYVFLLTFVFFMLSTAASLWIVNKGIKPVLM
FT                   EIAETETKRIANLVINNAIEQQFQKDNPEFRQLVTVQKDESGKIVSVDFDTAVINRILS
FT                   ETDDHVMESLKAATEGRLERMVLPEVESGTGNSRGIIYYIPLGKITDNALLANLGPRIP
FT                   VQFQIVGNVDSEVTKEIRAYDINSFFIEIDIHVSVDIQVVIPFASKISNVTTDIPVVMR
FT                   FIPGEVPQFYNKNGGQVGPSIQLPKR"
FT   sig_peptide     559513..559605
FT                   /locus_tag="GC56T3_0524"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.874) with cleavage site probability 0.489 at
FT                   residue 31"
FT   gene            560857..562089
FT                   /locus_tag="GC56T3_0525"
FT   CDS_pept        560857..562089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0525"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   gyc:GYMC61_3057 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25578"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADI25578.1"
FT                   /translation="MTEHFEQWGEQEMKKKRAAGVFFSLMLTAGLLAGCGGNQQGGSSS
FT                   GGNGGGGGGGDVIKIGANLELSGGVASYGQSIAEGLDLALEEINKEGINGKKLELVKVD
FT                   NKSEAAEATNGAIKLISQDKVVAIIGSATSTNTLAQVQVANDNKVPLITPTGTNPTITN
FT                   KDGKVNEFVFRTCFIDPFQGTVAAKFALNDLKVKNAAVLIDSSSDYSKGLAASFKDAFT
FT                   QGGGKIVAEEAYVAKDTDFRATLTRIKSKNPEFIFLPGYYEEVGLIVKQARELGLNVPI
FT                   MGGDGWDSPKLVEIAGKDALNNTYITNHYSSGDPDPKIQEFVKAFKAKYNKAPDAFNAL
FT                   GYDTAYFLADAIKRAGSADPVKIKDALAQTKDLQLVSGTLTLNENHDPVKSAAILEYKD
FT                   GQQQFKTKVNP"
FT   gene            562196..563074
FT                   /locus_tag="GC56T3_0526"
FT   CDS_pept        562196..563074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0526"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   gyc:GYMC61_3056 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25579"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADI25579.1"
FT                   /translation="MELIQQLINGISLGSIYALIALGYTMVYGIVRLINFAHGDVFMVG
FT                   SFVGFYAVTMLHVGFFPALLLAMASCAVLGMIIERIAYKPLRNAARIAVLITAIGVSLL
FT                   IEYVTIYLRGAQPEAYPSTLLPDRNLELFGVVISSQSLFILGTSLVLMILLQFIVHRTK
FT                   IGKAMRAVSHDAEAARLMGINVDNTISATFAIGSALAGAAGVIFGIYYTKIDPLMGILP
FT                   GLKAFVAAVLGGIGIIPGAMVGGLLLGVIESLVSGLGYSLWRDGAAFVILILILIFRPA
FT                   GLFGKNVREKV"
FT   gene            563091..564065
FT                   /locus_tag="GC56T3_0527"
FT   CDS_pept        563091..564065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0527"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   gyc:GYMC61_3055 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25580"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADI25580.1"
FT                   /translation="MATWKRTRGFWVSVILAFAFFAVVEWLIASGTLNVFYVNTLFFMA
FT                   INVMLAASLHLIIGITGQFSIGHAGFFAVGAYASAVMTMKLELPFAVGVLTAGIAAMLA
FT                   GLIIGVPSLRLKGDYLAIATLGFGEIVRIALLNIDYVGGASGMTVTHMTTWPWVFACLF
FT                   VTILVIANFTNSTHGRACISIREDEIAADAMGINTTYYKVAAFAIGSFFAGIAGALYAH
FT                   HFYIIQPSNFGFLKSFDILIFVVLGGLGSLSGAVMAAVLLTIVSTFLQNYPETRMIIYS
FT                   IVLILVMLYRPTGLMGTKELSSLFKWRKAAQGGMNHGGKNTVA"
FT   sig_peptide     563091..563165
FT                   /locus_tag="GC56T3_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.727) with cleavage site probability 0.717 at
FT                   residue 25"
FT   gene            564040..564819
FT                   /locus_tag="GC56T3_0528"
FT   CDS_pept        564040..564819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0528"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gka:GK2977 branched-chain amino acid ABC
FT                   transporter ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25581"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI25581.1"
FT                   /translation="MAAKTPLLKAENVGIQFGGLKALSGVTMELYRGELVGLIGPNGAG
FT                   KTTLFNLLTGVYVPTDGRILLDGETVNGLPPYKITRKGISRTFQNIRLFGELSVLDNVK
FT                   VAYHAHARHSIASSILRLPSHFRGEKEMEEKAIEFLNIFQLDGVMHEKAKNLPYGQQRR
FT                   LEIARALAAQPKVLLLDEPAAGMNPQETKELMKLIAFIRERFALTILLIEHDMSLVMGI
FT                   CERIYVLDHGQLIAEGTPEQVRSNPKVIEAYLGEEVS"
FT   gene            564822..565529
FT                   /locus_tag="GC56T3_0529"
FT   CDS_pept        564822..565529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0529"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gyc:GYMC61_3053 ABC transporter related
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25582"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI25582.1"
FT                   /translation="MLKVHGIDVFYGNIHALKGVSLEVNKGEIVTLIGANGAGKTTLLK
FT                   TISGLLRPKNGDIVYEGASIAGKAAQTIVKQGISHVPEGRRVFANMTVEENLELGAFLR
FT                   KDKEGIQQDFAKVFQLFPRLEERRKQLAGTLSGGEQQMLAIGRALMARPKLLLLDEPSM
FT                   GLAPLLVKTIFRIIQEINESGTTILLVEQNAHMALSIAHRAYVLESGRVVLSGTASELQ
FT                   ASEQVKQAYLGGH"
FT   gene            complement(565778..566767)
FT                   /locus_tag="GC56T3_0530"
FT   CDS_pept        complement(565778..566767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0530"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: gyc:GYMC61_3052 peptidase
FT                   M23"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25583"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADI25583.1"
FT                   /translation="MHRWLAAISAAAMLWIAAGAASAAEQEEAVYEKRMELYKKAEAVS
FT                   LIPWYYFAAIDQYERNVRQVRRDLPKPTGVLGIYMKPEIWAGPLNKNPHDTDPFSISQF
FT                   GGLGVDGDGDGYARADDDDDVIMAMARYLQTYGIDHRHIKIALWNYYQRAKTVDLILGK
FT                   ARIYKKYQTLKLDNHVFPLPLGANYSYRDTWGDARGWGGRRIHEGTDIFAGYGVPVRST
FT                   CYGIVELKGWNKYGGWRIGIRDINNTYHYFAHLNGFAADLREGQIVEPGTIIGSVGSSG
FT                   YGPPGTAGKFPPHLHYGMYKDNGYTEWAFDPYPHLKAWERSERQQRRR"
FT   sig_peptide     complement(566696..566767)
FT                   /locus_tag="GC56T3_0530"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 24"
FT   gene            566934..567830
FT                   /locus_tag="GC56T3_0531"
FT   CDS_pept        566934..567830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0531"
FT                   /product="lipoic acid synthetase"
FT                   /EC_number="2.8.1.8"
FT                   /note="SMART: Elongator protein 3/MiaB/NifB; TIGRFAM:
FT                   lipoic acid synthetase; KEGG: gyc:GYMC61_3051 lipoic acid
FT                   synthetase; PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25584"
FT                   /inference="protein motif:TFAM:TIGR00510"
FT                   /protein_id="ADI25584.1"
FT                   /translation="MATKEEHVRKPDWLKIKLNTNENYIGLKKLMRENRLHTVCEEAKC
FT                   PNIHECWAVRRTATFMILGSVCTRACRFCAVKTGLPTELDWQEPERVAESVRIMNLKHV
FT                   VVTAVARDDLKDGGAAVFAETVRAIRRKNPFTTIEVLPSDMGGVYENLKILMDARPDIL
FT                   NHNIETVRRLTPRVRARATYERSLEFLRRAKELQPDIPTKSSIMVGLGETKEEIIEAMD
FT                   DLRANHVDILTIGQYLQPTKKHLKVVKYYHPDEFQELKEIALSKGFSHCEAGPLVRSSY
FT                   HADEQVSEAAKARQLKA"
FT   gene            complement(567953..568639)
FT                   /locus_tag="GC56T3_0532"
FT   CDS_pept        complement(567953..568639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0532"
FT                   /product="Sporulation lipoprotein YhcN/YlaJ-like protein"
FT                   /note="PFAM: Sporulation lipoprotein YhcN/YlaJ-like; KEGG:
FT                   gka:GK2973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25585"
FT                   /inference="protein motif:PFAM:PF09580"
FT                   /protein_id="ADI25585.1"
FT                   /translation="MRRPWLAVAFGAAVALAGCAQTAQDENTDIYKRSGNTINVTDRNE
FT                   LYNENGVPNGDDTPMNNFGYVRHQKSPILGDANGYNDMPSFNREKAADLISKLCTQLPG
FT                   VKDVATLVTDEEVLVVYDADTNNRQQTADQVKKTALSVVPRYYHVYVADNPQLMKDIER
FT                   FGRLDSNTRNIDQILDATIQRMLKYPQGKKLSDGENENGEMINETNDELDRDFRDGTPR
FT                   ATKAGR"
FT   sig_peptide     complement(568571..568639)
FT                   /locus_tag="GC56T3_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.583 at
FT                   residue 23"
FT   gene            568752..569027
FT                   /locus_tag="GC56T3_0533"
FT   CDS_pept        568752..569027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0533"
FT                   /product="protein of unknown function DUF1027"
FT                   /note="PFAM: protein of unknown function DUF1027; KEGG:
FT                   gka:GK2972 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25586"
FT                   /inference="protein motif:PFAM:PF06265"
FT                   /protein_id="ADI25586.1"
FT                   /translation="MICINNHCYELVENVKNAFNEEAFRARYADILAKYDYIVGDWGYN
FT                   QLRLRGFFDDHNQKATYDTKISTLSEYLYEYCNFGCAYFVLRKVKR"
FT   gene            complement(569066..569350)
FT                   /locus_tag="GC56T3_0534"
FT   CDS_pept        complement(569066..569350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0534"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25587"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3048"
FT                   /protein_id="ADI25587.1"
FT                   /translation="MAERETYADFSVVEKQRNFLTAEEFPEGPYGSPRRDDAPVENKST
FT                   PWKEGQRHYSAFNYEFKSFHQNIPRRDPAAHPPHDDPHQSEQFPYNEGE"
FT   gene            complement(569409..569681)
FT                   /locus_tag="GC56T3_0535"
FT   CDS_pept        complement(569409..569681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25588"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3047"
FT                   /protein_id="ADI25588.1"
FT                   /translation="MMGERFYLYDDTVEAAVRFVSFVGERQRFDLALIETDRFYGKWLV
FT                   LDLQSNRFAILGRDDLEEPGYIEHAYQLHEQDANDLRAFLEEYLS"
FT   gene            569779..570216
FT                   /locus_tag="GC56T3_0536"
FT   CDS_pept        569779..570216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0536"
FT                   /product="protein of unknown function DUF86"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   gyc:GYMC61_3046 protein of unknown function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25589"
FT                   /inference="protein motif:PFAM:PF01934"
FT                   /protein_id="ADI25589.1"
FT                   /translation="MYFVDRKKLEETLSYMEQMLDRYKAEERWDEPLRQLALERIAHIV
FT                   IEAVLDVGNAMIDGFIMRDPGSYNDIIDILADERVISPADADRLKAFIAHRKMLVHEYA
FT                   RVDHAKLLADLNEHLPALEAYPKAVRAYLENELGPVSAFRN"
FT   gene            570241..571011
FT                   /locus_tag="GC56T3_0537"
FT   CDS_pept        570241..571011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0537"
FT                   /product="HAD-superfamily subfamily IIA hydrolase like
FT                   protein"
FT                   /note="KEGG: gka:GK2968 hypothetical protein; TIGRFAM:
FT                   HAD-superfamily subfamily IIA hydrolase like protein;
FT                   HAD-superfamily hydrolase, subfamily IIA; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25590"
FT                   /inference="protein motif:TFAM:TIGR01457"
FT                   /protein_id="ADI25590.1"
FT                   /translation="MKRYNGYLIDLDGTMYRGTECIAEARTFVNELHRRGIPYLFVTNN
FT                   SSRTPAQVAEKLRSFGVPAEEKHVFTTSQATANYIFEKKPDASVYVIGEEGLQTALADK
FT                   GFRLAGEDADVVVIGIDRQITYEKFAVACLAVRNGAMFISTNGDIALPTERGLLPGNGA
FT                   LTSVVAVSTQVKPTFIGKPEKIIMEQALKVLGVPKEDVLMIGDYYETDILAGMNAGIDT
FT                   LLVHTGVTTKEMLARYERMPTYTADSLLEWLDRL"
FT   gene            complement(571095..571592)
FT                   /locus_tag="GC56T3_0538"
FT   CDS_pept        complement(571095..571592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0538"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /note="PFAM: phosphatidylglycerophosphatase A; KEGG:
FT                   gyc:GYMC61_3044 phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25591"
FT                   /inference="protein motif:PFAM:PF04608"
FT                   /protein_id="ADI25591.1"
FT                   /translation="MSEFIMNNLEQTARRWLEERGVTVEKIAELVYYLQSKYHPDLTME
FT                   ECIENVNRVISKREVQNAILTGIQLDKLAEDGRLDEPLQSIIRRDEGLYGVDEILALSI
FT                   VNVYGSIGFTNYGYIDKQKPGILQYLNDKSTGKCNTFLDDIVGAIAAAASSRLAHRAAN
FT                   AE"
FT   gene            571888..572889
FT                   /locus_tag="GC56T3_0539"
FT   CDS_pept        571888..572889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0539"
FT                   /product="spore coat protein YutH"
FT                   /note="TIGRFAM: spore coat protein YutH; KEGG:
FT                   gyc:GYMC61_3043 spore coat protein YutH"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25592"
FT                   /inference="protein motif:TFAM:TIGR02905"
FT                   /protein_id="ADI25592.1"
FT                   /translation="MEEWVREQYGMRVERLERSGRHAAFWHRQERFLLVPADGQSEAEM
FT                   EERQQMSRYLRAKGVDGVGELVKTTSGTYIASYNGQPLALVRAPLPASRFRSLGRELAV
FT                   MHECGRTCPWPIVACRRIGQWRELWAKRIDQMEAFWSSKLASGPSSLFDRLFIESFPYY
FT                   LGLAENAVQYVADTEIDEEPGRIDYAAFCHERLPEAKWVGGGEAKLPTDWVYDHCARDL
FT                   AEWVRHLYEKSGLGCQRAVRQFFQEYEHAAPLSPFAWRLVYARLLFPLSYFECVEAYYI
FT                   AVDESERTRREGELRRLLDRSHEYERFLASFAKIAGISNRIRLPAVEWLPPA"
FT   gene            573034..574008
FT                   /locus_tag="GC56T3_0540"
FT   CDS_pept        573034..574008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0540"
FT                   /product="Glyoxylate reductase"
FT                   /EC_number="1.1.1.26"
FT                   /note="KEGG: gyc:GYMC61_3042 glyoxylate reductase; PFAM:
FT                   D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase catalytic
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25593"
FT                   /inference="protein motif:PRIAM:1.1.1.26"
FT                   /protein_id="ADI25593.1"
FT                   /translation="MTKPYVFITRKLPEDVVAPLLAIAEVEMWPHEDMAVPRDVLVEKA
FT                   KRATAILPMVSDPIDEDVLSAGSALQVVANMGVGYDNIDVAAATHRGILVCNTPDVLTD
FT                   TTADLTFALLLATARRLVEAAEFLKEGKWKSWSPFLLAGADVHHKTIGIVGMGNIGQAV
FT                   AKRAKGFDMNILYYNRSRRPEAEEKLGAVYRPFADLLAESDFVVCLTPLTSETRHLFNR
FT                   EAFRQMKKSAIFINAARGAVVDEQELYEALVGGEIAAAGLDVFEHEPVAADHPLVSLPN
FT                   VVALPHIGSATYETRRAMMTLARDNIIAVLEGRPPLTPVNRIS"
FT   gene            574101..575399
FT                   /locus_tag="GC56T3_0541"
FT   CDS_pept        574101..575399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0541"
FT                   /product="homoserine dehydrogenase"
FT                   /note="PFAM: homoserine dehydrogenase; homoserine
FT                   dehydrogenase NAD-binding; amino acid-binding ACT domain
FT                   protein; KEGG: gyc:GYMC61_3041 homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25594"
FT                   /inference="protein motif:PFAM:PF00742"
FT                   /protein_id="ADI25594.1"
FT                   /translation="MEKPILVGLLGLGTVGSGVVKIIENHQEKLMHQVGCPVKVKKILV
FT                   RDVQKPRDVAVDPSLLTTSAAEVIDDPDIDVIIEVMGGIEETKELLLRALRQGKHVVTA
FT                   NKDLMAVYGSELLRVAAEYRCDLFYEASVAGGIPILRSLVDGLASDRITKLMGIVNGTT
FT                   NYILTKMSQNGASYEDVLAEAQALGFAEADPTSDVEGLDAARKMAILARLGFSMDIDLD
FT                   DVQVKGITQVTEEDLNYGKRLGYTMKLIGIAQRDGQKVEVSVQPTFLPDSHPLASVHNE
FT                   YNAVYVYGEAVGETMFYGPGAGSLPTATAVVSDLVAVMKNMRLGVNGRYAVAPQYEKQL
FT                   KTPAEIFSKYFLRIHVKDQVGAFAKITTLFSQRGVSFEKILQLPLKEDGLAEIVIVTHD
FT                   ASQQDYEDILQQLGDLEIVERVQSSYRLEGEKR"
FT   gene            575399..576460
FT                   /locus_tag="GC56T3_0542"
FT   CDS_pept        575399..576460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0542"
FT                   /product="threonine synthase"
FT                   /note="KEGG: gyc:GYMC61_3040 threonine synthase; TIGRFAM:
FT                   threonine synthase; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25595"
FT                   /inference="protein motif:TFAM:TIGR00260"
FT                   /protein_id="ADI25595.1"
FT                   /translation="MAWKGLLDAYGEFLPLSAATPRLSLCEGNTPLIPLPRLSEELGIA
FT                   LYVKVEGANPTGSFKDRGMVMAVAKAKEEGSHTIICASTGNTSASAAAYAARAGMRCLV
FT                   VVPNGKIALGKLAQAAMYGAEIFAIDGNFDEALKMVRRLSETAPITLVNSVNPYRIEGQ
FT                   KTAAFEVCDQLGRAPDVLAIPVGNAGNITAYWKGFKEYHEAKGTGLPQMRGFEAEGAAA
FT                   IVRNRVIEQPETVATAIRIGNPASWDKAVEAASESRGKIDEVSDAEILAAYKRLARTEG
FT                   IFAEPASCAAIAGVIKQRERNEIERGSLVVAVLTGNGLKDPAIALETAAIEPIVLPNDE
FT                   QVVLEHLQGVVRT"
FT   gene            576457..577371
FT                   /locus_tag="GC56T3_0543"
FT   CDS_pept        576457..577371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0543"
FT                   /product="homoserine kinase"
FT                   /note="KEGG: gyc:GYMC61_3039 homoserine kinase; TIGRFAM:
FT                   homoserine kinase; PFAM: GHMP kinase; GHMP kinase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25596"
FT                   /inference="protein motif:TFAM:TIGR00191"
FT                   /protein_id="ADI25596.1"
FT                   /translation="MKEDEMLKIVVPGSTANLGPGFDSIGLAVNRYLTLDVRLADAWSF
FT                   APKTAEVSGIPRGTDNLVYQVAAETADVYGRRLPSCAVDVYSDIPFTRGLGSSAAAVVA
FT                   GIELADALLGLQLPREQKMELATRYEGHPDNVGASLYGGLVIGCCREAGVDVIHIPELD
FT                   VELVAIIPEYELETKKARGQLPEQWTRERAVEASAVSNVLVAALLTKNWKLAGRMMAAD
FT                   LFHQPYRKPLVPELERAEALALEYGAIGAALSGAGPTVLVFAEPGQGERLARRLRPHFP
FT                   TCEIARLSVEPRGSCVYKLALEA"
FT   gene            complement(577609..577845)
FT                   /locus_tag="GC56T3_0544"
FT   CDS_pept        complement(577609..577845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0544"
FT                   /product="nitrogen-fixing NifU domain protein"
FT                   /note="PFAM: nitrogen-fixing NifU domain protein; KEGG:
FT                   gyc:GYMC61_3037 nitrogen-fixing NifU domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25597"
FT                   /inference="protein motif:PFAM:PF01106"
FT                   /protein_id="ADI25597.1"
FT                   /translation="MTDQEIKEQVQEVLDKLRPFLLRDGGDCELVDVEDGVVKLRLLGA
FT                   CGSCPSSTITLKAGIERALFEEVPGVVEVEQVF"
FT   gene            577936..578289
FT                   /locus_tag="GC56T3_0545"
FT   CDS_pept        577936..578289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0545"
FT                   /product="hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   gyc:GYMC61_3036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25598"
FT                   /inference="protein motif:PFAM:PF07315"
FT                   /protein_id="ADI25598.1"
FT                   /translation="MTFKPVEICVYGADVICPACVQLPSSKETYEWLEAALRRKYPDQP
FT                   FVMTYVDIFAPPADDEEKRELAQTIVEEDWVYPVVVIEGNVVAEGNPRLKAICAEMEKF
FT                   GYRPSAHEGKKAE"
FT   gene            complement(578375..579445)
FT                   /locus_tag="GC56T3_0546"
FT   CDS_pept        complement(578375..579445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0546"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="KEGG: gyc:GYMC61_3035 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; manually curated;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25599"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADI25599.1"
FT                   /translation="MRQLVLLGGGYGNMRILQRLLPDELPNDIHIILIDRVPYHCLKTE
FT                   YYALAAGTVSDHHIRVPFPEHPQLVYQFGEVVSIDLDQQLVHLKDGSSVRYDDVVIGLG
FT                   CEDKYHGVPGAEAHTYSIQSIDKARAAYEALNNLPPKATVGIVGAGLSGVELASELAES
FT                   RPDLHIKLFDRGERILPMFPKRLSDYVEGWFVEHKVEIVRNSNVTKVEPGVLYNHDEPV
FT                   KCDVIVWTAGIQPNRVVRELNVEKDKQGRVVLTKRHHIPGYENAYVVGDCASLPHSPSA
FT                   QLAEAQAEQIVQVLQKRWNGEEPPSEFPPIKLKGILGSLGKKHGFGLLADRPLTGRVPR
FT                   LLKSGILWMYKHHHGY"
FT   gene            579615..579854
FT                   /locus_tag="GC56T3_0547"
FT   CDS_pept        579615..579854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0547"
FT                   /product="protein of unknown function DUF1450"
FT                   /note="PFAM: protein of unknown function DUF1450; KEGG:
FT                   gyc:GYMC61_3034 protein of unknown function DUF1450"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25600"
FT                   /inference="protein motif:PFAM:PF07293"
FT                   /protein_id="ADI25600.1"
FT                   /translation="MMLPIIEFCISNLASGSYKAMEMLEKDPNLDIMEYSCLSYCTRCA
FT                   ETLFALVNGEFVSGETPEQLVENIYRHLEENPMF"
FT   gene            579986..580858
FT                   /locus_tag="GC56T3_0548"
FT   CDS_pept        579986..580858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0548"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="TIGRFAM: diaminopimelate epimerase; KEGG:
FT                   gyc:GYMC61_3033 diaminopimelate epimerase; PFAM:
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25601"
FT                   /inference="protein motif:TFAM:TIGR00652"
FT                   /protein_id="ADI25601.1"
FT                   /translation="MRSFSFTKMHGLGNSYIYVDLFRETLPEEELPAIARSVADVHTGI
FT                   GSDGLILICPSEKAPLKMRIFNSDGSEGKNCGNGLRCVAKYAYEHGIVRDRTFLIETLS
FT                   GLVEARVAVADGEVTSVTVDMGEPRLERSAIPMVGPKAERVVAEPFAIAGGEYEMTAVS
FT                   MGNPHVIFYVDDIQKAPVTMLGPLVEKDSRFPEGVNVEFVEVVNERELHFRVWERGSGV
FT                   TQACGTGACAAVVASVLNGKTVRGEETVVHLAGGDLTIVWGHDGRVRMTGPAETVCTGV
FT                   YYYRGGRNG"
FT   repeat_region   580983..582762
FT                   /note="region with at least 98 percent identity another
FT                   region of the genome"
FT   gene            582771..583136
FT                   /locus_tag="GC56T3_0549"
FT   CDS_pept        582771..583136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0549"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="KEGG: gka:GK2956 hypothetical protein; TIGRFAM:
FT                   iron-sulfur cluster assembly accessory protein; PFAM:
FT                   HesB/YadR/YfhF-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25602"
FT                   /inference="protein motif:TFAM:TIGR00049"
FT                   /protein_id="ADI25602.1"
FT                   /translation="MAEAVITLTEAAAFQIKDMMKEQEEEGAYLRVGVHGGGCSGLSYG
FT                   MGFDHERRDDDIEFEQHGIKILVDRDSAPILRGTVIDYKQSLLGGGFTINNPNAIATCG
FT                   CGSSFRTATNAGTPEQC"
FT   gene            583362..583664
FT                   /locus_tag="GC56T3_0550"
FT   CDS_pept        583362..583664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0550"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25603"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3031"
FT                   /protein_id="ADI25603.1"
FT                   /translation="MKGQINVILALVLALIVALLAVANVEQVTIHYLVGETRLPLIIVI
FT                   LGSAVLGGLVVGMLGWVRLFSLRRQVKLLEREREEWTKNKAGNHDGESVSLEREG"
FT   sig_peptide     583362..583433
FT                   /locus_tag="GC56T3_0550"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.885 at
FT                   residue 24"
FT   gene            complement(583827..584819)
FT                   /locus_tag="GC56T3_0551"
FT   CDS_pept        complement(583827..584819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0551"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: gka:GK2954 thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25604"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADI25604.1"
FT                   /translation="MKEDRNVYDVTIIGGGPTGMFAAFYGGLRQMKVKIIESLPQLGGQ
FT                   LAALYPEKYIYDVAGFPKVRAQELVNQLKEQMDLFSPTVCLNESVDTLEKQEDGTFKLV
FT                   TNQQIHYSKTVIITAGNGAFQPRRLEIESASCYEGKNLHYFINDLGQFSGKRVLVCGGG
FT                   DSAVDWSLMLEPIAASVTIVHRRDKFRAHEHSVEQLKKSSVQVKTPFVPVELVGDEHAI
FT                   RQVILEHVKEGTKETIDVDAVIVNYGFISSLGPIKNWGLDIEKNAIKVNSRMETNIPGV
FT                   YAAGDICTYDGKIKLIACGFGEAPIAISSAKTYIDPTARMQPAHSTSLF"
FT   gene            585102..586325
FT                   /locus_tag="GC56T3_0552"
FT   CDS_pept        585102..586325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0552"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: gyc:GYMC61_3029 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25605"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADI25605.1"
FT                   /translation="MIQVRKPNVVILGAGYGGLMTTVRLQKLIGVNEANITLVNKHDYH
FT                   YETTWLHEASAGTLHHDRVRYPISDVIDRNKVKFIQDTVTKIIPNEKKVLLENGELTYD
FT                   YLVIALGFESETFGIKGLKEYAFSIANVDAARQIREHIEYQFATYNAEEEKKEERLTIV
FT                   VGGAGFTGIEFLGELANRMPELCREYDIDPHKVRIICVEAAPTALPGFDPELVEYAVSQ
FT                   LERKGVEFRIGTAIKECTPDGIIVAKGDDVEEIKAGTVIWAAGVRGSRVIEESGFEAAR
FT                   ARIKVDPYLRVPGHEDIFVVGDCSLVIDEETNRPYPPTAQIAMQEGQLCAKNLEVLIRG
FT                   QGELEPFKPDIKGTVCSLGHDDAIGVVFGKKLWGAKASFMKKVIDNRALYLIGGSSLVM
FT                   KKGKFKFF"
FT   gene            586436..586948
FT                   /locus_tag="GC56T3_0553"
FT   CDS_pept        586436..586948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0553"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: gyc:GYMC61_3028 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25606"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADI25606.1"
FT                   /translation="MRTMDNKRGNVWIAAAGLVINESGEWLVVKKKYSGLKGKWSLPAG
FT                   FVKPGEMLDEAAVREVKEETGIDAEPVALLGLRTGVIAGEISDNMAIFLLRPLSRDIVV
FT                   QTDELYAAAFFSKTALQNDPNTSGLLRYLLALEPLDSLSLHDGLNPGDPFGYTKYRLYF
FT                   ESSKLKE"
FT   gene            587072..587209
FT                   /locus_tag="GC56T3_0554"
FT   CDS_pept        587072..587209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0554"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25607"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3027"
FT                   /protein_id="ADI25607.1"
FT                   /translation="MTKTWTINDCPYCEGHGYVQLLLGGSETCYSCQGTGSDGEEDDDH
FT                   "
FT   gene            587336..587659
FT                   /locus_tag="GC56T3_0555"
FT   CDS_pept        587336..587659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3026 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25608"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3026"
FT                   /protein_id="ADI25608.1"
FT                   /translation="MQMSLPVVLISMVLFFVLFFGIGFLLNMILRMTWILAVCFPLIAV
FT                   FIIDDVPLTRYFTAPSEAFAALGRKIASLAAADLLILSSGFAGALCAGWAIRTLRAKGY
FT                   QMF"
FT   gene            587887..588525
FT                   /locus_tag="GC56T3_0556"
FT   CDS_pept        587887..588525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0556"
FT                   /product="3D domain protein"
FT                   /note="PFAM: 3D domain protein; KEGG: gka:GK2949
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25609"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ADI25609.1"
FT                   /translation="MNGFRQFVRRTAMTLLFLAALFATFESVSGVDAKTVLHPFPSALS
FT                   MDHQPVWGMKELAKNGGRSVLRLEDHFDWSKYPSVEVVATGYTAGIESTGKTPDHPEYG
FT                   ITYSGVRVKRDLYSTIAADLTVFPIGTILFIPGYGFGVVADKGGAIKGHRIDLYYETVE
FT                   DVYKYWGKRKVNVYIVQKGDGKLSEEELKRLNEDETMQVFRQQYLESKS"
FT   sig_peptide     587887..587979
FT                   /locus_tag="GC56T3_0556"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.477 at
FT                   residue 31"
FT   gene            complement(588543..589352)
FT                   /locus_tag="GC56T3_0557"
FT   CDS_pept        complement(588543..589352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0557"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   gyc:GYMC61_3024 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25610"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADI25610.1"
FT                   /translation="MRIVSLCPSNTELLAYLGRLGDVIAVDDSSDWPPEVKQLPKVGPD
FT                   LRIDMDQVEALKPDLVVASLSVPGMERNVEELKRRGLPHLVLAPNSLDDIANDLLQLGE
FT                   ALGETKKAAQLVRRYHDVLDWHRERAASAEPARLYWEWWPRPVFTPGGANWLSELSELA
FT                   GGRNIFSDVPQASVQTEWDDVLARNPSHILLVWVGVQTKKMSPKAVTARPNAQQAEAVR
FT                   TGNIHILEESLYCRPSPRLLVGLKKLAPLLHPALFPPADDSDPLLGG"
FT   gene            589518..591029
FT                   /pseudo
FT                   /locus_tag="GC56T3_0558"
FT   gene            591284..591904
FT                   /locus_tag="GC56T3_0559"
FT   CDS_pept        591284..591904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0559"
FT                   /product="Putitive phosphate transport regulator"
FT                   /note="PFAM: Putitive phosphate transport regulator; KEGG:
FT                   gyc:GYMC61_3022 putative phosphate transport regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25611"
FT                   /inference="protein motif:PFAM:PF01865"
FT                   /protein_id="ADI25611.1"
FT                   /translation="MIFSPKKDVFFDMLFTISENVKEAAQYFVEYKIQSVSDLKEFARV
FT                   MKEYERKGDSFIHELVVQLNKTFITPIEREDIHQLAMKMDDVLDGFEQCSARFEMFSFT
FT                   EIDEHMAKFFDYIYQSTIEIVHALELLANKKLLDMRQHAIKIKDYETKCDEILRASIKN
FT                   LFVTQKDPIKIIQYKELYEMLEEIADSCEDVANTLETIIMRNA"
FT   gene            591923..592921
FT                   /locus_tag="GC56T3_0560"
FT   CDS_pept        591923..592921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0560"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: gka:GK2945
FT                   low-affinity inorganic phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25612"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ADI25612.1"
FT                   /translation="MDTILILTICIVIFALAFDFINGFHDTANAIATSVSTRALTPRQA
FT                   IILAAAMNFIGALTFTGVAKTITKDIVDPFALENGPLIILASLTSAIAWNLITWYYGIP
FT                   SSSSHAIIGSVAGAAISAAGVGILNYGGFLKILQSLILSPFLALGVGFIIMSIFRFIFK
FT                   NANLYSTTRGFRMFQIVTAAFQAYTHGTNDAQKAMGIITMALIAGGYHATTDIPEWVRI
FT                   SAALAMGLGTAVGGWKIIKTVGGKIMKIRPINGAAADLSSALVILSATMFHLPVSTTHV
FT                   ISSAIMGVGAAQRVKGVKWGVARRIVLTWIITLPVSALIAGFVYQVLRLFF"
FT   gene            complement(593031..593636)
FT                   /locus_tag="GC56T3_0561"
FT   CDS_pept        complement(593031..593636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0561"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: gka:GK2944 biotin
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25613"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ADI25613.1"
FT                   /translation="MERRTSLRPIDMTLAAMFVALMAIGANITSWAPFLVVGGVPITLQ
FT                   TFFCVLAGAVLGRRLGAVAMIVYMLVGLAGVPVFAKFNGGLSMIFQPTFGFILSFIVAA
FT                   YATGWIINRGPQPASKARFVTAALVGMVINYVIGTNWMYMAYKLWAEAPEGLSYGMVWG
FT                   WMLAPLPKDILLSIVAGLIAPRICRAIGRSSAADRSAA"
FT   sig_peptide     complement(593559..593636)
FT                   /locus_tag="GC56T3_0561"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.615) with cleavage site probability 0.338 at
FT                   residue 26"
FT   repeat_region   593794..595571
FT                   /note="region with at least 98 percent identity another
FT                   region of the genome"
FT   gene            595580..595738
FT                   /locus_tag="GC56T3_0562"
FT   CDS_pept        595580..595738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0562"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK2943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25614"
FT                   /inference="similar to AA sequence:KEGG:GK2943"
FT                   /protein_id="ADI25614.1"
FT                   /translation="MERFVPDEELKRASKMGANEDIIHTSKHDDGYDLRTPAEIGKRQP
FT                   TDENGNS"
FT   gene            595762..595953
FT                   /locus_tag="GC56T3_0563"
FT   CDS_pept        595762..595953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25615"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI25615.1"
FT                   /translation="MDGKKRSWTGGSSEKRWPPPYRVLLEWSRRSDKMLGARMCYSFFS
FT                   GFFGMKGIEGNELIDFYE"
FT   repeat_region   596031..597924
FT                   /note="region with at least 97 percent identity another
FT                   region of the genome"
FT   repeat_region   598064..601085
FT                   /note="region with at least 96 percent identity another
FT                   region of the genome"
FT   repeat_region   598066..601085
FT                   /note="region with at least 96 percent identity another
FT                   region of the genome"
FT   repeat_region   601087..601664
FT                   /note="region with at least 98 percent identity another
FT                   region of the genome"
FT   repeat_region   601089..601664
FT                   /note="region with at least 98 percent identity another
FT                   region of the genome"
FT   repeat_region   601663..603596
FT                   /note="region with at least 98 percent identity another
FT                   region of the genome"
FT   repeat_region   603597..605524
FT                   /note="region with at least 98 percent identity another
FT                   region of the genome"
FT   repeat_region   605524..606883
FT                   /note="region with at least 98 percent identity another
FT                   region of the genome"
FT   gene            607003..607542
FT                   /locus_tag="GC56T3_0564"
FT   CDS_pept        607003..607542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0564"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK2940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25616"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI25616.1"
FT                   /translation="MEDIYRTSYKGVEIIINSSNSMITPEKMIIAKKVIDSELLNTSHA
FT                   FILNSNQVKPQVIPNPGDGTVIGTRYYSFDNDTAKFVSSVLKTGLTAIATLAGYTFGPG
FT                   AATTIASICTLAGEYINLKPYWTTVKIIRYYSDYYDQYIYDAYHFVYSDSKRTNLKKVF
FT                   ISDDMIKTTGNVLDTF"
FT   gene            607564..607740
FT                   /locus_tag="GC56T3_0565"
FT   CDS_pept        607564..607740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0565"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK2939 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25617"
FT                   /inference="similar to AA sequence:KEGG:GK2939"
FT                   /protein_id="ADI25617.1"
FT                   /translation="MNRKKRFVLALAVLMVIFFFVYMFEEQVLRFLDYKVVKLTMLISL
FT                   ITIIVGDIIYRRT"
FT   gene            complement(608226..608576)
FT                   /locus_tag="GC56T3_0566"
FT   CDS_pept        complement(608226..608576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0566"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25618"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3016"
FT                   /protein_id="ADI25618.1"
FT                   /translation="MFTPFPRMPAGPYPPIDPALFSQSATTAQTLMNDAATVLKKLAES
FT                   RSFAASVMSAAQEGKTDEVKRLIRSLGIRSKTDIYFNPDGIRLTLSPPPGAFPCCQLVI
FT                   GLRWNVFPPFHG"
FT   gene            complement(608697..610019)
FT                   /locus_tag="GC56T3_0567"
FT   CDS_pept        complement(608697..610019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0567"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Citrate transporter; KEGG: gyc:GYMC61_3015
FT                   citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25619"
FT                   /inference="protein motif:PFAM:PF03600"
FT                   /protein_id="ADI25619.1"
FT                   /translation="MDHAAAHVSNVQYYFAIAVFLITYAMIIAEKIHRAVIALLGAALM
FT                   VIFGIVDAEKAFTHHIEWGTITLLIGMMILVGITSKSGFFQYMAIKAAKLAKGSPVRIL
FT                   IMLSLLTGLLSAFLDNVTTVLLVVPVTFSITRMLQVNPVPYLISEVLLSNIGGTATLIG
FT                   DPPNIMIGSANKQLDFNAFLFNLTPVVIVIAIITLALLAFIYRKQLKTDPTLIQKLMEL
FT                   RDADYIQDAKLMRKSVAVLGLTILGFIFHSAIHVDAAIIAMTGAVALMLIAVPEHEIED
FT                   VFHSIEWGTIFFFAGLFVLVGGLVDIGLIKSLAEKTLEVTGGDISTAAYFILWLSGIAS
FT                   ATIDNIPFVATMIPLIQDMAVGMGLSPDAPQIDVLWWALSLGACLGGNGTLIGASANVI
FT                   VAGMASREGHGFTYMDFLKIGAPLTLIALLLSHAYLWLHYL"
FT   gene            complement(610040..610477)
FT                   /locus_tag="GC56T3_0568"
FT   CDS_pept        complement(610040..610477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0568"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK2935 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25620"
FT                   /inference="similar to AA sequence:KEGG:GK2935"
FT                   /protein_id="ADI25620.1"
FT                   /translation="MKNVVIHQIVTWIFTEDQLRAYWKKQKQNLPFSGLTDRQYMKLAE
FT                   DMLEHSSHSQLEQHLLGGRWRTKEEAEGAILAEDESRDDRHVEVIDTDAPAEPKRRMLI
FT                   DRVREIPCPHCSFTFYVREASSERRDWTCPACGSGFHDMTT"
FT   gene            610954..611574
FT                   /locus_tag="GC56T3_0569"
FT   CDS_pept        610954..611574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0569"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="KEGG: gyc:GYMC61_3013 exonuclease RNase T and DNA
FT                   polymerase III; PFAM: Exonuclease RNase T and DNA
FT                   polymerase III; SMART: Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25621"
FT                   /inference="protein motif:PFAM:PF00929"
FT                   /protein_id="ADI25621.1"
FT                   /translation="MDSLQYLFLDFEFTMPETKTNPNGFCPEIIEVGLVAVVDDQIIGQ
FT                   FSSYVKPLRFPQLTERCKSFLNITQEQIDRGMSFYELVSLLRQYDRDRPTTVMTWGSMD
FT                   MKVLRENCQSAQVEFPFTGEHRDLAMEYKRFFGNKNQTALRKAVQEYGNEAVGKAHCAL
FT                   DDAFTAYTIFRLVENDKKYLAKTKPPTIGERIDLTQLRKKFAL"
FT   gene            611651..611866
FT                   /locus_tag="GC56T3_0570"
FT   CDS_pept        611651..611866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0570"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25622"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3012"
FT                   /protein_id="ADI25622.1"
FT                   /translation="MWPSVLNLFLYFPEDKREYIPAAISFAVFFLMAVFTMRLIIVISR
FT                   RQEREAKQLEEQLLGKREERKEPPGV"
FT   gene            611922..612446
FT                   /locus_tag="GC56T3_0571"
FT   CDS_pept        611922..612446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0571"
FT                   /product="superoxide dismutase copper/zinc binding protein"
FT                   /note="PFAM: superoxide dismutase copper/zinc binding;
FT                   KEGG: gyc:GYMC61_3011 superoxide dismutase copper/zinc
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25623"
FT                   /inference="protein motif:PFAM:PF00080"
FT                   /protein_id="ADI25623.1"
FT                   /translation="MLRKRYGVVFAAALVLSGCGQENGTSRTVEMINADGDSIGTIELT
FT                   EQAEGVRLKLDLEGLPPGEHAIHIHENGSCKPPDFQSAGGHYNPDGKKHGLLHPEGAHA
FT                   GDLPNIIVKDDGTVNVELTAPNVTLKEGEKGSLLTKDGTSIVIHAKKDDGMTQPAGDAG
FT                   GRIACGEIKSS"
FT   sig_peptide     611922..611990
FT                   /locus_tag="GC56T3_0571"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.907) with cleavage site probability 0.359 at
FT                   residue 23"
FT   gene            complement(612692..613852)
FT                   /locus_tag="GC56T3_0572"
FT   CDS_pept        complement(612692..613852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0572"
FT                   /product="aminotransferase class I and II"
FT                   /note="KEGG: gyc:GYMC61_3010 aminotransferase class I and
FT                   II; manually curated; PFAM: aminotransferase class I and
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25624"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADI25624.1"
FT                   /translation="MFLFDRVIDRRGTLSVKWDDVHRVFGREDVWPMWVADMDFPAPKE
FT                   VQEALRQRVEHGVFGYTVIPDSLKEAVCQWLERRHDWTIDPSWLVFAHGVVPAVAAAIE
FT                   AFSELGDRIIVFSPVYRPLFDLVRRHDRTLLFSPLRLEEDNYAIDWDDLERKLPDAKLL
FT                   ILCHPHNPGGKSWTKEELERLGELCLKHGVFVLSDEIHADLTLPPAKHTPFASLHPELA
FT                   AQSATFRAPTKTFNLAGLQAAEVILPNESRRRAFRRVQQRHGFFTLNAFAIVGSEAAYR
FT                   HGGPWLDALLDYLRQNVDMTVAYLAEHLPPLRVIRPQATYLVWIDCRGLGLSEAELKRR
FT                   LLEKGKLAVEFGSKFGPEGVGFIRLNIACPRPTLEEGLRRLAAALG"
FT   gene            614007..614270
FT                   /locus_tag="GC56T3_0573"
FT   CDS_pept        614007..614270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0573"
FT                   /product="Domain of unknown function DUF1871"
FT                   /note="PFAM: Domain of unknown function DUF1871; KEGG:
FT                   gyc:GYMC61_3009 domain of unknown function DUF1871"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25625"
FT                   /inference="protein motif:PFAM:PF08958"
FT                   /protein_id="ADI25625.1"
FT                   /translation="MDGQQLNRLLIETIGAWDPFGLGKDAYDVEAASVLQAVYETEDAR
FT                   TLAARIQSIYEFAFDEPIPFPHCLKLARRLLELKQAASCPLP"
FT   gene            614325..614825
FT                   /locus_tag="GC56T3_0574"
FT   CDS_pept        614325..614825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0574"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="KEGG: gyc:GYMC61_3008 transcriptional regulator,
FT                   AsnC family; PFAM: Transcription regulator, AsnC-type-like;
FT                   SMART: Transcription regulator, AsnC-type"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25626"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADI25626.1"
FT                   /translation="MKLSEKELEIIEILEKDARTPIDVLAKMIDLPVEETEALVKKLEE
FT                   AKVIVQYTALIDWRKADGREGVTAMIDVKVTPKRGVGFDEVAERIYRFPEVKSVYLMSG
FT                   AYDLSVVIEGRSMAEIAQFVSEKLSTLDSVISTTTHFILKKYKHDGIVFDQGDQDRRIV
FT                   VSP"
FT   gene            614822..615994
FT                   /locus_tag="GC56T3_0575"
FT   CDS_pept        614822..615994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0575"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   gyc:GYMC61_3007 aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25627"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADI25627.1"
FT                   /translation="MKPQTRKTYVSETVAGLKPSGIRRFFDLASTMDGVISLGVGEPDF
FT                   VTSWSIREASILSLEQGYTSYTPNAGLLELRQEIAAYLRRKFHVDYCPETEILVTVGAS
FT                   QAIDLALRAIINPGDEVIIVEPSFVAYEPLVVLAGGKPVAVCTSGEDKFQLNPAHLEQA
FT                   ITERTKAVIICSPNNPTGTVQSRTELEAIARLAEAHDLLVIADEIYAELTYEGEYTSMA
FT                   AVSGMRERTILISGFSKGFAMTGWRLGFAAAPDEILQAMLKIHQYAMMCAPTMAQYGAL
FT                   EALRSGERDVAEMRNSYRRRRNYFVASLNEIGLPCHLPGGAFYAFPSIKPTGLTSEQFA
FT                   ERLLIEEKVAVVPGNVFGQSGEGYIRCSYASSLEQLQEAIKRMKRFLARL"
FT   gene            616100..616465
FT                   /locus_tag="GC56T3_0576"
FT   CDS_pept        616100..616465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0576"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   gyc:GYMC61_3006 RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25628"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ADI25628.1"
FT                   /translation="MSTIKRGAIVKGKVTGIQPYGAFVQLEDGMQGLIHISEISHQFVK
FT                   DVRDYVHVGDEVTVKVLDVDRKARRASLSLKALEPAGEKEKRHMRMKMPLKSGFRPLKE
FT                   KLREWIEQSKKENWPKP"
FT   gene            complement(616570..616803)
FT                   /locus_tag="GC56T3_0577"
FT   CDS_pept        complement(616570..616803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0577"
FT                   /product="protein of unknown function DUF378"
FT                   /note="PFAM: protein of unknown function DUF378; KEGG:
FT                   gyc:GYMC61_3005 protein of unknown function DUF378"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25629"
FT                   /inference="protein motif:PFAM:PF04070"
FT                   /protein_id="ADI25629.1"
FT                   /translation="MGALQRIALLLTIIGAINWGLIGFFQFDLVAAIFGGQDSVWSRII
FT                   YSLVGIAGLINLALLFKPAEELGRTEPKTSRT"
FT   gene            616952..618115
FT                   /locus_tag="GC56T3_0578"
FT   CDS_pept        616952..618115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0578"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   gyc:GYMC61_3004 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25630"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ADI25630.1"
FT                   /translation="MQEFIFRNPTKLIFGKGQLERLKEEVPRYGKKVLLVYGGGSIKRN
FT                   GLYDEVMKILGNIGAEVIELPGVEPNPRVSTVRKGVDICKREGVEFLLAVGGGSVIDCT
FT                   KAIAAGAKFDGDPWEFITKKAPVTGALPFGVVLTLAATGSEMNSGSVITNWETKEKYGW
FT                   GSPFTFPQFSILDPTYTMTVPKDHTVYGIVDMMSHVFEQYFHHTPNTPLQDRMCEAVLK
FT                   TVIETAPKLINDLENYELRETIMYSGTIALNGFLQMGVRGDWATHNIEHAVSAVYDIPH
FT                   AGGLAILFPNWMKHVLDENVSRFAQLAVRVFDVDPAGKSERDVALEGIERLREFWSSLG
FT                   APSRLADYGIGEENLELMADKAMAFGEFGRFKTLNRDDVLAILRASL"
FT   gene            618220..619569
FT                   /locus_tag="GC56T3_0579"
FT   CDS_pept        618220..619569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0579"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="KEGG: gyc:GYMC61_3003 phosphoglucose isomerase
FT                   (PGI); PFAM: phosphoglucose isomerase (PGI)"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25631"
FT                   /inference="protein motif:PRIAM:5.3.1.9"
FT                   /protein_id="ADI25631.1"
FT                   /translation="MTHIRFDYSKALAFFGEHELTYLRDAVKVAHHSLHEKTGVGSDFL
FT                   GWLDWPVDYDKEEFARIKEAAKKIQSDSDVLVVIGIGGSYLGARAAIEMLHHSFYNALP
FT                   KEKRKTPQIIFVGNNISSTYMKDVIDFLEGKDFSINVISKSGTTTEPAIAFRIFRKLLE
FT                   EKYGKEEARRRIYATTDSKRGALRTLANEEGYETFVIPDDIGGRYSVLTAVGLLPIAAS
FT                   GADINAMMEGAAKARDDFSSSELEENAAYQYAAIRNILYNKGKTIELLVNYEPALHYFA
FT                   EWWKQLFGESEGKDQKGIYPASADFSTDLHSLGQYIQEGRRDLFETVLKLEEPRHELII
FT                   EAEENDLDGLNYLAGKTVDFVNTKAFEGTLLAHTDGGVPNLVITLPKLDEYTFGYLVYF
FT                   FEKACAMSGYLLGVNPFDQPGVEAYKKNMFALLGKPGYEQLKEELEKRLK"
FT   gene            619845..620249
FT                   /locus_tag="GC56T3_0580"
FT   CDS_pept        619845..620249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0580"
FT                   /product="Protein of unknown function YugN-like protein"
FT                   /note="PFAM: Protein of unknown function YugN-like; KEGG:
FT                   gka:GK2923 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25632"
FT                   /inference="protein motif:PFAM:PF08868"
FT                   /protein_id="ADI25632.1"
FT                   /translation="MIEMPSRLEGKQFQLYHLEEQLKPMGYTIGGGWDYDHGYFDYKIA
FT                   DDAGYQFLRVPFRAVDGQLDSHGTTVELGRPFLLAHKYQRGIDDFADVGNISASFNQFA
FT                   EPQDPDATVPERYISVGKALVQELERRLLD"
FT   gene            complement(620246..621241)
FT                   /locus_tag="GC56T3_0581"
FT   CDS_pept        complement(620246..621241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0581"
FT                   /product="Ion transport 2 domain protein"
FT                   /note="PFAM: Ion transport 2 domain protein ; TrkA-N domain
FT                   protein; KEGG: gyc:GYMC61_3000 ion transport 2 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25633"
FT                   /inference="protein motif:PFAM:PF07885"
FT                   /protein_id="ADI25633.1"
FT                   /translation="MKTRNVLLSYWRWPPVLRLFVSASALIVLFGALMRFIEPETFRTV
FT                   FDGVWWAIVTSATIGYGDIAPKTVAGKLAAIGLIVLGTGILTAYFASVSAAAAARETAF
FT                   TSGQLRYTGRGHAVIVGWNERAREVLFRLSRHDASMRFVLIDATVPSHPLPNAPVHFIK
FT                   GTASDDAVLEKANIQEARFLLITADPHKAESEADKDTIVTLLAAKSLNPSVYAIVEILT
FT                   GRNVQNAFRAGADEVIQTNLLASFAMAASLRSPGAASVWETALYRLDGQTLCLLEPDEQ
FT                   QIGQPFAAVQQQLLKQNVTLLGVIHGDHGAISVAPDRPIQQSDRLFVLAP"
FT   gene            621354..621542
FT                   /locus_tag="GC56T3_0582"
FT   CDS_pept        621354..621542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0582"
FT                   /product="small acid-soluble spore protein, H-type"
FT                   /note="KEGG: gyc:GYMC61_2999 small acid-soluble spore
FT                   protein, H-type; TIGRFAM: small acid-soluble spore protein,
FT                   H-type; PFAM: small acid-soluble spore H family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25634"
FT                   /inference="protein motif:TFAM:TIGR02861"
FT                   /protein_id="ADI25634.1"
FT                   /translation="MDMNRVKQIVSSPADIPVYYNGVSVWIDGYDEEKQTATVHLRDGR
FT                   LHERRDVPVSELTEERE"
FT   gene            complement(621815..622388)
FT                   /pseudo
FT                   /locus_tag="GC56T3_0583"
FT   gene            622488..622988
FT                   /locus_tag="GC56T3_0584"
FT   CDS_pept        622488..622988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0584"
FT                   /product="Phosphinothricin acetyltransferase"
FT                   /note="KEGG: gyc:GYMC61_2997 GCN5-related
FT                   N-acetyltransferase; PFAM: GCN5-related
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25635"
FT                   /inference="protein motif:PRIAM:2.3.1.183"
FT                   /protein_id="ADI25635.1"
FT                   /translation="MESWLIRDATMEDLPHIVRIYNETIPSRMVTADLEPVSVESRRAW
FT                   FEAHDPHNRPLWVVEDDGVVCAWLSFQSFYGRPAYRHTAEVSIYIAETHRGRGLGAKLL
FT                   ERAVERAPELGIKTLLGFIFAHNEPSLRLFSRFGFERWGYFPRVAELDGVERDLVIVGK
FT                   RLV"
FT   gene            623046..623297
FT                   /locus_tag="GC56T3_0585"
FT   CDS_pept        623046..623297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0585"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK2919 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25636"
FT                   /inference="similar to AA sequence:KEGG:GK2919"
FT                   /protein_id="ADI25636.1"
FT                   /translation="MNVMPIRLFTIQDGEGFVADAFQCPVTGNLIYKSSGTPSVIAYTD
FT                   LTDEQIMRLEKYGFRRLGESPARMESGPDGIEELLPRQ"
FT   gene            623294..623434
FT                   /locus_tag="GC56T3_0586"
FT   CDS_pept        623294..623434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25637"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI25637.1"
FT                   /translation="MREKENTQDENVEEKACPLGTGFFFSPEGRRNPTDSLDPFVRKLK
FT                   G"
FT   gene            complement(623514..624395)
FT                   /locus_tag="GC56T3_0587"
FT   CDS_pept        complement(623514..624395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0587"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="KEGG: gyc:GYMC61_2995 nuclease (SNase domain
FT                   protein); PFAM: nuclease (SNase domain protein); SMART:
FT                   nuclease (SNase domain protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25638"
FT                   /inference="protein motif:PFAM:PF00565"
FT                   /protein_id="ADI25638.1"
FT                   /translation="MKRMVIFLFCFLLMFPISAFAHPGELDELGGHFRGSDCVYLLHEP
FT                   TALAKQAKTKQELVQLIQTYNGNERCKRHLTPERIDLDGHTLGKKEDRSTLRLGRTYPA
FT                   ELVECIDGDTAKFRVNGHVYTTRFLFIDTPESTIQVEPYGKEASRFTCSRLHQGNILLE
FT                   TDGDALFDKYQRLLAWVWVGKRLLQEDLAKAGLVEDFYDYGDYKYEARVRKAYEEAKRT
FT                   GAGMYGKRAAGEREGAGTETRPQTKEKTAKTDHPPALENKTPLERSGRPVLYTLLGLAA
FT                   AAALYWLIRRLT"
FT   sig_peptide     complement(624330..624395)
FT                   /locus_tag="GC56T3_0587"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            624647..625939
FT                   /locus_tag="GC56T3_0588"
FT   CDS_pept        624647..625939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0588"
FT                   /product="primosome, DnaD subunit"
FT                   /note="KEGG: gyc:GYMC61_2994 primosome, DnaD subunit;
FT                   TIGRFAM: primosome, DnaD subunit; PFAM: DnaD and
FT                   phage-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25639"
FT                   /inference="protein motif:TFAM:TIGR01446"
FT                   /protein_id="ADI25639.1"
FT                   /translation="MSNLLFDDQPLVILPQLALAIGLNESIVVQQLHYWLKKSENVHDG
FT                   YKWVYNTYADWQRQFPFWSESTVRRTITKLEKMGIIVAANFNRSKIDKTKWYRIDYDKL
FT                   AEITKEMSEMSGGEHGQAADDGVMTANGVSIVPDAFSFTQDGASFVHDEGLTTHGGDSI
FT                   VQDGVSAVQGGASVVHGEVLASGTSTAQNKVLAMEERGSMRPSSVSMIQQHPISAVCDG
FT                   VSTGQNEQTMGETVRPFAQNEPSNWSNWAVKALNLTRPIPETTTEMTAEIKKEDEEDAR
FT                   VRTYKEIVRFCEENGFGVIGDYLREKINAWVDDASEELVLEALKIAVENGAKRWVYVET
FT                   ILRDWTEKGYRTVDEVRAARLAFREQRMKQRSAPPSSDGGRTMRKPIRTEIVPDWLNMD
FT                   YSQPEDDDFDVEQARRELEERLKKYKTNLDG"
FT   gene            complement(626171..626243)
FT                   /locus_tag="GC56T3_R0052"
FT                   /note="tRNA-Ala8"
FT   tRNA            complement(626171..626243)
FT                   /locus_tag="GC56T3_R0052"
FT                   /product="tRNA-Ala"
FT   gene            complement(626316..626993)
FT                   /locus_tag="GC56T3_0589"
FT   CDS_pept        complement(626316..626993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0589"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: gyc:GYMC61_2993
FT                   MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25640"
FT                   /inference="protein motif:PFAM:PF02308"
FT                   /protein_id="ADI25640.1"
FT                   /translation="MMFDPFLKLGISAILGLIIGLERELKRKPVGLKTCLVISISSCLL
FT                   TIVSIESAYVFPLKDHITMDPLRLAAQIVSGVGFLGAGVILRRGNDSITGLTTAAIIWG
FT                   AAGIGVAVGAGFYWESAFGVALLIVSVELIPFLINFFGPKQLREKEVLLQITVADAKNI
FT                   TKVIDHLKQQDINIKTMRIKDVEENEHLLKLRAVIDQKRSTAELYYVIRSIDDVVHVDI
FT                   ESG"
FT   gene            627111..628019
FT                   /locus_tag="GC56T3_0590"
FT   CDS_pept        627111..628019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0590"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: gyc:GYMC61_2992 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25641"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADI25641.1"
FT                   /translation="MKPPSTIKAYAALFIGALAVSTSAIFVKWSQAPSAVIAFYRLFLA
FT                   VAIMTPLFLRHRSELRGISRRDWLFSLCSGVLLAFHFILWFESLDYTSVASSVVLVTLQ
FT                   PLFAFAGGALFFRERLTVGAVGSAVLAIIGSVLISWGDFRVSGEALYGDGLALLSCAFV
FT                   TAYWLFGQEVRQRLSLMTYTYIVYGISAAVLWLYAMLFRLSLTAYQLTDWLCFLALAVI
FT                   PTLLGHSVMNWAVKWVSASTVSMAILFEPIGASALAYWLFGEPIRPFQWIGGIFILTGI
FT                   ALYLWEKSEKGPLTVQEQSGP"
FT   sig_peptide     627111..627194
FT                   /locus_tag="GC56T3_0590"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.710) with cleavage site probability 0.526 at
FT                   residue 28"
FT   gene            complement(627990..628808)
FT                   /locus_tag="GC56T3_0591"
FT   CDS_pept        complement(627990..628808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0591"
FT                   /product="Protein-glutamine gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.13"
FT                   /note="KEGG: gka:GK2914 transglutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25642"
FT                   /inference="protein motif:PRIAM:2.3.2.13"
FT                   /protein_id="ADI25642.1"
FT                   /translation="MIRVLSPINFDVSSSFSLPASEQRILDALVSSPKLYTYANKHQLR
FT                   FEIALRDRIVRAAGELAKSRARFAIFRFSRCNSDFWTRDERGGFRLRPDVTASEAIQDI
FT                   FVHSERYAFECATAIVIVFYKAVLDVIDPAAFNRLFADLLLYDWHTDRDLGIQTKKDEH
FT                   FLPGDCLYFKNPEFDPLTPQWQGENTIYLGDGLFYGHGIGIQTADGIIAALNRKRKRGA
FT                   TKSAYLLPDITQVDFAYLSQFARSFDEFRLPIRRSSFIFGTLGSALFLHR"
FT   gene            629639..631184
FT                   /locus_tag="GC56T3_R0053"
FT   rRNA            629639..631184
FT                   /locus_tag="GC56T3_R0053"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            631548..634475
FT                   /locus_tag="GC56T3_R0054"
FT   rRNA            631548..634475
FT                   /locus_tag="GC56T3_R0054"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            634967..635041
FT                   /locus_tag="GC56T3_R0055"
FT                   /note="tRNA-Asn3"
FT   tRNA            634967..635041
FT                   /locus_tag="GC56T3_R0055"
FT                   /product="tRNA-Asn"
FT   gene            635046..635136
FT                   /locus_tag="GC56T3_R0056"
FT                   /note="tRNA-Ser2"
FT   tRNA            635046..635136
FT                   /locus_tag="GC56T3_R0056"
FT                   /product="tRNA-Ser"
FT   gene            635151..635222
FT                   /locus_tag="GC56T3_R0057"
FT                   /note="tRNA-Glu4"
FT   tRNA            635151..635222
FT                   /locus_tag="GC56T3_R0057"
FT                   /product="tRNA-Glu"
FT   gene            635232..635307
FT                   /locus_tag="GC56T3_R0058"
FT                   /note="tRNA-Val2"
FT   tRNA            635232..635307
FT                   /locus_tag="GC56T3_R0058"
FT                   /product="tRNA-Val"
FT   gene            635489..635565
FT                   /locus_tag="GC56T3_R0059"
FT                   /note="tRNA-Met2"
FT   tRNA            635489..635565
FT                   /locus_tag="GC56T3_R0059"
FT                   /product="tRNA-Met"
FT   gene            635571..635646
FT                   /locus_tag="GC56T3_R0060"
FT                   /note="tRNA-Asp2"
FT   tRNA            635571..635646
FT                   /locus_tag="GC56T3_R0060"
FT                   /product="tRNA-Asp"
FT   gene            635980..636055
FT                   /locus_tag="GC56T3_R0061"
FT                   /note="tRNA-Phe1"
FT   tRNA            635980..636055
FT                   /locus_tag="GC56T3_R0061"
FT                   /product="tRNA-Phe"
FT   gene            636217..636292
FT                   /locus_tag="GC56T3_R0062"
FT                   /note="tRNA-Thr2"
FT   tRNA            636217..636292
FT                   /locus_tag="GC56T3_R0062"
FT                   /product="tRNA-Thr"
FT   gene            636299..636383
FT                   /locus_tag="GC56T3_R0063"
FT                   /note="tRNA-Tyr1"
FT   tRNA            636299..636383
FT                   /locus_tag="GC56T3_R0063"
FT                   /product="tRNA-Tyr"
FT   gene            636393..636466
FT                   /locus_tag="GC56T3_R0064"
FT                   /note="tRNA-Trp1"
FT   tRNA            636393..636466
FT                   /locus_tag="GC56T3_R0064"
FT                   /product="tRNA-Trp"
FT   gene            636484..636556
FT                   /locus_tag="GC56T3_R0065"
FT                   /note="tRNA-His1"
FT   tRNA            636484..636556
FT                   /locus_tag="GC56T3_R0065"
FT                   /product="tRNA-His"
FT   gene            636572..636646
FT                   /locus_tag="GC56T3_R0066"
FT                   /note="tRNA-Gln3"
FT   tRNA            636572..636646
FT                   /locus_tag="GC56T3_R0066"
FT                   /product="tRNA-Gln"
FT   gene            636652..636723
FT                   /locus_tag="GC56T3_R0067"
FT                   /note="tRNA-Gly4"
FT   tRNA            636652..636723
FT                   /locus_tag="GC56T3_R0067"
FT                   /product="tRNA-Gly"
FT   gene            636733..636806
FT                   /locus_tag="GC56T3_R0068"
FT                   /note="tRNA-Cys1"
FT   tRNA            636733..636806
FT                   /locus_tag="GC56T3_R0068"
FT                   /product="tRNA-Cys"
FT   gene            636869..636953
FT                   /locus_tag="GC56T3_R0069"
FT                   /note="tRNA-Leu5"
FT   tRNA            636869..636953
FT                   /locus_tag="GC56T3_R0069"
FT                   /product="tRNA-Leu"
FT   gene            637198..637740
FT                   /locus_tag="GC56T3_0592"
FT   CDS_pept        637198..637740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0592"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK2903 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25643"
FT                   /inference="similar to AA sequence:KEGG:GK2903"
FT                   /protein_id="ADI25643.1"
FT                   /translation="MRLMITKEEEIGLKRWLAFIAAVWSVWLAGCSGQTDRYAIEGYVV
FT                   RKEGGSILVVSSDPQDFRSTGGLKEFYNAILVSSAPARVNIGQKVQVWIDGGIAESYPG
FT                   QGKAGKVLVVPSSPRDGASLSEEEAIRQALKQEESRLEHMIPVIRAVHYDKQADTWMIQ
FT                   IKDAHERTEFDVRIKDE"
FT   gene            complement(638019..638180)
FT                   /locus_tag="GC56T3_0593"
FT   CDS_pept        complement(638019..638180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0593"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dvi:Dvir_GJ21171 GJ21171 gene product from
FT                   transcript GJ21171-RA"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25644"
FT                   /inference="similar to AA sequence:KEGG:Dvir_GJ21171"
FT                   /protein_id="ADI25644.1"
FT                   /translation="MKPKKRWARFSSFATNKPNDSDHAKDGKKLETDQAIFYTKTGAVI
FT                   RAKSVMRV"
FT   gene            complement(638577..639191)
FT                   /locus_tag="GC56T3_0594"
FT   CDS_pept        complement(638577..639191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0594"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_0549 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25645"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0549"
FT                   /protein_id="ADI25645.1"
FT                   /translation="MEALLTQILDRLDQLHSSVGVLTSDVNEMKNQLNKIEARAGSIEE
FT                   RVNSIEARVDSIESRVNNIEANMATKDELAELRSKVDDIEAKMATKDELAELRSTVNGL
FT                   QSNVNEIQAKMATKEELAELRSKVNELQFKVNELQSNVNEIQAKMATKDDLVPIRQAVM
FT                   EIDQIVKRIEVNQERHEHILAILSKRSIEHEASIASLRQAQ"
FT   gene            639817..640758
FT                   /locus_tag="GC56T3_0595"
FT   CDS_pept        639817..640758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0595"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   gyc:GYMC61_0550 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25646"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADI25646.1"
FT                   /translation="MLQKKWTSLLAVLMALFVLLVPLAQPAAPVEAASKTRVFKTELGK
FT                   LVIKGTPKRIVTLSMAGTDAVVTLGLKPVGYTISNSGTVPTYLRNKLKGVPSVGALSAP
FT                   SLERIAALKPDLIIIDHEFEFHKAIIPQLKKIAPVAGFRANSYKEAMNQLLVLGDILGR
FT                   KAKAKSFVNQFYKELKSQQAKLKDKNLRVLGFFVNKDGINVWQDNSFSGSIFTALKADY
FT                   AFKEKGDEYSDFKTVSLERILEIDPDVLFAYTDPGKNDLKKVKANPIWFQLKAVKKKRV
FT                   VEVNRDLWSRSRGPLAAKLIVKEAASILKRYQ"
FT   sig_peptide     639817..639915
FT                   /locus_tag="GC56T3_0595"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.711 at
FT                   residue 33"
FT   gene            640789..641787
FT                   /locus_tag="GC56T3_0596"
FT   CDS_pept        640789..641787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0596"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   gyc:GYMC61_0551 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25647"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADI25647.1"
FT                   /translation="MTYGKKAIWISVIAGLGIVLLMIVSLVSGPFFVPIPKVLDVFLHD
FT                   DGSKARTVVWNLRFPRALLAVLIGANLAVAGAMMQCLTKNPMAEPKIMGVSAGAAAMVV
FT                   LIEYFFAGLPLLFFSPLVFLGAAVGGALVYSLSLKRGALSPVRLTLAGVAVSAFLHAIT
FT                   VGILVLLGQDAAAVYAWLAGGLNGLTWRHVSLIAPWSLAGLLLSIMIASKMDLLELGDD
FT                   TAKGLGVHVGILKTVMAVMIIILAGSAVSVSGVIGFIGLIIPHIVRKMVGVNYTYIVPV
FT                   SALCGGMLLLTADLLARLVAQPIELPVGVFTAAIGCPYFLYLIRKQGEWNA"
FT   gene            641780..642760
FT                   /locus_tag="GC56T3_0597"
FT   CDS_pept        641780..642760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0597"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   gyc:GYMC61_0552 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25648"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADI25648.1"
FT                   /translation="MRKRDVGLVAGLALLLVIIVPLGACFGDVKIPVSQVWEAFFNRKS
FT                   SLNGEIVWEYRLPRILAGLFVGANLAVSGALLQAVTQNPLAAPNVIGMTAGASLFAVLA
FT                   LLIIPHFPVSGLPFVAFFGALFAGLCVYAFAWKKGMDKGRFALSGIAFDALFQAVITGI
FT                   LVFATKGIDAAVIWLAGSLWGRTWEHVFLIAPWSVVGLGLAYLCYRRMNVLQLHDDVAA
FT                   SLGMRVQAARFLIFLIAVGLCGSAVAVSGPIGFVGLVIPHLARLLTRADYQRLIPVSAL
FT                   LGAILMISADTAGRTIAAPIEIPVGILTAFIGAPYFLFLLRRAKL"
FT   sig_peptide     641780..641863
FT                   /locus_tag="GC56T3_0597"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.823) with cleavage site probability 0.493 at
FT                   residue 28"
FT   gene            642795..644297
FT                   /locus_tag="GC56T3_0598"
FT   CDS_pept        642795..644297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0598"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_0553 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25649"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0553"
FT                   /protein_id="ADI25649.1"
FT                   /translation="MVSSFAVVSLAIAGAAESEAYASKPAKLAIESAQPVNASTVKEYI
FT                   VKGKGLKGAKIKIVITDGKASVTHDTVVQKSGSFEAPVNVSTLRDGTLTVSVTQIIKGQ
FT                   KHSRVQKKIIKDTKAPSVPVITNKGWINAKQQNAYAVQGTAEPHSAVQVLLSDGKQRIT
FT                   KTVRADGKGRFRAVIDARRLAEGEITVSAVSVDSAGNQSGQSKKVLRKDVSIEAPELLN
FT                   EGYINAFNYEAYPVTGTGTPGEKVVVEAADGKKSVSASGLVDEDGNYEVEINTSSLKDG
FT                   KITIRVKTIDQAGNESRMASVVLIKSLSSPAKPSIDNKGYVNASADATAYEVTGKGEPG
FT                   AEVEVTLSDGTNEISTVGTVEENGRYRVEADISPLSDGLITITAVQTSVTGNVSPEATA
FT                   TVWKDTAVAAPSLNALPAVTNQNQAAYTIAGTAESNALVQIIITDGQKSLVEWTSADSN
FT                   GNFSKTIDLSAFNNGQLMIIVTQEDKAQNHSEATTATVTKGQ"
FT   gene            644517..645051
FT                   /pseudo
FT                   /locus_tag="GC56T3_0599"
FT   gene            645061..645348
FT                   /locus_tag="GC56T3_0600"
FT   CDS_pept        645061..645348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0600"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_0555 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25650"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0555"
FT                   /protein_id="ADI25650.1"
FT                   /translation="MSAGRSLDEHFLPFYCAGLRFGAAVGVTRRENVRDKGMRLLPLGV
FT                   RLMKPQREQYKRMAACERKAAMLVLVEMPNLLSFGPDVLLFLPLLLLEGL"
FT   gene            complement(645552..646178)
FT                   /locus_tag="GC56T3_0601"
FT   CDS_pept        complement(645552..646178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0601"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   gyc:GYMC61_0556 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25651"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADI25651.1"
FT                   /translation="MGIGTIFSFLGVAVLLTLAPGPDILFVIAQSLSQGKQAGIATALG
FT                   LCTGLLVHISAATLGVSAVIYQSALAFAIVKYAGAAYLLYLAWQAFREKDSSLAFGRQK
FT                   PMAYASLYKKGIVMNVLNPKVSLFFLALLPQFVDPSAGRVPQQMLLLGAVFLAQALAVF
FT                   TLVSIGAEKLRHWLLANTAITKRIHWLKGAIFALIGIQIAFSERS"
FT   gene            complement(646309..647259)
FT                   /locus_tag="GC56T3_0602"
FT   CDS_pept        complement(646309..647259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0602"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="KEGG: gyc:GYMC61_0557 cation diffusion facilitator
FT                   family transporter; TIGRFAM: cation diffusion facilitator
FT                   family transporter; PFAM: cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25652"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ADI25652.1"
FT                   /translation="MAPTLYDFHHLPHVKTQNESKKALWVTLLLTMFFTAVEIIGGLIS
FT                   NSLALLSDSAHMASDVLALGLSMVALYMATRPPNRRFTFGFLRFEIITSFLNGLTLAVI
FT                   ALWILWEGIQRFLHPEPINFRLMLGIAAIGLVVNLTLTIVLSRSTKEEDNLNVQSALWH
FT                   FIGDLISSIGVIVSALLIYFTGWTVFDPIISLVIAAIIFTGGAKIMRESYLILMEAVPD
FT                   GFDLEQIRADIRKIEGVEDVHDMHLWAISTDHYSLSAHVFVNERIQPLCVILAVNEMLK
FT                   EKYGIEHATIQVEHAMLHDHGRYGRAFLEKKASHE"
FT   gene            647436..651207
FT                   /pseudo
FT                   /locus_tag="GC56T3_0603"
FT   repeat_region   648689..650468
FT                   /note="region with at least 98 percent identity another
FT                   region of the genome"
FT   gene            651131..652300
FT                   /locus_tag="GC56T3_0604"
FT   CDS_pept        651131..652300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0604"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /note="manually curated; TIGRFAM: glucose-1-phosphate
FT                   adenylyltransferase; KEGG: gyc:GYMC61_0559
FT                   glucose-1-phosphate adenylyltransferase; PFAM: Nucleotidyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25653"
FT                   /inference="protein motif:TFAM:TIGR02091"
FT                   /protein_id="ADI25653.1"
FT                   /translation="MKKKCIAMLLAGGQGSRLRSLTKNIAKPAVPFGGKYRIIDFTLSN
FT                   CTNSGIDTVGVLTQYQPLLLHSYIGIGSAWDLDRRNGGVTVLPPYSASSGVKWYEGTAN
FT                   AIYQNMNYIEQYDPDYVLVLSGDHIYKMDYQQMLDYHIAKQADATISVIEVPWEEASRF
FT                   GIMNTNENMEIVEFAEKPANPKSNLASMGIYIFNWPLLREYLQIDNADPHSSHDFGKDV
FT                   IPRLLRENKRLVAYPFKGYWKDVGTVKSLWEANMDLLDEHNELDLFDRSWRIYSVNPNQ
FT                   PPQYIAPEAEVSDSLINEGCVVEGTVERSVLFQGARIGKGAVVKESVIMPGATVGEGAY
FT                   VERAIVTPEIVIPPHSTVSPGDADDDVVLVTTEWIKQRNKDTARKDGAQ"
FT   gene            652297..653331
FT                   /locus_tag="GC56T3_0605"
FT   CDS_pept        652297..653331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0605"
FT                   /product="glucose-1-phosphate adenylyltransferase, GlgD
FT                   subunit"
FT                   /EC_number="2.7.7.27"
FT                   /note="TIGRFAM: glucose-1-phosphate adenylyltransferase,
FT                   GlgD subunit; KEGG: gyc:GYMC61_0560 glucose-1-phosphate
FT                   adenylyltransferase, GlgD subunit; PFAM: Nucleotidyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25654"
FT                   /inference="protein motif:TFAM:TIGR02092"
FT                   /protein_id="ADI25654.1"
FT                   /translation="MNNNMMLGVIDATTYMEAMAPLVEQRSIAAVPFAGRYRLIDFVLS
FT                   SMVNSGIESVAIFPKYQYRSLMDHLGSGKNWDLNRKRDGLFFFPSPDLLFSGERRVGAF
FT                   AHFEQHIDYFLRSRQKYAVIANSYTVCNIDFAAVLKRHIENGCDVTRVCHRGEPLEMYV
FT                   LETSLLLDLISVYKERGYRSIVDVVCDDCHSLSICDYEYSGYAAVIDSLARYFQASMEL
FT                   LDRSVWEQLFLPSRPIYTKVKDEPPTKYRREGNVKRSMIANGCVIEGTVENSVLFRSVK
FT                   IGKGAVVKNSIIMQKCQIGDGCVLDGVIVDKDAKIEPGVVLQGTAERPFVVRKGTVQGE
FT                   VVNR"
FT   gene            653328..654785
FT                   /locus_tag="GC56T3_0606"
FT   CDS_pept        653328..654785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0606"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /note="KEGG: gyc:GYMC61_0561 glycogen/starch synthase,
FT                   ADP-glucose type; TIGRFAM: glycogen/starch synthase,
FT                   ADP-glucose type; PFAM: Starch synthase catalytic domain
FT                   protein; glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25655"
FT                   /inference="protein motif:TFAM:TIGR02095"
FT                   /protein_id="ADI25655.1"
FT                   /translation="MNVLFAVSECAPFAKSGGLADVAGALPKELRRLGVDVRVMMPKYE
FT                   TIALKWKERMGKVAEFVVPVGWRRQYCGVEKLEHDGVVYYLIDNEYYFKRPQLYGHDDD
FT                   GERFAYFCRAVLDALPAISFQPDVIHCHDWHTGMIPFFLREQYRHDPFYADIRTIFTIH
FT                   NLQFQGLFPRGILEDLLNLDGRYFTVDHLEFYGSVSFMKGALVASDLITTVSPTYKEEI
FT                   QTAYYGERLDGLLRARRDDLLGIVNGIDDEFYNPETDPFLAATYSVHTRERKKLNKRAL
FT                   QRRFGLPERDDAPVVAMVTRMTAQKGLDLVTCVFHDLMQEEMQLVVLGTGDWRFEQFFS
FT                   QMAAAYPDKVGVYIGFHEPLAHQIYAGADLFLMPSLFEPCGLSQMIALRYGTIPIVRET
FT                   GGLNDTVQSYNEFTGEGNGFSFTNFNAHDMLYTIRRALSFYRQPSIWERLMERAMRGDY
FT                   SWRRSAREYRKAYEQLNKKGEDALVRG"
FT   gene            654772..657186
FT                   /locus_tag="GC56T3_0607"
FT   CDS_pept        654772..657186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0607"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /note="KEGG: gyc:GYMC61_0562 glycogen/starch/alpha-glucan
FT                   phosphorylase; TIGRFAM: glycogen/starch/alpha-glucan
FT                   phosphorylase; PFAM: glycosyl transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25656"
FT                   /inference="protein motif:TFAM:TIGR02093"
FT                   /protein_id="ADI25656.1"
FT                   /translation="MFADKETFQRAFVTRVEALCGKPFAESTARDHYHVLGHMVREHIS
FT                   RHWIATNERCRAERRKQVYYLSIEFLLGRLLGSNLLNLGVRPMVEEGLRELGIRLEDVE
FT                   ECEADAGLGNGGLGRLAACFLDSLATLNLPGHGHGIRYKHGLFDQKIVDGYQVELPEQW
FT                   LRNGNVWEIRKEELAVEVRFWGRVEVSEQNGRLVFRHVDSENVMAVPYDMPVIGFGTNT
FT                   VNTLRLWSAEPAKTFPLHKDVMQYKRETEAISEFLYPDDTHDEGKLLRLKQQYFLAAAS
FT                   LGSITRAHRRQHGSLRRLHEYVAIHINDTHPVLAIPELMRILLDEEGMSWEEAWRITTH
FT                   TIAYTNHTTLAEALEKWPIRLFQPLLPRIYMIVEEINERFCRELWERYPGDWGRIEQMA
FT                   IVAHGMVKMAHLAVVASHSVNGVAKLHTDILKQREMRLFYEWAPHKFNNKTNGVTHRRW
FT                   LLKANPELSALITETIGPRWIREPEALIELKSYASDPAFQQALAAVKQQRKARLAARIY
FT                   EKTGILVDESSIFDVQVKRLHAYKRQLLNVLHIMHLYNRLKEDPYVSIHPRTFIFGAKA
FT                   SPGYYYAKRIIKLIHSVADKVNNDNQVNEQLKVIFLENYRVSLAEEIIPAADVSEQIST
FT                   ASKEASGTGNMKFMMNGAVTLGTLDGANVEIAEAVGEENMFLFGLTAEEVLRYYEHGGY
FT                   RAHEYYHHDKRIKQVVDQLINGFFPDVGDYFEPIYDSLLAQNDEYFVLRDFAAYAEAHE
FT                   RVEDAYRDPARWWRMSAVNIAHSGRFASDRTVAEYAAEIWGLLPSGERFST"
FT   gene            complement(657301..658095)
FT                   /locus_tag="GC56T3_0608"
FT   CDS_pept        complement(657301..658095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0608"
FT                   /product="protein of unknown function DUF124"
FT                   /note="PFAM: protein of unknown function DUF124; KEGG:
FT                   gka:GK2879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25657"
FT                   /inference="protein motif:PFAM:PF01987"
FT                   /protein_id="ADI25657.1"
FT                   /translation="MNAHEIDYRLYGDDMQFVEIELDPYESVVAEAGGMMMMDDGIVME
FT                   TVFGDGSSSGKGLLGRLVGAGKRLLTGESLFMTVFTNQGSGKRRVAFAAPYPGKIIPVD
FT                   LSELGGKLICQKDSFLCAAKGVSVGIEFQRKLGAGFFGGEGFIMQKLEGDGLAFLHAGG
FT                   TIHRRDLQPGETLRIDTGCLVAMTKDVNYDIEYVGSIKTAFFGGEGLFLATVTGPGAVW
FT                   VQSLPFSRLADRVLAAAPSAGERSVGEGSILGGIGDWLDGDD"
FT   gene            complement(658195..659004)
FT                   /locus_tag="GC56T3_0609"
FT   CDS_pept        complement(658195..659004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0609"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="KEGG: gyc:GYMC61_0565 transcriptional regulator,
FT                   TraR/DksA family; TIGRFAM: sporulation protein, yteA
FT                   family; PFAM: zinc finger DksA/TraR C4-type"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25658"
FT                   /inference="protein motif:TFAM:TIGR02890"
FT                   /protein_id="ADI25658.1"
FT                   /translation="MLTNEQLAALRSRLLDMKRETEDRLKQNDHFGMIRSHAHDAVGEL
FT                   ASYDNHPADEATELYEREKDLALKEHAERELREIERALGAIADGTYGTCRVCGRPIPYE
FT                   RLEALPTTLYCREHSPDQTVSQKRPLEEGVLMPPFGKFDFDDRTESVAYDAEDAWQEVA
FT                   RYGTSDTPSDLGKNVDSYSEVYAESEENVGYVEDLENFAAVDLHGRHVRVYPTREHELL
FT                   ENILDDEGIMSNIGDLPAYEKDPYTSTDSYRRYDERPSQQHFGETTP"
FT   gene            complement(659090..660094)
FT                   /locus_tag="GC56T3_0610"
FT   CDS_pept        complement(659090..660094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0610"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /note="KEGG: gyc:GYMC61_0566 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase; TIGRFAM: 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase; PFAM: UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25659"
FT                   /inference="protein motif:TFAM:TIGR00751"
FT                   /protein_id="ADI25659.1"
FT                   /translation="MLSTFAYTYFGHKRMTFSQNLRGMNMQSFTHMDHRPPARRDWRVF
FT                   WRLTRPHTLTAAFVPVCVGTVLALGETSIDWLLFAAMMIASLLIQAATNMFNEYYDYQR
FT                   GLDSPESVGIGGAIVRDGLKPKTVLALAFGCLGLAMLIGIYICAESSWWLAVVGTICMA
FT                   AGYFYTGGPVPIAYTPFGELAAGFFMGFVIILISFFIQTGHISGGAVLTAIPIAILVGA
FT                   ILLANNIRDLDGDREKGRKTLAILIGRDWAIRLLAAMFAVAFLWTAALAAFQIVPFWAL
FT                   LALLSIPKAIAATRGFIGKIKPIEMMPAMKATAQTNTQFGFLLAAGLLIAHWL"
FT   gene            660188..661564
FT                   /locus_tag="GC56T3_0611"
FT   CDS_pept        660188..661564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0611"
FT                   /product="isochorismate synthase"
FT                   /note="manually curated; TIGRFAM: isochorismate synthase;
FT                   KEGG: gyc:GYMC61_0567 isochorismate synthase; PFAM:
FT                   Chorismate binding-like"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25660"
FT                   /inference="protein motif:TFAM:TIGR00543"
FT                   /protein_id="ADI25660.1"
FT                   /translation="MAIGFRHHLQQQLHRLAVNAGRPFVSWTEPWEGVDPVSFFMQGPS
FT                   CGFRERFFWADRTGGTILVGLGSVYAIETEKADSRFDDVEAGRRRWEKEMEPYGAADAP
FT                   PLLFGGFSFDPYRPGTDMWRGFPAGKLVAPAALLAVRNGKTTLTVTVPTDKRGRDWERV
FT                   GRLLERISDPMAAPKRLPRLVSDEEEEKERWLAAVREAIASIRAGALDKVVLARARRLA
FT                   FAKTVDAAAVLQRLREQQPFAYIFAFEQDGRCFIGASPEQLVQKEGKMCRSVCLAGSVR
FT                   RGAAMEEDERLGAWLRADRKNNEEHQFVVQMIGRLFSSVCETVEMPPAPQLLKLPHIQH
FT                   LCTPVVGRGCRERSVLRLVEMMHPTPALGGTPRDRALEVIRALEPLDRGWYAAPIGWVD
FT                   GEGNGEWAVAIRSALLVGKEAVLFAGCGIVADSDPNSEYEETNVKMAPMLSALGVMNDG
FT                   "
FT   gene            661557..663290
FT                   /locus_tag="GC56T3_0612"
FT   CDS_pept        661557..663290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0612"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate
FT                   decarboxylase"
FT                   /note="KEGG: gyc:GYMC61_0568
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase; TIGRFAM:
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase; PFAM: thiamine
FT                   pyrophosphate protein TPP binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25661"
FT                   /inference="protein motif:TFAM:TIGR00173"
FT                   /protein_id="ADI25661.1"
FT                   /translation="MADALSVYVAALVDGLAQAGVTEAVISPGSRSTPLAMAMAAHPGL
FT                   RLYMNIDERSAAFFALGLAKAKQRPVALVCTSGTAAANYGPAVVEAYYSRVPLVVLTAD
FT                   RPHELRDVGAPQAIDQLHLYGRYAKWFVDLALPEEADDMLRYARTMAARAVQTAAGAPC
FT                   GPVHVNAPFREPLVPHIDEAVWERVRSVSRAPQVWNGRPALPQESVSALYEQLSAAERG
FT                   LIVCGPLDRPGFAEAVTELARALDFPILADPLSQLRAGTHDKTYVLDSYDAILREETAA
FT                   SKLVPDVVLRFGAMPVSKPLFLWLKRHRAIRQIVVDDGGWRDPTLSADSFVQSDELILC
FT                   RQLLEWAKPKENKSAWSAIWREMNAIARAALERHLPKEEWFEGKVFTELADLLPAGAAL
FT                   FVGNSMPIRDADTFLFATDKPLRVLANRGANGIDGVVSSALGASVAANPLVLVIGDLSF
FT                   YHDLNGLLAAKMHSLSATIVLLNNNGGGIFSFLPQARHKGAFETLFGTPTDLSFAHAVE
FT                   MYGGRHTVPHNWAEFRRHVSESLSSGGLHVIEVRTSRAENVRMHRLLWNEVAREIAKCL
FT                   E"
FT   gene            663302..664114
FT                   /locus_tag="GC56T3_0613"
FT   CDS_pept        663302..664114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0613"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   gyc:GYMC61_0569 alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25662"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADI25662.1"
FT                   /translation="MTMMVNGVCYHVEQYGEGEPLLLLHGFTGSADTWRPLAPFWPDFR
FT                   VMAVDLLGHGRTEAPKDARRYRIEHAVADLAALLDEWGVEQVNVLGYSMGGRLALAFAV
FT                   WHPHRVRRLVLESSSPGLKMEEERRARREADEALARKIETEGVRAFVDDWEKIPLFATQ
FT                   QALPDSVRAAIRRERLRHTATGLANSLRGMGTGVQPSFWERLGELAMPVLLVCGEHDEK
FT                   FCRIAAQMHERLPNSELICVKEAGHAIHVEQPGIFAKIVSEFMTKGEV"
FT   gene            664115..664933
FT                   /locus_tag="GC56T3_0614"
FT   CDS_pept        664115..664933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0614"
FT                   /product="naphthoate synthase"
FT                   /note="KEGG: gyc:GYMC61_0570 naphthoate synthase; TIGRFAM:
FT                   naphthoate synthase; PFAM: Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25663"
FT                   /inference="protein motif:TFAM:TIGR01929"
FT                   /protein_id="ADI25663.1"
FT                   /translation="MPFEWVKQYDYEDIIYETYNGIAKITINRPEVHNAFRPKTVNEMI
FT                   DAFTKARDDSNIGVIILTGAGGKAFCSGGDQKVRGHGGYVGEDEIPRLNVLDLQRLIRV
FT                   IPKPVIAMVAGYAIGGGHVLHVVCDLTIAADNAIFGQTGPKVGSFDGGYGAGYLARIVG
FT                   HKKAREIWYLCRQYTAQEALEMGLVNKVVPLEQLEEETVKWAQEILEKSPTAIRFLKAA
FT                   FNADSDGLAGIQQLAGDATLLFYTTEEAKEGMRAFKEKRKPDFSQFPRFP"
FT   gene            665050..666522
FT                   /locus_tag="GC56T3_0615"
FT   CDS_pept        665050..666522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0615"
FT                   /product="O-succinylbenzoate-CoA ligase"
FT                   /note="KEGG: gyc:GYMC61_0571 O-succinylbenzoate-CoA ligase;
FT                   TIGRFAM: O-succinylbenzoate-CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25664"
FT                   /inference="protein motif:TFAM:TIGR01923"
FT                   /protein_id="ADI25664.1"
FT                   /translation="MTTMPNWLKQRAFLTPERIAVSDGRRTKTFAELYEAAAVWARRLA
FT                   QAGVKEGDVVALLMKNRIEMIEIIHALFFLGARVLLQNVRLTPYELGWQLDDSGARLVI
FT                   ADEELAGRLDGDGRVLTVGAVAALPEVDVSLKETCDLEAVATIMYTSGTTGTPKGVLQT
FT                   YGNHWWSAVGSALNLGLHERDCWLAAVPLFHISGLSIAMRSVIYGMPMRLQTSFDPKEA
FT                   NEWIMRGDVTIMSVVAAMLQRMVAELGEARYPDTFRCMLLGGGPAPRPLLEACKEKGIP
FT                   VYQTYGMTETASQIATLAPEYSLTKLGSAGKPLFPAELCILKDEKPVAPHEAGEIVVKG
FT                   PNVTKGYLHRPEATAQAIRGGWFFTGDIGYVDEDGFLYVLDRRSDLIISGGENVYPAEV
FT                   EAVLLSHPDVEEAGVTGVEDETWGQVPYAFVRLKRGASPDEAALRAFCRERLAKYKVPA
FT                   RIYFVDELPRNAAQKLLRRELKRLIPKTEQTF"
FT   gene            complement(666829..667026)
FT                   /locus_tag="GC56T3_0616"
FT   CDS_pept        complement(666829..667026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0616"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: gka:GK2871 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25665"
FT                   /inference="similar to AA sequence:KEGG:GK2871"
FT                   /protein_id="ADI25665.1"
FT                   /translation="MDKRASLIQALQTEMKRAALGTYPACIDSFARLWDYEFGSFDQLP
FT                   PEIERLIAHRAAELGWMDDV"
FT   gene            complement(667092..667253)
FT                   /locus_tag="GC56T3_0617"
FT   CDS_pept        complement(667092..667253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0617"
FT                   /product="protein of unknown function DUF1540"
FT                   /note="PFAM: protein of unknown function DUF1540; KEGG:
FT                   gyc:GYMC61_0573 protein of unknown function DUF1540"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25666"
FT                   /inference="protein motif:PFAM:PF07561"
FT                   /protein_id="ADI25666.1"
FT                   /translation="MAKDVLCEVHNCRYWAEGNRCSAEAIYVVSHAGKMASDSTETDCK
FT                   TFVPAHEA"
FT   gene            667582..667872
FT                   /locus_tag="GC56T3_0618"
FT   CDS_pept        667582..667872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0618"
FT                   /product="Uncharacterized conserved protein UCP020408"
FT                   /note="PFAM: Uncharacterised conserved protein UCP020408;
FT                   KEGG: gyc:GYMC61_0574 uncharacterized conserved protein
FT                   UCP020408"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25667"
FT                   /inference="protein motif:PFAM:PF10087"
FT                   /protein_id="ADI25667.1"
FT                   /translation="MASLLVVGADHLGHITDKLERSGFREIIHLNGRKVNMVKRDIPEH
FT                   VDAILVMIDYVNHNLAKKVKEKAKSKDKPIYFAKRSWSSINAVLEQLGKHA"
FT   gene            667891..668379
FT                   /locus_tag="GC56T3_0619"
FT   CDS_pept        667891..668379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0619"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_0575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25668"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0575"
FT                   /protein_id="ADI25668.1"
FT                   /translation="MVPIHHETLDVWPYALRRFLRRVIQAYCDTAPSLRSPLCLLRLID
FT                   QHRSLLPLSMFPTPLHYGLVLAKVTDHLLQFFGSMEEAACKPLLLADGGLGEEADRELY
FT                   IVYRDRVRVLLWCEEEEAIRRCKETASSLCREAIGRCPNELECCFLWTGGRRIEWIPA"
FT   gene            668526..670604
FT                   /locus_tag="GC56T3_0620"
FT   CDS_pept        668526..670604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0620"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_0576 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25669"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0576"
FT                   /protein_id="ADI25669.1"
FT                   /translation="MKRMPWKVMATSAAASLLLASGCSAVGEKENGRSSEAPHLHVPVA
FT                   DDHFDTAGNMFAYSEFELSGEPLAEGLGLDLDTLDARKPDEPTKFDYTAGIESYEYSEE
FT                   AMYEVTEKSGLGLHLINGPIAKQRAEQRHKPADEALADRFYELADSVGYPREEIFRNMF
FT                   PTFIEYAGGDPHYAQKVDTDVYAENDDGTYVPVYQVDFQSLRWDRRKMDKVLTPSAYGG
FT                   VFLKQALWAGDFLGNFHQKDSDEEVEAKTPNDDQSGKVALGVSSADGMQGMILTEQIWN
FT                   KLAFIRDHLFYDAKQQALTKAAGSRYNPSGGFVYLPHAVEVAEGGSELAPDAAKLVVKD
FT                   PRSLLEDQWLMLWPAAEFFGMTDQRPENKNQNPAFLAVFDGKPFPKAAKENVDADPAND
FT                   RVADDPYSVNRDVLLQVFRNIDAMHFNEKAGAFVTEHDGRTQGNRVDTFQAGYTMEALR
FT                   IFERAIDGMPVGYASGESAKGLGTPEGKRALELIRRQADFIMHNLMRKDGLVANGYTIG
FT                   QGPDQDEPTLLAQLGAIRGLTAAFLATKDEAYRDAARLVYEAMDRHFWDQKWHVYHTGE
FT                   KEDKYTPWLAGALSGVFRVALQNLNNDQADETAKPLDRETIISRYVDFYDRIVDGPTLQ
FT                   EGMQASEFWDTGDVYIKGKKLGNTDRDRVPQVQAAGGPYGVAPVLRTVKVNVGSGNK"
FT   sig_peptide     668526..668603
FT                   /locus_tag="GC56T3_0620"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.747 at
FT                   residue 26"
FT   gene            670701..672659
FT                   /locus_tag="GC56T3_0621"
FT   CDS_pept        670701..672659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0621"
FT                   /product="40-residue YVTN family beta-propeller repeat
FT                   protein"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: gyc:GYMC61_0577 40-residue YVTN
FT                   family beta-propeller repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25670"
FT                   /inference="protein motif:TFAM:TIGR02276"
FT                   /protein_id="ADI25670.1"
FT                   /translation="MRKWWFAAAIAALLAGCQDEKAGHEQPKVVRHAPAHGDNIAVSSD
FT                   GRYVYTANIDVDTVTIINAKTKTKEAEIPVGREPRQLALSPDGRTLYVSCMYDDEVDVV
FT                   SLDKRKVVDRWKTGIEPFGIVTSPDGAEVYVANYRSGTVSVFDAESGKRTKDIQAGDRP
FT                   RALALTADGRKLYVTQYLAAKVTVIDTKKRRAVKEIALAPSPDKADRKKSQGIPNTLEQ
FT                   IVIAPDGKKAYIPHLLTNIDTPIQFEETVFPAISVIDATKDAELPNERKELFAAINVTD
FT                   VHNETIIVSNPYDVAFSPDGGKAYAVMSGSEDLVVFDLRRGGKATQILRRIHGNNPRGI
FT                   AISPDGKTLYVHNAMSHDLAVIKTGGKSPYAKAKQESGTIRLIAKDSLSPLVREGKTIF
FT                   YSANSDEFAINITGNNWMSCASCHSDGDINGLTLMTAKGPRNVPSNILATKTGLFMWDG
FT                   SRDDFTDYIHTVQGEMGGMTAIDPSKPLPPNVQHMFDAILAYLNDPRSFPVPKSPYRKA
FT                   DGSLTAEAKEGERLFNGKGNCLSCHGGEYFTDSVKAVGPDGKLTTANTAYLHDIGTANP
FT                   KDRASKGDARARFTNPRTPKQWDTPTLRGVWATAPYLHDGSAKTIEEAIRRHRTKEVQT
FT                   LTPGEIAAIAAYVRSLQ"
FT   gene            complement(672768..673799)
FT                   /locus_tag="GC56T3_0622"
FT   CDS_pept        complement(672768..673799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0622"
FT                   /product="cytochrome bd-type quinol oxidase, subunit 2"
FT                   /note="KEGG: gyc:GYMC61_0578 cytochrome bd-type quinol
FT                   oxidase, subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25671"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0578"
FT                   /protein_id="ADI25671.1"
FT                   /translation="MTNELIAITVLWGFIFIYAVMATMDFGAGFWSMVYIHREKANATK
FT                   IANRYLSPTWEVTNVFIVAIVVALFSFFPGAAFLLGTVLLVPGSIILILLAIRSAFLVF
FT                   AHVAKEYEKALTYISGITGIIIPALLISVLPITHGEFIDIRKGVPTLDLERFFTSPHAH
FT                   SFMGFAISSTLFLSSLLLADYSLEAGDREAYRLYRRDAWITGPLSLLMAGGMMLTMRYE
FT                   AKWLYDRMMEYWPWLIGSVAMFAAAGIALSLPSSRHPHVRGRPRLAVIAIVIQYFLASY
FT                   AYGKAHLPYMVYPDVTIESAFTHPDTFRALFASYIVGFLILFPGFVYFWRLFMHDKRYV
FT                   RPK"
FT   gene            complement(673815..675164)
FT                   /locus_tag="GC56T3_0623"
FT   CDS_pept        complement(673815..675164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0623"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: gyc:GYMC61_0579 cytochrome bd ubiquinol oxidase
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25672"
FT                   /inference="protein motif:PFAM:PF01654"
FT                   /protein_id="ADI25672.1"
FT                   /translation="MDDVIIARSLFGTTMAFHIIFATLGVGIPIMILLAELLYQKTKDY
FT                   DYAVMAKRWTKGLAVLLGVAIPSGTIAGVQLSLLWPGFMEVIGKVMSLPFQIEIYAFFI
FT                   EALFMSIYVYAADRISPLMRIVSVFFVALGASASAILITNVHAFEGTPAGFRIENGEIV
FT                   DVDPWAAFFNPSFFVTAGHVVLSAYMTGAFVLASIAAYQLLRASQNEQVRRFHQKALKL
FT                   SLAVGGVFSLLTAINGHESAQLLHQYQPEKLAAAEGLFETQSHAPLAIGGFTDAKTQSV
FT                   KWAIEIPWALSFLAGNRFDTVVKGLNDFPKEWWPPLFVHTLFNAMVGIGVLLLFLSAAA
FT                   LVWQNWRKRPAFPRWLLYSFVAAGPLAVIGIECGWIFACTGRQPWVIYRMMKTEEAVTQ
FT                   TGNLAVLFALFVAIYILLSIAVVLVLRYYFRRHPVADELRKPPNEGTLPV"
FT   gene            complement(675295..676281)
FT                   /locus_tag="GC56T3_0624"
FT   CDS_pept        complement(675295..676281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0624"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   gyc:GYMC61_0580 periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25673"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ADI25673.1"
FT                   /translation="MRATSIILSFLLATSALLYGCQSKPETKEGQTSNDQLTIYTTVYP
FT                   LEDFTKKIGGDAVNVKSVYPPGVEAHTFEPTTKTVQQIADADAFIYIGHGMEPFAEKLQ
FT                   ETLQNEHVRFLVATNGIELLESNHEQEHAHGEGHKDEHGEGHEEEHGHEHGDKDPHVWL
FT                   DPIRSIAIAKNIRDLLIELKPEKKDLFMQNFETLKMKLERLDGQFRSTVEKAPRKEILV
FT                   SHQAYGYWEDRYGIKQLSVSGLSPSNEPSQKELTQLIQTAKQHHIRYVIFEQNVHPKTA
FT                   EVIQNEIGAKPLRLHNLESLTDEDRKAHKDYFALMAENLRVLQKALH"
FT   sig_peptide     complement(676219..676281)
FT                   /locus_tag="GC56T3_0624"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.768) with cleavage site probability 0.712 at
FT                   residue 21"
FT   gene            complement(676361..677545)
FT                   /locus_tag="GC56T3_0625"
FT   CDS_pept        complement(676361..677545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0625"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: gyc:GYMC61_0581
FT                   cobalamin synthesis protein P47K"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25674"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ADI25674.1"
FT                   /translation="MNKIPVTVLSGYLGSGKTTLLHHILHNREGKKIAVIVNDMSEINI
FT                   DAELVRQNGFFRTEEKLIQIQNGCICCTLREDLIKAVDQLVENGEIDYIVIESSGISEP
FT                   IPVAQTFTYLDEELGIDLSRKCRLDTMVTVVDANRFWTDFSSGETLLDRQQAVDETDSR
FT                   EIADLLIEQIEFANVIVVNKIDLVSPEEVQKLQKVLQKLNPEAVIIPATFGQVPLDSIL
FT                   NTHLFDFEKASQSAGWIKELNEEHTPETEQYGISSFVYRRKRPFHPERLMNWLENWPTE
FT                   VVRAKGFIWLVSWNDWCILLSQAGTSISMQAAGRWMASYPEEDIKQLLQEEEAWQEKWD
FT                   DTYGDRLTELVLIGIHMNADRIERSLDQCLLTDEEMKEDWTLLPNPFPSLIPSA"
FT   gene            complement(677633..677875)
FT                   /locus_tag="GC56T3_0626"
FT   CDS_pept        complement(677633..677875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0626"
FT                   /product="protein of unknown function DUF37"
FT                   /note="PFAM: protein of unknown function DUF37; KEGG:
FT                   gyc:GYMC61_0582 protein of unknown function DUF37"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25675"
FT                   /inference="protein motif:PFAM:PF01809"
FT                   /protein_id="ADI25675.1"
FT                   /translation="MGQWLIWCIRFYQRFLSPLKPPTCRFYPTCSNYGIEAIRRFGAIK
FT                   GGWLTVKRILKCHPFHPGGLDPVPELIHHLKRKNN"
FT   gene            678089..678565
FT                   /locus_tag="GC56T3_0627"
FT   CDS_pept        678089..678565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0627"
FT                   /product="quorum-sensing autoinducer 2 (AI-2), LuxS"
FT                   /EC_number="4.4.1.21"
FT                   /note="KEGG: gka:GK2863 S-ribosylhomocysteinase; PFAM: LuxS
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25676"
FT                   /inference="protein motif:PRIAM:4.4.1.21"
FT                   /protein_id="ADI25676.1"
FT                   /translation="MPSPVESFELDHCAVKAPYVRHCGVHKVGSDGVVNKFDIRFCQPN
FT                   KEAMDPAAIHTLEHLLAYTLRRHAAKYDHFDIIDISPMGCQTGFYLVVSGSPTVDEIID
FT                   LLEEAMKDALAATEVPAATERQCGQAKLHDLEAAKQLMRFWLSQEKEELKKVFG"
FT   gene            complement(678588..678803)
FT                   /locus_tag="GC56T3_0628"
FT   CDS_pept        complement(678588..678803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0628"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: gka:GK2862 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25677"
FT                   /inference="similar to AA sequence:KEGG:GK2862"
FT                   /protein_id="ADI25677.1"
FT                   /translation="MNASSARYGIIKRKKAGVMMYWTLIVCLIIAAVVLALAVVTTSKA
FT                   YAYKHTVDPLPNERGGEQQAGPKQPQ"
FT   sig_peptide     complement(678687..678803)
FT                   /locus_tag="GC56T3_0628"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.600 at
FT                   residue 39"
FT   gene            679302..679742
FT                   /locus_tag="GC56T3_0629"
FT   CDS_pept        679302..679742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0629"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG: gka:GK2861
FT                   starvation-induced protein controlled by sigma-B (general
FT                   stress protein 20U)"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25678"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ADI25678.1"
FT                   /translation="MTTRLIDLVNKQIANWTVLYVKLHNYHWYVTGPQFFTLHEKFEEL
FT                   YNEAATHIDALAERLLALGGKPVATMKDCLKQASVKEAAGTETAEQMVASIVGDFETMI
FT                   GELKEGMKLADEVNDETTGDMLLGIHRSLEKHVWMLKSFLGR"
FT   gene            679896..680291
FT                   /locus_tag="GC56T3_0630"
FT   CDS_pept        679896..680291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0630"
FT                   /product="toxin secretion/phage lysis holin"
FT                   /note="KEGG: gka:GK2860 hypothetical protein; TIGRFAM:
FT                   toxin secretion/phage lysis holin; PFAM: Holin toxin
FT                   secretion/phage lysis"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25679"
FT                   /inference="protein motif:TFAM:TIGR01593"
FT                   /protein_id="ADI25679.1"
FT                   /translation="MNKPIPMVAVSLFGSFLSLFVGSVDSFVVILLALVIVDYLTGIAA
FT                   SAVEGKLSSQVGFRGIIRKLLIFILVAASHLVDLAIGWNMHVIRDAIIFFYIANEFISI
FT                   VENAGRAGVPIPSVLRKAIELLKDEIK"
FT   sig_peptide     679896..679976
FT                   /locus_tag="GC56T3_0630"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.931) with cleavage site probability 0.410 at
FT                   residue 27"
FT   gene            680353..680685
FT                   /locus_tag="GC56T3_0631"
FT   CDS_pept        680353..680685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0631"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_0587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25680"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0587"
FT                   /protein_id="ADI25680.1"
FT                   /translation="MADERKKTYYVSMAHGEISQLKTASPWDFQIEATDEEIARLREYF
FT                   DQNYSTDWQAFWRTHVPYIQYHYDRENDAYDRTIVDIYKMIYELGNDEAKEHIRSMGIL
FT                   PDEKEP"
FT   gene            680744..681235
FT                   /locus_tag="GC56T3_0632"
FT   CDS_pept        680744..681235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0632"
FT                   /product="nucleoside triphosphatase YtkD"
FT                   /note="KEGG: gyc:GYMC61_0588 nucleoside triphosphatase
FT                   YtkD; TIGRFAM: nucleoside triphosphatase YtkD; PFAM: NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25681"
FT                   /inference="protein motif:TFAM:TIGR02705"
FT                   /protein_id="ADI25681.1"
FT                   /translation="MHEFRDYYGHRVRLAFADHPFSPSPGHVWVICRYGGRWLLTDHPR
FT                   RGLEFPGGKVEEGETAAEAAAREVMEETGGIVGRLEYIGQYKVEPDIVKNIYFADIAAL
FT                   VELGSYLETNGPVLLEALPDDIRTDDRFSYIMKDDVLSLSLAELKQRGLISRGERSGER
FT                   "
FT   gene            681235..681363
FT                   /locus_tag="GC56T3_0633"
FT   CDS_pept        681235..681363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25682"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI25682.1"
FT                   /translation="MILDGFCWSSGSMKEEAKGVWADAGPTSGMKRDARRSFTNVS"
FT   gene            complement(681360..682169)
FT                   /locus_tag="GC56T3_0634"
FT   CDS_pept        complement(681360..682169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0634"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gka:GK2857
FT                   nitrate/sulfonate/taurine/bicarbonate ABC transporter
FT                   (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25683"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADI25683.1"
FT                   /translation="MNQAPDRIQSLHREYLAALRKERRVIRLWQAALLVAFFAVWEAAS
FT                   RFHWVDPLLFSSPSAIIRLFIEKLSDHSLFVHTWATLFETLLGFLIGTVGGALIGAVLW
FT                   WFPRLAKTLDPYLVVFNAMPKVALGPILIVALGPGFTSIIAMGVVISIIITTIVVYSAF
FT                   QEVDPNYLKVLRTFGATRCQCFKEAVLPASFPAIISTLKVNVGLAWVGVITGEFLVSKQ
FT                   GLGYLIIYGFQVFNFTLVLMSLLIVALLSTVMYQLVAIVEKKWGSRR"
FT   gene            complement(682153..682944)
FT                   /locus_tag="GC56T3_0635"
FT   CDS_pept        complement(682153..682944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0635"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gka:GK2856
FT                   nitrate/sulfonate/taurine/bicarbonate ABC transporter (ATP
FT                   binding protein); PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25684"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI25684.1"
FT                   /translation="MFLVIDRLSHTYLTKTTAVTALDDVSLSVEKGEFVSFLGPSGCGK
FT                   TTLLSIIAGLIEPTEGAVLIEGEPLWPGGSDAQTARRAVGYMLQQDYLFPWKTIEENIL
FT                   LGLKMTRTLTAQTKERALALLAEIGLAGVESYYPSQLSGGMRQRAALVRTLATDPKLLL
FT                   LDEPFSALDQQTKLKLEELVWKTLKQYEKTAVLVTHDIEEAIAMSDRIFLFSPRPGRLV
FT                   RTFVIPDELRGRPPLAARQHPSFPALFQSIWKEMEALESSS"
FT   gene            complement(682963..684171)
FT                   /locus_tag="GC56T3_0636"
FT   CDS_pept        complement(682963..684171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0636"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   gka:GK2855 nitrate/sulfonate/taurine/bicarbonate ABC
FT                   transporter (substrate binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25685"
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /protein_id="ADI25685.1"
FT                   /translation="MSDCLAALACRPLAERQLEKALEREERPDRRPFSFDRPFFLGIHT
FT                   FLLRAYDKVKPRFTACEPRGLTNMKKWAVWLCSLLLLLPLSACTNDGGQSEKPLKKVRL
FT                   AEVTHSIFYAPQYVALAKGFFKEEGLDVELTTTWGGDKTMTTLLSGGADIALVGSETSI
FT                   YVYSQGTDDPVINFAQLTQTDGTFLVSRKKIGHFTWEMLKGSTFLGQRKGGMPQMVGEF
FT                   VLKKHGIDPHQDLKLIQNVDFANIANAFASGTGDFVQLFEPTASLFEQEGKGYIVASFG
FT                   TESGRVPYTSYMAKRSYMNENKDVIEKFTRAIYKAQQWVESHSAAEIAKAIQPYFKDTD
FT                   LALIEKVVDRYKSQGTYATDPILDEEEWNHLQTIMAEAGELPKRIDVNTLVDSSFAKSA
FT                   MNK"
FT   gene            684259..685047
FT                   /locus_tag="GC56T3_0637"
FT   CDS_pept        684259..685047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0637"
FT                   /product="BAAT/Acyl-CoA thioester hydrolase"
FT                   /note="PFAM: BAAT/Acyl-CoA thioester hydrolase; KEGG:
FT                   gyc:GYMC61_0653 BAAT/acyl-CoA thioester hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25686"
FT                   /inference="protein motif:PFAM:PF08840"
FT                   /protein_id="ADI25686.1"
FT                   /translation="MDGDIIDQYRFPSPHPGIDVFFVTYMSQGLKVKGFLAAPKQNKVY
FT                   DGFLYLRGGIKNVGQVRVPRLVQFASQGFVVFAPLYRGNGGGEGNEDFAGDDRYDALAG
FT                   FHLLRRHPLVHPGRVHMFGFSRGGAMALHAALMAEGVCSVAVWGGVADLELTYWERPDL
FT                   RRMMKRVIGGTPNKCPERYRHRTPLYYLERLQAPVLIIHGGRDENVSIEHAYRLERRLK
FT                   QLGKRVTAWYFPAFTHYFPPPANRETVQRLTEWMKQQPTM"
FT   gene            685140..685382
FT                   /locus_tag="GC56T3_0638"
FT   CDS_pept        685140..685382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0638"
FT                   /product="Protein of unknown function DUF2584"
FT                   /note="PFAM: Protein of unknown function DUF2584; KEGG:
FT                   gyc:GYMC61_0654 protein of unknown function DUF2584"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25687"
FT                   /inference="protein motif:PFAM:PF10763"
FT                   /protein_id="ADI25687.1"
FT                   /translation="MGMPMELQTVIVTKGKEQRVQGNVFVLEKEGYRLYPLDVPLEVRR
FT                   TVQSEASGVAVVRKLEWEGSRTTVTYELVSLYSTN"
FT   repeat_region   685661..686444
FT                   /note="region with at least 97 percent identity another
FT                   region of the genome"
FT   gene            685672..686598
FT                   /locus_tag="GC56T3_0639"
FT   CDS_pept        685672..686598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0639"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_2786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25688"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_2786"
FT                   /protein_id="ADI25688.1"
FT                   /translation="MAKQRIDHDRLFKELLSTFFEEFLLLFFPDVYEHIDVHHLSFLSE
FT                   ELFTDVTAGEKHRVDLLVETKVKGEDGLVIVHVEHQSYTQRTFPERMFLYFSRLFQKYR
FT                   RRILPIAIFSYDEQYDEPSSLVMQFPFLTVLDFRFLTVELRKQPWRAYIRHANPVAAAL
FT                   LSKMGYNEDEKVEVKKEFLRMLVRLELDEAKQRLLFGFFETYLRLSEEEEAKLRNEVSQ
FT                   METKEAKRVMELIVSYEQRGMEKGIQKGIELGIKQGMKQGMKQGRQQGIEEGKLDVVKR
FT                   MMAKGYDVDTIHELTGLPVEKIERVKG"
FT   gene            686625..686818
FT                   /pseudo
FT                   /locus_tag="GC56T3_0640"
FT   gene            686996..687165
FT                   /pseudo
FT                   /locus_tag="GC56T3_0641"
FT   gene            complement(687283..688530)
FT                   /locus_tag="GC56T3_0642"
FT   CDS_pept        complement(687283..688530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0642"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   gka:GK2851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25689"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADI25689.1"
FT                   /translation="MKKKSFHFLWIGQSFANFGDVFYIVSVVSYLYHLTSKAMAAALVP
FT                   FFVTLSLFISGIVAPIFFENYKLKTLLSYGQMCKTFLLLFLSLFLHWGAEHYTAIVYVF
FT                   VSLIAFLDGITNPIKNSLVPFIVSEEEILKANSFVNTLDQFIKFSAWPIGSLIVSAGSP
FT                   FLLINITLLFYIVSSILMFLLPIQEHTKKNTVQDKGLKNFLLSIRLGWEYTWRNVHAKS
FT                   ISFMSFFEGIGNGVWISAILYMYVKEQLHVGEEWWGYINSVFFGGMVIGGLLSVTFSQS
FT                   VEKNQQFFVLFGPFCIAIVTLLFGTTTHGALALLYSALYGIIEQWKVICLQTILQKNAR
FT                   MDALPHVFAVQGVISSVTFGISSLLMGFIADVYGIRFSFYLSVCCFLTSGWISYRQRKI
FT                   WSFDTGLTQKSGNASI"
FT   gene            complement(688909..690495)
FT                   /locus_tag="GC56T3_0643"
FT   CDS_pept        complement(688909..690495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0643"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /note="KEGG: gyc:GYMC61_0658 phosphoenolpyruvate
FT                   carboxykinase (ATP); TIGRFAM: phosphoenolpyruvate
FT                   carboxykinase (ATP); PFAM: phosphoenolpyruvate
FT                   carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25690"
FT                   /inference="protein motif:TFAM:TIGR00224"
FT                   /protein_id="ADI25690.1"
FT                   /translation="MGIANMTNKLDVLLQKPYVHHQLSVAELVEKVLQRNEGRLTHTGA
FT                   VAVTTGKYTGRSPKDKYIVEEPSTKQTIDWGAVNQPMSPETFDKLYDKVLDYLMKKDEL
FT                   FVFKGFAGADPKYRLPIQVVNEFAWHNLFVHQLFIRPNAEELAAHEPQFTVICAPNFKA
FT                   DPKVDGTRSEAFIIISFERRTVLIGGTEYAGEMKKSIFSVMNYLLPEQGILPMHCSANV
FT                   GQEGDVALFFGLSGTGKTTLSTDPNRRLIGDDEHGWSSRGIFNIEGGCYAKCINLSREK
FT                   EPQIFDAIGFGAVLENVVLDDATRVPNYDDGTLTENTRAAYPLQAIQNIIDPSVAGHPS
FT                   TIVFLTADAFGVLPPISKLTREQAMYHFLSGYTSKLAGTERGVTEPEATFSTCFGAPFL
FT                   PRPAVEYAEMLGQKIAEHNVRVFLVNTGWTGGPYGVGSRMKLAYTRAMVQAAVEGELDN
FT                   VETVQDPIFGLAIPTHVPGVPDDVLQPQNTWADKQAYEQKAKELAQKFRANFQKFAHID
FT                   PSIEKLGGPLV"
FT   gene            690958..692169
FT                   /locus_tag="GC56T3_0644"
FT   CDS_pept        690958..692169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0644"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="TIGRFAM: S-adenosylmethionine synthetase; KEGG:
FT                   gka:GK2849 S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25691"
FT                   /inference="protein motif:TFAM:TIGR01034"
FT                   /protein_id="ADI25691.1"
FT                   /translation="MSAKRRLFTSESVTEGHPDKICDQISDAILDAILEKDPNARVACE
FT                   TSVTTGLVLVSGEITTSTYVDIPRIVRDTVREIGYTRAKYGFDADTCAVLTSIDEQSPD
FT                   IAMGVDRALEAREGQMTDEEIEAIGAGDQGLMFGFACNETEELMPLPISLAHRLARRLA
FT                   EVRKTDVLPYLRPDGKTQVTIEYDENGKPVRVDTIVVSAQHHPEITQEQIQRDIKEQVI
FT                   KPVVPAELLDENTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKD
FT                   PTKVDRSAAYAARYVAKNIVAAGLADKCEVQLAYAIGVARPVSISIDTFGTGKVSEDIL
FT                   IEVVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDIDLPWERTDKAALLKEQALA
FT                   LADK"
FT   gene            complement(692192..692740)
FT                   /locus_tag="GC56T3_0645"
FT   CDS_pept        complement(692192..692740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0645"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: gyc:GYMC61_0660 transferase hexapeptide
FT                   repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25692"
FT                   /inference="protein motif:PFAM:PF00132"
FT                   /protein_id="ADI25692.1"
FT                   /translation="MIYPYKGKTPQIAASAFIADYVTITGDVVIGEETSIWFNTVIRGD
FT                   VAPTVIGNRVNIQDNSILHQSPNNPLIIEDGVTVGHQVILHSAIVRKNALIGMGSIILD
FT                   RAEIGEGAFIGAGSLVPPGKKIPPNTLALGRPAKVVRELTEDDIREMERIRREYVEKGQ
FT                   YYKALQQQRTSCANKKELP"
FT   gene            693079..694188
FT                   /locus_tag="GC56T3_0646"
FT   CDS_pept        693079..694188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0646"
FT                   /product="Protein of unknown function DUF2600"
FT                   /note="PFAM: Protein of unknown function DUF2600; KEGG:
FT                   gyc:GYMC61_0661 protein of unknown function DUF2600"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25693"
FT                   /inference="protein motif:PFAM:PF10776"
FT                   /protein_id="ADI25693.1"
FT                   /translation="MVFAPEVSRLNIPKNPIALMKMVYRDVLPLVHRELAYWRRQAERI
FT                   PDPELRRQALASIASKTFHCEGGSILALLAGENMEDCIRFIVAYQTISDYLDNLCDRST
FT                   SLDPLDFRALHDSMPDALTIGAEPSNYYRHRREQEDGGYLPALVRTCQKVLETVRHYET
FT                   IAPFLHELAGYYCDLQVHKHVEASERVPRLEKWFAQYKDALPPMEWYEFSACSGSTLGI
FT                   FCLVAYAFGESLPPEMARQVRDGYFPYIQGLHILLDYLIDQEEDRDGGDLNFCFYYPNE
FT                   TVMLERLCHFIEEADRHVGALPHGEFHRLIHRGLLGLYLSDAKVKKQRGLRRLARRLVR
FT                   AGGAASQFFYWNGKAYRFWQERQKRLSFS"
FT   gene            complement(694236..694823)
FT                   /locus_tag="GC56T3_0647"
FT   CDS_pept        complement(694236..694823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0647"
FT                   /product="putative rRNA methylase"
FT                   /note="PFAM: putative rRNA methylase; KEGG: gyc:GYMC61_0662
FT                   putative rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25694"
FT                   /inference="protein motif:PFAM:PF06962"
FT                   /protein_id="ADI25694.1"
FT                   /translation="MALMNILPFARFLLDQAVNEGDIAVDATVGNGHDTVYLAERVGET
FT                   GHVFGFDIQPEAITAASARLAEHGLCGRATLFERSHSELLEALPADVHGRIAGAVFNLG
FT                   YLPGGNKQIVTQPESTIEAVRQLLSVMKPGGVIVLVVYHGHPEGKRERDALLDYVRSLD
FT                   QRRVHVLKYEFINRQNNPPFLLALETRADKGA"
FT   gene            695252..695515
FT                   /locus_tag="GC56T3_0648"
FT   CDS_pept        695252..695515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0648"
FT                   /product="Protein of unknown function DUF2524"
FT                   /note="PFAM: Protein of unknown function DUF2524; KEGG:
FT                   gyc:GYMC61_0663 protein of unknown function DUF2524"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25695"
FT                   /inference="protein motif:PFAM:PF10732"
FT                   /protein_id="ADI25695.1"
FT                   /translation="MATRQSVEEFLQRCEDVIRYAKEQYTEAQKQEHYNITEYTNAQQM
FT                   LEQTVIDLAHLARSCNAQQREQLHRMRLQLEQLQNDMILLDR"
FT   gene            695534..695698
FT                   /locus_tag="GC56T3_0649"
FT   CDS_pept        695534..695698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0649"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_0664 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25696"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0664"
FT                   /protein_id="ADI25696.1"
FT                   /translation="MKRRLKQTNPEQKTPSGQNNNDLELGQDFDPVKLAKKQYEETGGQ
FT                   PIRSKQRNG"
FT   gene            695909..697108
FT                   /locus_tag="GC56T3_0650"
FT   CDS_pept        695909..697108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0650"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   gyc:GYMC61_0665 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25697"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADI25697.1"
FT                   /translation="MPRALWWLLVGMALNVTGASFLWPLNTIYLHEQLGQPLAVAGVVL
FT                   MLNAGGSVIGSLAGGFLFDRIGGFRVLLAGAVLTMAALAGLSVWHGWPHYAVFLAFVGV
FT                   GSGVVFPAASAYAGAIWPEGGRRAFNALYVAQNIGVAVGSALGGLVASYSFSLVFFANL
FT                   LLYAAFLFTVVAGLRRVPLPPRRKKEREGRTGDEASRAHIRALVLLCAGYGLCWLSYVQ
FT                   WSTTIAAYTRELGIPVGQYSLLWTINGALIVLAQPLLSAVIRRFMPTLKRQIVIGFLIF
FT                   AVSFAMLLGAHSFAEFAASMIVLTIAEMIVWPAIPAAVNEWAPPGKAGLYQGIVNGTAT
FT                   AGRMIGPVIGGSVADLFGMKLLIMMLALFALLAVLAALLHDRRLSKRTENADEKTAASV
FT                   "
FT   gene            697496..699913
FT                   /locus_tag="GC56T3_0651"
FT   CDS_pept        697496..699913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0651"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="KEGG: gyc:GYMC61_0666 leucyl-tRNA synthetase;
FT                   TIGRFAM: leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25698"
FT                   /inference="protein motif:TFAM:TIGR00396"
FT                   /protein_id="ADI25698.1"
FT                   /translation="MSFNHREIEQKWQDYWEKNKTFRTPDDDDKPKFYVLDMFPYPSGA
FT                   GLHVGHPEGYTATDILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNI
FT                   DNFRRQIKSLGFSYDWDREINTTDPNYYKWTQWIFLKLYEKGLAYMDEVPVNWCPALGT
FT                   VLANEEVINGRSERGGHPVIRKPMRQWMLKITAYADRLLEDLEELDWPESIKEMQRNWI
FT                   GRSEGAEIEFAVDGHDETFTVFTTRPDTLFGATYTVLAPEHPLVEKITTPEQKPAVDAY
FT                   LKEIQSKSDLERTDLAKEKTGVFTGAYAIHPVTGARLPIWIADYVLMSYGTGAIMAVPA
FT                   HDERDYEFAKKFHLPMKEVVAGGNIEKEAYTGDGEHINSEFLNGLNKQEAIDKMIAWLE
FT                   EHGKGRKKVSYRLRDWLFSRQRYWGEPIPIIHWEDGTMTPVPEEELPLVLPKTDEIRPS
FT                   GTGESPLANIEEWVNVVDPKTGKKGRRETNTMPQWAGSCWYYLRYIDPHNDKQLADPEK
FT                   LKKWLPVDVYIGGAEHAVLHLLYARFWHKFLYDLGIVPTKEPFQKLFNQGMILGENNEK
FT                   MSKSKGNVVNPDDIIESHGADTLRLYEMFMGPLEASIAWSTKGLDGARRFLDRVWRLFV
FT                   TENGELNPNIVDEPANDTLERIYHQTVKKVTEDYEALRFNTAISQLMVFINEAYKAEQM
FT                   KKEYMEGFVKLLSPVCPHIGEELWQKLGHTDTIAYEPWPTYDETKLVEDVVEIVVQING
FT                   KVRSRLHVPVDLPKEALEERALADEKIKEQLEGKTVRKVIAVPGKLVNIVAN"
FT   gene            699971..700285
FT                   /locus_tag="GC56T3_0652"
FT   CDS_pept        699971..700285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0652"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: gyc:GYMC61_0667 rhodanese domain protein;
FT                   PFAM: Rhodanese domain protein; SMART: Rhodanese domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25699"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADI25699.1"
FT                   /translation="MEEIKEITPAEVKEKLERGEKLNIVDVREDEEVALGMIPGAKHIK
FT                   MGDIPDRLEEFDRNEEYIFVCRSGRRSENVCRYLQELGYRVRNMTGGMLEWEGETVPKR
FT                   "
FT   gene            700630..701904
FT                   /locus_tag="GC56T3_0653"
FT   CDS_pept        700630..701904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0653"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: gyc:GYMC61_0668 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; TPR
FT                   repeat-containing protein; SMART: helix-turn-helix domain
FT                   protein; Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25700"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADI25700.1"
FT                   /translation="MKLGDRLKFARLMKGLTQEETAEGIISVSYLSKIENNQVIPSQEV
FT                   LEWLFRRLDIRPGGNETMPSWFEWVMSWYKAMTNRDVPAAREMYETVKERCEQSGDAEA
FT                   MIYFQLMRIRYLLLLGDKKGAETAAQSVRDWYGSLSDDMRYYYWKFFGLLYYCQEKYDD
FT                   ALHCCKKAEELLKGEWKTSGEEADLAYLSALACSRLWKWFQCLHYAERALTLSQAEYDL
FT                   RRSAECHVLLAICYRRCGEIDKAVDHCLLAQKAARMVDDRRLLGIVEHNLGHLKGMKRQ
FT                   YREAVQHYENSLIYKEDAPLDARLITLLSLVRVHCDAKHYRKASMAVEEGWKQLEQAPN
FT                   GASEHYEYYLHFSIYRLLLSEEDEPLERLLKQEAIPYFQKKKEYDDASLYAEYLADCYM
FT                   RRRQYKQAAQYYQLSCSLLRTQTGV"
FT   gene            701920..702048
FT                   /locus_tag="GC56T3_0654"
FT   CDS_pept        701920..702048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0654"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_0669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25701"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0669"
FT                   /protein_id="ADI25701.1"
FT                   /translation="MKKRVVVIVALAILGLASALGQGIGVKEAAKDEHPPPTVIAR"
FT   sig_peptide     701920..701985
FT                   /locus_tag="GC56T3_0654"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.804 at
FT                   residue 22"
FT   gene            702428..704068
FT                   /locus_tag="GC56T3_0655"
FT   CDS_pept        702428..704068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0655"
FT                   /product="Thermolysin"
FT                   /EC_number="3.4.24.27"
FT                   /note="KEGG: gyc:GYMC61_0670 thermolysin; PFAM: peptidase
FT                   M4 thermolysin; Peptidase M4 thermolysin; Propeptide
FT                   peptidase M4 and M36; Propeptide PepSY amd peptidase M4"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25702"
FT                   /inference="protein motif:PRIAM:3.4.24.27"
FT                   /protein_id="ADI25702.1"
FT                   /translation="MNKRAMLGAIGLAFGLMAWPLGASAKERSMVWNEQWKTPSFVSGP
FT                   LLKGEDAPEELVYRYLDQEKNTFQLGGQARERLSLIGKQTDELGHTVMRFEQRYHGIPV
FT                   YGAVLVAHVNDGELSSLSGALIPNLDKRTLKTEAAISVQQAEMIAKQDVADAVTKERPA
FT                   AEEGKPTRLVIYPDGETPRLAYEVNVRFLTPVPGNWIYMIDAADGKVLNKWNQMDEAKP
FT                   GGGQPVAGASTVGVGRGVLGDQKYINTTYSSYYGYYYLQDNTRGSGIFTYDGRNRTVLP
FT                   GSLWADGDNQFFASYDAAAVDAHYYAGVVYDYYKNVHGRLSYDGSNAAIRSTVHYGRGY
FT                   NNAFWNGSQMVYGDGDGQTFLPFSGGIDVVGHELTHAVTDYTAGLVYQNESGAINEAMS
FT                   DIFGTLVEFYANRNPDWEIGEDIYTPGIAGDALRSMSDPAKYGDPDHYSKRYTGTQDNG
FT                   GVHTNSGIINKAAYLLSQGGVHYGVSVTGIGRDKMGKIFYRALVYYLTPTSNFSQLRAA
FT                   CVQAAADLYGSTSQEVNSVKQAFNAVGVY"
FT   sig_peptide     702428..702505
FT                   /locus_tag="GC56T3_0655"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.917 at
FT                   residue 26"
FT   gene            704049..704363
FT                   /locus_tag="GC56T3_0656"
FT   CDS_pept        704049..704363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0656"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2740 YteV"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25703"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI25703.1"
FT                   /translation="MRLECIKTNEVSDVTRPAIRGRVTPFVGRIFPKCVEKEKENGGMA
FT                   MYKVKVFDKEHEKDLEAAVNDFLARLKDGQLIDVKYSVAAMESEGEQIYCFSAMVIYRT
FT                   "
FT   gene            complement(704557..705867)
FT                   /locus_tag="GC56T3_0657"
FT   CDS_pept        complement(704557..705867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0657"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: HI0933 family protein; KEGG: gka:GK2836
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25704"
FT                   /inference="protein motif:PFAM:PF03486"
FT                   /protein_id="ADI25704.1"
FT                   /translation="MGYDVIIIGGGPSGLMAAIGAGEEGAKVLLLEKGTKLGRKLAISG
FT                   GGRCNVTNRLPVDEIVRHIPGNGRFLYSAFSVFNNEDIIRFFERLGVPLKEEDHGRMFP
FT                   KSDSAQSVVDALVRELSRLGVDVRLESPVAEVLYEQGKTVGVTLKSGETIHARAVVVAV
FT                   GGKSVPQTGSTGDGYPWAEKAGHTVTELFPTEVPIVSHEPFIKERTLQGLSLRDVALSV
FT                   LKPNGKPIITHRMDMLFTHFGISGPAALRCSQFVVKALKKAADGAVEMSIDALPDVTQE
FT                   ELFQHFAKLCKEEPKKAMKTIAKTVLPERYAVFLLERAGIDPHASAGTVGHEALRAFVR
FT                   QCKQFTFYVHGTLPLEKAFVTGGGVSVKEIEPKTMASKCMAGLYFCGEILDIHGYTGGY
FT                   NITAALVTGRLAGVNAARYALAEKNGASGSAGQTATN"
FT   gene            705980..707605
FT                   /locus_tag="GC56T3_0658"
FT   CDS_pept        705980..707605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0658"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   gyc:GYMC61_0673 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25705"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADI25705.1"
FT                   /translation="MSTSKLLRGTFILTAGVMISRLLGLFYVIPFYHLVGERGGALYGY
FT                   GYVPYQIFLSLATGGLPVAVSKFVSKYNALGEYGVGYRLFRSGLVLMIASGIASWLILY
FT                   ALAPILAPHVIDAKTNVNSVDDVTAVIRAVSFALLIVPVMSLIRGFFQGHESMGPTALS
FT                   QVVEQIARIAFLLGACYVILRLMDGSIVSAVSAATFAAFVGAAAGLLVLLVYWWKRRPY
FT                   LQSLLARDRGEADVSLLAMYKELLLSSIPFVFVGLSMSLYQLVDQFTFNHAMAAAGRGN
FT                   ISEHAYSVFNMWAQKLVIIPVTLATSFSLALIPTITKAYVAQDRKALRQYLNQTFQVLM
FT                   FLTLPAVIGMAVLAGPVYSSFYSYDPLGEQVLRWYAPAAILYALFSVTAAIMQGINEQR
FT                   FTVVSLTAGLLVKLLLNTPLIMKWSAVGAIVATMAGYFVSVAFNLWVIQRRTRYRYRFV
FT                   ARRTAFMAILTAAMSAAVMGVEALASRWIDYRAGTAESVGAVSIGAAVGAAVYLFLSIR
FT                   SGLFSALFGDRFAFWRRKEKKAVS"
FT   gene            complement(707958..708170)
FT                   /locus_tag="GC56T3_0659"
FT   CDS_pept        complement(707958..708170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0659"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_0674 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25706"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0674"
FT                   /protein_id="ADI25706.1"
FT                   /translation="MNEYYYYVPTLDDYRQQPPASQFWPGYPGGPFANWARRIERLERA
FT                   VERLDRRLDRVESRLDRIERRLGLS"
FT   gene            708275..709021
FT                   /locus_tag="GC56T3_0660"
FT   CDS_pept        708275..709021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0660"
FT                   /product="pseudouridine synthase"
FT                   /note="KEGG: gyc:GYMC61_0675 pseudouridine synthase; PFAM:
FT                   pseudouridine synthase; RNA-binding S4 domain protein;
FT                   SMART: RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25707"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ADI25707.1"
FT                   /translation="MELRIDKLLAHMGYGTRKEVKKLLKSGAVKVDGAPVRDAKTKVRP
FT                   DEQIVTVWGETVEYKPFIYLMMNKPSGVVSATEDAVEETVVDFLEEEDRAFSPFPVGRL
FT                   DKDTEGLLLLTNDGQLAHQLLSPKKHVPKTYFAVVDGEVTEADVAAFQRGVVLDDGYET
FT                   KPAKLVVLKSGLRSDVEVTITEGKFHQVKRMFQAVGKRVVYLKRIQMGPLALDPDLAVG
FT                   EYRELTDEEVDMLKQYRPETDEKKGT"
FT   gene            complement(709117..709338)
FT                   /locus_tag="GC56T3_0661"
FT   CDS_pept        complement(709117..709338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0661"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="KEGG: gyc:GYMC61_0676 transcriptional regulator,
FT                   DeoR family; PFAM: regulatory protein DeoR; SMART:
FT                   regulatory protein DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25708"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ADI25708.1"
FT                   /translation="MKPSTHRMLTRIKSVYMYISEKGTVTTQELVDEFGTTPRTIQRDL
FT                   NVLMYNDLVRSPSKGKWTTTNKKVRISS"
FT   gene            709589..711004
FT                   /locus_tag="GC56T3_0662"
FT   CDS_pept        709589..711004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0662"
FT                   /product="dipeptidase"
FT                   /note="KEGG: gyc:GYMC61_0677 dipeptidase; TIGRFAM:
FT                   dipeptidase; PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25709"
FT                   /inference="protein motif:TFAM:TIGR01887"
FT                   /protein_id="ADI25709.1"
FT                   /translation="MALNIDWMNEAKKRKDDLVRDVQALVRIPSVRDDQQAQPGAPFGP
FT                   KVAEALEHMLRRGREEGFRVKNVDGFAGHIEMGHGEKLVGVLGHIDVVPPGDGWTMDPF
FT                   AAEVRDGRLYGRGAIDDKGPTVAAFYAMKIIRDLGLPLGKRVRLIIGGDEESDWRCVEH
FT                   YFRHEEMPDVGFAPDADFPIIHAEKGIIDADLAYRPLESAEAEGLALASFRAGRRYNMV
FT                   PDAAEAVVEGAGRTEELLGLYEQFCRERGVKGSIRQSEGAVVFQLEGVSAHGAEPERGK
FT                   NAGVYLAQFLASLPLDGRSRPFIQFVASAFFGDARGRRLGLAYRDEQSGDLTVNVGVLS
FT                   YDRQHGGTIGLNIRYPVTADGEAIRRTLAGAAAEHGFALSRFSDTKPHYIDPSHELVRT
FT                   LQRVYEEQTGEPAQLLAIGGGTYARALTAGVAFGALFPGRPDVAHQKDEYIEIDDLVKA
FT                   TAIYAQAIYELAK"
FT   gene            711073..712257
FT                   /locus_tag="GC56T3_0663"
FT   CDS_pept        711073..712257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0663"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   gyc:GYMC61_0678 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25710"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADI25710.1"
FT                   /translation="MEAAFKREAAVRKQVFPLFYFLIFFAFGALFPLLSVYLQEEARLS
FT                   GAAIGWIMSLPPIVTMAAQPLWGTAADYTRKPVELLTLALGVTALFGLLYSLAGSYRVF
FT                   VALTVLLSAMQSAIVPLSDSIALHHVRRSGGNYGAIRLWGSIGFAAAVLVVGWLSDHVA
FT                   FAVIFYAFSLALLAALVLAARLPRYPMAAPGALTLRDVRRLLSVRSFQLLLVATFLLFG
FT                   PILANNSYFGLLIHELGGTLTGIGLAFLFAAGSEAPFMKAADRLIGRFGMVRLLLLAAL
FT                   ISAVRWLSYAVDPPLWFVYVTTVVQGCSVGLAIPTALQYARRLAPERVQATAVALYSAV
FT                   GNGLGAWFCTLVGGYLFERWQIGAVYLFFSICTIVGVLVLLLLAKRERTAGEEK"
FT   gene            712254..712832
FT                   /locus_tag="GC56T3_0664"
FT   CDS_pept        712254..712832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0664"
FT                   /product="2'-5' RNA ligase"
FT                   /note="KEGG: gyc:GYMC61_0679 2'-5' RNA ligase; TIGRFAM:
FT                   2'-5' RNA ligase; PFAM: Phosphoesterase HXTX"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25711"
FT                   /inference="protein motif:TFAM:TIGR02258"
FT                   /protein_id="ADI25711.1"
FT                   /translation="MKRSHYFIAVPLTSEAKQAIARFSGDAASSLPFRTWVHEEDYHIT
FT                   LAFLGDVPPKKMAPLCEAMAAVAAKSAPFSLALAGLGTFGERTAPRVFWQGVETEEALN
FT                   GLRRDVYEACMKLGFSLDRRPFAPHITIARKWQGAEPFRPDRLRSLAAAKAVFSVPEIV
FT                   LYRTNMERTPKYEAIAVFPLLGAPMNGRK"
FT   gene            712844..713782
FT                   /locus_tag="GC56T3_0665"
FT   CDS_pept        712844..713782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0665"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_0680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25712"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0680"
FT                   /protein_id="ADI25712.1"
FT                   /translation="MGQLVKLMDCISRYETDVYYYVPEFIRLKQRQWEQAKARWQAERT
FT                   AEASGWLETGETWDVWLDKPSWWERLTKRWRRRAALTEEETFSLAPMARPAATLEELKQ
FT                   QFLDELFELQLKWASSTMMYVSSLDEAVYGDETLKYFLQRFPDTHLCFYRPVAMVGKAP
FT                   VELETMMLTPSALWCIAFVEGRPDNIVMASTGRFWVEQAGTNETRLVNPVVSLRRTEQI
FT                   VSEIFCKHGVDWPIHLVLLNRSGYIDSGGLFPFIRYIDKRNYDEWFSRLRRSALPLRHG
FT                   QLKAAEALLRHCASFYDRRQDENMNSEEGQQ"
FT   gene            713884..716040
FT                   /locus_tag="GC56T3_0666"
FT   CDS_pept        713884..716040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0666"
FT                   /product="pullulanase, type I"
FT                   /note="TIGRFAM: pullulanase, type I; PFAM: glycoside
FT                   hydrolase family 13 domain protein; alpha amylase catalytic
FT                   region; KEGG: gyc:GYMC61_0681 pullulanase, type I; SMART:
FT                   alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25713"
FT                   /inference="protein motif:TFAM:TIGR02104"
FT                   /protein_id="ADI25713.1"
FT                   /translation="MLHISRTFAAYLDEMDQIVVLAPKSLGFDGMAPFTLVAPSGEEIP
FT                   LSVQHVEDVGETVKYVCRFASAFEFGATYWVRSCRGEETDVQIGAVVRTPAFDDRFFYD
FT                   GPLGAEYFKEQAVFRVWAPTATAVSVKLVHPHLGEIRCVPLERGERGVWSAAVPGDWER
FT                   ARYTYIACINRVWREAVDPYATAVSINGEFGVVIDWEKTKLAPPSSPLPPLCSPTDAII
FT                   YELSIRDFTSHPDSGAVHKGKYLGLAETNTSGPNGTATGLSYVKELGVTHVQLMPFTDF
FT                   AGVDERDPQAAYNWGYNPLHLYAPEGSYATDPADPYARIIELKQAICTLHESGLRVVMD
FT                   AVYNHVYDREQSPLEKLVPGYYFRYDAYGQPANGTGVGNDIASERRMARRWIVDSVVFW
FT                   AKEYGIDGFRFDLMGVHDIETMKAVRDALDAIDPSILVYGEGWDLPTPLPPEQKATMAN
FT                   AKQLPRFAYFNDRFRDAVKGSTFHLPDRGFALGNPGGREQVKLAIAGSLRALGGLFCHP
FT                   RQSINYVECHDNHTFWDKMEAANHDEPEWLRRKRQKLATAIVLLAQGIPFLHSGQEFYR
FT                   TKGGDGNSYRSPDAVNQLDWERKSRYEDDVRYVQGLIALRRAHGAFRLATEAEVLRHFT
FT                   FLEPLPPSVIAYRLHDVAVYGPWEDIIVVHHNEEKETAIALPDEREWAVVCDGQRCGTT
FT                   PFGQARGMLRLDGVGTWVLVQPAG"
FT   gene            716349..717131
FT                   /locus_tag="GC56T3_0667"
FT   CDS_pept        716349..717131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0667"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   gyc:GYMC61_0682 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25714"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADI25714.1"
FT                   /translation="MEQLLGKEWEITPAGGATGDAYFAEYEGKKLFLKRNSSPFLAVLS
FT                   AEGIVPKLVWTKRLENGDVFTAQQWLNGRELKPWEMGSEQVAALLRKIHRSKELVTMLK
FT                   RLGKSPLRAKKMLALLAEQQRRHPAGGSVVCQALDWLEQHVSSLPDGEYVVCHCDINHN
FT                   NWLLADDGTLYLVDWDGAMIADPAIDIGMLLHLYIPRVEWEAWLDRYGWAWSEELGLRL
FT                   KWYTIAHTLHSLFWPKGKDGEKEKKQSLRLLERVITEH"
FT   gene            complement(717275..717544)
FT                   /locus_tag="GC56T3_0668"
FT   CDS_pept        complement(717275..717544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0668"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_0683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25715"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0683"
FT                   /protein_id="ADI25715.1"
FT                   /translation="MPLDHNHQLTVLRDILSEHQLDCCGTVSECEQIERLAKSLLANDE
FT                   VNSQVKQILPHIYAYGQGGKYSADLNAHISAHQGQLADWLNELS"
FT   gene            717693..718346
FT                   /locus_tag="GC56T3_0669"
FT   CDS_pept        717693..718346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0669"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /note="KEGG: gka:GK2823 hypothetical protein; TIGRFAM: tRNA
FT                   (guanine-N(7)-)-methyltransferase; PFAM: putative
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25716"
FT                   /inference="protein motif:TFAM:TIGR00091"
FT                   /protein_id="ADI25716.1"
FT                   /translation="MRLRNKPWAKDKIAAYPQYVIPDPETKRGRWRELFGCDRPIHVEI
FT                   GTGKGKFITEMAKLHPDVNFIGIELYPSVLVSALDKLIESGLANVKLLNANAKDLTAFF
FT                   ADGEVSRIYLNFSDPWPKKRHEKRRLTYRDFLALYDRILAEDGDIHLKTDNQSFFEYSL
FT                   VSLSQYGFVLASVQLDLHQSGMTDNVMTEYEEKFSVKGNRIYRCEAVRPPRRSS"
FT   gene            718427..719275
FT                   /locus_tag="GC56T3_0670"
FT   CDS_pept        718427..719275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0670"
FT                   /product="beta-lactamase domain protein"
FT                   /note="KEGG: gyc:GYMC61_0685 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25717"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0685"
FT                   /protein_id="ADI25717.1"
FT                   /translation="MEQLRIGQVTLTWLQGGVTHLDGGAMFGVVPKPLWSKKYPPNDNN
FT                   QIELRTDPILVEAYGKRLLIESGIGNGKLTDKQKRNFGVTEESAIDESLAGLGLTRRDI
FT                   DIVIMTHLHFDHACGLTVWEDGRLVPAFPRAAIITSDVEWEEMRNPNIRSRNTYWKENW
FT                   EPIADQVVPFTKETEVVPGIRLVHTGGHSAGHAIVLIESDGEMAIHLGDLLGTHAHQNV
FT                   LWVMAYDDYPMDSIFAKQRWLPYGVKQNAWFTFYHDAYYRAVKWQEDGTMAAAVKRERP
FT                   L"
FT   gene            complement(719270..719569)
FT                   /locus_tag="GC56T3_0671"
FT   CDS_pept        complement(719270..719569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0671"
FT                   /product="Propeptide PepSY amd peptidase M4"
FT                   /note="PFAM: Propeptide PepSY amd peptidase M4; KEGG:
FT                   gka:GK2821 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25718"
FT                   /inference="protein motif:PFAM:PF03413"
FT                   /protein_id="ADI25718.1"
FT                   /translation="MAWKKWLVGAAVGAAAIYAIRSASKPALLSPEQALALAKAALGGP
FT                   RAIRGSWIQSAPERYEKNGLAYTVYRGGVCRDDGDDEFFINAYTGAIVDAKPLS"
FT   sig_peptide     complement(719495..719569)
FT                   /locus_tag="GC56T3_0671"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.872) with cleavage site probability 0.452 at
FT                   residue 25"
FT   gene            719682..720761
FT                   /locus_tag="GC56T3_0672"
FT   CDS_pept        719682..720761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0672"
FT                   /product="Glutamyl aminopeptidase"
FT                   /EC_number="3.4.11.7"
FT                   /note="KEGG: gyc:GYMC61_0687 glutamyl aminopeptidase; PFAM:
FT                   peptidase M42 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25719"
FT                   /inference="protein motif:PRIAM:3.4.11.7"
FT                   /protein_id="ADI25719.1"
FT                   /translation="MMKEETLRLFQTLTELPGAPGYEHPVRQFMRQELAKYADDIVQDR
FT                   LGSLFGVKRGDEAGPTVMVAGHMDEVGFMVTAITDNGMIRFQPLGGWWDQVLLSQRVQI
FT                   ITDGGPVIGVIGSIPPHLLDEEQRKKPMEMKNMLIDIGAESREDAERVGVRPGQPIVPV
FT                   SPFTVLANGKTVMAKAWDNRFGCGLAIELLKELNGETVPNVLYAGATVQEEVGLRGAQT
FT                   AAAMINPDIFFALEASPANDMSGDKQAFGHIGKGALIRLYDRTMITHRGMREFVLDTAE
FT                   TIGVPYQFFISPGGGTDAGRVHIANRGVPSAVIGICARYIHTHASIIHVDDYAAAKQLI
FT                   VELVKRCDRTTVETIRQNS"
FT   gene            720807..721337
FT                   /locus_tag="GC56T3_0673"
FT   CDS_pept        720807..721337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0673"
FT                   /product="protein of unknown function DUF84"
FT                   /note="PFAM: protein of unknown function DUF84; KEGG:
FT                   gyc:GYMC61_0688 protein of unknown function DUF84"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25720"
FT                   /inference="protein motif:PFAM:PF01931"
FT                   /protein_id="ADI25720.1"
FT                   /translation="MKTVAVGTNNEAKIAAVRAVLSEKEYRIVSLEVPSGVSAQPLSDE
FT                   ETRLGAIRRAKRALEAAEADIGIGLEGGVTKIDGQWWLCNWGALADRNGVVVAAAGARL
FT                   TLPPDVGAGIEAGRELGDVMEAYTGRRNVRRKEGAVGVLTNGRVDRSAMFSHIVELLAG
FT                   QYEWLCQNGSFHV"
FT   gene            721565..722362
FT                   /locus_tag="GC56T3_0674"
FT   CDS_pept        721565..722362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0674"
FT                   /product="protein of unknown function DUF1444"
FT                   /note="PFAM: protein of unknown function DUF1444; KEGG:
FT                   gka:GK2818 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25721"
FT                   /inference="protein motif:PFAM:PF07285"
FT                   /protein_id="ADI25721.1"
FT                   /translation="MNSRQMYEKIKERLVAHRHWTFRFDPKQDAMRVEDRRTKKGVTIS
FT                   LPGVIAKWHEQKDEAVREVVYYVEQTLKTMEEDAALSGNERNIYPVIRSASFPTETKEG
FT                   IPLLFDDHTAETRIYYALDLGKTYRLIDERMLEKDKWSRERVKEIARFNVRSLPTPVKE
FT                   DRVADNVFYFLNTNDGYDASRILNESFLADMRARVEGTMAVAVPHQDVLIIADVRNDIG
FT                   YDVLAQMTMSFFAGGRVPITALSFLYENGKLEPIFILGKKRRT"
FT   gene            722383..722988
FT                   /locus_tag="GC56T3_0675"
FT   CDS_pept        722383..722988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0675"
FT                   /product="t-RNA-binding domain protein"
FT                   /note="PFAM: t-RNA-binding domain protein; KEGG: gka:GK2817
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25722"
FT                   /inference="protein motif:PFAM:PF01588"
FT                   /protein_id="ADI25722.1"
FT                   /translation="MNVFYNREGVGDVLLVSLKPAADEERTFVRQGDVVRIMSERTGET
FT                   VGYNIFSASSYYPFSGNGPLEVNEELVGVINDILAKNGFDEPIEADLSPKFVVGYVKEK
FT                   TKHPNADKLSVCQVDVGGEVLQIVCGAPNVAEGQKVVVAKIGAVMPNGLVIQESELRGV
FT                   RSSGMICSARELGLPNAPQEKGILVLSDEYEVGQPFVF"
FT   gene            723095..725446
FT                   /locus_tag="GC56T3_0676"
FT   CDS_pept        723095..725446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0676"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; DNA translocase
FT                   ftsK gamma; KEGG: gyc:GYMC61_0692 cell
FT                   divisionFtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25723"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ADI25723.1"
FT                   /translation="MKFWKRWLRFLTSDEEEEGNEQRANSPLSADTPERGAVNVIYQYP
FT                   QGRFRFPLIPDDQPGENRERPRRAKSEASRPLPSRRSSAGVSREIAEKRPFRPSDVPSP
FT                   VFGYDRNRGKQRQRADEPELTAGGMENRSDEAVREEALRGEATRRDAREGTESRAAEPP
FT                   KEEAPLAKGAEEWNEDASGAMPAAVMETEGKHELAPAAGQEERDAEADEKKGQELDERG
FT                   NERAPHATDGGLESEGRGVPSQMRNGDGGRASSTEQREKTPDREIRHSAASAGRKEASR
FT                   PERTRIPYNVIMLKQDWRKLEEKAANRSNGCVLPPLALLEPPEKAAERDEQWLRDQCQR
FT                   LDRTFASFHIGAKVVGATQGPTVTRFEVQPDLGVKVSKITSLIDDIKLSLAAKDIRIEA
FT                   PIPGKRTIGIEVPNRTSRPVRLREILESEAFRKSPSPLTVALGLDISGAPVVTDIRKMP
FT                   HGLIAGATGSGKSVCMNAMLISMLYKAAPHEVKWLLIDPKMVELAPYNGLPHLLSPVIT
FT                   EAKAAAGALKWAVGEMERRYEQFVHAGVRDIEKYNAHLRERGSSEPPLPYIVIVIDELA
FT                   DLMMAAPADVEESICRLAQKARACGIHLLIATQRPSVDVLTGLIKANIPTRIAFSVSSQ
FT                   VDSRTILDVNGAERLLGRGDMLFLENGSAKPVRLQGCFISDEEIERVAAHVKEKQGPSY
FT                   LFDPDDFRQTASMGGEDDELFEEACRFVIAQGGASTSSLQRHFRIGYNRAARLIEMMEE
FT                   RGLISEARGSKPRDVLMSEDEWERWREQNS"
FT   gene            725605..726909
FT                   /locus_tag="GC56T3_0677"
FT   CDS_pept        725605..726909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0677"
FT                   /product="UDP-N-acetylmuramate/alanine ligase"
FT                   /note="KEGG: gyc:GYMC61_0693 UDP-N-acetylmuramate/alanine
FT                   ligase; TIGRFAM: UDP-N-acetylmuramate/alanine ligase; PFAM:
FT                   Mur ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25724"
FT                   /inference="protein motif:TFAM:TIGR01082"
FT                   /protein_id="ADI25724.1"
FT                   /translation="MTAYHFVGIKGTGMSALAQVLHDLGYTVQGSDVEKWFFTQKALEE
FT                   RGIPVLPFSKDNIRPGYTVIAGNAFPDTHEEIEAARQLGVPVIRYHRFLGQLAGKFTSI
FT                   AVTGSHGKTTTTGLLAHVMQGAHPTSYLIGDGTGKGEPGSKYFVFEACEYRRHFLSYFP
FT                   DYAIMTNIDFDHPDYFANVDDVFSAFQQMANQVKKAIVACGDDPYLPNIQAKVPILFYG
FT                   FGEENDFQARNIVKTTEGMAFDVFVRNTFFASFAIPRFGTHNVLNALAVIALCHYEGVD
FT                   AGTIAKRLQTFQGVKRRFSEKTVGRQVLIDDYAHHPREITATLEAARQKYPGREVVAIF
FT                   QPHTYTRTQTFLREFAESLLQADHVYLCDIFGSAREHEGKLTIRDLQAQIPRSQLLEEQ
FT                   NVAVLKQHQDAVLVFMGAGDIQKFQQAYERAVLSA"
FT   gene            727055..727498
FT                   /locus_tag="GC56T3_0678"
FT   CDS_pept        727055..727498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0678"
FT                   /product="protein of unknown function DUF948"
FT                   /note="PFAM: protein of unknown function DUF948; KEGG:
FT                   gyc:GYMC61_0694 protein of unknown function DUF948"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25725"
FT                   /inference="protein motif:PFAM:PF06103"
FT                   /protein_id="ADI25725.1"
FT                   /translation="MEWLLYGSVALIALAFLLLVVYIAKTLIVLQETLRRLTAAIDHAD
FT                   EQVQTVAKEVRELLHTANGIASDVQKKAETLNGAIEAVGEIGGTIRSLNRALRQAAAGL
FT                   SARAGLEQGKWVKALRWTNVLLDLREKWRKKQSLKEGVSNGEK"
FT   gene            727485..727880
FT                   /locus_tag="GC56T3_0679"
FT   CDS_pept        727485..727880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0679"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK2813 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25726"
FT                   /inference="similar to AA sequence:KEGG:GK2813"
FT                   /protein_id="ADI25726.1"
FT                   /translation="MAKNNGGFLLGALVGGIAGAAAALFLTSEKGRKWLAEWSNDETWE
FT                   PVKTTAVEWLETAKEKTKEIASFIPLKSSTAPAGGENDGEEAKEATIPIPPSAGPADRE
FT                   TLQKLLEEAEAALDDAEQNITSRKEAE"
FT   sig_peptide     727485..727553
FT                   /locus_tag="GC56T3_0679"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.466 at
FT                   residue 23"
FT   gene            727884..728213
FT                   /locus_tag="GC56T3_0680"
FT   CDS_pept        727884..728213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0680"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK2812 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25727"
FT                   /inference="similar to AA sequence:KEGG:GK2812"
FT                   /protein_id="ADI25727.1"
FT                   /translation="MGMEKLETIEQFDRVMKETERFLFVKHSLTCPISQAAFGECEKFA
FT                   ADHPELAVYCLYVQEARPLSNYIAEATGVKHESPQVLLFENGRVVWHASHWAITYGALS
FT                   EHVGA"
FT   gene            728425..729507
FT                   /locus_tag="GC56T3_0681"
FT   CDS_pept        728425..729507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0681"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /note="KEGG: gyc:GYMC61_0697
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; TIGRFAM:
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; chorismate
FT                   mutase; PFAM: DAHP synthetase I/KDSA; Chorismate mutase,
FT                   type II"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25728"
FT                   /inference="protein motif:TFAM:TIGR01361"
FT                   /protein_id="ADI25728.1"
FT                   /translation="MSNERLDELRARVDEINLQLLKLINERGRLVQEIGKIKEAQGTHR
FT                   YDPVRERKMLDLISEHNDGPFETSTLQHIFKEIFKAALELQEDDHRKALLVSRKKHPEN
FT                   TIVEVKGERIGDGNQYFVMGPCAVESYEQVAAVAEAVKKQGIKLLRGGAYKPRTSPYDF
FT                   QGLGVEGLKILKRIADEFDLAVISEIVTPADIEIALDYIDVIQIGARNMQNFELLKAAG
FT                   QVNKPILLKRGLAATIEEFINAAEYIMSQGNGQIILCERGIRTYERATRNTLDISAVPI
FT                   LKKETHLPVFVDVTHSTGRRDLLIPCAKAALAIGADGVMAEVHPDPAVALSDSAQQMDI
FT                   AQFNEFMEEVRAFQRQFVRA"
FT   gene            729812..730804
FT                   /locus_tag="GC56T3_0682"
FT   CDS_pept        729812..730804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0682"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="TIGRFAM: catabolite control protein A; PFAM:
FT                   periplasmic binding protein/LacI transcriptional regulator;
FT                   regulatory protein LacI; KEGG: gyc:GYMC61_0698 global
FT                   transcriptional regulator, catabolite control protein A;
FT                   SMART: regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25729"
FT                   /inference="protein motif:TFAM:TIGR01481"
FT                   /protein_id="ADI25729.1"
FT                   /translation="MTVTIYDVAREANVSMATVSRVVNGNPNVKPSTRKKVLEAIERLG
FT                   YRPNAVARGLASKKTTTVGVIIPDISSIFFAELARGIEDIATMYKYNIILSNSDQNKEK
FT                   ELHLLNTMLAKQVDGLLFMGGTITEEHVAEFQKSSVPIVLAATIGPEEIPSVNIDYEQA
FT                   AFEAVTYLLEKGNRRIVYVTGPTDDPINQRKLAGYRRALEEHGAPYEEELVIEGDNSYD
FT                   SGLEAYEKMTELAERPTAVFAGTDEMALGIIHSAQDHGVRVPDELEVVGFDNTRLATMV
FT                   RPRLTTVVQPMYDIGAVAMRLLTKYMNKEPVDHHIVVLPHRLEVRESTK"
FT   gene            730801..730917
FT                   /locus_tag="GC56T3_0683"
FT   CDS_pept        730801..730917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0683"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25730"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI25730.1"
FT                   /translation="MKKAGLNMGASFLLALLHFFFDGCNRLAVGPFFGENGS"
FT   gene            complement(730970..732139)
FT                   /locus_tag="GC56T3_0684"
FT   CDS_pept        complement(730970..732139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0684"
FT                   /product="Histone deacetylase"
FT                   /note="KEGG: gka:GK2809 acetoin utilization protein; PFAM:
FT                   histone deacetylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25731"
FT                   /inference="protein motif:PRIAM:3.5.1.98"
FT                   /protein_id="ADI25731.1"
FT                   /translation="MSRNCAFVYSEQFLQYKFHDDHPFNQLRVKMTYDLLCTLGALEDR
FT                   QIVAPRMATDDELALIHDRSYIEAVKAAGRGELSEAAAQNYGLGTEDTPIFPNMHEASA
FT                   LLVGSTLTAVDAVLSGAAEHALNLGGGLHHGFRGKASGFCVYNDSAVAIQYIREKYGLR
FT                   VLYVDTDAHHGDGVQWAFYDDPNVCTFSIHETGRYLFPGTGNVNERGLGAGYGYSFNIP
FT                   VDAFTEDESWIAAYTTALREIADFFRPDVIVTQNGVDAHYYDPLTHLSVTMKTYRAIPK
FT                   LAHEIAHEYCGGRWIAVGGGGYDIWRVVPRAWALLWLEMTGQADVSGPLPDEWRERWQP
FT                   LSPVALPLEWDDPDDLYPPIPRKAEISEKNAQTVEKALYFIRSQRRAGT"
FT   gene            complement(732136..732780)
FT                   /locus_tag="GC56T3_0685"
FT   CDS_pept        complement(732136..732780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0685"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="KEGG: gka:GK2808 acetoin utilization protein; PFAM:
FT                   CBS domain containing protein; amino acid-binding ACT
FT                   domain protein; SMART: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25732"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADI25732.1"
FT                   /translation="MLVEQVMKAPVITLRATNTIAEALQLLRHHRIRHLPVVDGEGRLV
FT                   GLVTSQDLREASPSIFRLHEQWEDLEKPVGDVMKTDLIVGHPLDFVEEVAALFYEHRIG
FT                   CLPIVNHGKLVGIITQTDLLRTFIELTGVHQPGSQIEIKVPNEAGMLSKAAAIISERHV
FT                   NIASVLVYPAPDPNEKILVFRVQTMNPLPLIRDLQNAGYHVLWPNLPGVTS"
FT   gene            complement(732810..733442)
FT                   /locus_tag="GC56T3_0686"
FT   CDS_pept        complement(732810..733442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0686"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   gyc:GYMC61_0710 acetoin utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25733"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADI25733.1"
FT                   /translation="MEHKKTYNAKELKTPKGTLLIEGPVTPEALASYEFHHDLTSFRPP
FT                   AKQHKALIEIAKLPEGRIIIARRGEVIVGYVTFLYPDPLERWSEGNMENLLELGAIEVI
FT                   PEFRGFGVGKNLLIVSMMDDAMEDYIIITTEYYWHWDLKGTGLNVWEYRKVMEKMMNAG
FT                   GLVWYATDDPEICSHPANCLMVRIGKRVDAESIQRFDRLRFMNRYMY"
FT   gene            733617..735332
FT                   /locus_tag="GC56T3_0687"
FT   CDS_pept        733617..735332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0687"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   gyc:GYMC61_0711 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25734"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADI25734.1"
FT                   /translation="MNTERLPVIQGDYNLKNYEETYKQFQWSEVEKEFSWHETGRVNMA
FT                   YEAIDRHAESFRKNKVALYYRDAVRNEKYTFKEMKEMSNKVANVLKQAADIQKGDRVFV
FT                   FMPRSPELYFAVLGIIKTGAIVGPLFEAFMEGAVRDRLEDSGAKAIVTTPELLPRVPVG
FT                   DLPELKYVFLVGDGIVEEGPYIDLKKRMNEASKHFDIEWVDRQDGLILHYTSGSTGKPK
FT                   GVLHVHNAMIQHYQTAKWVLDLKEDDIYWCTADPGWVTGTSYGIFGPWLCGASSVIVGG
FT                   RFSPDAWYQTIQDFGVTVWYSAPTAFRMLMGAGDEVVKKYDLSSLRHILSVGEPLNPEV
FT                   IRWGMKVFGRRIHDTWWMTETGGHLICNYPCMEIKPGSMGKPIPGVEAAIIDDQGNVLP
FT                   PYRMGNLAIKKGWPSMMKTIWNNPQKYESYFIGDWYVSGDSAYMDEDGYFWFQGRVDDV
FT                   INTSGERVGPFEVESKLVEHPAVAEAGVIGKPDPVRGEIIKAFIALREGYEPSEELKED
FT                   IRQFVKKGLAAHAAPREIEFRDKLPKTRSGKIMRRVLKAWELNLPTGDLSTMED"
FT   gene            complement(735702..738452)
FT                   /locus_tag="GC56T3_0688"
FT   CDS_pept        complement(735702..738452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0688"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51;
FT                   penicillin-binding protein transpeptidase; KEGG:
FT                   gyc:GYMC61_0712 glycosyl transferase family 51"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25735"
FT                   /inference="protein motif:PFAM:PF00912"
FT                   /protein_id="ADI25735.1"
FT                   /translation="MKRNQLSISLEKAWHYFSLTYDVVWNVILILLIAALCLICFSIGA
FT                   GAGYFAFLVKDMPVPSPDEMKKEIYSYGETSHMYFDGGVYLGRFRSDLDREAVRLSDVS
FT                   PYVVQAIIATEDEHFYEHHGVVPKAVIRAVFQELTNSPVKSGGSTLTQQLVKNQMLTNE
FT                   VSFERKAKEMLLSLRLEKFFSKEDILEAYLNVVPFGRNSSGRNIAGIQAAAQGVFGVNA
FT                   KELNLAQAAFLAGLPQNPFVYTPFAADGSVKSDISAGLKRMKTVLYRMKRAGYISERQY
FT                   KEALAYDVAKHFAAPKPSPFEQYPFLTMEIERRAKEVLAETFAKRDGYKPEEVQREPAR
FT                   FRRYLGEAEKELRQGGYRIYTTIDKKIYEQMQRIAARYPYYGSDNVYYTKDKKTGKTIP
FT                   HRQPVEVGAMLIENKTGKIISFVGGRDYGREQLNHATQAHRSNGSTMKPLLVYAPAMEM
FT                   GVIQPATIIPDLPLSIGSYTPKNADGKTHGLVTARYALQQSFNIPAVRTYMRIRSRHPI
FT                   DYLHKMGITSVSKQEEANPALAIGGTHIGVTVEENVNAYATFANYGSFVDAYMIEKIVD
FT                   KNGKIVYKHQSKPVPVFSPQTSYLMIDMMRDVLHGGTASSVPRYLTFSADWAGKTGTSQ
FT                   DKRDSWFIAVNPNVTFGVWIGYDRPAPLESRYKGLSYSQRTQLLWAQLMNAAYDQNPQL
FT                   IAPPKRFLMPGGIVRRAYCAASGFSPSAACEKAGLVRYDLYNTKFAPREGSGEEVMESR
FT                   VVVIGGRRYVALETTPEEFVTREVIVNPKLLADWGINGEGQAGDASLVSTLKENGRPPA
FT                   PPAARLAGGKLVWNRHNEPDVIGYRVYLVNETGERRLAAAVKADEAASFSPLQPGAAYC
FT                   VTAVDIAGQESAPSNPVSLPSASPPNSGHQKSGEPSSPPPSGDVE"
FT   gene            738617..738877
FT                   /locus_tag="GC56T3_0689"
FT   CDS_pept        738617..738877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0689"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: gyc:GYMC61_0713 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25736"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0713"
FT                   /protein_id="ADI25736.1"
FT                   /translation="MMGISSGCLPGAESWRTVRASPQAGVNYLPEQRWRTVLAPSSHPP
FT                   AGAVTQMSEKAPCFLSRVVPRRTLAPSSRAGVFFFMTFIER"
FT   gene            738883..740142
FT                   /locus_tag="GC56T3_0690"
FT   CDS_pept        738883..740142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0690"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="SMART: RNA-binding S4 domain protein; TIGRFAM:
FT                   tyrosyl-tRNA synthetase; KEGG: gyc:GYMC61_0714 tyrosyl-tRNA
FT                   synthetase; PFAM: aminoacyl-tRNA synthetase class Ib;
FT                   RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25737"
FT                   /inference="protein motif:TFAM:TIGR00234"
FT                   /protein_id="ADI25737.1"
FT                   /translation="MDLLAELQWRGLVNQTTDEDGLRKLLNEERVTLYCGFDPTADSLH
FT                   IGNLAAILTLRRFQQAGHQPIALVGGATGLIGDPSGKKSERTLNAKETVEAWSARIQEQ
FT                   LSRFLDFEAHGNPAKIKNNYDWIGPLDVITFLRDVGKHFSVNYMMAKESVQSRIETGIS
FT                   FTEFSYMMLQAYDFLRLYETEGCRLQIGGSDQWGNITAGLELIRKTKGEARAFGLTIPL
FT                   VTKADGTKFGKTESGTIWLDKEKTSPYEFYQFWINTDDRDVIRYLKYFTFLSKEEIEAL
FT                   EQELREAPEKRAAQKALAEEVTKLVHGEEALRQAIRISEALFSGDIANLTAAEIEQGFK
FT                   DVPSFVHEGGDVPLVELLVSAGISPSKRQAREDIQNGAIYVNGERLQDVGAILTAEHRL
FT                   EGRFTVIRRGKKKYYLIRYA"
FT   gene            complement(740189..740791)
FT                   /locus_tag="GC56T3_0691"
FT   CDS_pept        complement(740189..740791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0691"
FT                   /product="ribosomal protein S4"
FT                   /note="TIGRFAM: ribosomal protein S4; PFAM: ribosomal
FT                   protein S4; RNA-binding S4 domain protein; KEGG:
FT                   gyc:GYMC61_0715 ribosomal protein S4; SMART: RNA-binding S4
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25738"
FT                   /inference="protein motif:TFAM:TIGR01017"
FT                   /protein_id="ADI25738.1"
FT                   /translation="MARYTGPMWKVSRRLGISLSGTGKELQKRPYPPGQHGPGQRRKLS
FT                   EYGLQLQEKQKLRHMYGVNERQFRKTFEEAGKMPGKHGENFMILLESRLDNLVYRLGLA
FT                   RTRRQARQLVTHGHILVDGSRVNIPSYRVKPGQTIAVREKSRNLQVIKEALEANNYIPD
FT                   YLTFNPEKMEGTYTRLPERSELPAEINEALIVEFYSR"
FT   gene            741104..742963
FT                   /locus_tag="GC56T3_0692"
FT   CDS_pept        741104..742963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0692"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: gka:GK2801 two-component sensor
FT                   histidine kinase; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25739"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADI25739.1"
FT                   /translation="MLVWVEKAMNKDEMKRYESFKQKFFHWFLAFQDDGPFSAAAGELL
FT                   ALLKEELALEQAVFYSYDPVRVAFYPEAAAVGTPDVGLIAAEGEREVVVVDAGGPHMAA
FT                   RLFFMLSDEASAMVELMYRKDGGFDERLLWEIRTDLARLFRKLSAVLQGEGEEKRYGQL
FT                   HRFAAKIHSSMHIDVVLEEIIRTLQNVYPSFTYHLLLSHDNHLRGNLPIKTLVLDEREK
FT                   QTAALRAFLTGQVQCEEMEAPPRSVLYAPIKGVQAVYGVIEIIAPYAAPFPKREIHFIS
FT                   LLASTAGSALENAKLYEQSRRLVADLQLINDTMRQLNARPRLHEAIEYMISQIQQSFGA
FT                   DEVGFFLFADGKRELLPGSTPFFFDHRSEPYIEWVEKRRQSGNDILFAGDVCVSAFGPF
FT                   RSIMAAPMQQNKETKGLCIALASEPYRFTFEMFKLLESLVQHSTLAFMNAMLHEELEKL
FT                   VVTDYLTKLHTRRYLDEVIQTSMGSDASGALILFDIDNFKQINDVYGHQTGDEVLVQVA
FT                   ETVRANIRDGDVAARWGGEELAVYLPKVPLSDAISIARRITEKVREQTIPTVTVSCGVS
FT                   WWERHGCEDANQLFKRADAALYMAKETGKNCIFVHDDCHLYKV"
FT   gene            complement(743019..743495)
FT                   /locus_tag="GC56T3_0693"
FT   CDS_pept        complement(743019..743495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0693"
FT                   /product="putative GAF sensor protein"
FT                   /note="KEGG: gyc:GYMC61_0717 putative GAF sensor protein;
FT                   PFAM: GAF domain protein; SMART: GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25740"
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /protein_id="ADI25740.1"
FT                   /translation="MFHPIAYRGTREENYQLVIEQLKALIAGEPNFIANLANAAALLNQ
FT                   FFTDINWVGFYLADGEELVLGPFQGLPACVRIPFGKGVCGTAAAERRTVVVPDVHQFPG
FT                   HIACDAASQSEIVVPLIKDGRVIGVLDIDSPVKNRFDDIDRRYLEQFSSVLMST"
FT   gene            complement(743582..744385)
FT                   /locus_tag="GC56T3_0694"
FT   CDS_pept        complement(743582..744385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0694"
FT                   /product="histidinol phosphate phosphatase HisJ family"
FT                   /EC_number="3.1.3.15"
FT                   /note="TIGRFAM: histidinol phosphate phosphatase HisJ
FT                   family; KEGG: gyc:GYMC61_0718 histidinol phosphate
FT                   phosphatase HisJ family; PFAM: PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25741"
FT                   /inference="protein motif:TFAM:TIGR01856"
FT                   /protein_id="ADI25741.1"
FT                   /translation="MRDGHIHTPFCPHGSQDPLEAYVERAIELGYTDISFTEHAPLPEQ
FT                   FIDPTPNQDCSMKLSQLERYLHAVAEVKARYRNDIAIRVGLEVDFIPGFEEETTRLLDE
FT                   VGPLLDDSILSVHFLAHEGQYVCLDYSEDMFADIVRLFGSVERVHRAYYETVRQSIRTE
FT                   LGRYKPRRIGHMTLVRKFQRRFPCLEPMDEWIVAILDDIKQFGYELDYNGAGAAKPLCL
FT                   EPYPPGGVIAEARRRGIPIVYGSDAHRAADLHQGREEMERTALSD"
FT   gene            744581..746284
FT                   /locus_tag="GC56T3_0695"
FT   CDS_pept        744581..746284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0695"
FT                   /product="Septation ring formation regulator EzrA"
FT                   /note="PFAM: Septation ring formation regulator EzrA; KEGG:
FT                   gyc:GYMC61_0719 septation ring formation regulator EzrA"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25742"
FT                   /inference="protein motif:PFAM:PF06160"
FT                   /protein_id="ADI25742.1"
FT                   /translation="MGMAWIVLLLGAGAIIYNHVYRKRMYREIDRLEEWKINLMNRPVP
FT                   DELAKVKQLNMTGETEQLFERWRQQWDDIVAVKLPNVEEQLFDAERLLDKYRYRQARRL
FT                   LGQIADGLRRLEEEVHEIIHEVNELIGSEEQSRAEIEELRAAHREAKKALLAYRYTFGS
FT                   AADLLDVRLTEAENQFQRFAELTEAGNYLAARDVVLTLKEELGRLTSMMEEIPKLLGEC
FT                   QTSLPAQLAELADGYREMEERGYILDHLHMERTLQEKREKIEQCLAMIHGLRIEEAKQI
FT                   VAELKEEIDALYDLLENEVLAHQYVQTEMPRLSGMLQELAAEAKETEAEALFVQQSYHL
FT                   APSDLEKYRSIEKQLHQLQKRFFLIQDRVAEAKTAYSLLKEELEQLVSQIDLMKEEHEQ
FT                   FRTMLQTLRKDELIAREKLDGMRKTLAEALRLVQKSRLPGLPEPYALELAEARRSLQAV
FT                   AARLEEKPLDMPAVDQALEEAKAAVERLYERTVEMIEQATLAERTIQYGNRYRRRYPAV
FT                   RKGLEEAEFLFRHYDYEEALRQAVAAVEEVEPGAFDRVQKLWQEDNSREQ"
FT   gene            746663..747808
FT                   /locus_tag="GC56T3_0696"
FT   CDS_pept        746663..747808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0696"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG:
FT                   gyc:GYMC61_0720 cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25743"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ADI25743.1"
FT                   /translation="MIYLDNSATTKPFPEVVDSFVAVATNYFANPSSLHGLGMKAERLL
FT                   AQAREQIAAMLRVKPNEIVFTSGGTEANNFAIKGVAWQYQRRGRHIITTKIEHPSVAEP
FT                   CRQLEELGFEVTYLPVDREGRVSVERVERALRDDTILVSVMHVNNEVGTVQPIEEIGAL
FT                   LSRYPKTLFHVDRVQGISKVPLDLKQAGVDLCTISAHKFHGLRGAGLLYVREGVRLAPL
FT                   IAGGGQERQLRSGTENVAAIVAMAKALRLAMERYERDIGRLQALKDEWLEALSAIPDIE
FT                   INTPRDGAAPHIINFSLKSGIKPEVFVHELEKSGIYVSTTSACSSKKKAPSKTLLAMGL
FT                   GEDRAERGIRISLSFDNSREEIAPAVAAIKQAIKTLSEVTE"
FT   gene            747810..749018
FT                   /locus_tag="GC56T3_0697"
FT   CDS_pept        747810..749018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0697"
FT                   /product="thiamine biosynthesis/tRNA modification protein
FT                   ThiI"
FT                   /note="KEGG: gka:GK2795 thiamine biosynthesis protein ThiI;
FT                   TIGRFAM: thiamine biosynthesis/tRNA modification protein
FT                   ThiI; PFAM: Thiamine biosynthesis protein-like; THUMP
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25744"
FT                   /inference="protein motif:TFAM:TIGR00342"
FT                   /protein_id="ADI25744.1"
FT                   /translation="MMNYDRILIRYGEMTTKGKNRNIFVRRLKNNIARKLQAFERIQIE
FT                   YMRDRMYILLNGEPHEPIIEKLKTVFGIHSFSLAMKCENDLDAIKETALAAVRQLPYKG
FT                   KTFKVSARRVDKQFPYRSDELNYEVGAHILRHTDGLTVNVREPDIDVRIEVRQDGTYIT
FT                   CRDIFGAGGLPVGTSGKAMLMLSGGIDSPVAGYLSMKRGLEIEAVHFFSPPFTSERAKQ
FT                   KVIDLVRKLTTYGGRIKLHIVPFTEVQQAIYQGVPNEYSLISTRRAMLRITDALRRRQR
FT                   ALAIVTGESLGQVASQTLESMYVINEVTNTPILRPLVSMDKLEIIELAKQIGTHDISIL
FT                   PYEDCCTIFTPRAPKTKPKKEKVFHYESQLDLAPLLEKAVNDTETLVIDEETGQGDEFA
FT                   ELF"
FT   gene            749100..749303
FT                   /locus_tag="GC56T3_0698"
FT   CDS_pept        749100..749303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0698"
FT                   /product="small acid-soluble spore protein alpha/beta type"
FT                   /note="PFAM: small acid-soluble spore protein alpha/beta
FT                   type; KEGG: gyc:GYMC61_0722 small acid-soluble spore
FT                   protein alpha/beta type"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25745"
FT                   /inference="protein motif:PFAM:PF00269"
FT                   /protein_id="ADI25745.1"
FT                   /translation="MARNNSNQLLVPGAQQALEQMKYEIAQEFGVNLGADTTSRANGSV
FT                   GGEITKRLVAMAQQQLGGARQF"
FT   gene            749441..751033
FT                   /locus_tag="GC56T3_0699"
FT   CDS_pept        749441..751033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0699"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   gyc:GYMC61_0723 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25746"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADI25746.1"
FT                   /translation="MRREDLIAPERYNLTSEMERHAAAGPDRIALKWESEQGETKEITY
FT                   GRLMARANQIGNAFLSHGLEKGDKVLVMMPRLIETYEVYIGALKAGLVVIPSSEMLRTK
FT                   DLQYRLVHSEAKAVVAYAPYTDEFAPIDGIERLTKFVIGEPRDGWIPLEDAMAKESETL
FT                   EAADTSRDDMAFLSYTSGTTGNPKGVVHCHGWAYAHLRTAAKNWLCIEEGDLVWATAGP
FT                   GWQKWIWSPFLSVLGSGATGFVYYGRFEPEKYLQLLEKYNINVLCCTPTEYRLMAKVPD
FT                   IGRYHLSHLHSAVSAGEPLNREVIDTFAKHFGVEVRDGYGQTENTLLVGVMKGMPIKPG
FT                   SMGKPTPGNRVEIIDENGEPCPPGQVGDIAVHIETPALFKYYYKDPERTAMQFRGDYYI
FT                   TGDKARKDEDGYFWFEGRGDDIIISAGYTIGPFEVEDALVKHPAVKECAVVASPDEVRG
FT                   HVVKAFVVLRDGVDKDDPSLIPALQEHVKQLTAPYKYPRKIEFVDDLPKTASGKIRRVE
FT                   LREREARLAGRSS"
FT   gene            complement(751197..751999)
FT                   /pseudo
FT                   /locus_tag="GC56T3_0700"
FT   gene            752107..753114
FT                   /locus_tag="GC56T3_0701"
FT   CDS_pept        752107..753114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0701"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /note="KEGG: gyc:GYMC61_0725 signal peptide peptidase SppA,
FT                   36K type; TIGRFAM: signal peptide peptidase SppA, 36K type;
FT                   PFAM: peptidase S49"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25747"
FT                   /inference="protein motif:TFAM:TIGR00706"
FT                   /protein_id="ADI25747.1"
FT                   /translation="MNRKRWTALAIAAALFVISVLVQAVGVLLSDKAGGWSESWLALME
FT                   SPFSEEVIAEGDPLKKIAVLEVNGVIQDAGEAESFLSSSQYNHQTFLQMIKQAKEDQDV
FT                   KAIILRINSPGGGVAESAEIYDQLMKLKKKTNKPIYVSMGAMAASGGYYIAAAGDKIFA
FT                   SPETITGSIGVIMQSVNYEGLAKKYGVELVTIKSGPYKDIMNPARKMTEAEREILQQLI
FT                   NDSYDAFVDVVAKGRKLPEDTVRKLADGRIYDGRQAKALLLVDEFGYLDDAIAALKKEH
FT                   HLTGAQVVKYVNDAPWSSLFEMVSNRMKPDSEAAGLIRLLSRPSSPRLMYLYAE"
FT   sig_peptide     752107..752181
FT                   /locus_tag="GC56T3_0701"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 25"
FT   gene            753127..753597
FT                   /locus_tag="GC56T3_0702"
FT   CDS_pept        753127..753597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0702"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein; KEGG:
FT                   gyc:GYMC61_0726 RDD domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25748"
FT                   /inference="protein motif:PFAM:PF06271"
FT                   /protein_id="ADI25748.1"
FT                   /translation="MTDMQITATLADHLPPAERPLCYGGFWLRFWAYCLDVIVVSSLNR
FT                   LIVWPLFRLFDWPLAQDGLFAPAAVAAAVVFYAYFVLMTKWFGQTLGKMVFGLKVVDER
FT                   GEPLTWLTVLFREVVGKFIAKKLLFIGFLFVAFSEKKKGMHDQFADTIVVRE"
FT   gene            753707..754396
FT                   /locus_tag="GC56T3_0703"
FT   CDS_pept        753707..754396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0703"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_0727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25749"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0727"
FT                   /protein_id="ADI25749.1"
FT                   /translation="MKAVIAVIATVVLLLLLVAWMKVSVTVVFRHMKDDDECKIVVRTL
FT                   FGLLRYTVRIPLIKLDMDPDAPGVAFLHKKGMGGTHGKEEQRGKVTPQKIADLFQQLKR
FT                   FLEQVVDLHEIMKQFYRHVTITKWEWKTRIGTGDAASTGLLVGLGWSLKYMIIGAASRY
FT                   MNMKTTPAVAIVPAYDRAASETVFLCMIQFRIGHAMVAGLRVVKHWRGRRLPKRNPLAA
FT                   KQANEGY"
FT   gene            754408..754872
FT                   /locus_tag="GC56T3_0704"
FT   CDS_pept        754408..754872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0704"
FT                   /product="sporulation protein YtfJ"
FT                   /note="KEGG: gka:GK2788 hypothetical protein; TIGRFAM:
FT                   sporulation protein YtfJ; PFAM: Sporulation protein YtfJ"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25750"
FT                   /inference="protein motif:TFAM:TIGR02874"
FT                   /protein_id="ADI25750.1"
FT                   /translation="MTNHPIQGLMTTAMENLKQMIDVNTIIGDPVETPDGSVILTVSKV
FT                   GFGFAAGGSEFMLDGQQNGHQGAQADGNGQAQGNGHPFGGGSGGGVSITPIAFLVVNSS
FT                   GVKLLHLDESTHLYEKILDVAPQAFEKIQAMLKKNKKDGAAGQKADDFDI"
FT   gene            754997..755497
FT                   /locus_tag="GC56T3_0705"
FT   CDS_pept        754997..755497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0705"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: gka:GK2787 thiol
FT                   peroxidase (superoxide-inducible protein 8)"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25751"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ADI25751.1"
FT                   /translation="MAYVTFKGQPVTLVGNEVKVGDKAPDFTVLDQNLQEVTLADTKGH
FT                   VRLISVVPSLDTGVCDAQTRRFNEEAAKLDNVKVLTISVDLPFAQKRWCGAAGIENVQV
FT                   LSDHRDVSFGQAYGVLIKELRLLARAVFVIDSNDTVTYVEYVPEVTNHPNYEAAIEAAK
FT                   AAK"
FT   gene            755618..756607
FT                   /locus_tag="GC56T3_0706"
FT   CDS_pept        755618..756607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0706"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: gyc:GYMC61_0730 N-6
FT                   DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25752"
FT                   /inference="protein motif:PFAM:PF02384"
FT                   /protein_id="ADI25752.1"
FT                   /translation="MMTPVERLFTVFDETAQLLQEELQCTYLEAVAETGENLFHGDVLQ
FT                   SEVSELNAKRLKKQYRELMLERFQNEEIRKAFQLAVLKGMRKHVQPHHQMTPDAVSLFL
FT                   AYLVREFTRSHLALKILDPAVGTANLLTAVLNGLRGKQAASYGSDVDDLLVKLAYVNAN
FT                   LQKHPVQLFNQDSLRPLFVEPVDVVVCDLPVGYYPDDDNAARFALKAKEGRSYAHHLFI
FT                   EQSLRYTKEGGYLFFLIPNTLFSSPQAGQLNEFLKEAAIVQGVLQLPLSMFKNDQAAKS
FT                   VLILQKKGPNVKKPKHVLLVELPRFSNKLAMQAMMAKIDAWITAEKER"
FT   gene            756988..758178
FT                   /locus_tag="GC56T3_0707"
FT   CDS_pept        756988..758178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0707"
FT                   /product="acetate kinase"
FT                   /note="KEGG: gka:GK2785 acetate kinase; TIGRFAM: acetate
FT                   kinase; PFAM: acetate and butyrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25753"
FT                   /inference="protein motif:TFAM:TIGR00016"
FT                   /protein_id="ADI25753.1"
FT                   /translation="MAKVLAINAGSSSLKFQLFEMPAETVLTKGVVERIGFDDAIFTIV
FT                   VNGEKHQEVTAIPDHAAAVKMLLDKLIRYGIIRSFDEIDGIGHRVVHGGEKFSDSVLIT
FT                   EDVIKQIEEVSELAPLHNPANLVGIRAFQEVLPDVPAVAVFDTAFHQTMPEQSFLYSLP
FT                   YEYYTKFGIRKYGFHGTSHKYVTQRAAELLGRPIEQLRLISCHLGNGASIAAVEGGKSI
FT                   DTSMGFTPLAGVAMGTRSGNIDPALIPYIMEKTGMTADEVIEVLNKKSGMLGLSGISSD
FT                   LRDLEKAAAEGNERAELALEVFANRIHKYIGSYAARMCGVDAIIFTAGIGENSEVVRAK
FT                   VLRGLEFMGVYWDPILNKVRGKEAFISYPHSPVKVLVIPTNEELMIARDVMRLANL"
FT   gene            758415..758927
FT                   /locus_tag="GC56T3_0708"
FT   CDS_pept        758415..758927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0708"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_0732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25754"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0732"
FT                   /protein_id="ADI25754.1"
FT                   /translation="MALFRDDAHVYRVIGEFMQIPSRPRTEMELRSWWGQHPAYQEYGD
FT                   EVEQINRIGEQIRRSRAAFVFYLTDPGAVISIDARRPETGENYAIYFGQAIDAPDVAIK
FT                   TTGDIAHQFWGGNINVPLALMTGKMKAKGSKAKALQLLPRIVPAFPLYRRYLELIDERA
FT                   LLHALKA"
FT   gene            759064..759414
FT                   /locus_tag="GC56T3_0709"
FT   CDS_pept        759064..759414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0709"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   gka:GK2783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25755"
FT                   /inference="protein motif:PFAM:PF02036"
FT                   /protein_id="ADI25755.1"
FT                   /translation="MTTVRDIFQLIDSQLREDPSRADGIVAVYQFNLSGSDAGVYQVVL
FT                   RPDAGFVIEGEQETPDCTLSMDSEDFKKMVDGELNGTEAFMSGRLRIDGDMGLALRLQE
FT                   VLSAYNSANQNQ"
FT   gene            759550..761085
FT                   /locus_tag="GC56T3_0710"
FT   CDS_pept        759550..761085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0710"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   gka:GK2782 long-chain fatty-acid-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25756"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADI25756.1"
FT                   /translation="MDLRTVWTKNIERFGPYPALIFEGNEYTNVDCDARSSQLAHALIE
FT                   LGVKPGDRVVVTMPNSPEVVVAFSGVLKAGAVVVPVLPLLQTQELHYIFKDCEPKVVLT
FT                   AEMLWAKAKEAANGLPAPPMMFTIDDPHSPRSLRTRMEQAPASMPLAAVTENAPAALLY
FT                   TSGTTGHPKGVVLTHRNLYANAEAAAEMAKRLPTEYDRVGLGVLPISHAFGFTMMNVAL
FT                   LLGDKIVLLPYFEPKKVLETIERHRVTHTAMVPAMFHALCHYSDADRYDTSSLAACVSG
FT                   SASLPPSLAWQFQRKFNCLILEGYGLSEAAPIVTATDPTKTIKPGSVGLPLPGVQVAVV
FT                   DEHGNRLPPNEVGELIVSGPNVFQGYYGKDEETRQALRDGWLYTGDMARIDEDGYVFIV
FT                   DRKKDVIIRGGFNIYPRDIEELLMSHPDVLEAGVVGVPSPKMGEEVAAYVVVRRGAQVT
FT                   EEELIEFCQKRVAKYKSPRFLKKVGYLPKNIIGKIDKNKLREWASEFIPAVQS"
FT   gene            761106..762248
FT                   /locus_tag="GC56T3_0711"
FT   CDS_pept        761106..762248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0711"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   gka:GK2781 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25757"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADI25757.1"
FT                   /translation="MISFQPTEEEQAFFQVARSLAVEKIRPAARECEKRRTVSADLSDR
FT                   VDELGLSALELPESWGGLELPLLSQALIWQGLSYGDLGVIQGLPGAGEASSLFRLSSEH
FT                   RVWHRYREMAKGGWPTVAWIDEAEQKEPLKEAIRVRRRGSGYIVDGVSSPVRLASKADW
FT                   AVIAARDEEEETVLLAFDERVWEIEEGDIRLGLLAAGIARLRFAEVYAGPEQLVAWGSE
FT                   ADALLNRVRARNQVIEAAKEVGLMEAALDYTIEYTAGRKAFGQEIAKFQGVSFTIAEMA
FT                   FECRGAKLLVWQAAAAVDRGDEQAGGYAWSALSRAHRSLRYVTDQAVQMLGGHGYVQEY
FT                   PAEKWMRDAQAQVMLYGRERDWLIRRGEQLLNERKERVAQ"
FT   gene            762245..763459
FT                   /locus_tag="GC56T3_0712"
FT   CDS_pept        762245..763459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0712"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   gka:GK2780 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25758"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADI25758.1"
FT                   /translation="MISFTLSPQQKQMKELVHWFAKHEVRPIALEADRLGRVPDEWLQK
FT                   VNKMGIQLNASSFGGGRPPSHAEGKKEKKEREGNRVAVIAAEELAWGCPGIALSLPGPG
FT                   LGGPPIQSSGTPEQKQRFLSIFTKDEPRWGAYALTEPEAGSDASGIRTTAKKVDGGYLL
FT                   NGQKIFITNGARASWVVVFATVDPKLGRAGHRAFVVEKGTPGFVATRTVHKMGLRANET
FT                   AELLFEDCFVPDENLLGGEELYSANANKPSGFQVAMKTFDSTRPIVAAMAVGIARAAYE
FT                   YTLDIVRSEYPKQGRLYYEAAALLAEAEQEIDAARLLTWEAAWKADIGEPNAMEAAVCK
FT                   AVAGKMALHVCAMCLELLGPVGLGGHLVEKLYRDVKVFDIFEGTQQIQRLVTARRLYAP
FT                   YGVHV"
FT   gene            763557..764348
FT                   /locus_tag="GC56T3_0713"
FT   CDS_pept        763557..764348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0713"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   gka:GK2779 enoyl-CoA hydratase/carnithine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25759"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADI25759.1"
FT                   /translation="MPYETLRIERRNKGVAWVMIHNPPANAISERLMEELEKAADELEA
FT                   DRGVRVVVIASAHPKTFLAGADLKDMIQRGTQFAGNEAGIAEQSARMQRCFDRFATMPK
FT                   PVIAAINGYALGGGCELALACDFRIMGGGKIGLTEVSLGLIPGAGGTQRLTRLVGRAKA
FT                   TELIFLARRLDPQEALELGLIHRVTPPERLEEEASAFAEQLSEGAVRAMGLAKRAIYAA
FT                   EGLPEDGFGIEAASFAATFKTGEPAIGLAAFFQKKQPQFLR"
FT   gene            764364..765206
FT                   /locus_tag="GC56T3_0714"
FT   CDS_pept        764364..765206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0714"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   gyc:GYMC61_0738 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25760"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADI25760.1"
FT                   /translation="MSSWAELLKGKVAVVTGASRGLGRADALALAEAGADVVITDILLE
FT                   SDEESKQTAQKYGPLSQVMQSTKVVYAEKTAEDIRAMGRRALALKMDVTDREQVKEVFA
FT                   RVKEEFGSIDILVNNAGTLDHVSQIEKQNDEFWERDLRVNLTGTYNCTKAVWPYMKEQG
FT                   WGRIINMSSVAGTLGGFGQASYSATKGAVLSFTKSMALEGARYGITVNAIVPGIINTEA
FT                   FRMGNPKMNERMIQRTAFRRPGEPEDVANAIVFLCSDKAKYITGIGLNVSGGIELFTF"
FT   gene            765276..766418
FT                   /locus_tag="GC56T3_0715"
FT   CDS_pept        765276..766418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0715"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: gyc:GYMC61_0739 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25761"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADI25761.1"
FT                   /translation="MREVVIVDAVRTAIGKKKGALSSVHPVDLLVPVLRALVDRNGLDA
FT                   GLVEDVIVGCVTMTGEQGGNIARQAVLAAGFPVGVPAFSLNRMCGSSQQAIHNAAQAIL
FT                   AGDIDIAIAAGVESMTRVPMGSDMGRFSRQLTSRYNIVPQGISAEMIAKKWGLSREELD
FT                   AFSLQSHEKAAAATDRGMFEREILPLDVPGEDGAVRFARDEGIRRDTSLEKLAALTPSF
FT                   QPKGGVITAGNSSQVSDGAAGVLLMSAEKARQLGLRPRARIVARAVVGEDPVMMLTGII
FT                   PATRSVLQKAGLRLDQMDAIEVNEAFASVVKAWERELEPNMAKVNPRGGAIALGHPLGA
FT                   SGARLMTTLLHELEDMDGTYGLQVMCIGFGMATATIIERL"
FT   gene            766439..768184
FT                   /locus_tag="GC56T3_0716"
FT   CDS_pept        766439..768184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0716"
FT                   /product="ABC-1 domain protein"
FT                   /note="PFAM: ABC-1 domain protein; KEGG: gka:GK2776 ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25762"
FT                   /inference="protein motif:PFAM:PF03109"
FT                   /protein_id="ADI25762.1"
FT                   /translation="MHASLETAKPKPARDFAAIGAAIEEELAAITAGKRRRKIIAVLVK
FT                   NGLGMVLGDAIAHKLRGKGGDNDYWRHVGRRLRLAFEELGPTFIKLGQVLVTRQDLLPE
FT                   PITLELEKLLDRVPPIEFAKIQYILERELSDGLETFEWIDETPLGSASLAQVYKAKLKD
FT                   GPVVAVKVVRPTVEKLFQTDIAIIKKMAARLQKRLPPELQAALDLGGLVQDYYSSAMDE
FT                   LDMTEEARKMQEMKQKYERRAEHVTVPHVYDATKSVLIMEYIDGWLIKDFPVDFLTFEE
FT                   RVNIMIDLVHHYVQTMLDGHYHADAHGSNIMIDKRTKKAVIIDWGMTGRMDSVMAQILM
FT                   RVILHIQLNQAEDAAEVFMELMSPTIYTDVVKLKDELRTLTLNYVSAHQGSSRYNYGRL
FT                   VLEATAIGLRNYCKVPNGLALWAKGFSATEGTARWICPEISYGEVVEAYEIPILKSILG
FT                   KRFNFRANASLVAETAEMIATFPRRFNKVLETMAENKWRMTVQVQTDPVTRNTLNQIAN
FT                   RLALSIIAFAIIMATGFIVASIPGGTFLGMEKTTIANIGLAASVILVVFLGWRLFRTRK
FT                   QRPRF"
FT   gene            768201..768527
FT                   /locus_tag="GC56T3_0717"
FT   CDS_pept        768201..768527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0717"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK2775 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25763"
FT                   /inference="similar to AA sequence:KEGG:GK2775"
FT                   /protein_id="ADI25763.1"
FT                   /translation="MREEQEELTMSKRIEAFYRQSGGPGSPTIRRLLDKHLLYGKDHGL
FT                   PGKKEEFEDVIRDVFLQDHSTRPLVIGLFKLKETLKQEWDAYLDALRGRGIREEEADMA
FT                   GKRA"
FT   gene            768555..769661
FT                   /locus_tag="GC56T3_0718"
FT   CDS_pept        768555..769661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0718"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   gyc:GYMC61_0742 alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25764"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ADI25764.1"
FT                   /translation="MAKAAVLHRYGEPMSIEELDLASPKSGEVKVKMKAAGLCHSDWHV
FT                   VQGQLPLPLPIVLGHEGAGIVEEVGEGVTSVKQGDHVVLNWVPSCGTCSYCRTGRPDMC
FT                   EEAARLTATGTLPDGTTRFSLRGKPVYQFLTAGAFSEYTVVPEQAAIPIRRDVPFELAA
FT                   LISCSVMTGVGAVIHTAQVRPGSTVAVIGAGGVGFNIIQGAALAGAKQVIAIDVVDEKL
FT                   AMTKTFGATHTVNAREDDAVSAVLDLTDGIGVDYAFEAIGRPETMADAYNMTRKAGTTV
FT                   IVGIAAPHETVEINAFSLPSQSKTLTGSWLGQGNPPVDYPKLLDLYAAGKLKLEPLISA
FT                   VYSLDQINDGFAALKSGQNIRGIIRFDE"
FT   gene            769716..770144
FT                   /locus_tag="GC56T3_0719"
FT   CDS_pept        769716..770144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0719"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_0743 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25765"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0743"
FT                   /protein_id="ADI25765.1"
FT                   /translation="MPVFQSEQEVYDVLGRFFERVAETEESKELIAATELGPGYDAFVQ
FT                   YIFHKPEAKITWAQENGKLKIVCGETALHPELIFEQTADVGHKFWLGKLDLQQALARQQ
FT                   IKVQGPLVNALKVLPQLDAIYPAYREYLQEIGRSDLLP"
FT   gene            770261..771751
FT                   /locus_tag="GC56T3_0720"
FT   CDS_pept        770261..771751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0720"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: gyc:GYMC61_0744
FT                   betaine-aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25766"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADI25766.1"
FT                   /translation="MISMKTTEAGLWIGGEWRPAADGAMFDVIDPATGQVTARVANAGE
FT                   KDVDAAVAIAEEAFSDRRWLSIPPLERGRILRRIAELIRQHHYELAQLMTRENGMPINL
FT                   ALFIEIPLAADCFDFFASLVVKPQGEVLPFSVAGSAPDYMAWTMKEPIGVAGLITPWNF
FT                   PLLMPTWKIAPALAAGCTMVLKPAPETPLTALKLAEICHEAGVPEGVVNVLPGLDEAGK
FT                   ALVSHPGVPKIAFTGETETGRHILQAAAPHIKRVTLELGGKSPNIIFADADLEQAAKSA
FT                   LFGVFYNSGQVCQAGSRILVERPVYETFVELLASKAKKLKVGPGTDARSDLGPVISREQ
FT                   YEKVLRYIDIGKQEGAKLVAGGSALDGLGGGYFIEPTVFADVSPSMCIAREEIFGPVAA
FT                   VIPFQDEEEAASIANDTIYGLAAAVWTNDIKRALRLARRVKSGTVWINTYQVLSPTAPF
FT                   GGYKQSGLGRELGMQALEAYLETKTVICDMNDRPMTLF"
FT   gene            771765..772712
FT                   /locus_tag="GC56T3_0721"
FT   CDS_pept        771765..772712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0721"
FT                   /product="ribonucleotide reductase"
FT                   /note="PFAM: ribonucleotide reductase; KEGG:
FT                   gyc:GYMC61_0745 ribonucleotide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25767"
FT                   /inference="protein motif:PFAM:PF00268"
FT                   /protein_id="ADI25767.1"
FT                   /translation="MVHHNGFHKEGKTMVHHDGFQTVKGTIDWEHPMYKLYEKAKRNGK
FT                   WNPADIDFSQDKEDFARLTSEEKIAALPLVAGFSAGEEAVTLDILPMTNALARQGRLED
FT                   VMFLTTFMHDEAKHVEMFSRWQQEVGIGAMDLSVFHNDHYKRIFYEALPEAMNRLYTDD
FT                   SPEAVIRAATVYNMIVEGTLAESGYYTFRQIYKKAGLFPGLLQGIDYLNMDEGRHIQFG
FT                   LYTIQRLVNENERYYDLFIQYMDELWPHVVGYVAYLTELGKRQQQLARTYALEIDYDML
FT                   NNYVVKQFNIRKKQISRAKRVDSIEELEKTVAES"
FT   gene            772943..773548
FT                   /locus_tag="GC56T3_0722"
FT   CDS_pept        772943..773548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0722"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_0746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25768"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0746"
FT                   /protein_id="ADI25768.1"
FT                   /translation="MGSLFAVNPKRFVIAGGAGFLAVIALVAMLLLSGTAFAAFPLSGV
FT                   GGFTISADKITGTGFKLYPAIGETEQRGAWGQAAIDLASANITNLVLTKNINTESALGA
FT                   YGIKSIDVVVTGGNVSGQNLKLRVTGIQADSTSFAGLETQEHKTDNPLNVIDLSAPNLT
FT                   LDKPSLNTHYMSAGAITIPNMKLKVIANMKDGSRVGDF"
FT   sig_peptide     772943..773059
FT                   /locus_tag="GC56T3_0722"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 39"
FT   gene            773822..774964
FT                   /locus_tag="GC56T3_0723"
FT   CDS_pept        773822..774964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0723"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_0747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25769"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0747"
FT                   /protein_id="ADI25769.1"
FT                   /translation="MRKGFEMMQIAVIGALTGAFIGGIALQGGAGGAVWGGSVLAVVLA
FT                   AVVWPLLERPTALMRLKYGTAAFLPGLLVGGSQWVSFGVVGAAVGGMASSALAAFFAPR
FT                   IIIRQEEQGRYIRTRFHYVWMFFGASMATFFALNVLFAAERAAPWQTWAGSISMAVQSS
FT                   IVLALVLLGYVICISWKKRKTETWKQARASARRMGRGLLAGGMVVIGAASLFHYGFLSV
FT                   HTASRVVGPLLSYILGWLLPYAVGWLLAANRHRPVLGSMLAIIGAIFVLIVGISVLPML
FT                   LLPGSGLMWAGVVTGLVMIVLAILSIIKPQSHVTIGSFLIVASILSFVGAAGGLIIGGI
FT                   IGLLGGALVVGWSGEQAKKSSRDSSPPTSPLPPHSSMMTG"
FT   gene            775048..776196
FT                   /locus_tag="GC56T3_0724"
FT   CDS_pept        775048..776196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0724"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_0748 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25770"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_0748"
FT                   /protein_id="ADI25770.1"
FT                   /translation="MGSIKGLKMLLLALTLLLCLPLGGGRSLAAGEEQGFVIHADKVVG
FT                   IFDLGGIILGSPKVIVGKLPIAFIQADISGLSMERVVDTPQGTIVLSIRAGETASATWM
FT                   KLDVTKLKFGGLCLDGFPVKQCLKDVTLVATKMTASRLSIPGMSLSASFSGASRMQAEQ
FT                   KALEQTDLAQEAERLIWQLDEQKQGDNSAARMVETMQANVRALEKRIKDRTDEWAVLVE
FT                   KQSTVSASLKQLEQAMSGGQTAEGKEQTKYEEVLMHFRDWKQMLDQQRVALSQDIEKWN
FT                   EQDALWKKTASYVAEKLNLGERSEAMDLLSDLRSSLDGIKRRLDEQEKDEEVWSQIVHD
FT                   LEGRLDAVAEWLKRKPDDGGNSAEERFRPPLSSSGTDGEATP"
FT   sig_peptide     775048..775137
FT                   /locus_tag="GC56T3_0724"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.852 at
FT                   residue 30"
FT   gene            complement(776286..777788)
FT                   /locus_tag="GC56T3_0725"
FT   CDS_pept        complement(776286..777788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0725"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="KEGG: gyc:GYMC61_0749 transcriptional regulator,
FT                   LuxR family; PFAM: regulatory protein LuxR; SMART:
FT                   regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25771"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADI25771.1"
FT                   /translation="MNLRLSSQLDAILKEGWETIRQHRDDILSAWLDKCGELEDKQHAA
FT                   AQPLRLAIDTFSSQWLGPVKDIAEWLASFQREWEKRNGELSPNQSTAILSMMENVVHET
FT                   IQSAGVVEFRVHQAVQYVFSRLHESVNASDCSSFDLEQFLGQIVSSKQLPIIWIAQLSR
FT                   TADGGFVVAKWYGNAGDALTDSSMYGETIFVLCEHILSRMDASGKQLIPLPWGSDLLLV
FT                   CAEGEERLIIPFLLHAFEQFQAAQKVSIRTREQHLWKDAVLLFDQWIMRAKSLHQAIEY
FT                   ISTGFVTYLPFERCALFAYSSTHESGFGLYGYQLNNHEIKSIHEHIDSLPFIKQYIQRL
FT                   QLLGRQMTNVPPIYVRHAAQGLPMKYVKQFQLESIVIAPIYAPSENRLIGAAILDCGPK
FT                   TSFQLSNDLYTAVMKFGQSAGEILSKCNGGRSDLVQPMPHLSPREIEVLKLVAEGASTY
FT                   EAARRLHLSEYTVRDYVSAILQKMNAKNRTEAIVKAIRDGII"
FT   gene            778100..778621
FT                   /locus_tag="GC56T3_0726"
FT   CDS_pept        778100..778621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0726"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="KEGG: gyc:GYMC61_0750 molybdenum cofactor synthesis
FT                   domain protein; TIGRFAM: molybdenum cofactor synthesis
FT                   domain protein; PFAM: molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25772"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ADI25772.1"
FT                   /translation="MSTSEHKQEAPKTVRCKVITISDTRTEETDRSGRLMIELLTEAGH
FT                   EVVGYEIVKDEADAIREAVLDGCRRADVDAVLTNGGTGIAKRDVTIETVKALLEKELVG
FT                   FGELFRFLSYTEDIGPAAMLSRAVAGVAMDTAVFCTPGSTGAVRLAMTKLILPELGHVV
FT                   REIRKDRAPR"
FT   gene            complement(778774..778872)
FT                   /pseudo
FT                   /locus_tag="GC56T3_0727"
FT   gene            779103..780164
FT                   /locus_tag="GC56T3_0728"
FT   CDS_pept        779103..780164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0728"
FT                   /product="Threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /note="KEGG: gka:GK2764 L-allo-threonine aldolase; PFAM:
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25773"
FT                   /inference="protein motif:PRIAM:4.1.2.5"
FT                   /protein_id="ADI25773.1"
FT                   /translation="MIDLRSDTLTLPTEEMRNVIANALVGDDCYGEDSSVIELEEYCKQ
FT                   LFHVEDALFVPTGTMANQLAIKSQVTEGNEVITETNYHINFYESASIAMLSRVVLHTCR
FT                   TADGILRVEHVEELIHSKPIGPFYAHPQLVSIENTINYYQGKIFPLKVIEQLYGFTREK
FT                   NISLHMDGARLFNAHVATNIPLRDYAKFVDSLSVCFAKGLGAPFGSMLMGRKEVISKAR
FT                   IYRKQFGAGFHQIGMYAAAALYALKHHISHLRTDHLLTKKLAMMLSKIDGLYVDPRAVE
FT                   TNMIFFHVNNFHISSFEFVDRCKKKGLLLFPWLPDEVRIVVSRNVNEKDIDEAANIIEA
FT                   VCKELTRGVMYVS"
FT   gene            780154..781356
FT                   /locus_tag="GC56T3_0729"
FT   CDS_pept        780154..781356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0729"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   gyc:GYMC61_0753 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:GC56T3_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ADI25774"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADI25774.1"
FT                   /translation="MFPKVNEGILTFGIRVFNSVGFFVYVPLLSLWLVKMKDLDITETS
FT                   LAVAAFTFVSKAGNVLVGGVVNKFGIKNSLIVGLWGSALLLTMLTIIHSYTLIFVIVLL
FT                   LGISISLYNVSLKTHISLLEENERLQAFALLNIAVNVGASIGPFLGGWLLDWNSFGIII
FT                   AAIVCYVLAGGVSLLLPRITIEDAEKGINIVQFVKNSRSDPHFFIFIRFIAFSGLFWFL
FT                   YTQLFTTFPVVVSQHFSGKTIGLFFTVNAMTIIALQGFYPKIQPKWKMEYWYALALVLI
FT                   TASYFLLWISHHFWIIFVSVILFSMAEIIWVPTIDHQIVEKKGVLSSSWAFGISGVLWG
FT                   MWESIGGFVGLNLYQYVGHQTFFYLTMIGIVIFIGYMFQLPYRKMSFFTNKNQVERKDC
FT                   R"
FT   gene            781353..782582
FT                   /locus_tag="GC56T3_0730"
FT   CDS_pept        781353..782582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GC56T3_0730"
FT                   /pr