(data stored in ACNUC10043 zone)

EMBL: CP002051

ID   CP002051; SV 1; circular; genomic DNA; STD; PRO; 1580347 BP.
XX
AC   CP002051; ADGW01000000-ADGW01000007;
XX
PR   Project:PRJNA33683;
XX
DT   03-JUN-2010 (Rel. 105, Created)
DT   16-DEC-2013 (Rel. 119, Last updated, Version 3)
XX
DE   Staphylothermus hellenicus DSM 12710, complete genome.
XX
KW   .
XX
OS   Staphylothermus hellenicus DSM 12710
OC   Archaea; Crenarchaeota; Thermoprotei; Desulfurococcales;
OC   Desulfurococcaceae; Staphylothermus.
XX
RN   [1]
RP   1-1580347
RX   DOI; 10.4056/sigs.2054696.
RX   PUBMED; 22180806.
RA   Anderson I., Wirth R., Lucas S., Copeland A., Lapidus A., Cheng J.F.,
RA   Goodwin L., Pitluck S., Davenport K., Detter J.C., Han C., Tapia R.,
RA   Land M., Hauser L., Pati A., Mikhailova N., Woyke T., Klenk H.P.,
RA   Kyrpides N., Ivanova N.;
RT   "Complete genome sequence of Staphylothermus hellenicus P8";
RL   Stand Genomic Sci 5(1):12-20(2011).
XX
RN   [2]
RP   1-1580347
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Davenport K., Detter J.C., Han C., Tapia R., Larimer F.,
RA   Land M., Hauser L., Kyrpides N., Mikhailova N., Anderson I.J., Woyke T.;
RT   ;
RL   Submitted (25-MAY-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 57ae1f0e31d62c0e3c7a19a7cd1c2809.
DR   BioSample; SAMN00002730.
DR   CABRI; DSM 12710.
DR   EnsemblGenomes-Gn; EBG00001458960.
DR   EnsemblGenomes-Gn; EBG00001458963.
DR   EnsemblGenomes-Gn; EBG00001458965.
DR   EnsemblGenomes-Gn; EBG00001458967.
DR   EnsemblGenomes-Gn; EBG00001458968.
DR   EnsemblGenomes-Gn; EBG00001458969.
DR   EnsemblGenomes-Gn; EBG00001458971.
DR   EnsemblGenomes-Gn; EBG00001458973.
DR   EnsemblGenomes-Gn; EBG00001458974.
DR   EnsemblGenomes-Gn; EBG00001458977.
DR   EnsemblGenomes-Gn; EBG00001458981.
DR   EnsemblGenomes-Gn; EBG00001458984.
DR   EnsemblGenomes-Gn; EBG00001458988.
DR   EnsemblGenomes-Gn; EBG00001458991.
DR   EnsemblGenomes-Gn; EBG00001458993.
DR   EnsemblGenomes-Gn; EBG00001458994.
DR   EnsemblGenomes-Gn; EBG00001458995.
DR   EnsemblGenomes-Gn; EBG00001458996.
DR   EnsemblGenomes-Gn; EBG00001458997.
DR   EnsemblGenomes-Gn; EBG00001458999.
DR   EnsemblGenomes-Gn; EBG00001459001.
DR   EnsemblGenomes-Gn; EBG00001459002.
DR   EnsemblGenomes-Gn; EBG00001459004.
DR   EnsemblGenomes-Gn; EBG00001459006.
DR   EnsemblGenomes-Gn; EBG00001459008.
DR   EnsemblGenomes-Gn; EBG00001459010.
DR   EnsemblGenomes-Gn; EBG00001459012.
DR   EnsemblGenomes-Gn; EBG00001459015.
DR   EnsemblGenomes-Gn; EBG00001459017.
DR   EnsemblGenomes-Gn; EBG00001459019.
DR   EnsemblGenomes-Gn; EBG00001459021.
DR   EnsemblGenomes-Gn; EBG00001459023.
DR   EnsemblGenomes-Gn; EBG00001459025.
DR   EnsemblGenomes-Gn; EBG00001459026.
DR   EnsemblGenomes-Gn; EBG00001459027.
DR   EnsemblGenomes-Gn; EBG00001459028.
DR   EnsemblGenomes-Gn; EBG00001459030.
DR   EnsemblGenomes-Gn; EBG00001459031.
DR   EnsemblGenomes-Gn; EBG00001459033.
DR   EnsemblGenomes-Gn; EBG00001459035.
DR   EnsemblGenomes-Gn; EBG00001459037.
DR   EnsemblGenomes-Gn; EBG00001459039.
DR   EnsemblGenomes-Gn; EBG00001459040.
DR   EnsemblGenomes-Gn; EBG00001459041.
DR   EnsemblGenomes-Gn; EBG00001459042.
DR   EnsemblGenomes-Gn; EBG00001459043.
DR   EnsemblGenomes-Gn; EBG00001459045.
DR   EnsemblGenomes-Gn; EBG00001459046.
DR   EnsemblGenomes-Gn; EBG00001459048.
DR   EnsemblGenomes-Gn; EBG00001459051.
DR   EnsemblGenomes-Gn; EBG00001459052.
DR   EnsemblGenomes-Gn; EBG00001459053.
DR   EnsemblGenomes-Gn; EBG00001459054.
DR   EnsemblGenomes-Gn; EBG00001459055.
DR   EnsemblGenomes-Gn; EBG00001459056.
DR   EnsemblGenomes-Gn; EBG00001459057.
DR   EnsemblGenomes-Gn; EBG00001459058.
DR   EnsemblGenomes-Gn; EBG00001459060.
DR   EnsemblGenomes-Gn; EBG00001459062.
DR   EnsemblGenomes-Gn; EBG00001459063.
DR   EnsemblGenomes-Gn; EBG00001459064.
DR   EnsemblGenomes-Gn; EBG00001459065.
DR   EnsemblGenomes-Gn; EBG00001459066.
DR   EnsemblGenomes-Gn; EBG00001459067.
DR   EnsemblGenomes-Gn; EBG00001459069.
DR   EnsemblGenomes-Gn; EBG00001459071.
DR   EnsemblGenomes-Gn; EBG00001459073.
DR   EnsemblGenomes-Gn; EBG00001459074.
DR   EnsemblGenomes-Gn; EBG00001459075.
DR   EnsemblGenomes-Gn; EBG00001459076.
DR   EnsemblGenomes-Gn; EBG00001459077.
DR   EnsemblGenomes-Gn; EBG00001459079.
DR   EnsemblGenomes-Gn; EBG00001459080.
DR   EnsemblGenomes-Gn; EBG00001459081.
DR   EnsemblGenomes-Gn; EBG00001459082.
DR   EnsemblGenomes-Gn; Shell_R0001.
DR   EnsemblGenomes-Gn; Shell_R0002.
DR   EnsemblGenomes-Gn; Shell_R0003.
DR   EnsemblGenomes-Gn; Shell_R0004.
DR   EnsemblGenomes-Gn; Shell_R0005.
DR   EnsemblGenomes-Gn; Shell_R0006.
DR   EnsemblGenomes-Gn; Shell_R0007.
DR   EnsemblGenomes-Gn; Shell_R0008.
DR   EnsemblGenomes-Gn; Shell_R0009.
DR   EnsemblGenomes-Gn; Shell_R0010.
DR   EnsemblGenomes-Gn; Shell_R0011.
DR   EnsemblGenomes-Gn; Shell_R0012.
DR   EnsemblGenomes-Gn; Shell_R0013.
DR   EnsemblGenomes-Gn; Shell_R0014.
DR   EnsemblGenomes-Gn; Shell_R0015.
DR   EnsemblGenomes-Gn; Shell_R0016.
DR   EnsemblGenomes-Gn; Shell_R0017.
DR   EnsemblGenomes-Gn; Shell_R0018.
DR   EnsemblGenomes-Gn; Shell_R0019.
DR   EnsemblGenomes-Gn; Shell_R0020.
DR   EnsemblGenomes-Gn; Shell_R0021.
DR   EnsemblGenomes-Gn; Shell_R0022.
DR   EnsemblGenomes-Gn; Shell_R0023.
DR   EnsemblGenomes-Gn; Shell_R0024.
DR   EnsemblGenomes-Gn; Shell_R0025.
DR   EnsemblGenomes-Gn; Shell_R0026.
DR   EnsemblGenomes-Gn; Shell_R0027.
DR   EnsemblGenomes-Gn; Shell_R0028.
DR   EnsemblGenomes-Gn; Shell_R0029.
DR   EnsemblGenomes-Gn; Shell_R0030.
DR   EnsemblGenomes-Gn; Shell_R0031.
DR   EnsemblGenomes-Gn; Shell_R0032.
DR   EnsemblGenomes-Gn; Shell_R0033.
DR   EnsemblGenomes-Gn; Shell_R0034.
DR   EnsemblGenomes-Gn; Shell_R0035.
DR   EnsemblGenomes-Gn; Shell_R0036.
DR   EnsemblGenomes-Gn; Shell_R0037.
DR   EnsemblGenomes-Gn; Shell_R0038.
DR   EnsemblGenomes-Gn; Shell_R0039.
DR   EnsemblGenomes-Gn; Shell_R0040.
DR   EnsemblGenomes-Gn; Shell_R0041.
DR   EnsemblGenomes-Gn; Shell_R0042.
DR   EnsemblGenomes-Gn; Shell_R0043.
DR   EnsemblGenomes-Gn; Shell_R0044.
DR   EnsemblGenomes-Gn; Shell_R0045.
DR   EnsemblGenomes-Gn; Shell_R0046.
DR   EnsemblGenomes-Gn; Shell_R0047.
DR   EnsemblGenomes-Gn; Shell_R0048.
DR   EnsemblGenomes-Tr; EBT00001612639.
DR   EnsemblGenomes-Tr; EBT00001612640.
DR   EnsemblGenomes-Tr; EBT00001612641.
DR   EnsemblGenomes-Tr; EBT00001612642.
DR   EnsemblGenomes-Tr; EBT00001612643.
DR   EnsemblGenomes-Tr; EBT00001612644.
DR   EnsemblGenomes-Tr; EBT00001612645.
DR   EnsemblGenomes-Tr; EBT00001612646.
DR   EnsemblGenomes-Tr; EBT00001612647.
DR   EnsemblGenomes-Tr; EBT00001612648.
DR   EnsemblGenomes-Tr; EBT00001612649.
DR   EnsemblGenomes-Tr; EBT00001612650.
DR   EnsemblGenomes-Tr; EBT00001612651.
DR   EnsemblGenomes-Tr; EBT00001612652.
DR   EnsemblGenomes-Tr; EBT00001612653.
DR   EnsemblGenomes-Tr; EBT00001612654.
DR   EnsemblGenomes-Tr; EBT00001612655.
DR   EnsemblGenomes-Tr; EBT00001612656.
DR   EnsemblGenomes-Tr; EBT00001612657.
DR   EnsemblGenomes-Tr; EBT00001612658.
DR   EnsemblGenomes-Tr; EBT00001612659.
DR   EnsemblGenomes-Tr; EBT00001612660.
DR   EnsemblGenomes-Tr; EBT00001612661.
DR   EnsemblGenomes-Tr; EBT00001612662.
DR   EnsemblGenomes-Tr; EBT00001612663.
DR   EnsemblGenomes-Tr; EBT00001612664.
DR   EnsemblGenomes-Tr; EBT00001612665.
DR   EnsemblGenomes-Tr; EBT00001612666.
DR   EnsemblGenomes-Tr; EBT00001612667.
DR   EnsemblGenomes-Tr; EBT00001612668.
DR   EnsemblGenomes-Tr; EBT00001612669.
DR   EnsemblGenomes-Tr; EBT00001612670.
DR   EnsemblGenomes-Tr; EBT00001612671.
DR   EnsemblGenomes-Tr; EBT00001612672.
DR   EnsemblGenomes-Tr; EBT00001612673.
DR   EnsemblGenomes-Tr; EBT00001612674.
DR   EnsemblGenomes-Tr; EBT00001612675.
DR   EnsemblGenomes-Tr; EBT00001612676.
DR   EnsemblGenomes-Tr; EBT00001612677.
DR   EnsemblGenomes-Tr; EBT00001612679.
DR   EnsemblGenomes-Tr; EBT00001612680.
DR   EnsemblGenomes-Tr; EBT00001612681.
DR   EnsemblGenomes-Tr; EBT00001612682.
DR   EnsemblGenomes-Tr; EBT00001612683.
DR   EnsemblGenomes-Tr; EBT00001612684.
DR   EnsemblGenomes-Tr; EBT00001612685.
DR   EnsemblGenomes-Tr; EBT00001612686.
DR   EnsemblGenomes-Tr; EBT00001612687.
DR   EnsemblGenomes-Tr; EBT00001612688.
DR   EnsemblGenomes-Tr; EBT00001612689.
DR   EnsemblGenomes-Tr; EBT00001612690.
DR   EnsemblGenomes-Tr; EBT00001612691.
DR   EnsemblGenomes-Tr; EBT00001612692.
DR   EnsemblGenomes-Tr; EBT00001612693.
DR   EnsemblGenomes-Tr; EBT00001612694.
DR   EnsemblGenomes-Tr; EBT00001612695.
DR   EnsemblGenomes-Tr; EBT00001612696.
DR   EnsemblGenomes-Tr; EBT00001612697.
DR   EnsemblGenomes-Tr; EBT00001612698.
DR   EnsemblGenomes-Tr; EBT00001612699.
DR   EnsemblGenomes-Tr; EBT00001612700.
DR   EnsemblGenomes-Tr; EBT00001612701.
DR   EnsemblGenomes-Tr; EBT00001612702.
DR   EnsemblGenomes-Tr; EBT00001612703.
DR   EnsemblGenomes-Tr; EBT00001612704.
DR   EnsemblGenomes-Tr; EBT00001612705.
DR   EnsemblGenomes-Tr; EBT00001612706.
DR   EnsemblGenomes-Tr; EBT00001612707.
DR   EnsemblGenomes-Tr; EBT00001612708.
DR   EnsemblGenomes-Tr; EBT00001612709.
DR   EnsemblGenomes-Tr; EBT00001612710.
DR   EnsemblGenomes-Tr; EBT00001612711.
DR   EnsemblGenomes-Tr; EBT00001612712.
DR   EnsemblGenomes-Tr; EBT00001612713.
DR   EnsemblGenomes-Tr; EBT00001612714.
DR   EnsemblGenomes-Tr; Shell_R0001-1.
DR   EnsemblGenomes-Tr; Shell_R0002-1.
DR   EnsemblGenomes-Tr; Shell_R0003-1.
DR   EnsemblGenomes-Tr; Shell_R0004-1.
DR   EnsemblGenomes-Tr; Shell_R0005-1.
DR   EnsemblGenomes-Tr; Shell_R0006-1.
DR   EnsemblGenomes-Tr; Shell_R0007-1.
DR   EnsemblGenomes-Tr; Shell_R0008-1.
DR   EnsemblGenomes-Tr; Shell_R0009-1.
DR   EnsemblGenomes-Tr; Shell_R0010-1.
DR   EnsemblGenomes-Tr; Shell_R0011-1.
DR   EnsemblGenomes-Tr; Shell_R0012-1.
DR   EnsemblGenomes-Tr; Shell_R0013-1.
DR   EnsemblGenomes-Tr; Shell_R0014-1.
DR   EnsemblGenomes-Tr; Shell_R0015-1.
DR   EnsemblGenomes-Tr; Shell_R0016-1.
DR   EnsemblGenomes-Tr; Shell_R0017-1.
DR   EnsemblGenomes-Tr; Shell_R0018-1.
DR   EnsemblGenomes-Tr; Shell_R0019-1.
DR   EnsemblGenomes-Tr; Shell_R0020-1.
DR   EnsemblGenomes-Tr; Shell_R0021-1.
DR   EnsemblGenomes-Tr; Shell_R0022-1.
DR   EnsemblGenomes-Tr; Shell_R0023-1.
DR   EnsemblGenomes-Tr; Shell_R0024-1.
DR   EnsemblGenomes-Tr; Shell_R0025-1.
DR   EnsemblGenomes-Tr; Shell_R0026-1.
DR   EnsemblGenomes-Tr; Shell_R0027-1.
DR   EnsemblGenomes-Tr; Shell_R0028-1.
DR   EnsemblGenomes-Tr; Shell_R0029-1.
DR   EnsemblGenomes-Tr; Shell_R0030-1.
DR   EnsemblGenomes-Tr; Shell_R0031-1.
DR   EnsemblGenomes-Tr; Shell_R0032-1.
DR   EnsemblGenomes-Tr; Shell_R0033-1.
DR   EnsemblGenomes-Tr; Shell_R0034-1.
DR   EnsemblGenomes-Tr; Shell_R0035-1.
DR   EnsemblGenomes-Tr; Shell_R0036-1.
DR   EnsemblGenomes-Tr; Shell_R0037-1.
DR   EnsemblGenomes-Tr; Shell_R0038-1.
DR   EnsemblGenomes-Tr; Shell_R0039-1.
DR   EnsemblGenomes-Tr; Shell_R0040-1.
DR   EnsemblGenomes-Tr; Shell_R0041-1.
DR   EnsemblGenomes-Tr; Shell_R0042-1.
DR   EnsemblGenomes-Tr; Shell_R0043-1.
DR   EnsemblGenomes-Tr; Shell_R0044-1.
DR   EnsemblGenomes-Tr; Shell_R0045-1.
DR   EnsemblGenomes-Tr; Shell_R0046-1.
DR   EnsemblGenomes-Tr; Shell_R0047-1.
DR   EnsemblGenomes-Tr; Shell_R0048-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01138; sR23.
DR   RFAM; RF01339; CRISPR-DR27.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002051.
DR   SILVA-SSU; CP002051.
DR   StrainInfo; 163320; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085294
CC   Source DNA and organism available from DSMZ: DSM 12710
CC   Contacts: Iain J. Anderson (IJAnderson@lbl.gov)
CC        Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Staphylothermus hellenicus P8, DSM 12710
CC   Culture Collection ID :: DSM 12710T, JCM 10830T
CC   GOLD Stamp ID         :: Gi02533
CC   Greengenes ID         :: 920
CC   Funding Program       :: DOE-LSP 2007
CC   Gene Calling Method   :: Prodigal
CC   Isolation Site        :: "Shallow hydrothermal vents off
CC                            Palaeochori Bay, Milos, Greece"
CC   Isolation Country     :: Greece
CC   Latitude              :: 36.674
CC   Longitude             :: 24.517
CC   Oxygen Requirement    :: Anaerobe
CC   Cell Shape            :: Coccus-shaped
CC   Motility              :: Nonmotile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Hyperthermophile
CC   Temperature Optimum   :: 85C
CC   pH                    :: 6
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Fresh water, Hydrothermal vent
CC   Energy Source         :: Heterotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1580347
FT                   /organism="Staphylothermus hellenicus DSM 12710"
FT                   /strain="DSM 12710"
FT                   /mol_type="genomic DNA"
FT                   /country="Greece:Palaeochori Bay, Milos"
FT                   /isolation_source="water from shallow hydrothermal vent"
FT                   /note="type strain of Staphylothermus hellenicus"
FT                   /db_xref="taxon:591019"
FT   gene            88..1269
FT                   /locus_tag="Shell_0001"
FT   CDS_pept        88..1269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0001"
FT                   /product="orc1/cdc6 family replication initiation protein"
FT                   /note="TIGRFAM: orc1/cdc6 family replication initiation
FT                   protein; PFAM: CDC6 domain protein; AAA ATPase central
FT                   domain protein; KEGG: predicted protein; K02213 cell
FT                   division control protein 6; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31154"
FT                   /db_xref="GOA:D7DAF7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAF7"
FT                   /inference="protein motif:TFAM:TIGR02928"
FT                   /protein_id="ADI31154.1"
FT                   /translation="MASDIIDEIIESRLKKKSRIFMNKEILHPDYIPETLPHREKEIRK
FT                   LAEILVVALKGERPSNVLIYGLTGTGKTAVAKYVSRRLAEKASALNTRLLHAYVNTRKV
FT                   DTTYRVIASIASSLGLRIPSTGIAISEVYRRYTRALENWGGLHIVVLDEIDYYVRREGD
FT                   DLLYKLVRINEELEKARVAIVGITNDINFVENLDPRVRSSLGEEEIVFPPYDAEQLYDI
FT                   LKQRADKAFYPGVVSSKIISYCAALAAREHGDARRALDLLRVAGEIAEREGSSIVTIKH
FT                   VKKAQIELEEGRVFQAVSTLPLHPKLVLKAIVELMKEKGTSTTGEVYNKYFKIALEYGI
FT                   EPLTQRRISEIITQLDMIGLINAVVVSRGRHGKTKLIKINSGLLDVIEGAIKL"
FT   gene            1266..1841
FT                   /locus_tag="Shell_0002"
FT   CDS_pept        1266..1841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0002"
FT                   /product="protein of unknown function DUF99"
FT                   /note="PFAM: protein of unknown function DUF99; KEGG:
FT                   tgr:Tgr7_2677 protein of unknown function DUF99"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31155"
FT                   /db_xref="InterPro:IPR002802"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAF8"
FT                   /inference="protein motif:PFAM:PF01949"
FT                   /protein_id="ADI31155.1"
FT                   /translation="MKNTIIACDDGYFPQFFKGRKGRTVLACIKTRNNSFIVGIAFKRI
FT                   IIDGRETTPTITDLVKSLKPCKAVLLDGITYAGFDVADAMQIHEETQVPVITVQQYPLN
FT                   LERIKYSLRKHFPDWTKRYEVISRIYRNMYPLSTRWKTIEFSPYGMSPKKASKLLLQTM
FT                   IYSPIPEPLRIADHIASQISRLILRNNY"
FT   gene            complement(1845..1918)
FT                   /locus_tag="Shell_R0001"
FT                   /note="tRNA-Lys1"
FT   tRNA            complement(1845..1918)
FT                   /locus_tag="Shell_R0001"
FT                   /product="tRNA-Lys"
FT   gene            complement(2030..2131)
FT                   /locus_tag="Shell_R0002"
FT                   /note="tRNA-Gln2"
FT   tRNA            complement(join(2030..2069,2092..2131))
FT                   /locus_tag="Shell_R0002"
FT                   /product="tRNA-Gln"
FT   gene            complement(2206..3900)
FT                   /locus_tag="Shell_0003"
FT   CDS_pept        complement(2206..3900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0003"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   afw:Anae109_0183 radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31156"
FT                   /db_xref="GOA:D7DAF9"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034471"
FT                   /db_xref="InterPro:IPR034474"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAF9"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADI31156.1"
FT                   /translation="MALQTTKHIGEISYKLPKVREGEELLAITQSVCPYCYRILPSIVV
FT                   ERDGKVYIRRICPEHGEIEDLYYGDVEIYKKMIKWDIEGRGARHIYTPVTRPCPFNCGL
FT                   CPMHKQHSALVNIVLTNRCNLSCWYCFFYAEAAGYVYEPTIEQIVSMVRQIKKQGIAVN
FT                   VQLTGGEPTLREDLVDIVKALKAEGVRHLQLNTNGIKFSELYWEDPAKAVEYARALRTS
FT                   GVNTIYLSFDGVSPVTNWKNHWEIPYMFEVFRKARMTSIVLVPTVINNVNTHEMGAIVR
FT                   FAAKHVDIVRAVNFQPVSLTGMMKKHERARFRITIPDVIKLIEEQTDGEVPREAWFPIP
FT                   VSAIFSRFIEAFAKEFKFEMANHPMCGAGTYVYVERRSDGTTRLVPITNFVDVEGLLEY
FT                   LKDKWEELLSGSTRLMVGMKILYSIRKFIDQKRAPEGFDLYKMLLNIIIRRNYEALGEL
FT                   HYKMVFLGMMHFMDLYNYDIQRVQRCNIHYATPDGRLIPFCAFNIFEDIYRDKIQREYG
FT                   IPLEEYSKKHGLPPKVITKKYIRNRRLLESTEIYKKAYEGIIELTKR"
FT   gene            complement(4025..4342)
FT                   /locus_tag="Shell_0004"
FT   CDS_pept        complement(4025..4342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31157"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAG0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31157.1"
FT                   /translation="MSEELTSKLENLFNEMKDWERRPVVKSGRIIIELVKLPEKHSRST
FT                   IKPASLALMIRREDAFRGIIIGSAEEIDDLRTAISIEKIRDLAKAIKEFNRKRAIKEFE
FT                   I"
FT   gene            4681..5937
FT                   /locus_tag="Shell_0005"
FT   CDS_pept        4681..5937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0005"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="PFAM: phosphoadenosine phosphosulfate reductase;
FT                   KEGG: gem:GM21_0790 phosphoadenosine phosphosulfate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31158"
FT                   /db_xref="GOA:D7DAG1"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAG1"
FT                   /inference="protein motif:PFAM:PF01507"
FT                   /protein_id="ADI31158.1"
FT                   /translation="MYWMYNVVVKDPGIEDYVRETLSRYYGRWLVLSRKHRSNSYNILV
FT                   STGEKTSIRLIDPITVHIQIDHRLMGQRFKLAKIIEAGRAFLRNHIVWSDTYKLGSKGE
FT                   ILEKYEIKPAYDVWLALGEAYHKLLLSTGLNPPINALINKRFAGEHYVYDGPYLHGKLI
FT                   VPDKGYTLRGVKYRSKVYESIDLDEILKKNNDTLLMNTIVSRRFLNSLGKPDIVLVSFS
FT                   GGKDSLVVLHMAKMHYGEDMVRGIYVDTGVDFPHTRKYVEEISMKIGLDIDIVKADVDA
FT                   LLPKKGLPTKNNRWCTLRKTRAFKKRVKWYKKRFDRILVLVGDRDSESVARARKPPVRK
FT                   REGYLEAAPIKQWSTFLVQLYHLKYDLPLNPLYLKGFYRLGCYICPALTALEKHIMFNY
FT                   MFKELKDLYWFKKFWRKNQ"
FT   gene            complement(5957..6976)
FT                   /locus_tag="Shell_0006"
FT   CDS_pept        complement(5957..6976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0006"
FT                   /product="protein of unknown function DUF1152"
FT                   /note="PFAM: protein of unknown function DUF1152"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31159"
FT                   /db_xref="GOA:D7DAG2"
FT                   /db_xref="InterPro:IPR010581"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAG2"
FT                   /inference="protein motif:PFAM:PF06626"
FT                   /protein_id="ADI31159.1"
FT                   /translation="MLGMFSGNDRVLVIGIGGGGDVVSAAVIAYMLRKLGVKTYIGSIV
FT                   WERFVYDPVPGPVHLGEMRKIKLVDRYVGVIDQESYAVRNGRKIVFQAVNVSRALNEEI
FT                   FVFDLWSGVKGYVEGVNRVAEKYSIDKIVGVDVGGDVLAEGYEDNLWSPLADAMGLAML
FT                   YHFKNSYLIIHSPGSDGELSQEYVLQRLSIIASMKGYYGAIGLDRNDIEILEKILKYAE
FT                   SEASRAALVAFQGFYGNMPIRRNTRSIKINLINTLMFITDPRITYGLSKPAQLVDNTSS
FT                   LEEANNKLDKAGIYTEYNLEKDIQSLNVDPLKLSGEEILNIRKNGIRKLRMMNDQSTD"
FT   gene            7037..7621
FT                   /locus_tag="Shell_0007"
FT   CDS_pept        7037..7621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0007"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="KEGG: Hypothetical UPF0101 protein E02H1.6 in
FT                   chromosome II, putative; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31160"
FT                   /db_xref="GOA:D7DAG3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020618"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAG3"
FT                   /inference="protein motif:PRIAM:2.7.4.3"
FT                   /protein_id="ADI31160.1"
FT                   /translation="MGKVIIIAGTPGTGKTTTAKLLSKKINAVHVDVSRYVIENKLYID
FT                   YDPRHLSYVIDEEKVIEKLIELVEKSDKIVIIDTHYPEILPPDTVEYVFVLRTNPLILE
FT                   DRLRKKGWPWRKIRENVMAEILSIVVSNAINRFSEDKVFEIDTSNKTPEKVVEEITGVI
FT                   KGYIKPSKQRIDWLSLLKPEDIMRYEISGEE"
FT   gene            7624..8424
FT                   /locus_tag="Shell_0008"
FT   CDS_pept        7624..8424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0008"
FT                   /product="GTP-binding protein HSR1-related protein"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   nucleolar GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31161"
FT                   /db_xref="GOA:D7DAG4"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAG4"
FT                   /inference="protein motif:PFAM:PF01926"
FT                   /protein_id="ADI31161.1"
FT                   /translation="MVKGFILAGWNDLRRIVSRADVVLEVVDAREPMNTRSRKLEKIVY
FT                   ELGRELIIVLNKSDLVPRTVVEEWARLLKNRGYNVAYIAATKHMGTRILRRKIKEAAPA
FT                   LPVIVAVTGYPKTGKSSIINALKGRHSASTSPIPGSPGYTHHAQLYRVEKNILMIDTPG
FT                   IIPVEGSSLERILRGISPEQLDDPVPPAVELIRRIIKYSPNAFIRAYGISSKDPYVILE
FT                   ELAVKRGWYYRTTKEPLIEESARTIIRDYHKGKIPYYVKPHEYI"
FT   gene            8481..9221
FT                   /locus_tag="Shell_0009"
FT   CDS_pept        8481..9221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0009"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: xcc:XCC1989 molybdopterin
FT                   biosynthesis protein MoeB"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31162"
FT                   /db_xref="GOA:D7DAG5"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAG5"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ADI31162.1"
FT                   /translation="MLSEKEIERYSRQLPIIGLEGQQKLKKSTVVIVGVGGLGSAASYY
FT                   LAASGIGKLILIDNGLVEESNLQRQILYTTNDIGKSKVEAAAERLRSLNPYIEITPVNE
FT                   FFSENVAMKYFRDVDVVVDALDNWGGRLVIDKVAHKLGKPFIHAGVHGFYGQLTVIIPG
FT                   KTPCLKCVFPKKPSHTVSPLPIIPTTPGVLGVLEANEALKILLGKGEILANKLLVYDGL
FT                   TGMFEVLKLSMAPDCPVCSEYYEK"
FT   gene            complement(9228..9497)
FT                   /pseudo
FT                   /locus_tag="Shell_0010"
FT   gene            complement(9516..9731)
FT                   /locus_tag="Shell_0011"
FT   CDS_pept        complement(9516..9731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31163"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAG6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31163.1"
FT                   /translation="MIKVMILPDRKTLIVDKKSIKAKKLLDLLGIDDPDSVALVINDRV
FT                   IDLDREGENMIKERDKVLMIRQAIGG"
FT   gene            9835..10566
FT                   /locus_tag="Shell_0012"
FT   CDS_pept        9835..10566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0012"
FT                   /product="Protein of unknown function DUF432"
FT                   /note="PFAM: Protein of unknown function DUF432"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31164"
FT                   /db_xref="InterPro:IPR007366"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAG7"
FT                   /inference="protein motif:PFAM:PF04254"
FT                   /protein_id="ADI31164.1"
FT                   /translation="MGYIEDMSGYGVVEDKVSINDYVIAVEKQGEIVHYYRYVNNKVKV
FT                   SKTIVKPARFELVPFYPVMLPIRFTNYILVKLSKKILVPSKEEVTIYVKIPVNLAVYAY
FT                   GRHRRFKIIDVFSINKIKYALYGIPDRGVVARYWRSNPNLDLPEPTMGEAIALVNIRNR
FT                   YDGWVEIGKILLNAQILRLYYIPKSWTAYTQVVIMAVNSRTTATIYYGRRIEANAKPIL
FT                   DPPAFKPPRIPAKTEMLWGLK"
FT   gene            10567..11415
FT                   /locus_tag="Shell_0013"
FT   CDS_pept        10567..11415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0013"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   vsp:VS_II1172 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31165"
FT                   /db_xref="GOA:D7DAG8"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAG8"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADI31165.1"
FT                   /translation="MDGFNATSLAEMFGNISWLRVLIAIIIFVAGAFAASIFKILFYKL
FT                   FIRFLPEHTSRNVARAIYYSTVFVAGVLALGYLGIDLTAFIVAGGIIGIVLGFALQNIT
FT                   ANLFSGLFLYWEKPFKIGDLVRISDIEGWVTDITIMSTRIVGFDGVKIRIPNQTIYQSL
FT                   IRNYYATKVRRIDFVVGIAYKEDAEKAYKVIKKVIDKHPLVLVNPSPDIYVYELGDSSV
FT                   NILVRVWVPSRWDLTYKVIKDLLWKIKKSITEAGIEIPFIQNDVWFRTPLKIRIEESKE
FT                   T"
FT   gene            complement(12241..13458)
FT                   /locus_tag="Shell_0014"
FT   CDS_pept        complement(12241..13458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0014"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; transferase
FT                   hexapeptide repeat containing protein; KEGG: Hypothetical
FT                   protein CBG06266"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31166"
FT                   /db_xref="GOA:D7DAG9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAG9"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ADI31166.1"
FT                   /translation="MTLKNLVLAAGKAKPELSVLIPPGKNKVLLRILGKPVLYYPLTSV
FT                   QRVNREETILVYREGEEEVVETSNSISLGTLTPVKQVEGTSVREAILVAENKLRDTDYF
FT                   FLVYGDIIVDPEAFNLLLSTHYTEEPDATILIVPYDPEYAETYGLAIINEEGYVEKIIS
FT                   GEQARQANQTYIVGGIYILPTTILDYLEENNSLPEAINKLAVNGRVKTVLWNKHWIDIG
FT                   YPTDILEATYQLLSELKYSKISGKAEIESTAIIKGPVIIEDNTYIDHYTVIKGPAYIGE
FT                   KVFIGAHSFIREYNNIEYKVRIGSYNEIKKTNIQPYTLLDSKVTIVDSVIGENCTIETN
FT                   TTILNVLPEKEKPPRLRTHIVYPPTKIIRKMGAVIGYNTRIGASTTISPGKIIKQESII
FT                   KPKSTI"
FT   gene            complement(13524..15362)
FT                   /locus_tag="Shell_0015"
FT   CDS_pept        complement(13524..15362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0015"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="KEGG: gsu:GSU0270 glucosamine--fructose-6-phosphate
FT                   aminotransferase; TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: sugar isomerase (SIS);
FT                   glutamine amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31167"
FT                   /db_xref="GOA:D7DAH0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAH0"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ADI31167.1"
FT                   /translation="MCGIIGVIALPGKTPYSPGVMVYRGLLRLEYRGYDSAGVASIVGE
FT                   HVRVLKGKGRIIDLERRIGLSSIEGLTVIGHTRWATHGTPSDRNAHPHIDCSGRIAVIH
FT                   NGIIQNFRELKKILVEKGHVFRSDTDTEVFPHLVEELYRDTNNLFEAFRKAVEMIDGSY
FT                   ALIMISSIEPDKIFFAKKDSPLIIGLGIGFNILASDIPAILEYTRRIITVRDGWLGYVT
FT                   PTSIHIEDIRGGVVDWRRYIRVVEWSLEDATRGGYAHFMLKEIHEQPRALKDTYYGILH
FT                   DVAVGEAVKLMHDADKIYVTAAGTSFHASYYFSLLMSILGKRLVIPFIASEYESYYLTA
FT                   SDKDLLVVVSQSGETMDALKALRAFRNRGAGVVAVSNVVDSAIPRESNIAVYTRAGPEI
FT                   GVAATKTFTTQTLVLSWLAIAYAEASGSLSKSEADMLRGWLGRSGEVVGKIIARLEPVA
FT                   KRLAEWFRSVGNAYYLSRSIGVPVAMEGALKLKEIAYIHAEAYPAGESKHGPIALVEEG
FT                   FPVIFTIPNREDLEKLLLGNIQEMKARGAVIIGVASENTGLSDQLDYHFRIPDTHWILT
FT                   PITHTPPQQLLAYYTAVSKGYDPDKPRNLAKTVTVE"
FT   gene            15477..16151
FT                   /locus_tag="Shell_0016"
FT   CDS_pept        15477..16151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0016"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.22"
FT                   /note="TIGRFAM: uridylate kinase; KEGG: wsu:WS0238
FT                   uridylate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31168"
FT                   /db_xref="GOA:D7DAH1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011818"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAH1"
FT                   /inference="protein motif:TFAM:TIGR02076"
FT                   /protein_id="ADI31168.1"
FT                   /translation="MDDVLVIKITGKLFDTDASLIKGYVEIFKDLSRKYKLAIITGGGG
FT                   LARKYIGYAREIGVSSNYWLDMIGIRSAQLNAYLLISSLYPKAYPEPVNNLEELLRIIN
FT                   NYEIAVLGGLIPGQSTASVALEVAEALGVNKVIDYSAIDKVYDKDPVKYPDAKPYNKIS
FT                   ITKLREILRQKQLPGEYALIDLRALDIAERSKITIIITHYKKPETIYDILRGENPGTII
FT                   YP"
FT   gene            complement(16157..16852)
FT                   /locus_tag="Shell_0017"
FT   CDS_pept        complement(16157..16852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0017"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   slo:Shew_2320 RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31169"
FT                   /db_xref="GOA:D7DAH2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAH2"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ADI31169.1"
FT                   /translation="MYVRVVLVGVEGSVNLGFIARTCVNFSVDELYLVKPAADLGEALR
FT                   YAAKARDYLKKAIIVDDLADAIRDVDLVVATTAKGYSVGDVVRQAVPLKDFADMIRGRV
FT                   NRLAILFGRESTGLTRKELRYADVLVTIPANPEYPVLNLSQAVAVFLWEIWNIKGIRAE
FT                   NIPPPAEKEEIEFVLKLIHDISSKVLVKDEKVLRIMEIWKKIIYRSRISKYEARLLTYW
FT                   LRKVLGRLE"
FT   gene            complement(16837..17364)
FT                   /locus_tag="Shell_0018"
FT   CDS_pept        complement(16837..17364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0018"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: msu:MS1588 16S
FT                   ribosomal RNA m2G1207 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31170"
FT                   /db_xref="GOA:D7DAH3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAH3"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ADI31170.1"
FT                   /translation="METIRDNNYFNNCIDLGCGTGVVGLYLLSKNICSKTVFIDINPVA
FT                   LLNTVYNLKLNYYQHRGLVASISSDSILENYFDLVVANPPYLPGIPENLYDYSLVGGSG
FT                   GYEAVLEFIDLAYYFLVENGVFYLVYSSLSQPSIIENYLSKKCFRIIRKNIKHFFFEDI
FT                   IVVEAVKKCMLE"
FT   gene            complement(17445..18251)
FT                   /locus_tag="Shell_0019"
FT   CDS_pept        complement(17445..18251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0019"
FT                   /product="ribosomal RNA adenine methylase transferase"
FT                   /note="KEGG: rty:RT0666 dimethyladenosine transferase;
FT                   PFAM: ribosomal RNA adenine methylase transferase; SMART:
FT                   Ribosomal RNA adenine methylase transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31171"
FT                   /db_xref="GOA:D7DAH4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAH4"
FT                   /inference="protein motif:PFAM:PF00398"
FT                   /protein_id="ADI31171.1"
FT                   /translation="MSAPPLTSSRTLYFWTVNILRKHGVRPRKKLSQNFIVNPRIIHDF
FT                   LKHVLPNKTLLEIGAGIGSLSYYLSRKVSKYSVFIEIDERLSRICRDLISPRGILINGN
FT                   ALDLDWSVEQVFSNAPYHITSDIIVKTARSNSVEYAVFVFQKDVVDRLLARPGTKEYGR
FT                   ITVLTRLVFDIERGPTYPPVFFYPRPEVSSQMIILKRKRRYDEVISRVEEVTRLLFSKR
FT                   RKKALKTIMRELGLSIDDVRRLGVDEKARVYDLSPEVFLKLAEEII"
FT   gene            complement(18285..18926)
FT                   /locus_tag="Shell_0020"
FT   CDS_pept        complement(18285..18926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0020"
FT                   /product="Protein of unknown function DUF655"
FT                   /note="PFAM: Protein of unknown function DUF655"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31172"
FT                   /db_xref="InterPro:IPR007003"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAH5"
FT                   /inference="protein motif:PFAM:PF04919"
FT                   /protein_id="ADI31172.1"
FT                   /translation="MHAYRRRPGRRGERRFYCREPYMIVLDFMEFGNPTDRHYEHRNQP
FT                   VAQGIGTKYFTLLEAVPLPAIRLEIFEKVDLGPHSKVRKPIRIVYDDLTSVARTNLEEA
FT                   VKRIILKNEKNFVEFFNIAEPVNIRLHALELLPGIGKKTMRTILYERENKRFESFKEIH
FT                   ERTKIDPVKVLVERILDELRGGEKYYLFIKPPEGKGIYLGYLERIYGEIF"
FT   gene            complement(19053..19415)
FT                   /locus_tag="Shell_0021"
FT   CDS_pept        complement(19053..19415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0021"
FT                   /product="RNA polymerase Rpb4"
FT                   /note="KEGG: MGC85403 protein; K03012 DNA-directed RNA
FT                   polymerase II subunit D; PFAM: RNA polymerase Rpb4; SMART:
FT                   RNA polymerase II, Rpb4, core"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31173"
FT                   /db_xref="GOA:D7DAH6"
FT                   /db_xref="InterPro:IPR005574"
FT                   /db_xref="InterPro:IPR006590"
FT                   /db_xref="InterPro:IPR010924"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR038324"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAH6"
FT                   /inference="protein motif:PFAM:PF03874"
FT                   /protein_id="ADI31173.1"
FT                   /translation="MAEELDVEVLEEKLLSNPEAYKLLKKAVDKIQEREGSVSMLLSKT
FT                   LHYLSEFSKMEPESSEALRNVLKNMDLKDETIVMIINICPQTLDELRILFELEEKVIDT
FT                   ETAQQILEAIKPYCKE"
FT   gene            complement(19464..19763)
FT                   /locus_tag="Shell_0022"
FT   CDS_pept        complement(19464..19763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0022"
FT                   /product="Ribosomal protein L21e"
FT                   /note="PFAM: Ribosomal protein L21e; KEGG: hypothetical
FT                   protein; K02889 large subunit ribosomal protein L21e"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31174"
FT                   /db_xref="GOA:D7DAH7"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="InterPro:IPR022856"
FT                   /db_xref="InterPro:IPR036948"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAH7"
FT                   /inference="protein motif:PFAM:PF01157"
FT                   /protein_id="ADI31174.1"
FT                   /translation="MVKAPKGYRHRTRKVFSKHIREKGAVPPLSLLMIDYKPGDKVHIV
FT                   VNPAIHKGMPHRRYHGKTGIIIGKRGKAYIVKVTLGDKEKTLFIRPEHLRPAKA"
FT   gene            complement(19886..21199)
FT                   /locus_tag="Shell_0023"
FT   CDS_pept        complement(19886..21199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0023"
FT                   /product="THUMP domain protein"
FT                   /note="PFAM: THUMP domain protein; KEGG: PUS10;
FT                   pseudouridylate synthase 10"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31175"
FT                   /db_xref="GOA:D7DAH8"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR005912"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR039894"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAH8"
FT                   /inference="protein motif:PFAM:PF02926"
FT                   /protein_id="ADI31175.1"
FT                   /translation="MEESSTENQSAKIIKTAKALLARYPLCHHCLGRQFAKYGLQLKNS
FT                   ERGYAIKTILQMILHKELQDKIIDKETLRKYAVNAGDPITRLYEKIYEEKVEPAKCYIC
FT                   GNKLGEEYFEDLARKVAELLEQYNAYTFIVGVSLSQETMLREIEVSSFSGLETSESIKN
FT                   EIKREVGKIVRDKYGYIPDFDRPDVMVIIDYETDMVRAVVNPILFEGRYWKRGRNISHT
FT                   IWLSKTGIKEYPYSLEEFFNDRLREIFESERIVLHASGREDVDARMLGTGRPMVIEVKN
FT                   PRFRYVDMDLINELLRSTLIEAEITGYSSRAKIEYLKGEGSKKRKAYKILVYTAEPITS
FT                   DKLRMLEEEYRNRVIHQRTPKRILRRKKDTLRIRRVYEVKTKLLHNKLFEAIVYCDGGL
FT                   YVKELVHGDDGRTTPSFSDVLGVQAYPLELDVFVVETK"
FT   gene            complement(21156..21740)
FT                   /locus_tag="Shell_0024"
FT   CDS_pept        complement(21156..21740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31176"
FT                   /db_xref="GOA:D7DAH9"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAH9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31176.1"
FT                   /translation="MNYRPQRTIIVSINNLCNNIETIKNIVLHSLLISHGIRIDTTLYI
FT                   IDHTRKIVYSLNGYELRHLYAEEKSLKGFITRFFCENKLFVGTNIYPLSIFSMKNNSYD
FT                   LVLTTSVQNYSDEKIIVWSPLTSILFNILIIDNYSMKHLNLLRYSTILTVKAPDIVSFI
FT                   IFSHYIIDKVFGGWIRRYGRIEYREPISQDN"
FT   gene            complement(21737..23071)
FT                   /locus_tag="Shell_0025"
FT   CDS_pept        complement(21737..23071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0025"
FT                   /product="GTP-binding signal recognition particle SRP54
FT                   G-domain protein"
FT                   /note="KEGG: srp54; signal recognition particle 54; K03106
FT                   signal recognition particle subunit SRP54; PFAM:
FT                   GTP-binding signal recognition particle SRP54 G- domain;
FT                   Signal peptide binding (SRP54) M- domain protein;
FT                   GTP-binding signal recognition particle SRP54 helical
FT                   bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31177"
FT                   /db_xref="GOA:D7DAI0"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAI0"
FT                   /inference="protein motif:PFAM:PF00448"
FT                   /protein_id="ADI31177.1"
FT                   /translation="MIDMVLDGVRKALSRFLSGKGDYERAVKEFIRDLQKELIKADVNV
FT                   RLVLELTKKIRERALEEEPPPGITRREWFINIVYEELSKFFGGDRKPDIKPKKKPWVML
FT                   LVGLQGSGKTTTAAKLAYYYKLEGYRVGLVTADTYRPAAYDQLKQLGEQIGVPVYGEPN
FT                   NKDAVEIARRGVEYFVSRGFDIVIVDTAGRHHREEDLLKEMREIAENIKPDEVVLVIDA
FT                   AIGQQAHNLAKKFHTATPIGSIIVTKLDGTAKGGGALSAVAVTGATIKFIGTGEKIDEL
FT                   EVFRPPRFVARILGIGDLEGLVEKVRRIKVEFTEKDVEEFLSGRLNMRLVYKQLVSLRK
FT                   MGPLRKILQMIPGLSLKIPLEIEAGKAEEKIKKWLAIINSMTYEELDKPEIIDRRRTRR
FT                   IAYGAGVKTEDVRELLKQYEMMKKLSKQLRKRKDLLKKLQLGFKP"
FT   gene            23318..24193
FT                   /locus_tag="Shell_0026"
FT   CDS_pept        23318..24193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31178"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAI1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31178.1"
FT                   /translation="MKNIVSLLIVFAVVFASCGILFHQSINRNKFVIDKNGLKRFLEGQ
FT                   YVSSVGLLRASTTVYPDNITIYIVNDNVLAAKALIVLASPLTFKIIAELNNEYSGGWNG
FT                   KIDVLLGRDIPDTFYSSYNLLVKEIDGYKVVWEKLNYSSPITDWYNYADLLVYHALDKL
FT                   LQGSRREAEESFINLTKMWDGYGFRDKAYYETQTYAVYKCALFIYLYRALQYAGSKIIN
FT                   DYSYIYDKCLSIIAKAQDPKYGGIHTDYRVVDGEIVVEGDMNTETTSIVVLALYSNYPK
FT                   IIGEHAEPTL"
FT   gene            complement(24308..24715)
FT                   /locus_tag="Shell_0027"
FT   CDS_pept        complement(24308..24715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0027"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: atc:AGR_L_62 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31179"
FT                   /db_xref="GOA:D7DAI2"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAI2"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADI31179.1"
FT                   /translation="MVVEENKLLERAVNRLVKILNVKGIILFGSRARGDWMPWSDYDIL
FT                   IIADFKEKYLDRIKTVLDIIGDIPLNIEPHPYTLREALDMLRKGNPLIVDALEEGKILY
FT                   ATNDLEEIIKEYEKLKKKGLKRTNTTILIPK"
FT   gene            complement(24696..25106)
FT                   /locus_tag="Shell_0028"
FT   CDS_pept        complement(24696..25106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0028"
FT                   /product="HEPN domain protein"
FT                   /note="KEGG: hypothetical protein; PFAM: HEPN domain
FT                   protein; SMART: HEPN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31180"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAI3"
FT                   /inference="protein motif:PFAM:PF05168"
FT                   /protein_id="ADI31180.1"
FT                   /translation="MRNEAIRWLDEALWDYETALILHREKRYNASAFYSHQAAEKAVKA
FT                   LLYFINEAPWGHSVRTLLLRYFEKKSINPDQELLRCARELDRHYIPSRYPNALPAGTPH
FT                   EAYDEETSRRALEASKKIVDYVRKVIYGGRRE"
FT   gene            complement(25263..25350)
FT                   /locus_tag="Shell_R0003"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(25263..25350)
FT                   /locus_tag="Shell_R0003"
FT                   /product="tRNA-Leu"
FT   gene            complement(25467..26849)
FT                   /locus_tag="Shell_0029"
FT   CDS_pept        complement(25467..26849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0029"
FT                   /product="adenylosuccinate lyase"
FT                   /note="KEGG: erg:ERGA_CDS_02460 adenylosuccinate lyase;
FT                   TIGRFAM: adenylosuccinate lyase; PFAM: fumarate lyase;
FT                   Adenylosuccinate lyase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31181"
FT                   /db_xref="GOA:D7DAI4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAI4"
FT                   /inference="protein motif:TFAM:TIGR00928"
FT                   /protein_id="ADI31181.1"
FT                   /translation="MASLHSNKKHLDPVCVFDWRYGSPEMKHLFSRSHIIHNMILVEEA
FT                   LMEALVEAGIASRKALDEMKQAIDKVRPEDVYEKEKETGHEIIALIELLAENAGSEAAR
FT                   WIHYGATSNDIIDTAWALTLREALGLIKKKLAEIIKFLSEKALETIDVLMVGRTHGQHA
FT                   LPITLGFKIANYIYELSQSYERICDAMRRAVRAKIGGAVGTMAAWGEKGLFIREIICRK
FT                   LKLNPHIITTQVAPRDSLAELASALTILACQLDRFAVEIRELSRPEIMELWEDRSGKLG
FT                   SSAMPHKANPVTAERISGLSKIARSLLIGFYENIVLWHERDLSNSSAERILIPHIFLAI
FT                   DQILEDTKNLLQRLRWDPQRMRENLELTKGAIMAEALMNLLIKENKMKRKEAYKIAKEL
FT                   ARKAQEENKPLYEVAAEDPRINKHYSLLRLREELDPHNYLGQAKKLVEQAIQYAEEVLR
FT                   KC"
FT   gene            complement(26881..28302)
FT                   /locus_tag="Shell_0030"
FT   CDS_pept        complement(26881..28302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0030"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; HI0933 family
FT                   protein; KEGG: dvl:Dvul_2322 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31182"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAI5"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADI31182.1"
FT                   /translation="MVLYDVAIIGAGPAGLFASLALAEEARRGRVGVALLERGPRAHHR
FT                   HCPLLEYGYCRNCKPCMIMEGVGGAGLFSSGIINLRPDIGGDLHKLLGSWSEAQKLIDI
FT                   IDKVFLYFGAPKNRLFEPDSSKIAELERKALRAGAKFIPAKQRHIGSENTVKIVEAMTS
FT                   YLEKMGVKIHVLTHVYHIEAKREGYVLKTNKGDLEAKTVIIAPGRSGSHWLSMEAQRLG
FT                   LETEPGPLDVGVRVETPYRVMEPLTSIIPDPKVVFYTKTYDDKVRTFCTNPKGFVVKEV
FT                   YRDGLVGVNGESYVSRKSMNTNFAFLVTIKLTNPMEDALEYGRSIARMATKLGGGKPLI
FT                   QRLGDLISGRRSTRDRIGRSVVEPTLKEATPGDIGMALPHRIITDILEGLEKLDDLAPG
FT                   VWSKHTLLYAPEVKYYSLKIRVKAPTMETNLPGLYVAGDGAGLSRGINVAAATGYLAAK
FT                   GVAERLGIEARLPVE"
FT   gene            complement(28302..29321)
FT                   /locus_tag="Shell_0031"
FT   CDS_pept        complement(28302..29321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0031"
FT                   /product="Adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG:
FT                   bpy:Bphyt_2530 adenylosuccinate synthetase; SMART:
FT                   adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31183"
FT                   /db_xref="GOA:D7DAI6"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAI6"
FT                   /inference="protein motif:PRIAM:6.3.4.4"
FT                   /protein_id="ADI31183.1"
FT                   /translation="MSVHIVVGGFFGDEGKGKIVGYLALSQNPWGCVRTGATNAGHTVT
FT                   YRGRTWRLRAIPSGFINHKTKLYIARGALIDLEVFLSEAHALGVGNRVWLDFNTGIITS
FT                   EHVARERMNSYLMEHIGSTGTGVGSAMSDRVFRRLRLARDYPELRNMVTDTQQEILEAI
FT                   DQGELVLIEATQGYWLSLYHGTYPYVTSRDTTASAALSEVGLGPRSVDRITVVFKAYVT
FT                   RVGSGPLPGEISREKAVKLGWAEYGTVTGRPRRAAPFNSELARRAVKANTATDIALTKI
FT                   DILFPQARCKKRWDDLPREAKLWIGNIEDKLGAPVVLIGTGEDVECTIDLSREKGVEG"
FT   gene            complement(29471..30088)
FT                   /locus_tag="Shell_0032"
FT   CDS_pept        complement(29471..30088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0032"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: sat:SYN_03353
FT                   xanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31184"
FT                   /db_xref="GOA:D7DAI7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAI7"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ADI31184.1"
FT                   /translation="MENIEYIPWSKAIKLCYKLAEKILDSKYVPDTIIAVLRGGAIPAL
FT                   IISDYLGVEEFYGMRVKHWGIASKKLDKPVILQMPENLKHKKLLIVDEVADTGLTLKTI
FT                   IEELKKQKPQDIKTAVLHVKPTTKYMPDYYVEYLKEWRWIFYPWSVSETLSSLARRGSS
FT                   IRDLDKIYDKVRELARSFNIVEPDIKVILKSIKTYIEKYKNI"
FT   gene            complement(30103..31692)
FT                   /locus_tag="Shell_0033"
FT   CDS_pept        complement(30103..31692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0033"
FT                   /product="GMP synthase, large subunit"
FT                   /note="KEGG: gur:Gura_3123 GMP synthase; TIGRFAM: GMP
FT                   synthase, large subunit; GMP synthase, small subunit; PFAM:
FT                   glutamine amidotransferase class-I; GMP synthase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31185"
FT                   /db_xref="GOA:D7DAI8"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAI8"
FT                   /inference="protein motif:TFAM:TIGR00884"
FT                   /protein_id="ADI31185.1"
FT                   /translation="MCCNGFDAVLNALSTLDDKGPDKVLVVDFGGQYAHLIARRVRELN
FT                   VYSLVANYSIVDEGFIDKIKPKAIILSGGPSSILCRKHPRIGDWILDLNIPVLGICYGH
FT                   QLLAVMIGGRVETGRGEYGRTMIKIINKDPLFEGWSSEEYVWMSHRDYVAELPSNTKIL
FT                   AISENGYIAAFKISDKKIYGVQFHPEVYHTRKGMLLLKNFLFNIARVKPEWRMENIVDN
FT                   IVENIRRKVKPYEKVLVAVSGGVDSTVTALLVKKAVGKRLVPVFVNHGLMREGEVEEVL
FT                   ENLRSLGINPIYIDASNRFLERLKGIRDCEEKRRIIGEEFARIFSDIVRRDKDIKWLAQ
FT                   GTTYPDVIESGSTPGSDRIKSHHNVAGLPDWLGLKVLEPLRELYKDEVRRLALHLGVPK
FT                   DVAYRHPFPGPGLAVRIIGEVNEEKLRIVRRASRIVEDVLKKHNLYDRVWQAFAVVGDD
FT                   KWVGVKGDKRQHGYIVIVRVVESVDGMTADWVRIPYEVLDEISKRITSEISEVVMVTYA
FT                   ITTKPPSTIEPC"
FT   gene            complement(31915..32790)
FT                   /locus_tag="Shell_0034"
FT   CDS_pept        complement(31915..32790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31186"
FT                   /db_xref="GOA:D7DAI9"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="InterPro:IPR025962"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAI9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31186.1"
FT                   /translation="MNMITCVISVFIGLILIITGIILYLFAERIPRNLLFGFRIGYTLS
FT                   SKKLWVKYNRLSGIVLVFIGLVTLFLPLFISNIMVLILILLGLIIVSTITLTYMASREA
FT                   KQELSFETVGLGVAGRRIWRIMPVKPSPLRIILAVLPPLLSIILTLYLLPYLPNLIPVH
FT                   YDISGAPNRWDTLNDFLKITFPFIIGIECLPLIFMLVEIKAPMIFYAPRLPKKKFVNLL
FT                   YDIGIMMAWLVMLVYIDILYYAINNKHIIPMTMFTVLILIVVAIILVEITWLTIRWKKN
FT                   WGMLKYNSYG"
FT   gene            complement(33022..33165)
FT                   /locus_tag="Shell_0035"
FT   CDS_pept        complement(33022..33165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAJ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31187.1"
FT                   /translation="MKILRTGFYTVIILGLLKKHDPLYGYKIKPLIKQLSNNILDPREQ
FT                   SI"
FT   gene            complement(33214..33666)
FT                   /locus_tag="Shell_0036"
FT   CDS_pept        complement(33214..33666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31188"
FT                   /db_xref="GOA:D7DAJ1"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAJ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31188.1"
FT                   /translation="MVESKYVLYGLVSGAVSGLVAGILTYLTLPSVDAVLEQVRSRINI
FT                   TSVPEDILRSYISLGLILAPFIIFFIALILGALFGALYDFLDQKIPGSPIIAVLLTGTI
FT                   YAGILVLPNIVLGGSQQNIIVNSGLTITYTLVLIALTIYKNPRKQG"
FT   gene            complement(33659..34327)
FT                   /locus_tag="Shell_0037"
FT   CDS_pept        complement(33659..34327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31189"
FT                   /db_xref="GOA:D7DAJ2"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAJ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31189.1"
FT                   /translation="MIGLLPPLIIVIVSIIVLLILYSATKSFSIEAFLIGIGLLILTLI
FT                   IQPPIQQLPILLLRINPEASIVTLLLVLLYAALVSGFLQELLKLIGVRGKNIVYALWLG
FT                   AGFGFGEASLVVLNQLINIFSGINIPLFLGLASCYERFIVLLYHVFSAAILLQYYMRGK
FT                   GLFIYVVMALTHSLMNYQAILLVKLYGSSIPILLVVYTVISVVVLFLYTIYRQGMRRLG
FT                   "
FT   gene            complement(34351..34680)
FT                   /locus_tag="Shell_0038"
FT   CDS_pept        complement(34351..34680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0038"
FT                   /product="protein of unknown function DUF74"
FT                   /note="PFAM: protein of unknown function DUF74; KEGG:
FT                   hch:HCH_01985 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31190"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAJ3"
FT                   /inference="protein motif:PFAM:PF01906"
FT                   /protein_id="ADI31190.1"
FT                   /translation="MEDILLTTTENIPGYRIVKVLGIVSANTVRARHIGRDFVASLRNI
FT                   VGGEIKEYAELLQQSRKYVLDKLKEEARKLGANAVVGIRFGTASTMQRAAEILAYGTAV
FT                   VVEKS"
FT   gene            34808..35099
FT                   /pseudo
FT                   /locus_tag="Shell_0039"
FT   gene            35184..35546
FT                   /pseudo
FT                   /locus_tag="Shell_0040"
FT   gene            35583..36281
FT                   /locus_tag="Shell_0041"
FT   CDS_pept        35583..36281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0041"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: tgr:Tgr7_1686
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31191"
FT                   /db_xref="GOA:D7DAJ4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAJ4"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ADI31191.1"
FT                   /translation="MVKNMARIKVKLVSWDEIVDWAWNLAKIIKDNGYKPDVIVALARG
FT                   GYVPARLLCDFLDVENLLSIQSQHWTEAAKAEEKAIIKFPYKVDLHDYRVLVVDDIVDT
FT                   GDTLKLARDFVAENWKPKELKTAALQWISPVAKFKPDYYYIEVKDWTWFQYPWTRLEDT
FT                   YQFIKRMMTETYKETGKKEWSYEEIIDGFKEWYGIDVGDRYYKDALNILVEKQFIKYDE
FT                   ASNKYVLLTM"
FT   gene            36294..37118
FT                   /locus_tag="Shell_0042"
FT   CDS_pept        36294..37118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0042"
FT                   /product="methylthioadenosine phosphorylase"
FT                   /note="KEGG: glo:Glov_3607 methylthioadenosine
FT                   phosphorylase; TIGRFAM: methylthioadenosine phosphorylase;
FT                   PFAM: purine or other phosphorylase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31192"
FT                   /db_xref="GOA:D7DAJ5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAJ5"
FT                   /inference="protein motif:TFAM:TIGR01694"
FT                   /protein_id="ADI31192.1"
FT                   /translation="MVLVKPPVKAEIGVIGGSGLYEIPDLQNIREYKIYTPYGMPSDNI
FT                   IVGELRGRTIAFLPRHGRGHKIPPHRINYRANIWALKSIGVKWIIAFSAVGSLREDYEP
FT                   GDFVVPDQFIDMTKGIRPTTFFEGGVVAHVSMADPFCEHLREIIIDAAKEIDGLMLHNK
FT                   GTYICIEGPRFSTRAESRIWKEVFKADIIGMTLVPEVNLACEAQTCYATVAMITDYDVW
FT                   AEKPVTAEEVVRVMNENTVKAKKLLPKIIERIPEKPLEDKCSCCKSLETALV"
FT   gene            37085..38002
FT                   /locus_tag="Shell_0043"
FT   CDS_pept        37085..38002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31193"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAJ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31193.1"
FT                   /translation="MLQKLRDSASINKYVKHIERLESRSRILAEKIIDFLNLNEEYVII
FT                   TYNRQGYLPASILYWFILTMEPESRVVFGDANTVSYYIVAYREPGKTLFLATNPFSGAT
FT                   ITLLQSSSLTGNKVFFITPKPADLRLIDMLSKYDPIYIEFNDELEASLLMSMAAYHAAS
FT                   KHYKDKLGRRGSRLYKHSLEGFTVVINELLEKYMDQLEKISMLKEVIVSSSKILEPSSL
FT                   FFVEALRRIGVKTHYEAPEQIVGPTNVLLLTTSVEEYYAREILFKMNMMNTKTIHLPIN
FT                   TDPLEAQIYYAVLAYYLVHSRNKT"
FT   gene            37977..38369
FT                   /locus_tag="Shell_0044"
FT   CDS_pept        37977..38369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31194"
FT                   /db_xref="GOA:D7DAJ7"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAJ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31194.1"
FT                   /translation="MFIVGIRLDITVILMVIEKILYSRKMISLLLFLLYIDIAYVSAVF
FT                   NRDALIYGTIVSVIILGYLAYYSHSHRSAKEVLALTVFTSLALILGLITGIIFGGYNDI
FT                   GASMYALTMAISILLILYFANRIYRI"
FT   gene            38344..39282
FT                   /locus_tag="Shell_0045"
FT   CDS_pept        38344..39282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0045"
FT                   /product="alpha-L-glutamate ligase, RimK family"
FT                   /note="KEGG: aap:NT05HA_1236 ribosomal protein S6
FT                   modification protein; TIGRFAM: alpha-L-glutamate ligase,
FT                   RimK family; PFAM: RimK domain protein ATP-grasp; protein
FT                   of unknown function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31195"
FT                   /db_xref="GOA:D7DAJ8"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAJ8"
FT                   /inference="protein motif:TFAM:TIGR00768"
FT                   /protein_id="ADI31195.1"
FT                   /translation="MPIEYTEYEYMVLVIDMRILLLHYKATPPWSVKELENAAVKLGHT
FT                   PVYLRINNLDAQITSNGDILVRHHDEIVEGEGGVIRGIGLRLTLETFMRRIGLLEVLDQ
FT                   LIPLINKPETIMIARDKWRSLIELSKHGLPVPETIITENPFTAKRFVEKHGKAVFKPLM
FT                   GSLGLGSSLILDPDIAFHITRTMFNLNLPSYYQVYIEKPGYDFRVFIVGDQVIGAMKRV
FT                   GLSWKTNIFQGARGEKISEKDYPEVFDLGLKASRALGLDYAGIDIVYDIVNDKYYIIEV
FT                   NAFPQWKGLKTATGVDPAIHIIKHLIDIIRR"
FT   gene            complement(39359..39976)
FT                   /locus_tag="Shell_0046"
FT   CDS_pept        complement(39359..39976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31196"
FT                   /db_xref="GOA:D7DAJ9"
FT                   /db_xref="InterPro:IPR011672"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAJ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31196.1"
FT                   /translation="MKLIHIFTRTTLYVISGIVTYLSLSTATNTYYAVLETTIIVAAII
FT                   ISDLKKSFIRIGKSIGLSIAGFIIPFIFSIELILRLYNIFSSVALDFFIGLLICIIINY
FT                   LNSITYRKLGVLLLDLLIPLLTISAVSVIIVTKNNLDPLLVSPLSIVLGSFSSIIGLDL
FT                   LNMRRELGKIYVFGGNNVFDAIFLETFLAPSLSYAILVLSIM"
FT   gene            40061..40933
FT                   /locus_tag="Shell_0047"
FT   CDS_pept        40061..40933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31197"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAK0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31197.1"
FT                   /translation="MDPTILKSMIEGVHLSVYAAIKPGAIHRLRLDKRIEYYVSNTIAA
FT                   INHIIDAIEYGEKIRRGDLAATSLGLGRLLSKGLREAYRWLPNNVYPSFIVPQIIYSLA
FT                   ISHSDIDSIIKDHGKLVRSLDLFISTTSWKEIKYFIDALKGVHREDMYEHLSSAGISHI
FT                   AGIGEGVSFRDVFRVLGSKWYAFISLDTRESKTYEYVKKLLDYYRKFRDANNAIIALYL
FT                   EMIMPRLPSWAKPYVEEAFKEGLMASRVGSKKLFELDLKLRKHGVSFNEYVGLLGIITG
FT                   LAVYEGLRA"
FT   gene            complement(40941..41747)
FT                   /locus_tag="Shell_0048"
FT   CDS_pept        complement(40941..41747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0048"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: mxa:MXAN_0661
FT                   S54 family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31198"
FT                   /db_xref="GOA:D7DAK1"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAK1"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ADI31198.1"
FT                   /translation="MEGEYSLGIPVHQTAPRKSPVVTLSIILVNTVVFILMYIEPQLLV
FT                   PGATNVYEVQRQLAMIPIAIVRGERLWTIFTAMFTHADIYHLLGNMIFLFFFGGPVESV
FT                   MSRKRYLLFYFLGGIMADVFHILSITIIPSHYLITGKTIINPWVTPTLGASGAISAVMG
FT                   AYLIYYPRSRITMVYPIWIIPLIFTLPAWVYILLWFSYQLIMGLITLLGFASSIAFWAH
FT                   IGGFISGIAFAPFFMDPAIKEQIRMYKAMLKEFMEEETPYYEEEFY"
FT   gene            complement(41737..42480)
FT                   /locus_tag="Shell_0049"
FT   CDS_pept        complement(41737..42480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0049"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: rhi:NGR_c30440
FT                   putative metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31199"
FT                   /db_xref="GOA:D7DAK2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAK2"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADI31199.1"
FT                   /translation="MLKILATADIHSPRFLDLFIKSLNKVKIRPDLIILAGDLVDKNNI
FT                   YALKHVYEIIIDKYGKTPIISVFGNEEYRGFEDEYRKMYPVFKWLDDEYIILEINGLKI
FT                   GIIGTRGALDKPTPWQSRHMPWLYRYYQELPSKISALIDEARIKGAQYVFLVSHYGVTY
FT                   KNLEGEPRNIWPYLASSRMEKIIKNKRIDLVIHGHAHNGVRDKINIDGAEVYNVSLPAR
FT                   REVVIIDFTPKSKVFGLEKWLHSGG"
FT   gene            42570..42809
FT                   /locus_tag="Shell_0050"
FT   CDS_pept        42570..42809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31200"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAK3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31200.1"
FT                   /translation="MTIGLLKGVNKSGHKGWTTVKCAICHKDIDLFKAVDTGDAYYCPR
FT                   CLANGREAFFCAADAKRLHYKCPYCGGELKPYYL"
FT   gene            complement(42816..43028)
FT                   /pseudo
FT                   /locus_tag="Shell_0051"
FT   gene            43053..43721
FT                   /locus_tag="Shell_0052"
FT   CDS_pept        43053..43721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0052"
FT                   /product="PHP domain protein"
FT                   /note="KEGG: ank:AnaeK_1370 PHP domain protein; PFAM: PHP
FT                   domain protein; SMART: phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31201"
FT                   /db_xref="GOA:D7DAK4"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAK4"
FT                   /inference="protein motif:PFAM:PF02811"
FT                   /protein_id="ADI31201.1"
FT                   /translation="MHIHSTYSDGRASPKEIILTAIYKGLNIISITDHNSFQGSVAASK
FT                   LAKDLVREYGEQLLVIIGNEVRSDKGDILVYCYEPIDVPRRVDYLIDKAHENNCLVVPA
FT                   HPFDTLRFGVGDALFEYNGWDAIEVWNASANPRANREALKASKILGIPGIANSDAHIPE
FT                   AIGSAYTVLELDKLSVESVFKAIKNGKVHPHFGYPPFKVFIKRVEWSIERRVRKFLGRE
FT                   "
FT   gene            complement(43761..46247)
FT                   /locus_tag="Shell_0053"
FT   CDS_pept        complement(43761..46247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0053"
FT                   /product="aminoacyl-tRNA synthetase class Ia"
FT                   /note="KEGG: rbe:RBE_0509 valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31202"
FT                   /db_xref="GOA:D7DAK5"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAK5"
FT                   /inference="protein motif:PFAM:PF00133"
FT                   /protein_id="ADI31202.1"
FT                   /translation="MVVSVKTLTGREKLNEQRFKPLIEEKRWNIKWEKDLYRKWEEMGL
FT                   FKFTFREDDPREIIAIDTPPPYASGKWHVGGAAHYAQIDMIARYFRMKGYNVLVPFYAD
FT                   RNGLPVEVQVEKTYGINPHETAKTPEGREEFLRLCRKFLDKAEKDIVKIWRMLGCSFDY
FT                   WRNGTDSEEYRKITQATFIELYKKGLIYEAERPVNWCPRCKTTLADAELEHKEVEGYLY
FT                   YIKFKVKETGEEVVVATTRPEMLRACKALVFHPEDNRYKHLNGLHAINPLYGHEMIITT
FT                   YPEVDPKFGTGLVMVCSYGDQTDVKMFRDLGLKPTIIIDKDGRLTPETGPLSGLKVEEA
FT                   RRKAAEILEEKGLLVKKEKIKHSVPVCWRCKTPIQIIHTKEWFLKQLDFKDEIRKIAEK
FT                   IEFKPEIHRKKLLDWIDSVSTDWPISRDRYYGTEVPVWRCKKCGSVLLPEPGKYYRPWR
FT                   DEPPWDKCPVCGAPKEYLEGEKKVFDTWFDSSISVLYVTGYKRNDKLFRKAFKYTLRPQ
FT                   GQDIIRTWLYYSLLRVYQLTGKPAFKWVRITGMGLDEKGEAMHKSKGNVIDPEPYIEKY
FT                   GADAFRYWAAASAKLGYDYRFSEQVIRTGFLFATKLWNIARFISMFPKPEKKPALRPLD
FT                   EATIAYFNNILREIDEAYSNLDVFEPITKIYQFVWNYFASHYIELVKSRAYNRENKYSR
FT                   EEQEAAWYTLHYILNRTLRALAPIMPFVTDALYTRLYGKTVHLEKFPEPEKEWLNKDYK
FT                   LALLVQKINSAVWSYKKKNNIKFKETLTKKIYLPIEAEKALKEIVDLHKLANIEFYSGA
FT                   PPANAEKIGENIYIER"
FT   gene            46316..47665
FT                   /locus_tag="Shell_0054"
FT   CDS_pept        46316..47665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0054"
FT                   /product="Hydroxypyruvate reductase"
FT                   /EC_number="1.1.1.81"
FT                   /note="KEGG: sfu:Sfum_3915 MOFRL domain-containing protein;
FT                   PFAM: MOFRL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31203"
FT                   /db_xref="GOA:D7DAK6"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAK6"
FT                   /inference="protein motif:PRIAM:1.1.1.81"
FT                   /protein_id="ADI31203.1"
FT                   /translation="MYEEFYREIVNAAIKVSDPEKILPLRIRRVNNCLYIDDRRICIDD
FT                   GKIYVVGAGKASGKMALAVEKILGDLIEKGVVAIPYYMSSLYKLKKIQLVEAGHPIPNE
FT                   GSIEAAEKILDIAGEVGEKDVLLSLISGGGSALMEKPIQPITLDDLKITNKLLLESGAD
FT                   IREINIVRKHLSEIKGGRLAVKASKAKYIVSLMISDVPGDNPEFIASGPTVPDSSTYLD
FT                   AKNVLERYDLWDKVPESVRIVIKKGIRGEIDETPKHEHPVFRKTFNKIIASNYAVLRKL
FT                   SEYFRDKGYTPYILTTRLEGESSEAGKVLASIAMDISDRGLLDQKPIVLLLGGEPNVSL
FT                   KEQRYGKGGRCQELVLSFLATTRGRRDLSIIAFDTDGVDGFSDAAGAYGDYEVWENMSK
FT                   NRDSPWGYLREHNSYEFFRKYNGLIITGPTGTNVNIVVAVIIHKPESSGQ"
FT   gene            complement(47638..48069)
FT                   /locus_tag="Shell_0055"
FT   CDS_pept        complement(47638..48069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31204"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAK7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31204.1"
FT                   /translation="MDKNAEEESIYEKVSEYWFLDHYRVLFVKVDEKTTMASVDVYRRK
FT                   WPFNNYDEEICVSDNKYCIVYKNIDNHGENIDANIEKIVVTGIKTPEGIETVNVRWIIT
FT                   GNISFKDAEKLFYESWKLIGCKGPRNDPWHTYCPEDSGL"
FT   gene            complement(48097..49236)
FT                   /locus_tag="Shell_0056"
FT   CDS_pept        complement(48097..49236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0056"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   dal:Dalk_1643 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31205"
FT                   /db_xref="GOA:D7DAK8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR040085"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAK8"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADI31205.1"
FT                   /translation="MFLEKLEPYEIFTLRPDAFWIWNNEEVKERLSWYYQVMTNNKPAK
FT                   FIIAKYIESPINPYEIEDQRELWKIHDSLEKEFSKIYKEIRNDQLKLEELNKPKYSFLD
FT                   VKIALARSHLKKCRLCEWKCGVNRLSGRPGICMMDKDCIVHSYFHHMGEEAPLVPSGTI
FT                   FYGGCNFRCVYCQNYDISQLYARQGEKVDPRKLAIIQETLRKTGARNINHVGGEPTPHI
FT                   PFIVESFKYLNTNVPQLWNSNMYLSLEAMKIIKDLIDIWLPDFKYGNNQCAWRYSKARN
FT                   YWEIITRNIKIAYRNGDMIIRHLVLPNHIECCTRKVLEWIAKNTPKALVNIMDQYRPEH
FT                   LVAKHPEKFPEIARRPYRHEILEAYRIADELGILYKPIS"
FT   gene            complement(49208..49831)
FT                   /locus_tag="Shell_0057"
FT   CDS_pept        complement(49208..49831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0057"
FT                   /product="maf protein"
FT                   /note="KEGG: sat:SYN_00572 putative inhibitor of septum
FT                   formation protein; TIGRFAM: maf protein; PFAM: Maf family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31206"
FT                   /db_xref="GOA:D7DAK9"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAK9"
FT                   /inference="protein motif:TFAM:TIGR00172"
FT                   /protein_id="ADI31206.1"
FT                   /translation="MEILVLASSSQRRIELLRRLGADFIVIPPRITEKIYNDPAKTVLE
FT                   NAFSKASYALEYAPENSVIIGMDTVIFSRELGVIGKPATIDEANHILKLLRGKWHSVYT
FT                   GAYVIEKNSLRYKSFIEETRVKMRNFSDEELTLYISSLEPLMKAGGYAIQGLGALLIET
FT                   IVGDYYNVVGIPITRLYITLKKYFGVDLLREAVKKRVLGKTRTI"
FT   gene            complement(49926..51881)
FT                   /locus_tag="Shell_0058"
FT   CDS_pept        complement(49926..51881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0058"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sfu:Sfum_3762 ABC transporter related; PFAM:
FT                   ABC transporter related; GCN5-related N-acetyltransferase;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31207"
FT                   /db_xref="GOA:D7DAL0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAL0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI31207.1"
FT                   /translation="MVEQLGVKGYTITTKITRDPYKLMSRRGYKWFGILPVEIKGHEVF
FT                   LWTTGVIAQWFSKDEIVKVVLKDEPKKVGNTWILGPNDYELYRMYRGEEIPVWPVWRKT
FT                   YVLERKDPLNTRKVYEYKVVAREALSEEDYMEIVNLEQHHYASKEEIVAIWRCPICGYY
FT                   TESNIQPKCPKHGVPMKLQEIRGSIPSSRFLVLELLGRKEYEPRIVAYVRVDTPIPLMN
FT                   RRLPNGKVEKMIREKVFPKKWFHPTFWPTALSERRNIISRYKYLKTIYGRRLARAIVGE
FT                   EVSGQALKIANTAAARIARVVVHPDYRGDGLGVLSVKAAIEWIRERRIPEMKKRKHIVE
FT                   TIAMMARYNPFFEKAGFYYMWDTGSGRPVLMYPLTLEAEKRIREFLEKDPYAKIHCGKL
FT                   YRSRYGTVEKMSDPIIIENLTKTYSSILDVKRLPPKLRDVLLAFGVKRRVVEKYVLRNV
FT                   NIVIGPGEIVVVVGASGAGKTTFLRMIIGAVRKELQSQDKYKPTEGTIKVPPNTRLQAL
FT                   LPGELEPSFGSETLLEHVSMKIGDPVAAVEVLNMVGLSDAVFYRARFTELSTGQKERAK
FT                   LASLLAEKPNLLVIDEFTAHLDALTAQRVARKVGLLARKAGITLIVATNRSEIIETLNP
FT                   DKIIYIGYGTAFSTKP"
FT   gene            complement(51901..52596)
FT                   /locus_tag="Shell_0059"
FT   CDS_pept        complement(51901..52596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0059"
FT                   /product="Uncharacterized protein putative amidase-like
FT                   protein"
FT                   /note="KEGG: ara:Arad_3902 creatinine amidohydrolase
FT                   (creatininase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31208"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAL1"
FT                   /inference="protein motif:COG:COG1402"
FT                   /protein_id="ADI31208.1"
FT                   /translation="MASPGHNSFPPSKNLYISIIPTGSYEYHGENLPYDTDSVLAEKIV
FT                   SRCITSLKSMKNVNIQVYPALKYGYSIEWIKYPGTISIDPKTYLDMLESIVDFMEKNIS
FT                   PAGYIFVNGHGGNYSLLEVFSRKKFYELKKPFIIIDIWRIASRYGLKYCHGCLFEQQLY
FT                   SYLTGQSIKENYREEQVCSGYNELLKGYIEELKIGGCGNINIEPGVFVNKICMIIGEAI
FT                   KIIIDHSQN"
FT   gene            complement(52650..53516)
FT                   /locus_tag="Shell_0060"
FT   CDS_pept        complement(52650..53516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31209"
FT                   /db_xref="GOA:D7DAL2"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015254"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAL2"
FT                   /inference="protein motif:COG:COG4047"
FT                   /protein_id="ADI31209.1"
FT                   /translation="MYKVNVKRAEFIGSLINRVRDFIDLLEKNDPQYLAVSELVKHYGK
FT                   ELASIILVANALISYQLSSRGEEYWSALSKWFIDRREKIKDINDIMENHVMFLKYTNYN
FT                   KMGLRHKIKRLQLFYNSSLAKNLVNSPLKYCNQLDKLVYEISKILKTDPTAKTVVFAGK
FT                   MYYYLCLTCEAEIGGEIPIPVDRRNTFLAISSCIVMGCRNNISTCVKELMTPRNRGIVI
FT                   EAWKIVSEKANIPLYRLDSFTWLLTGMIRQLKEPIKIYRLICNTYNYCREELLGILKEL
FT                   VHCIAKH"
FT   gene            53593..53892
FT                   /locus_tag="Shell_0061"
FT   CDS_pept        53593..53892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0061"
FT                   /product="response regulator receiver modulated metal
FT                   dependent phosphohydrolase"
FT                   /note="KEGG: afw:Anae109_1991 response regulator receiver
FT                   modulated metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31210"
FT                   /db_xref="GOA:D7DAL3"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAL3"
FT                   /inference="similar to AA sequence:KEGG:Anae109_1991"
FT                   /protein_id="ADI31210.1"
FT                   /translation="MSNNIVMITINDKGYVTPLDKASKIAIYDASKHVVIEELKNPYKE
FT                   GFWILEEVFDKYDPAIIITGEISEELAYDVEENGVKVYVAKPHKIHDLIRDLFL"
FT   gene            53918..54226
FT                   /locus_tag="Shell_0062"
FT   CDS_pept        53918..54226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31211"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAL4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31211.1"
FT                   /translation="MNSSIITLVVDLVIDKKSLNNLISILDNNCKNICSHNVSSMNFKV
FT                   YLCQNEFFELYYNDKNYLVNIMCRSEDECVKVLNEYLFKVVPKNKVLIHMIQRGIPG"
FT   gene            complement(54232..54465)
FT                   /locus_tag="Shell_0063"
FT   CDS_pept        complement(54232..54465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31212"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAL5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31212.1"
FT                   /translation="MSGEEKVREYKISDLDKIWMEYDRQNDILYINFGYDIEDADEEFL
FT                   SGDGDIVVRIKNRRVVSLMIMNFSDKANIIVY"
FT   gene            complement(54514..54834)
FT                   /locus_tag="Shell_0064"
FT   CDS_pept        complement(54514..54834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31213"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAL6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31213.1"
FT                   /translation="MNSDVRIEDHELQEALGKAEKKEEVDEKQKWIQRMIRSAKHHHKI
FT                   CPYYDKKTGMCFLTLGEKCPRDGRYETCPVFREFLEKKYEEYKSKGLPLPVDFADITIT
FT                   PF"
FT   gene            54939..55589
FT                   /locus_tag="Shell_0065"
FT   CDS_pept        54939..55589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0065"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   gur:Gura_3459 diguanylate cyclase with PAS/PAC sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31214"
FT                   /db_xref="GOA:D7DAL7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAL7"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADI31214.1"
FT                   /translation="MGTNSSFKVFDRYHWKYENWYLRNYNIMKAERDCIKSLGLHGKVL
FT                   DVGVGTGILTYGLSKSMVGVDPSEKMLLYASRRGFLTINSFGEELPFIDGYFDTVIVVV
FT                   TICFVNDPLKMLAEINRVLKKNGTLVTCVVPKDSSWGIYYNWLKNSGKSLFYRYARFYT
FT                   IQELFYMLSITGFIVKDTCSTLSYPPGNPPAYEVPIKSLVPDSGFICIRAEKK"
FT   gene            55586..56737
FT                   /locus_tag="Shell_0066"
FT   CDS_pept        55586..56737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0066"
FT                   /product="Fmu (Sun) domain protein"
FT                   /note="KEGG: similar to predicted protein; PFAM: Fmu (Sun)
FT                   domain protein; PUA domain containing protein; SMART: PUA
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31215"
FT                   /db_xref="GOA:D7DAL8"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAL8"
FT                   /inference="protein motif:PFAM:PF01189"
FT                   /protein_id="ADI31215.1"
FT                   /translation="MNNIDHSLIASLRRVYGSLTYSLLDKILLPPKRLYLRVNTMLITR
FT                   DELVELLKKRGINVKKDPYVEEAVFIELEGPNKIPVYDKKIVVDKYAAESIMIGANLYR
FT                   PGILRFDRFKENEYVNVQATNGKIISVVRTLVSSDKLKYIRKGIVGENIVSIYKAPPIR
FT                   DLEEYDLGLFYPQSLPAMTVSRILDPQPGELIFDMNAAPGGKTSHLIQLSRGRSRVVAF
FT                   ERNVKKALKVYSTLKRLRLLRNIIILPMDSRYVHLDLDASEKVDKVLIDPPCTGLGVRP
FT                   KIEIDIKGEDTVVLSKYQRQFLNAASMIVARKGIIVYSTCTLTWEENEENIIYAVRKLG
FT                   LETIDLGKIPYADKIYYRDIIAYRFSPLGYDMPGFFVAVLRRK"
FT   gene            complement(56739..57284)
FT                   /locus_tag="Shell_0067"
FT   CDS_pept        complement(56739..57284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0067"
FT                   /product="Nucleotide binding protein PINc"
FT                   /note="SMART: Nucleotide binding protein PINc; KEGG:
FT                   predicted protein; K11883 RNA-binding protein NOB1"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31216"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR033411"
FT                   /db_xref="InterPro:IPR039907"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAL9"
FT                   /inference="protein motif:SMART:SM00670"
FT                   /protein_id="ADI31216.1"
FT                   /translation="MRKEEYCIHNRINKKLNIVFDTSAFLAKYHLQLPKYLVKIFTVPR
FT                   VVDEVRDQENKKALELGIEAKMIEIIEPREDFKKKTIIKAREIGEHVSLSKTDIDVAAL
FT                   SLQLKTMHDKVVVFTDDYSLQNLLYHIGIPFKPLRTEGIRKARRYRVYCPVCGYVPANP
FT                   SEDTCPICGSKLVKKRVK"
FT   gene            complement(57256..58083)
FT                   /locus_tag="Shell_0068"
FT   CDS_pept        complement(57256..58083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0068"
FT                   /product="ATP-NAD/AcoX kinase"
FT                   /note="PFAM: ATP-NAD/AcoX kinase; KEGG: ccv:CCV52592_0464
FT                   inorganic polyphosphate/ATP-NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31217"
FT                   /db_xref="GOA:D7DAM0"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAM0"
FT                   /inference="protein motif:PFAM:PF01513"
FT                   /protein_id="ADI31217.1"
FT                   /translation="MKEVFKRALVIYRPTPTCLEKTKKIIELLREYGLAVNSFWVDDLI
FT                   KEMKIKTDLVVSIGGDGTLLKISRVFQDTTPLILPIPCGRRTALYEPIDTSDLEKILDM
FT                   VMNGLFTIQTLSRIDVILDNNRYTALNEAELISIDRGRVIRSKITVKTPAFVSEYYLEG
FT                   DGILIGTSPGSAAYNLSVRGPFIDYFLETIYITPLNPMELNISPIIVPPLSKILIETMG
FT                   IMEIYIDGERTDILGPHRKILVEHSNKDFRIMRIYGKKDFIRDVFEKRRILHS"
FT   gene            58173..59159
FT                   /locus_tag="Shell_0069"
FT   CDS_pept        58173..59159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0069"
FT                   /product="protein of unknown function Met10"
FT                   /note="PFAM: protein of unknown function Met10; KEGG:
FT                   similar to tRNA-(N1G37) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31218"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="InterPro:IPR040601"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAM1"
FT                   /inference="protein motif:PFAM:PF02475"
FT                   /protein_id="ADI31218.1"
FT                   /translation="MIKCVKVYRRYASNVLALLKKHGLLNREYKVSHDKEYVYMPVIQG
FT                   SDDEIRVVLRDFEYELVDCLPEKRRKHRDYGYIPSYDLLGDVVVVRENVLENISREQLV
FT                   NTILDLHPNIKAIYIKEKTIDEFRLPKLKLLWGVEVGSVVVKEYGLLFKIMLGKVYYNK
FT                   RLSEEHRRISIISGENEKIIDLFSGIGGFPIHIASMHKAFILANDLNPYAFVSIIDNIL
FT                   LNKKKLIGNIAVTRIDAREFTNFPSLKEYFDRLIANLPHKSIEYMYVYDYLLRKNGILH
FT                   LYIIGKNLEDLLERISKYSDKWVLEKAAKVLDYAPYTYIYRVDLIKR"
FT   gene            complement(59106..59576)
FT                   /locus_tag="Shell_0070"
FT   CDS_pept        complement(59106..59576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0070"
FT                   /product="Protein of unknown function DUF371"
FT                   /note="PFAM: Protein of unknown function DUF371"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31219"
FT                   /db_xref="InterPro:IPR007171"
FT                   /db_xref="InterPro:IPR023131"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAM2"
FT                   /inference="protein motif:PFAM:PF04027"
FT                   /protein_id="ADI31219.1"
FT                   /translation="MKAYDIIVARGHPNIKATHKTTIEITKENYLTPRGDCIIGVASNK
FT                   SANDLRPELKNILKQDNTIIVFILYVGELMDYILATGSKNLLINDEKKLIIRKSTYVEP
FT                   ATVAIRSNKAAKDIDRRIIEKLKDPHTILKIYIVGLTLDEINSVDISVGSII"
FT   gene            59644..60321
FT                   /locus_tag="Shell_0071"
FT   CDS_pept        59644..60321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0071"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="TIGRFAM: protein-L-isoaspartate O-methyltransferase;
FT                   KEGG: ppd:Ppro_2838 protein-L-isoaspartate
FT                   O-methyltransferase; PFAM:
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31220"
FT                   /db_xref="GOA:D7DAM3"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAM3"
FT                   /inference="protein motif:TFAM:TIGR00080"
FT                   /protein_id="ADI31220.1"
FT                   /translation="MHIRFENERRRVIDYLRRIGIIRSEKVYHALLSAPREEFVPSHYR
FT                   EYAYIDEPLPIGFGQTISAIHMVAIMTEELDPEPGNIVLEVGTGSGYQAAVLAEIVAKQ
FT                   DSSRRGHVYTIERIPELAELAKKNLERTGYIEYVTVIVGDGTKGYPEKAPYDRIIVTAA
FT                   APDVPEPLLKQLRMGGKLVIPVGDRFVQRLLTVRRVGEDEYVTRHGIECMFVPLIGEYG
FT                   WRD"
FT   gene            complement(60335..61387)
FT                   /locus_tag="Shell_0072"
FT   CDS_pept        complement(60335..61387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0072"
FT                   /product="flap structure-specific endonuclease"
FT                   /note="TIGRFAM: flap structure-specific endonuclease; PFAM:
FT                   XPG I domain protein; XPG domain protein; KEGG: similar to
FT                   predicted protein; K04799 flap endonuclease-1; SMART: XPG
FT                   domain protein; XPG I domain protein; 5'-3' exonuclease;
FT                   Helix-hairpin-helix domain protein class 2"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31221"
FT                   /db_xref="GOA:D7DAM4"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019973"
FT                   /db_xref="InterPro:IPR023426"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAM4"
FT                   /inference="protein motif:TFAM:TIGR03674"
FT                   /protein_id="ADI31221.1"
FT                   /translation="MGVNLKDLIPEEAKMVIEDLRMLRGRIVVIDGYNALYQFLTAIRQ
FT                   PDGTPLMDSQGRITSHLSGLFYRTINILENGIKPAYVFDGKPPEIKAREIEKRRKIRED
FT                   ASKKYEEALRRGDVEAARRYAMMSAKLTDEMVHDAKKLLDAMGIPWIQAVAEGEAQAAY
FT                   IVGKGDAWASASQDYDSLLFGSPRLIRNLTISGRRKLPRKNVYIEIKPEIIELKKLLEK
FT                   LGITREQLIYVALLIGTDYNPDGVKGIGPKKALQLVKAYKTLDKILKAIPKTEFPVEPE
FT                   KIVEYFLNPPVTTDYKLEWKEPDESKIREILVEEHDFNPERVKNAVERLVKAYREHIRS
FT                   KQMGLEAWFS"
FT   gene            complement(61431..61682)
FT                   /locus_tag="Shell_0073"
FT   CDS_pept        complement(61431..61682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31222"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAM5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31222.1"
FT                   /translation="MSRNIWRNNPLFRIILEELINKPTGMSIRELIDVIKKEYGYGVSK
FT                   VELYQTLLKLELRGLIRVEELGRDLIVKISPGFSRIIQ"
FT   gene            complement(61759..63975)
FT                   /locus_tag="Shell_0074"
FT   CDS_pept        complement(61759..63975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0074"
FT                   /product="AAA family ATPase, CDC48 subfamily"
FT                   /EC_number="3.6.1.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: AAA family ATPase, CDC48
FT                   subfamily; KEGG: gur:Gura_2842 AAA family ATPase, CDC48
FT                   subfamily protein; PFAM: AAA ATPase central domain protein;
FT                   cell division protein 48 CDC48 domain 2; ATPase associated
FT                   with various cellular activities AAA_5; AAA ATPase VAT
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31223"
FT                   /db_xref="GOA:D7DAM6"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAM6"
FT                   /inference="protein motif:TFAM:TIGR01243"
FT                   /protein_id="ADI31223.1"
FT                   /translation="MSLSTSSNKPGKIKITLRVLESEPRDVGKGIARVDPAIMERYGII
FT                   NGDILVVEGRKKTVIRAVEGYEKDRGLGIIRLDKFSRQNAGVKIGDKVIVEKLDENEVR
FT                   KAITVKLAPTKYYAPIDPGTTGYIKNRLLNRPVLEEDLVVIQILGQTIPFKVILTKPKG
FT                   PVIIKKNTNIIVLERPMDHAVPRVTYEDIGGMKHIVQRVRELVELPLRHPELFRRLGIE
FT                   PPKGILLYGPPGTGKTLLAKAVANEAEAYFIAINGPEIISKFYGESEQRLREIFEQAKK
FT                   NAPAIIFIDEIDAIAPKRDEVMGEVERRVVAQLLALMDGLESRGDVIVIAATNRPNALD
FT                   PALRRPGRFDREIEVPLPDKQGRLEILQIHTRGMPLANDVDLNKLAEITHGYTGADIAA
FT                   LVKEAALHALRRYMPEIDLESETIPVEVLEKMEVRMEDFLAAYKEIVPSGLREIYVEVP
FT                   EVSWDDIGGLNDVKQELRRAVEWPMKYPEVFKRLGIKPPRGILLYGPPGTGKTLLAKAV
FT                   ATESGANFIAVRGPEILSKWVGESEKAIREIFRKARLYAPAVIFFDEIDAIAPARGYAF
FT                   DSRVTERIVSQLLTEMDGINRLNNVVVIAATNRPDILDPALLRPGRFDKLIYVPPPDLN
FT                   GRIEILKIHTRNMPLAKDVDLYEIARLTEGYSGADLEALVREAAMRALKENIEINKIYM
FT                   RHFLEAINEVRPSITQDIVKLYEEWGRKARQRLPREYLKPAMYT"
FT   gene            complement(64167..64439)
FT                   /locus_tag="Shell_0075"
FT   CDS_pept        complement(64167..64439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0075"
FT                   /product="translation elongation factor aEF-1 beta"
FT                   /note="TIGRFAM: translation elongation factor aEF-1 beta;
FT                   PFAM: Translation elongation factor EF1B, beta and delta
FT                   chains, guanine nucleotide exchange"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31224"
FT                   /db_xref="GOA:D7DAM7"
FT                   /db_xref="InterPro:IPR004542"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR036219"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAM7"
FT                   /inference="protein motif:TFAM:TIGR00489"
FT                   /protein_id="ADI31224.1"
FT                   /translation="MAKVLVLLKILPEDINIELEELKERIRKALPEGYEIKGYDIEPIA
FT                   FGLKALRLYIFMPEKTEGGTEPLENTVMNVEGVSQVEVEAVHRIT"
FT   gene            complement(64452..64667)
FT                   /locus_tag="Shell_0076"
FT   CDS_pept        complement(64452..64667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0076"
FT                   /product="Protein of unknown function DUF1610"
FT                   /note="PFAM: Protein of unknown function DUF1610"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31225"
FT                   /db_xref="InterPro:IPR011668"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAM8"
FT                   /inference="protein motif:PFAM:PF07754"
FT                   /protein_id="ADI31225.1"
FT                   /translation="MASKYSLSSNISMLEAASPPVCSSCHRVIPPHEHGTEFLCPNCGQ
FT                   VIIRRCKKCRKLSVPYVCPNCGFRGP"
FT   gene            64769..65134
FT                   /locus_tag="Shell_0077"
FT   CDS_pept        64769..65134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0077"
FT                   /product="Aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="KEGG: similar to peptidyl-tRNA hydrolase 2; K04794
FT                   peptidyl-tRNA hydrolase, PTH2 family; PFAM: protein of
FT                   unknown function UPF0099"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31226"
FT                   /db_xref="GOA:D7DAM9"
FT                   /db_xref="InterPro:IPR002833"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="InterPro:IPR034759"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAM9"
FT                   /inference="protein motif:PRIAM:3.1.1.29"
FT                   /protein_id="ADI31226.1"
FT                   /translation="MLKNMEYKQVIIVRTDIKISKGKLAVQVAHAAVSAAFEAYKKKRE
FT                   WFLEWWATGQKKIVVKGGDEKDLLKYAEIAKKKDLPVAIIKDAGLTELPPNTLTAVGIG
FT                   PGPSRKIDEITGDLKLL"
FT   gene            65125..66252
FT                   /locus_tag="Shell_0078"
FT   CDS_pept        65125..66252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0078"
FT                   /product="tRNA pseudouridine synthase D TruD"
FT                   /note="PFAM: tRNA pseudouridine synthase D TruD; KEGG:
FT                   gur:Gura_0971 tRNA pseudouridine synthase D, TruD"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31227"
FT                   /db_xref="GOA:D7DAN0"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAN0"
FT                   /inference="protein motif:PFAM:PF01142"
FT                   /protein_id="ADI31227.1"
FT                   /translation="MTLETPPCKEFIYVHPLDYVSATKYYLTCAKLDTKYYPSTETFIV
FT                   EEIIDWKKLGFSKENGDYAVFEIRKRNIDTLKAIRIIAKDLGIPEQNILFLGFKDRDSR
FT                   SKQFFFIRKNIIYDHLVYEKVMHRDLEYEFIGYVRRKPRRKDLIGNKFVLIVKDVDKKD
FT                   RDTTDHIMNMIVRHGLPSYYGYQRFGLKRFNSHLLGKYLLTGRIDLFIREFLEGIYPSE
FT                   SDESIYNRSFLRFEKLLYEKILVNAVDVFKAVNKINRMIRNILVDAYAAFLYNLLLNKI
FT                   VEEKGWIGLDKVLPLPGCFEGADFYGDILRVEGFDHSVMKHLGCWYRKGLFRPINTGLV
FT                   LVGDVLKISFLLESGMYASIIMRELFKDNLLFTRT"
FT   gene            complement(66239..66736)
FT                   /locus_tag="Shell_0079"
FT   CDS_pept        complement(66239..66736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31228"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAN1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31228.1"
FT                   /translation="MKYPLDKICVKSGILCPNCQRKVDTGIVGKYEIPIMKAMMELEDE
FT                   MKELRRGEYIKAYEVNGMVIVIVRDHWEKEEIEKISKALSAKLHRKSKVVVDTGDKKLL
FT                   VEQILYPATLLGLNTLWLPDGSEQVIIRISRRDHRFIGGRKHAYESLLSKLLGRKVRIR
FT                   FE"
FT   gene            67373..68371
FT                   /locus_tag="Shell_0080"
FT   CDS_pept        67373..68371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0080"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31229"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAN2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31229.1"
FT                   /translation="MNTLLIVGVIVAALLVGVGAAITYYNNAPSTNIGTTTTPSETTTQ
FT                   QPTQTTTTTSGYSGADLSGTWEGTFTAHAWQGSGGTGHWTWIIHRVGSNKYEGVLKTSN
FT                   VYPTGGWINIEVTVDGNQITVGTVGNYGGIAAVVFTGTVSGDGSQASGTWHFTNDMDNG
FT                   QWSGRKVSSSTQIPSETTTIQTSASQTTTTQSGTGTTTTTQVPGCVPNPPTQYQAAYQS
FT                   MYQAAATVFGESNLQCYFQGIVNTQYVVSFHIQNYNSEEAFNYAQQLNTTLTSNGWIID
FT                   TLLSSGNEIHVGGYYNTTVNGAPTMFMGLLTIQIEDNGTVDLAIQIQPVTY"
FT   gene            complement(68574..69305)
FT                   /pseudo
FT                   /locus_tag="Shell_0081"
FT   gene            complement(69283..70227)
FT                   /locus_tag="Shell_0082"
FT   CDS_pept        complement(69283..70227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0082"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: pca:Pcar_1575 ABC-type transport system,
FT                   ATPase component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31230"
FT                   /db_xref="GOA:D7DAN3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAN3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI31230.1"
FT                   /translation="MKYAIYTRDLTKYYGDLLAVDHVNLRVPYNIIFGFLGPNGAGKTT
FT                   TIRMLCGLTKISSGDAIVNGYSIKDEPEKVKASIGVVPDISNLYPELTCYDNLMFAAEM
FT                   HGVPSKRRRQRVLELLRFFGLTDKINVKFANLSKGLKRRLTIAAALVHKPKILMLDEPT
FT                   LGLDVRSRRKMWALIRSLKEKGITIFLTSHNVYEVSRLCERIAIINKGRIVAEGTPSEL
FT                   RKLVPYEEAIELSVSDPRKLIKKISNSENIVKAYIENDTLKIVAKDPLAALIEITRVLR
FT                   MEKIDVNYVSLRSADMEEVFLKIVEGNRIERSR"
FT   gene            complement(70462..70539)
FT                   /locus_tag="Shell_R0004"
FT                   /note="tRNA-Val4"
FT   tRNA            complement(70462..70539)
FT                   /locus_tag="Shell_R0004"
FT                   /product="tRNA-Val"
FT   gene            70695..71981
FT                   /locus_tag="Shell_0083"
FT   CDS_pept        70695..71981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0083"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ftn:FTN_0910 sugar:cation symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31231"
FT                   /db_xref="GOA:D7DAN4"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAN4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADI31231.1"
FT                   /translation="MEERISSLKALLYGYGNLMGVGSALIVQWLLYYYCPPENSGLTPL
FT                   APIIAMGAIILFGRIVDAVSDPFIGYWSDKTMTRWGRRKPFIVIGFILMALSQILVWIP
FT                   IVRGVSIINVLYAAILLGVFWFGFTAAIAPYLALLPEIATTKEDRVKLSTSQAFFSQVS
FT                   LIISGVIVPILLGILGFLNTATVLTLIGITAMISIVLGIRERIRSAEKIATKMNLWEAV
FT                   KITATNKTFLLYLVPTALLVLSTTMLQMALSYAVTVSAGLEKEHVSLFYLPLIIVSIIT
FT                   LPLYKHLASTIGKKKVYLLGMLLFLVPTLMIAFIGYIPIDPQIYLLVTGVIAGLFVTPL
FT                   LMLPNAIIADITDVDEQITGYRREAIYFGTQGLITKTMAGIAGVTVSFLLGVFGYAPGN
FT                   DLGVRLVYVVGALLLIPAALIFTKYPIEK"
FT   gene            72008..72823
FT                   /locus_tag="Shell_0084"
FT   CDS_pept        72008..72823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0084"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: vei:Veis_0048 LmbE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31232"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAN5"
FT                   /inference="protein motif:PFAM:PF02585"
FT                   /protein_id="ADI31232.1"
FT                   /translation="MAEILQLIKQLPEQEVYRIIVKQYIAKDFDQAFDNAHRILCISPH
FT                   PDDCEVGVGGLIAKYAGKGKDVYLVVMTDGSRGTRDPRMTRGRVALIRRREQEEAGRVL
FT                   GVKNIYWLNYPDGELPYSYEVINKLVTLYRLLKPDIVLAPDPSLPYEAHPDHLNTGRAA
FT                   STAAIFSGMPLYNRVDLETGLSPHSIRYIAYYYTSRPNTYIDITDTIEKKLEALRKHES
FT                   QFKESWTLIEALIRVLGAIYGRKINVEYADAVKLVPAILLHAVPFTEYV"
FT   gene            72832..74022
FT                   /locus_tag="Shell_0085"
FT   CDS_pept        72832..74022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0085"
FT                   /product="Hyaluronidase"
FT                   /note="PFAM: Hyaluronidase; KEGG: Hypothetical protein
FT                   CBG16157"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31233"
FT                   /db_xref="InterPro:IPR011496"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAN6"
FT                   /inference="protein motif:PFAM:PF07555"
FT                   /protein_id="ADI31233.1"
FT                   /translation="MYVGVVEGFYGPLWDKIDRLSMIEFMQQIGLNIYIYGPKWDPYHR
FT                   TRWRTPYPRSYIDMFTELIDAGNRKGVEIVYALSPGLTINYSDKNDRRQLVLKLEGLME
FT                   AGFTSIAIFLDDIPPILRGEGYKTLGEAQADLINYVVQELSPKNMFFCPTYYWGFREDY
FT                   LGELGSLLENNVYIMWTGPAIVSRKIRLEDAKRFHEITGRKPFVWDNYPVNDYFLLKGI
FT                   ARLHLGPFTNREPEIWNYVSGYVANPMIEAEASKIPLYTLAEMYRKKQNYNPEESINNA
FT                   IKHLYPEEYYETIRLYVELNKASPFNPYGDYVPSKNDVSRLKKMLYEINNINNKKLLEE
FT                   ASWIISKLQAITASLEGQRTRLEPRIQTAGDYDPMMNNEEMKFFFGEVIEKRRIWI"
FT   gene            complement(74019..74963)
FT                   /locus_tag="Shell_0086"
FT   CDS_pept        complement(74019..74963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rle:pRL110512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31234"
FT                   /db_xref="GOA:D7DAN7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAN7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31234.1"
FT                   /translation="MGLEIYTLNEMGLSNKEVLEILNEIFVYDHIDIELYRRTIELDPN
FT                   HSNNEFFFFTENNEVIGVAYLTYLKEKTKSVLGVLKNYTDHLWLKLLGVVPGKEEYLEN
FT                   IIDYVEDYARRNNKKTIHIYGYAPFYFAPGIDRRYEIINKKLFEKGYKLESKVVNYYVD
FT                   MDEYYVPLEALWLQERISREGYVVREISIDEYDRVTTWIKEKFGIIWGLESLVTKNYEC
FT                   SGIIIVENKEGEIIGFNTYGASAPYRYGPVGVWEKYRGRGFGKILLHYTLNKMKKLGLY
FT                   IVEIPWTTHLFYYAGVPGLCRIRMFNVYVKKIG"
FT   gene            complement(74980..76383)
FT                   /locus_tag="Shell_0087"
FT   CDS_pept        complement(74980..76383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0087"
FT                   /product="glycoside hydrolase family 4"
FT                   /note="PFAM: glycoside hydrolase family 4; KEGG:
FT                   lch:Lcho_3239 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31235"
FT                   /db_xref="GOA:D7DAN8"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAN8"
FT                   /inference="protein motif:PFAM:PF02056"
FT                   /protein_id="ADI31235.1"
FT                   /translation="MFVVEKALPESSRIKIGIIGAGSAVWSIPVLIDIMLKKSLANADV
FT                   YLMDIDLDRLKLVYGFAKRYAEEIHSTVNFHTTTDRVEAIKDADFVINSAMAMGHSYYE
FT                   RMREISEKHGYYRGINSVEWNMVSDYHTIWGYYQFKLAMSIARDIEEYAPNAWLFDVAN
FT                   PVFELATLISRKTKVKIIGLCHGHMGIKNVIRELKLPQDKVEAEMIGFNHVIWLTKFKV
FT                   DGEDGYKFLDKWIVTEAEKYWKKWRETTANPFDIDLSPAAIDMYRNYGLLPIGDTVRGG
FT                   TWKYHWNLETKKKWYGPYGGPDSEIGWAMYIAYLKMRLYEIYKAITNASRPLTLLFPPK
FT                   PSGEQVIEIIDSMVTGTPRTFQVNVLNNGSIPGIPDNVAVEMPAVIDDKGVHRKTFSPL
FT                   PSKIQKYVIYPRMMRMEWALEAFLEGGRDKLFEWLIYDPRTKSTRQVEETIDDLLKMPG
FT                   NEEMAKHYS"
FT   gene            complement(76488..76817)
FT                   /locus_tag="Shell_0088"
FT   CDS_pept        complement(76488..76817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0088"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: sfu:Sfum_3410 dinitrogenase
FT                   iron-molybdenum cofactor biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31236"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAN9"
FT                   /inference="protein motif:PFAM:PF02579"
FT                   /protein_id="ADI31236.1"
FT                   /translation="MVKIAFPTDKGGLDDYIYDRFGRTPTFTIVEVEDSEIKNVKIVEN
FT                   PGHKAGSGAGIKAVQKLIEEKIDVVAGPNPGPNSYMALQQSNIKVVTVLGLKVKDAIEH
FT                   VIKQL"
FT   gene            complement(76835..77824)
FT                   /locus_tag="Shell_0089"
FT   CDS_pept        complement(76835..77824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0089"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   dat:HRM2_42450 ferredoxin (iron-sulfur cluster-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31237"
FT                   /db_xref="GOA:D7DAP0"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAP0"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ADI31237.1"
FT                   /translation="MSIGGLEIVVASGKGGVGKSTITSSLALVFAEKKLDFIAVDADAE
FT                   APNLNIVLGIIDWDKIEPYYEGRYAEIVEEKCINCGECMKVCPFNAVELINNKYVINKW
FT                   ICEGCYTCSFVCPTKAIRMIRDIVAGHIRIKYRTPYGFALISGELVPGRPNSGKLVTEV
FT                   KNRARKIGGKDAILLVDAAAGIGCQVISSLAGAHMAILVAEPTPASLSDLKRIHKLTKH
FT                   FMIPPALIINKYDTNPEYYEIIKEYALKENIDYLGEIPFDKHVAESAANMEPLLIKYPD
FT                   SPAATAIRKISLKIINILQNYREWRIKHLPPKMEPFIPIVIKPGETHT"
FT   gene            complement(77821..78708)
FT                   /locus_tag="Shell_0090"
FT   CDS_pept        complement(77821..78708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0090"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   dal:Dalk_2263 cobyrinic acid ac-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31238"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAP1"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ADI31238.1"
FT                   /translation="MQRQITVTGGKGGTGKSFVATNLAVLLSDRYATVLADLDLEAPND
FT                   HVLLGVKKLENEEPIKAFLPFIDTKKCTKCGVCAKICDTGAILMPPNSFPVIFPRLCSG
FT                   CKACYYACPYNAILKGYHVLGYSYVTKVTIHNHSFTLVTGILREGEEHVPPAVAATKNR
FT                   AKNIDHELMIVDTGAGTGNQISIALQGSDQVIAVTEATPLGLHDLESILKVTSDMNLET
FT                   IVVINRYGLGRTDKHIETMKKYNVRTYFTIPYHVDAVESYVKGKPIVIYKPDSIVSKSI
FT                   YQIYEYIAKEVLEK"
FT   gene            complement(78731..79132)
FT                   /locus_tag="Shell_0091"
FT   CDS_pept        complement(78731..79132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31239"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAP2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31239.1"
FT                   /translation="MIELEKIIGYILSETGCMHPYRLSRVLALAELEYYEKYGERLTNA
FT                   EYKGFDKVFYIEGVKELFENNKCFNKREGDPEKGIKGCIEYTCQKPVISEKYREPIDKA
FT                   IAQAKNLTDEELNELVFRNPLFNKFLKPM"
FT   gene            79275..79928
FT                   /locus_tag="Shell_0092"
FT   CDS_pept        79275..79928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0092"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bba:Bd1385 putative phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31240"
FT                   /db_xref="GOA:D7DAP3"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAP3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31240.1"
FT                   /translation="MKTYGHRANNKLVLRKYLALKNINGLEVDVSVRNNKVVVRHGPSP
FT                   VVRPSLLGKIMGWIDYRFFYRDPYIRSLSISLEDIFGIVRKRGLELILDVKDINTMARI
FT                   LESNIMLPHNIIFTSKDHFAIRYAKETTNYRALVSIDSLPLSIIDIINDSLADGVSINY
FT                   GFIEDWLIDLLHSNNYVVYTWIVNDQATACKLEKLGVDAVISDDPKTILYRRCR"
FT   gene            79891..80793
FT                   /locus_tag="Shell_0093"
FT   CDS_pept        79891..80793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0093"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: atc:AGR_L_1699 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31241"
FT                   /db_xref="GOA:D7DAP4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAP4"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADI31241.1"
FT                   /translation="MIQKQSCIEDAGDLVALETGLIGVLSALTASSIWSLSPGLISRYG
FT                   KGTDATTLNMLRGLHAVFVLFLIFHLTINERWFVPEGIFIVYISAFFGPLLGDTLYIYS
FT                   IKHIGGGNAVSISYTYIFFAQLYSYLLYGEQLRIQLILGSFIAIIGVYLVYSGQKNDIK
FT                   ITGFIAALGAALSWGMGATLSKLALNYGDPVTIALLRNLSTTISLLPITYNSAKKVFLD
FT                   KEIQITAFITGGIGFGVGMTLFLTAINTIGVSATVLATSLTPVLGRILAKFIAGEKPSP
FT                   KTYLGTIITSTGIFIGLYF"
FT   gene            81485..82000
FT                   /locus_tag="Shell_0094"
FT   CDS_pept        81485..82000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0094"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: ara:Arad_15018 nucleotidyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31242"
FT                   /db_xref="GOA:D7DAP5"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAP5"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADI31242.1"
FT                   /translation="MFRKGLNNIPEPFRTLVSRLLAELLRLFNGRLKSLVVYGSVARGD
FT                   YRKDSDIDLLIIIEGLPRSRLERIRLFTKAESKLDELLDKLLDKGYAVSFSPIIKTPEE
FT                   AVRISPIYLDMVEDAIIVYDENGFFEKILMGLKKKLEQLGAERVRLGKKWYWRLKKNYR
FT                   FGEVISIE"
FT   gene            81993..82424
FT                   /locus_tag="Shell_0095"
FT   CDS_pept        81993..82424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0095"
FT                   /product="HEPN domain protein"
FT                   /note="PFAM: HEPN domain protein; SMART: HEPN domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31243"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAP6"
FT                   /inference="protein motif:PFAM:PF05168"
FT                   /protein_id="ADI31243.1"
FT                   /translation="MNNIALARSYIRQTKERIKHAGEALETGNYPYVIRQCQEAVELAL
FT                   KAALRIVGIEPPKWHDVGPVLRREKNRFPDWFQERIPELAYISRSLRKERETAMYGDEE
FT                   TGLPAEELYTLYDAEQALKQARTVLYLVEKLLREAQDKQ"
FT   gene            complement(82978..84204)
FT                   /locus_tag="Shell_0096"
FT   CDS_pept        complement(82978..84204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0096"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   abc:ACICU_01252 major facilitator superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31244"
FT                   /db_xref="GOA:D7DAP7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAP7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADI31244.1"
FT                   /translation="MDSHRWLTVMLDTLLIAVCLGTLTMMSVAKPEIMSFFGVDEKLYD
FT                   LQYIAYAAGLFAAFFLGYTKLYEGGFKKDVLLAVSFAAIPQFLIPLIRWWSIVVILRFI
FT                   QGFILSLIPLFSVQIAKYFLAERPLAKGIILSGIFWGGFLGAFTAGSLMQIVDWRTTFI
FT                   LTAILMYVMLIVWWIPAEDFTVIQKKREGDRTINVWKMKFTWIMGFTFFPAIWVIFTIA
FT                   GFSASLGYSMGWTESQVSMVSGYLHMALAIWSIVFGYIGYRLSKRNISPRGLFRAIIIV
FT                   MLISYALSFIGLLLYSYAMTTGNYVLASITVWVVGAIQGTGPAFWTTAPATYPEEIFPR
FT                   ASFALGVISNIPNIIAPTITELLAQISNILALSELTAMPLIGIIILVIALHAKLPIEEA
FT                   EKTTSILID"
FT   gene            complement(84344..85090)
FT                   /locus_tag="Shell_0097"
FT   CDS_pept        complement(84344..85090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0097"
FT                   /product="purine or other phosphorylase family 1"
FT                   /note="PFAM: purine or other phosphorylase family 1; KEGG:
FT                   sse:Ssed_3654 uridine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31245"
FT                   /db_xref="GOA:D7DAP8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAP8"
FT                   /inference="protein motif:PFAM:PF01048"
FT                   /protein_id="ADI31245.1"
FT                   /translation="MDKVKPVLLKDAVGVSDLAIVMGDPDRVYLLSTLLEKPEIIYDRR
FT                   GIVAVNGEYKGRKVTLASHGIGCSMASIILEELGMLGAKTIIRIGTAGSLVEDLDVGDT
FT                   VLAAGAGYMLNGCGNNMYSPEINGGTSPDPLLLSGIYYYLLNNNVKPHVGLVFTSDAFY
FT                   AEENIMDKLISRGFIAIDMETAILYMLGWIRKWRTLSILVISNSLVKKTPLLTTHELAE
FT                   RFIELTKLVLEYLAKYLELNTVFTNT"
FT   gene            85167..86168
FT                   /locus_tag="Shell_0098"
FT   CDS_pept        85167..86168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0098"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   bcm:Bcenmc03_5466 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31246"
FT                   /db_xref="GOA:D7DAP9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAP9"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADI31246.1"
FT                   /translation="MKALVLHGPGDLRLEEVDDPIPRNDWVRIRVKRVGICGTDKAFYK
FT                   GTYKLMKKPLIPGHEIAGIIDMVGENVSEPLIGHKVTTEINVYCGKCWYCRHGMYTHCP
FT                   YRETIGITRDGGMAEYVLTRKDLVHVVDDLDFDIIAFIEPLAAVVEMIEMQRVEPFSNI
FT                   AVLGIGPIGLLSIQVLKLFNPNKIVAIARRGSPKIKYAYMVGADEVLTYDEALEYMKKH
FT                   TPEGQGFDYVVEATGSSKGLDMALKLTRPRGVVAAKSTHGSDVSFNYTLMVVKEVRIVG
FT                   SRCGPFDKAIMLLRRGLVRVRELITAVYPLEKGVEAFEASFRRENVKVQLEI"
FT   gene            complement(86179..86625)
FT                   /pseudo
FT                   /locus_tag="Shell_0099"
FT   gene            complement(87127..88173)
FT                   /locus_tag="Shell_0100"
FT   CDS_pept        complement(87127..88173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0100"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   nam:NAMH_0848 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31247"
FT                   /db_xref="GOA:D7DAQ0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAQ0"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADI31247.1"
FT                   /translation="MAYEKEYVKPSRFYEVYDEEKKIIRCTICERRCVLAPGLTGICWN
FT                   HKNIDGKLYNIAYGLLSAVEPRPIEIKPLFHYYPNSIALTFSGWGCNFRCPWCQNYYIS
FT                   WSKPDPDKSIYMEPKELVELAVKLKNHGLCASFNEPTIHLEYLLDVGEYAVKHGLYLAM
FT                   VTNGYMTLKTIKHLLENGYTGFSIDIKGCPYTYKKYLSANPLIIYRNAKTILDHGGHVE
FT                   MVYLVVPKANDWKECYEWIINNHLKYLGENIPLHINRYYPANKYYEPPTKISKLVEIKK
FT                   EAEKSGIEYVYIGNTPYEEYEYTRCPRCGKILIARRNHRVIKWNLTKDHRCPRCGYKIN
FT                   IYGKYIYR"
FT   gene            88438..88989
FT                   /locus_tag="Shell_0101"
FT   CDS_pept        88438..88989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0101"
FT                   /product="Protein of unknown function DUF2204"
FT                   /note="PFAM: Protein of unknown function DUF2204"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31248"
FT                   /db_xref="InterPro:IPR018700"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAQ1"
FT                   /inference="protein motif:PFAM:PF09970"
FT                   /protein_id="ADI31248.1"
FT                   /translation="MTYTLKDLAVVLGKLGDYGVKFVVIGDTVVQLALRTKVFTGDIDL
FT                   FVYEPSPLVEEDFYREIVEKENWGISTTELGTPRIIARIGEKEIIIELYENFMDIEIPE
FT                   EILSQARTIKVKGVKIKVLRPEHYFVLKARQGVDLDKLSEYYKKLGSLDKRLLDKSIKA
FT                   FPEEEQSLIRERLSSIGISF"
FT   gene            89299..89439
FT                   /locus_tag="Shell_0102"
FT   CDS_pept        89299..89439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31249"
FT                   /db_xref="GOA:D7DAQ2"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAQ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31249.1"
FT                   /translation="MGFEEIISLPIIFGWLAITFGYGYIATRRRVEWKAFEWFVVGEGL
FT                   D"
FT   gene            89409..89612
FT                   /locus_tag="Shell_0103"
FT   CDS_pept        89409..89612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31250"
FT                   /db_xref="GOA:D7DAQ3"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAQ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31250.1"
FT                   /translation="MVCCRRRLGLIDKYTAVAAMSAGMIVGYVKYYYGRIWNIYEGLWG
FT                   LLANLLVLSIMLLIKKLIKGKQ"
FT   gene            89682..89843
FT                   /locus_tag="Shell_0104"
FT   CDS_pept        89682..89843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0104"
FT                   /product="Ribosomal protein L40e"
FT                   /note="PFAM: Ribosomal protein L40e; KEGG:
FT                   Ubiquitin/ribosomal protein CEP52"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31251"
FT                   /db_xref="GOA:D7DAQ4"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR023657"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAQ4"
FT                   /inference="protein motif:PFAM:PF01020"
FT                   /protein_id="ADI31251.1"
FT                   /translation="MPITDPVKLQIVYNRVLNKKVCRRCGALNPPTATKCRRCKSKNLR
FT                   PKKGFKLR"
FT   gene            89950..90669
FT                   /locus_tag="Shell_0105"
FT   CDS_pept        89950..90669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0105"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: nis:NIS_0508 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31252"
FT                   /db_xref="GOA:D7DAQ5"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAQ5"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ADI31252.1"
FT                   /translation="MSIIDLLSVKPFAVIGHRGAAGRYPENTLKSIEYAIGLGVEIVEV
FT                   DVRATRDGEIIVFHDPDLKRLFGISKSVGELDYSWIRNNLRLGSEYIPLLREVLELVKD
FT                   RVGLFVEVKEPVITRRVVELISKYNMISDVAIISFYDEALVEAKQLIPNIVTGLIYFKP
FT                   PGRLFDAKKLGANIVLPRYNIATLKANQLAHKLKLKVVVWTVNSEKLVYEMIRREVDGI
FT                   ASDYPDLLINIRKKLSG"
FT   gene            complement(90674..91297)
FT                   /locus_tag="Shell_0106"
FT   CDS_pept        complement(90674..91297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0106"
FT                   /product="Pyrrolidone-carboxylate peptidase (N-terminal
FT                   pyroglutamyl peptidase)-like protein"
FT                   /note="KEGG: rfr:Rfer_0871 pyrrolidone-carboxylate
FT                   peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31253"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAQ6"
FT                   /inference="protein motif:COG:COG2039"
FT                   /protein_id="ADI31253.1"
FT                   /translation="MGDCWFIVSGFDWYRGRGGWVLYYPNPSGIVASLLDGEVVGGCGV
FT                   RGVVLDVDYPSIEKLDKILEKLKPVGVVGLGLHPLTTVPLLEASAVNVRFENREDERNA
FT                   SKLYSDSPLCISVQIELFDLLKYLWSKGYDVAPSNTAGLYLCNAVAYTIYRFASKHNSK
FT                   ALFIHVPPVGVLKHRLSRTYVNMWSIDLLKQLVIDVLKYMVKNK"
FT   gene            91456..91566
FT                   /locus_tag="Shell_R0005"
FT                   /note="tRNA-His1"
FT   tRNA            join(91456..91492,91531..91566)
FT                   /locus_tag="Shell_R0005"
FT                   /product="tRNA-His"
FT   gene            92115..93134
FT                   /locus_tag="Shell_0107"
FT   CDS_pept        92115..93134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0107"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   nam:NAMH_0956 DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31254"
FT                   /db_xref="GOA:D7DAQ7"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAQ7"
FT                   /inference="protein motif:PFAM:PF01555"
FT                   /protein_id="ADI31254.1"
FT                   /translation="MSKQLEVEPEFAEKISSDDLGWLLEKLADRVEKEIVLIAKNPNLY
FT                   RRIERIVFTLPTRHIIYHGDSRNLSFIPSESVHLVVNSPPYWIVKKYKPIPGQLGVIKD
FT                   YNKFLEELGKVWREVYRVLVPGGRLIIVVGDVLLPRRKYGRHRVIPLHSDIIKQCTSIG
FT                   FEYLAPIIWFKIGNVSREVPGRSGFLGKPYMPNAVIKNDIEYILMFRKPGYRSVSRVRM
FT                   KLSVIPEKLFKEWFTQIWRLLGESTKHHPAPFPLELAERLIRMYSYVYDTVLDPFMGTG
FT                   TTLLAAARTGRNSIGVEIDPEYVKYAYNRLRKEAQSLFGKREIILKEMSNEQSYQGMG"
FT   gene            93106..93855
FT                   /locus_tag="Shell_0108"
FT   CDS_pept        93106..93855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31255"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAQ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31255.1"
FT                   /translation="MNNPIKEWVELNKVIVNKKLYFKDIEDRLIDIIWRLDKLWRNELI
FT                   EQGEYRQKGNYYRDTIISLIKACCLEEGFRIEIREARLEGRTDKVHKVDFAYIGRNNVP
FT                   IIAGEVKAIGSPPHRIGGRTYPERNISIDTDKRIKEVKYTPIDLKRKYDPLVSKPWNQW
FT                   IDETPPKFYTFWLLRLGSSNRLNHILEKIRGLKEYNNGVSAIIYTESRRGYRWVFMKDN
FT                   IIRGVDELTQEIAQEIIRSIKSRPYII"
FT   gene            94375..95622
FT                   /locus_tag="Shell_0109"
FT   CDS_pept        94375..95622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31256"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAQ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31256.1"
FT                   /translation="MHLSLDNLRSFLVDVGRLYNITSAIKDYYDEVVRPLNGKNIDELP
FT                   RDLKVAVLGGLKPDGEYVDNAYAMFIKDFIGLYIEDPKLYVFMLKRGRIPSVKIITSAT
FT                   KFVEFVYLLNGVSGFIISKARNLGLIHNSVKSSKTEINQLNIEDAITELINTILNLSVG
FT                   TNSFTTGIWGLRKTTLRYAKKAYGKLPENLLEVLGFSKLVDLKNYQLWGFPDYVTKCRL
FT                   YQYEYNEYGLIINGLPIVSEYLRKIPGLSSIALNTLGGAICILNEVIWRYIDLLYKDLN
FT                   KWYKNSINLEKEYVRKAWRSLDEIGWSMPEYLKSLYVDFREALDGRVGSSYGSPFKFLH
FT                   YDENGVIKEYTQWFYRGSYERSGFYTYKLSQYIYLPELLDDLMPAIYLGVVDTTLYLNS
FT                   GRALLILIRSPSREKL"
FT   gene            95619..96245
FT                   /locus_tag="Shell_0110"
FT   CDS_pept        95619..96245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31257"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAR0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31257.1"
FT                   /translation="MTKSDEASIKEEFKKLIKAIYTLLPSRNKVSQLIMLLPLKEEVIQ
FT                   DLYPELFEDIEYWEMFNSALGLYRSSEGKIHASGLADALKDFINRIFQILRDEKYRAAI
FT                   SALLGEISPNPEREWLEVRIKAVLKDPSIGSAAKKVLMLLVETRSASTKELPSKLNIDE
FT                   QELQHTIYALKNLKLVEINGETISLPYDIRERYTLYVKKLLEESR"
FT   gene            96245..98284
FT                   /locus_tag="Shell_0111"
FT   CDS_pept        96245..98284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31258"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAR1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31258.1"
FT                   /translation="MGKDIGSKLGRGRKHIHIDLGEATISEHKRVVKEDLKKTGIGLEK
FT                   EAEAKDTGTATRSTRPRIPRPPIIRSEPVSPSVKTEPQVIFPKVTLSGKQKAILYILYH
FT                   LFREKNFKDALSRMNSVLEYEPEDILHNIIYLENQNLIKIDADKIVFTDKGEILARSIA
FT                   VDNSIINKIKELKYKIPEASSIAIPQIIRKTLDKHIYQISPEILREELIVPTIPKIQLS
FT                   TLILSTINKNITSIFISTSIYKDKNIVIPHIPRITYGKIATISMNKNIPPLNHEVEKKS
FT                   LVKTIEKAKETVRVKKWRLPPSLLTMLFKPIKKYNVKGLISVKPDRPVIIVAIKSPDEE
FT                   YIFTLLSILREIYRMKVGGLPLSRYVSAKRTKYIAEEEMMRQGLIKVIDDSTADFLEFF
FT                   GISKIKDFDKINLDSLKDRLIELSVGGLSFLIFYIDENKKDQLLGYLLSIRDRIAPAKI
FT                   IIVQPRKLNSELKRELARASWGFVDPSEPLLKDTLDKNFRLREEEFYNKLENIATKQEY
FT                   AELVRESVEDEEGLESFESPLHYQLKVFVVYYLMKKLKIPEEDIETEAEVVKGVIPDIY
FT                   VKSKRLAIEIETFYGTGLSPWRKLERTIEKYKKNNVTNEVWIIIPPLQTMLYLKDLIHK
FT                   VKRLKEKGYGFIKLYTVNISKKKLIPIKEIPVKLSRLFSKQAQV"
FT   gene            complement(99055..99309)
FT                   /locus_tag="Shell_0112"
FT   CDS_pept        complement(99055..99309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31259"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAR2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31259.1"
FT                   /translation="MKRIKMFIQQIPLGFDEIIINIFIEEVIRSAIRILLKYLIIKIIE
FT                   LIRNGAEMYKFVKRRDRIEEMKFVKKKDRLNAYLHIWGH"
FT   gene            99511..99924
FT                   /locus_tag="Shell_0113"
FT   CDS_pept        99511..99924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0113"
FT                   /product="HEPN domain protein"
FT                   /note="PFAM: HEPN domain protein; SMART: HEPN domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31260"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAR3"
FT                   /inference="protein motif:PFAM:PF05168"
FT                   /protein_id="ADI31260.1"
FT                   /translation="MSMEYVDLLRNRAKRYLESAVNNLLSNRFDVAIVEAEIASQLALK
FT                   ALIVKIGFEPPRTHMVRQLFSFIIDNKLLPDNMLNIVRNYVKKNREKLIILERARIVGQ
FT                   YGASIVDHDEAEIAVNTAKEVLSVVEKLWKMVI"
FT   gene            99893..100258
FT                   /locus_tag="Shell_0114"
FT   CDS_pept        99893..100258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0114"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: see:SNSL254_p_0144 aminoglycoside resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31261"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAR4"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADI31261.1"
FT                   /translation="MSRNFGKWLSKRRQVLRNWDSIAKTIAYILKKVMPDIMEIYVFGS
FT                   VVDGKFTGASDLDLLIVIPEKYDESKTYILFNKILEEKLGEIAYMIDLHIINKNKLAKP
FT                   PYTWWLKKSYKINSMKH"
FT   gene            100348..100713
FT                   /pseudo
FT                   /locus_tag="Shell_0115"
FT   gene            100804..101574
FT                   /locus_tag="Shell_0116"
FT   CDS_pept        100804..101574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31262"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAR5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31262.1"
FT                   /translation="MVWVSVEAPIIPSLEKYGSEKARIFIDTCITHLIMHREGWIGKKM
FT                   EELGIKSPREAVEFVINNIDYPSTLETPDDKHVWEAFSGKIKYVVFKDYWSSASEVLMT
FT                   YILNKKLYGKPGYGDFEDTSILATSMLRILNTPAYEVFGAIYSNNTLLGGHAWTIAKLE
FT                   DGKWHLIETFLTQPPKYPSNYPVINPEENKWRIRNTIYEGWIKFNEKEYYEWREPGTQY
FT                   SLEKYLAFEKKDKYNMRKYEALEKAWRIKTKVKI"
FT   gene            101992..103395
FT                   /locus_tag="Shell_0117"
FT   CDS_pept        101992..103395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31263"
FT                   /db_xref="GOA:D7DAR6"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAR6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31263.1"
FT                   /translation="MIGQGDGWLGRKIALILIVVLVAGIVAGALSYYLYSQHKQKPEKT
FT                   TTQHPYPSTTSTQPPTTTQIPGDKTPPRIYSINYEFLPPDSVSITVNATDNSGISKVLA
FT                   EVQGENYSLALVDGLCAENITVGAISEIKELPVKIYVFDKFNNYAKTKLTAVPNLEEKF
FT                   VSLGMSNKISKSSAEEFYSDYQQLVQQLYPENKSLLIPLLKLYSKNSTIFSMLYQSVSQ
FT                   DPQLSKYSCLEKDELISSASQLFLDLGYTGKVKVLIPGTNNYREEFLTKPTIQAFGNYS
FT                   VAIDSLGLPKHNKSTLFLLGNATQINPAIVDFEPVIVKDMNGKTFVIKSKNIARDVWMI
FT                   AEHLRRTPYVVNYPEMYEAFSIKVQQNAFDILDNPEMHELGEHYKPTDKIIWEKVIIPQ
FT                   WKYYWNSTPQAGNLSKRICVFPWYNSTLLKEWISNKTDRKIALMYFWELLPRVADLDEW
FT                   LTHKKNSLS"
FT   gene            103409..104083
FT                   /locus_tag="Shell_0118"
FT   CDS_pept        103409..104083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31264"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAR7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31264.1"
FT                   /translation="MIYQIQQMPRLYKEVMSKYPNGKLYDSDVRFWYYSWLEDRQVHGL
FT                   DSAIKQFAGDLQGNWTNLLKDPSIMLQYNTIDTYLTKNFSYWDLIKFIHGYGQKWGGGD
FT                   SEKHFLYYPIAFKAFGIPIHYFTTYYEFYINAPARYAIFYEGTFFGLPDSVLEPLKQGK
FT                   YNEVLIFPGNGISPIGSPLYGIKKDLEYGEQHRVEPNAKYIEMYLPVRGKKIYLFKEGK
FT                   EG"
FT   gene            complement(104145..104372)
FT                   /locus_tag="Shell_0119"
FT   CDS_pept        complement(104145..104372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31265"
FT                   /db_xref="GOA:D7DAR8"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAR8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31265.1"
FT                   /translation="MELMHLIVIRVVILVNVIGVVLITVNVLRIIVAPTILMDLKLVRR
FT                   NVWRKEILQIMEENPIFVTLLDGVVLKIKK"
FT   gene            complement(104536..104721)
FT                   /pseudo
FT                   /locus_tag="Shell_0120"
FT   gene            104803..105084
FT                   /locus_tag="Shell_0121"
FT   CDS_pept        104803..105084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0121"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; KEGG: tgr:Tgr7_3222 AbrB
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31266"
FT                   /db_xref="GOA:D7DAR9"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAR9"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADI31266.1"
FT                   /translation="MSIVKVTRKRQITLPKKICDSLGISPGDYVRVYIDENGKIIVEKA
FT                   FSIDQLAGSLNPSRPLENLAEDLDEDRKVITLKELKAAASSPRISPVL"
FT   gene            complement(105102..105203)
FT                   /pseudo
FT                   /locus_tag="Shell_0122"
FT   gene            complement(105945..107117)
FT                   /locus_tag="Shell_0123"
FT   CDS_pept        complement(105945..107117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0123"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: vsa:VSAL_I2682
FT                   putative phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31267"
FT                   /db_xref="GOA:D7DAS0"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAS0"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ADI31267.1"
FT                   /translation="MDLLWFIIGVLAAFFVAWNNGSNNAPNAIGTAVGAKVLDVRKALI
FT                   MATIASFAGSISLGIYVTNTVMKGIVNTLNMPAPYVVKGMISVLIASGIYTLISTYLKV
FT                   PMSVHVEIIGGIIGFGLAIGSSFISWETILVIMIAWLIVPFAATGIAYILYPAFSRSFR
FT                   EKRPAKTSLIVSSYITSATPTILILVKTINVSSIVYASITTVTISTLTTIMVYLYWKRR
FT                   IAEGGSPLHEASRILLIMVAAAMAFSFGSNDVANSAGPLAAILYALGIKESLTAMWIAI
FT                   IVASIGLSAGIIMWGSKIIDTIGEKISPLTPPTAYVAQLSATLTMLAASRLGLPVSTSM
FT                   AIVGGVMGVGFSRGTRSVNLKLLARIFTLWLISLPATMGITYFLTLGLLI"
FT   gene            complement(107294..107680)
FT                   /locus_tag="Shell_0124"
FT   CDS_pept        complement(107294..107680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31268"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAS1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31268.1"
FT                   /translation="MSNSSMPEEIVRAYAVYLIVKRDSEKALSVLSRYYGILTPRIRIG
FT                   LPKKHSKALGCYDPVKKTICLRSSEEYGNPFVVLHEYYHHLRNSRREYPGNEKYANRYA
FT                   LKSIMYFKELVRTGIRLDKVFDSL"
FT   gene            complement(107856..109733)
FT                   /locus_tag="Shell_0125"
FT   CDS_pept        complement(107856..109733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0125"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="PFAM: aldehyde ferredoxin oxidoreductase; Aldehyde
FT                   ferredoxin oxidoreductase; KEGG: gsu:GSU0910
FT                   aldehyde:ferredoxin oxidoreductase, tungsten-containing;
FT                   SMART: Aldehyde ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31269"
FT                   /db_xref="GOA:D7DAS2"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAS2"
FT                   /inference="protein motif:PRIAM:1.2.7.5"
FT                   /protein_id="ADI31269.1"
FT                   /translation="MGRILRVNLWRNKYYIEPLPPETVLRSWLGGRGLGVYLALKEIDP
FT                   KADPLGPRNKAFVMTGPITGVAGIPEAGRWCSVTKSPLTDTIHDSQSGGKFGPELKFAG
FT                   FDAIILEDISEKPVYLWIHDGKVEIRDATHLWGKDVHSTTDIIQEELAAEIGRDEAKKV
FT                   KVLAIGPAGENLVRFAALMNDKYRAAGRGGHGAVWGSKKIKAIAVRGHMKPEIAKKEMF
FT                   KEVVIKMVKKHRENPVTSEGLPKLGTAILVNIINKAGMLPTRNFRTGVFEGAEKISGEV
FT                   LAEKYLDKKKSVEESCWGCVITCGRYTKVGKSPFSGEGGGPEYETIWAFGAQTGTDDLE
FT                   AINKANYLCNELGLDTISMGNTIGALMELVELGKIPPEKLRGLNVKWGSPDAIVELVWR
FT                   TAYRSGIGDELAEGSWRLAQKYGAPEVSMSVRGQELPAYDPRGAQGQGLAYATSNRGGC
FT                   HVRAYLISPEVLGVPKLVDRFTTKGKPALVKEFQDVTAVVDSMIVCLFSSFAIWDEDYA
FT                   EIISAVTGWDVSKDEVHKIGERIYNAERAFNVLSFGDGREYDTLPKRLLEEPMPEGPSK
FT                   GHVVRLNEMLDEYYKLRGWIDGRPTRAKLEELGLKWVADRLEEEGLLPG"
FT   gene            110007..110090
FT                   /pseudo
FT                   /locus_tag="Shell_0126"
FT   gene            110254..111228
FT                   /locus_tag="Shell_0127"
FT   CDS_pept        110254..111228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0127"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: sfu:Sfum_3638 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31270"
FT                   /db_xref="GOA:D7DAS3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAS3"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADI31270.1"
FT                   /translation="MLDIAIYATMWEGMVLKILISNLLEKSPIKIGRIVFYVLVFTIIF
FT                   LSISVASILVLLSNASAVACAFWRTFLSAIILWFIKLLLNRSWVGLRNYKVLSLIVLSG
FT                   VFLAAHFLFWMESLFLVPVAISTTIVVSYPLFSLVVDKIIYNERIYGIQYIGLTTGFIG
FT                   IAFFMEPRLIGEYSVSGVILALLGAVAATGYFSIGRRVRKVVGLLEYTTIAYSSAAITL
FT                   LVYSLFTGANLVHYGLNSYIYFFLLAIIPMLGGHTLLNYVLKYIKTSSATSIALGEPVG
FT                   ASILAYIFLGQIITPIQILLIIVILLSIALVLYPEIRNITEKK"
FT   gene            111350..112774
FT                   /locus_tag="Shell_0128"
FT   CDS_pept        111350..112774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0128"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: dal:Dalk_5142 radical SAM domain protein;
FT                   PFAM: Radical SAM domain protein; cobalamin B12-binding
FT                   domain protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31271"
FT                   /db_xref="GOA:D7DAS4"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAS4"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADI31271.1"
FT                   /translation="MKVLLSLPPEVHKLEIYKVTGMSAPPLGLAYIGAVLENAGHKVRI
FT                   IDSPTLKINFKDWISEVKSWDPDIVGISMLTPLAPKGYVAAKLVKEELGNDVIVIAGGP
FT                   HPTYMYEEALSNGIDVVVRGEGEYTTLELVNTIEKYGLDKNTLKEIKGIAFKDDSGKAV
FT                   VTPPRPFIQNLDELPWPARHLLPMDKYTLFGKPIRIAHVMASRGCPYGCIYCITSYFWG
FT                   RRIRFRSAKNVADEVEFLVNKYKANHIAFSDDDLVINRRFVLGFIDEIKKRGLDITFSC
FT                   GSRVNHINKEILKTLYDNGCTALYFGVESASQETLNRIGKRITIEQAERVFKWVKELKG
FT                   FALGSFILGFPWETIDDMKKTVDFAIKLDPNYAQFTVLTPYPGTPLFEYAKKYNLIEDW
FT                   NWEHYTTVKPVMRGFHFTTKDLGKMIKYAYRKFYLRTKFIMRELKAGRLKDLSGILVRE
FT                   VFSWMRDKVYEYLRWK"
FT   gene            112774..114294
FT                   /locus_tag="Shell_0129"
FT   CDS_pept        112774..114294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0129"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: dal:Dalk_3856 radical SAM domain protein;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31272"
FT                   /db_xref="GOA:D7DAS5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAS5"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADI31272.1"
FT                   /translation="MNNKSQDNSKSDQRGGIGALLAGLRTLFDNPVSRIFLKTATIESE
FT                   CNHNGRKVTAPIVYHALSMYAGEPVSSCPITARFIGSIVNAIMRLGIKLLKGREDEVIE
FT                   ALKDPALRRGVSLVLKGLGLYGVTVPQELPAPFLIVWNFTNMCNLKCKHCYQRADKPLP
FT                   NELSLKEKIMVVDQLDRAGVAAIALSGGEPTIHPHFRRILYEIASRGMYAAVATNGWVF
FT                   ADIEKLKEAKKLGLRYVEVSVDSADPKKHDWFRGVQGSWERAVKALENAVKLGINHAMA
FT                   TTITKMNINEVEDLLDLAESIGVKRVVFFNFVPVGRGKDNIWLDLDPLEREEFLRTIYK
FT                   EMSKRKMEIVSTAPQYGRVSLQLSGGKEVAPTHFYVGGDPIVRAVAEFVGGCGAGRIYA
FT                   GIQPDGTLIPCVFLPIPVGNLRERTFWDLWVNAPLFKLLRDRSKLQGACAVCPYKNICG
FT                   GCRARAYAYFNDPMAPDPGCLYNIKYWKKLKEEAKTASHIKIKVGSKD"
FT   gene            114439..114906
FT                   /locus_tag="Shell_0130"
FT   CDS_pept        114439..114906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0130"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: sat:SYN_02544
FT                   universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31273"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAS6"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADI31273.1"
FT                   /translation="MLDNTELFQKILYTTDFSKASEKALDYVIKLKGAGAEEVIILHVV
FT                   DISTLEAYEDIYSLKGMSSNQIIETIKNEIKKKLEGIEEKIRAQGLKTKVLVRIGKSYK
FT                   EIVKVAEEENVSLIVIASIGRGVKWGVFDVFLGSTAGKVVARAKRPVLVVK"
FT   gene            complement(115701..116927)
FT                   /locus_tag="Shell_0131"
FT   CDS_pept        complement(115701..116927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0131"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG:
FT                   dal:Dalk_1082 bile acid:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31274"
FT                   /db_xref="GOA:D7DAS7"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAS7"
FT                   /inference="protein motif:PFAM:PF01758"
FT                   /protein_id="ADI31274.1"
FT                   /translation="MNIKKMQKNLATNMPLYSTLAIAMGLITGYYLINLLKLSEFIILR
FT                   IFMAIYQILMTTYPMINLSLDNIKKKIKSTVKQLVETIDFMKLKVHLDKYLIPYVVVAM
FT                   ILGFIAGLHINVEHYKNIFSTLNMIVVITMIYPMMINLRIEALAKASKSWKQLTLAILI
FT                   GLIYAPLLVFGLTLLLHMSPVLSLGLILATVVPCSSMAIAYTGLSEGNIELATVIVALS
FT                   FTLAIVTVPGWLSIFAGAYHLSVSAWLLIKTILIVVIVPLILGYITRILLLSKMGVKGF
FT                   ERLRPLFPSISILGMFAIVALIFMEKAKLLASKPSVVGMVIIPLALYYSITLLLMTYLD
FT                   KKIGLNYEDHMAIVFTSVGKNEGTAIAIAVAAGMGLMAIPPAITPILQIPFLVGYLKLS
FT                   QKIRKWWAK"
FT   gene            complement(117077..117151)
FT                   /locus_tag="Shell_R0006"
FT                   /note="tRNA-Asp1"
FT   tRNA            complement(117077..117151)
FT                   /locus_tag="Shell_R0006"
FT                   /product="tRNA-Asp"
FT   gene            117251..118489
FT                   /locus_tag="Shell_0132"
FT   CDS_pept        117251..118489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0132"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: sun:SUN_0480
FT                   NhaA family Na(+)/H(+) antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31275"
FT                   /db_xref="GOA:D7DAS8"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAS8"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ADI31275.1"
FT                   /translation="MEDFIDLVLALFLAFSVGRLLEEGFSRLGVPSVLGDLTVGIIFGA
FT                   SLLGWYPVGGVVKAFSVFGVFLLLFYAGLETRYSEFMRSLPVYGIITLGEVLVAFSLGY
FT                   IIGVSFGYPPKSAYFVGTVLVATSVSVSIKTLVEINKLHTLEGYTVMGIAVLDDLAALI
FT                   TIVVGASLVKTGTISFGTVSEILLIAISAWLIIVVLLHRYGSYISRLASHLHTDESILV
FT                   SILATVFGLTLLSQYINLSPLVIAYAAGLGFSEAWGSRTVAEKVRLLAVLFSPLFFITT
FT                   TAEIDLKTAIVPQYILFYTVMIIAAFVGKLLGGGLTSFLVGYPAWASLRIGVGLFPRAE
FT                   FCIIAAYMGYSYHVIGADVYLAALLIIVATNFLTPPILKYVYSHGPQYDPLKFKPKIVL
FT                   FMEKLMRKTKRTG"
FT   gene            118500..119816
FT                   /locus_tag="Shell_0133"
FT   CDS_pept        118500..119816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0133"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Citrate transporter; Arsenical pump membrane
FT                   protein; KEGG: dma:DMR_06440 arsenical pump membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31276"
FT                   /db_xref="GOA:D7DAS9"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAS9"
FT                   /inference="protein motif:PFAM:PF03600"
FT                   /protein_id="ADI31276.1"
FT                   /translation="MYGILVLSLLILMIILVAIGKPSREYIGLILIITLLITRTISIEE
FT                   FILYVNWDVLGLIVGMSMFSILLEESGIVELVSIYILRKTTSPRNILFLLTLTAGLVSI
FT                   ALENVTVVLLFAPIAFNIARKLGIKPTYMIIGIALASNMAGSATMIGDPPAIIVAGHYD
FT                   LSFADFIIYNGKPSMFFITLVPMIISTYIYTILSTHEEVEPRIGIIQANKNSWEKTNNI
FT                   VKDKSFLAEALLFLTIKITLLSIRETIKLPLTLIAVIGVGGLITTRILLHRDTESVKKS
FT                   IREGFDWKLLLFLIGVFALSGAFAKYGLANKFAEALLKISGDNIFIITGILIWLSVAFS
FT                   AVIDNTPYVATMIPVIDSIAENLGVEPLRIAWALLLGATLGGGITYIGASANLVAVRLL
FT                   ENRGYRVTFTDFIKKSLPFNLSNLLVGWLLYIVFWIIWF"
FT   gene            complement(119869..120861)
FT                   /locus_tag="Shell_0134"
FT   CDS_pept        complement(119869..120861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0134"
FT                   /product="respiratory-chain NADH dehydrogenase subunit 1"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase subunit
FT                   1; KEGG: dds:Ddes_1881 respiratory-chain NADH dehydrogenase
FT                   subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31277"
FT                   /db_xref="GOA:D7DAT0"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAT0"
FT                   /inference="protein motif:PFAM:PF00146"
FT                   /protein_id="ADI31277.1"
FT                   /translation="MTWGDLGSYTLQSLLYPGLLFIIIMIIFTQWIYRKVAGRVQYRRG
FT                   PTYVGPFGLLQPFADLMKLLLKEDVVSRYSAKIAPVIIAALGVGAITVLTLMTPLAYDP
FT                   VHAPFDIILFFYLALWASLSIMFLGLATPNPYTSLGVGRYMALLVSAEPAYISSFLVPV
FT                   IIASKIDPGVEYSLYRSSLISYQLWTDNVFSLIAMIIAAIAGFLAMMGILEIKPFDFPE
FT                   AEGEIYWGIFTEYGGPRLALAFFILFAERIVVPIIYVLLFLGGSWPIDISTNYIGGLLV
FT                   IFAKFIVVFILLSVIDNVMPRFKPTQGVRFLWKYPVTLAIAALIIALLI"
FT   gene            complement(120868..121218)
FT                   /locus_tag="Shell_0135"
FT   CDS_pept        complement(120868..121218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31278"
FT                   /db_xref="GOA:D7DAT1"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAT1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31278.1"
FT                   /translation="MNGLDIYIATLLVTGLAVLNGIIIYLILYKLLGKIYGEKLKSPSR
FT                   LKEEVVMCGQEYTEETLSAPVSHVFTDIIKRSLPKLSKIIEEGGGTSILNNWFAWMLVL
FT                   LLTIIVLAYVYG"
FT   gene            complement(121235..121738)
FT                   /locus_tag="Shell_0136"
FT   CDS_pept        complement(121235..121738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0136"
FT                   /product="cation antiporter"
FT                   /note="PFAM: cation antiporter; KEGG: avi:Avi_1281 Na+/H+
FT                   antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31279"
FT                   /db_xref="GOA:D7DAT2"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAT2"
FT                   /inference="protein motif:PFAM:PF01899"
FT                   /protein_id="ADI31279.1"
FT                   /translation="MDKVKAIIALIIPLIIIYLIYTGSYSLFELLLGIIVAVFVAYLFG
FT                   DAVVRNAGKIYSPIRWFWGLVYAILYFTIIEAKAHWEVIKLIFKPSNVKPAIVRIPYSV
FT                   ETDYAVTTIANSITNTPGTITIDVDENKKHLYVHWIRAVDLSDEGAWVHISSVFEKYAK
FT                   KIFD"
FT   gene            complement(121731..122156)
FT                   /locus_tag="Shell_0137"
FT   CDS_pept        complement(121731..122156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0137"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   dal:Dalk_4921 NADH-ubiquinone oxidoreductase chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31280"
FT                   /db_xref="GOA:D7DAT3"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAT3"
FT                   /inference="protein motif:PFAM:PF00420"
FT                   /protein_id="ADI31280.1"
FT                   /translation="MIDVSTLIWSYIYAVTITIIVITVYGMATRPNIVKKLILLSILSD
FT                   TGNLIAVMIGVHAGMIKPPVFPGISFTDHPVAGYNELLNFAGEAVDPIPQVLVVTAIVI
FT                   GLAVLVFLGYVTLLLYQKYGTLDVRLLEKKIRGEKSG"
FT   gene            complement(122153..122989)
FT                   /locus_tag="Shell_0138"
FT   CDS_pept        complement(122153..122989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0138"
FT                   /product="Na+/H+ antiporter MnhB subunit-related protein"
FT                   /note="PFAM: Na+/H+ antiporter MnhB subunit-related
FT                   protein; KEGG: swp:swp_0938 putative monovalent cation/H+
FT                   antiporter subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31281"
FT                   /db_xref="GOA:D7DAT4"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAT4"
FT                   /inference="protein motif:PFAM:PF04039"
FT                   /protein_id="ADI31281.1"
FT                   /translation="MVEGKVSGRDVLLSIVAASIIVILSYVLVSFFVISIPPQETNRWL
FT                   ANWFLTSTYNWENKEWWSGSPEVVTSILWDYRGLDTVYETSVFFFAIIGGLMLVRSVKI
FT                   DKESLGIKGMSVISKTVTKIILVAVPVVAASVALHGHLTPGGGFQGGSIFAVSSLLAIV
FT                   ALGTGFLYRRGWTKMRLLGFRTLGLLIISTTVISLFVVGVFSGITAYIVQNQWKPWAPI
FT                   GMGYLVDLGVFGNILYSGSLIFLNLAEFLAVSAGLSLAFIIMALPKKKLVEGGDIE"
FT   gene            complement(122989..123288)
FT                   /locus_tag="Shell_0139"
FT   CDS_pept        complement(122989..123288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31282"
FT                   /db_xref="GOA:D7DAT5"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAT5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31282.1"
FT                   /translation="MIPSIPLCYILLALFMTYALILTYMTLKAKNLVKATIYSAGQAVA
FT                   YTLALTLLAAPDLVLAYVAVGVGMYTALFLFIISRTEDTEYESLSEALEKSGGR"
FT   gene            complement(123285..123668)
FT                   /locus_tag="Shell_0140"
FT   CDS_pept        complement(123285..123668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0140"
FT                   /product="monovalent cation/proton antiporter, MnhG/PhaG
FT                   subunit"
FT                   /note="KEGG: ara:Arad_1474 Na+/H+ antiporter; TIGRFAM:
FT                   monovalent cation/proton antiporter, MnhG/PhaG subunit;
FT                   PFAM: Na+/H+ antiporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31283"
FT                   /db_xref="GOA:D7DAT6"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAT6"
FT                   /inference="protein motif:TFAM:TIGR01300"
FT                   /protein_id="ADI31283.1"
FT                   /translation="MILEAIAYYAGMALILVGGVLDIIASIGMNRFKNFYLRLHAATIG
FT                   AIGGGFYPLIGLGLVALTFDWLGSMKYYISGIAFTTAFFLVLTAPVGSHALAQGAHKSR
FT                   IVMPEPIIADKLLEDEEKGAGKQ"
FT   gene            complement(123683..123976)
FT                   /locus_tag="Shell_0141"
FT   CDS_pept        complement(123683..123976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0141"
FT                   /product="multiple resistance and pH regulation protein F"
FT                   /note="PFAM: multiple resistance and pH regulation protein
FT                   F; KEGG: tcx:Tcr_0059 putative monovalent cation/H+
FT                   antiporter subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31284"
FT                   /db_xref="GOA:D7DAT7"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAT7"
FT                   /inference="protein motif:PFAM:PF04066"
FT                   /protein_id="ADI31284.1"
FT                   /translation="MSLLPPQETTLYLLSFATGLFVLASIFYFTRVVKGPSLPDIVLAV
FT                   DTLSYDLAVFMVLFSLLCNSPLLAVGALPLVLWAYLLDMYVSKYLVKRELGD"
FT   gene            complement(123987..124451)
FT                   /locus_tag="Shell_0142"
FT   CDS_pept        complement(123987..124451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0142"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: geo:Geob_1270 NADH-quinone oxidoreductase,
FT                   chain I"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31285"
FT                   /db_xref="GOA:D7DAT8"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAT8"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADI31285.1"
FT                   /translation="MVLKAVLLGFKYLFKKPYTRMYPYKEEAYVTSKTRARHILYMDRC
FT                   IGCRACQLACPADAIKMYHVEGDYPKNRKKIFPGIDYSRCTYCGLCVEACPVNALAMTN
FT                   YTMEHLITEDKATTLYTPEMLAKPPEGKYVITLSKDTWKPPLTPPPKKKK"
FT   gene            complement(124457..125584)
FT                   /locus_tag="Shell_0143"
FT   CDS_pept        complement(124457..125584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0143"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: nse:NSE_0566 NADH dehydrogenase subunit D;
FT                   PFAM: NADH-ubiquinone oxidoreductase chain 49kDa"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31286"
FT                   /db_xref="GOA:D7DAT9"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAT9"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ADI31286.1"
FT                   /translation="MSKARVLTVFLGPQHPGAPGNVGFKLLLDGERVLDIDLIPGFLHR
FT                   GFEKMMEYRRWDMDLVLSARVCVEDPDHVELTYTHAMEQIFGIEPPEKAKYVRVIVAEF
FT                   SRLANHLLWMMHFAGPIAARYATSWAIAAREEILKWFDYVAGHRVYHHYIFPGGIRWNI
FT                   PSDFKEKTLKVLKVIKPLIDDLRDGFFYHPIFEKRARDMGRLKPGDAIRLGATGPTLRG
FT                   SGVKFDLRKALKYDAYGEIDFEIPTGEYGDSYDRALVRLREMYISMEIIRQAVEKMPTE
FT                   GPYRYRLPAAIPTGEGIGRVESARGEFLAHILQRPPGAHRYSKPLNPYRIKFRGPTMAH
FT                   LTTVLKHIVHNEEITVADLPVLIGSFDPCAPDIDR"
FT   gene            complement(125581..126135)
FT                   /locus_tag="Shell_0144"
FT   CDS_pept        complement(125581..126135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0144"
FT                   /product="NADH dehydrogenase (ubiquinone) 30 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone) 30 kDa
FT                   subunit; KEGG: scl:sce9060 NADH dehydrogenase (ubiquinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31287"
FT                   /db_xref="GOA:D7DAU0"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAU0"
FT                   /inference="protein motif:PFAM:PF00329"
FT                   /protein_id="ADI31287.1"
FT                   /translation="MEIDKELIEKLPDKYKNSFSVEGTDTGKRIEINIEPQDLCKVLPA
FT                   VKDAGYDHFIGITVIDYPDQNAFELVYLIDSISKNGQLVAIRTKLPRDNPVIDTASFIY
FT                   PLAYYQEIEAYEFFGIRFNNHDGLRKWILEDNWQGPPPLRKDVDTRDIVLKLYYGGKRY
FT                   ERPVQKRSLGGYSLVEKGGEK"
FT   gene            complement(126138..126677)
FT                   /locus_tag="Shell_0145"
FT   CDS_pept        complement(126138..126677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0145"
FT                   /product="NADH-quinone oxidoreductase, B subunit"
FT                   /note="KEGG: geo:Geob_0463 NADH-quinone oxidoreductase, B
FT                   subunit; TIGRFAM: NADH-quinone oxidoreductase, B subunit;
FT                   PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31288"
FT                   /db_xref="GOA:D7DAU1"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAU1"
FT                   /inference="protein motif:TFAM:TIGR01957"
FT                   /protein_id="ADI31288.1"
FT                   /translation="MSGKKKSKPGFAEWVRSRSIWMIHYCTACGAIELPPNIVAPLDAE
FT                   RWGIMAAPSPRQADVLVVMGYVTKKTLKILMRLYHQMPEPRYVMVGCNCPATGGLYWDS
FT                   YSTIKAVDEFLPVDVWVPGCMPRAEDWLQGFLRLRKKISEGRIVSPRPVEEPGELEELI
FT                   YREIEMREKLMAKVRG"
FT   gene            complement(126683..128281)
FT                   /locus_tag="Shell_0146"
FT   CDS_pept        complement(126683..128281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0146"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: shl:Shal_3361 putative monovalent cation/H+
FT                   antiporter subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31289"
FT                   /db_xref="GOA:D7DAU2"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAU2"
FT                   /inference="protein motif:PFAM:PF00361"
FT                   /protein_id="ADI31289.1"
FT                   /translation="MVYQSAAVTAAALAPLLAVISAFMLPLLSSLLSNKRSLFAFIYSE
FT                   TVFLINAFLTTLVYLYIHGSNNVLIYLFAGFPAPFGIIYEVDTLGAFFGLLVGLVFPLV
FT                   NIVSYSYLERSSKHNEWYYTLYLGLQAGMLGIAYTGDLFNLFVMLEVMSITAYGLTAYF
FT                   REKGRPLNAAIKYGLFGAVGSTIYFLAVVFLYSGIGTLAMPDAAAASMGLNYFGETTGL
FT                   APNPFPVLTLFAGLAVWALMIESAIFPHHFWLPDAYSSMPSSAAATMAAVAEGIGAYAI
FT                   IRIIYVIVGIDKVLWLLSLLVILGTVNIIAGGYLMAVSRDAKRIVAYSTILDMGYVMIG
FT                   IGLATKIGLQSALFYILAHTIVKPLLFIAVGEVEAEYKTTDIDKLEEIGGVDPYISSAL
FT                   LFGGLAVVGIPPLNMFFAKLMLFEAVLDSGIYPLLIVILLGSALAFIGFSRLWFVTIGY
FT                   RRRSIVGKIARASYSAKALIVLLVLATILTGIFYNYLYEQVLSRIVETMFSNQFRYEYV
FT                   KAAYDYLSQALLRGG"
FT   gene            complement(128424..128612)
FT                   /locus_tag="Shell_0147"
FT   CDS_pept        complement(128424..128612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0147"
FT                   /product="RNA-binding protein Nop10p"
FT                   /note="PFAM: RNA-binding protein Nop10p; KEGG: nucleolar
FT                   RNA-binding protein; K11130 H/ACA ribonucleoprotein complex
FT                   subunit 3"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31290"
FT                   /db_xref="GOA:D7DAU3"
FT                   /db_xref="InterPro:IPR007264"
FT                   /db_xref="InterPro:IPR023532"
FT                   /db_xref="InterPro:IPR036756"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAU3"
FT                   /inference="protein motif:PFAM:PF04135"
FT                   /protein_id="ADI31290.1"
FT                   /translation="MRKCIRCGRYTLNHDRCPYCGGELIVPHPPRFSPEDKYVAYRLEM
FT                   KIKTGILDLNKIPVYDP"
FT   gene            complement(128621..129424)
FT                   /locus_tag="Shell_0148"
FT   CDS_pept        complement(128621..129424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0148"
FT                   /product="translation initiation factor 2, alpha subunit"
FT                   /note="PFAM: translation initiation factor 2, alpha
FT                   subunit; RNA binding S1 domain protein; KEGG: eukaryotic
FT                   translation initiation factor 2 subunit 1; K03237
FT                   translation initiation factor eIF-2 alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31291"
FT                   /db_xref="GOA:D7DAU4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011488"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022964"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR024054"
FT                   /db_xref="InterPro:IPR024055"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAU4"
FT                   /inference="protein motif:PFAM:PF07541"
FT                   /protein_id="ADI31291.1"
FT                   /translation="MPIPRKELPNVGEYVIATVKKIFDYGAYVTLDEYNGLEAYLPWSE
FT                   VASRWVRNIRDVIRENQKIVVKVIRVNRRRKTVDVSLKKVPENEKRRKVLWWKRYLKAS
FT                   KIVELVAEKIGKSIEDAYREVVWKLEDYYGDPLLGLEEAVIRGPDALREAGIPEEWIKP
FT                   LYNDALRHVKVKMVKIRGLMFLRSYESDGVERIKKILLSAKEILDKVGDNVKGRIYLLG
FT                   SPRYVVEITAPDYKEAEKILKEILATTEKLAKELKVEFRFERERK"
FT   gene            complement(129459..131513)
FT                   /locus_tag="Shell_0149"
FT   CDS_pept        complement(129459..131513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0149"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Hypothetical protein CBG09235"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31292"
FT                   /db_xref="GOA:D7DAU5"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAU5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31292.1"
FT                   /translation="MKNNRFIVEVVVGIVLLAIGFLGYIWISYYMNQYQDIPDDMVSWF
FT                   HLHVIQYLSSGHNPASDTYLRFIDGRNLLLSPILLDLFIVKMNLSPWITVVVLSLVYIL
FT                   LVFTVSYLISNKNMYVAGFSTILFSFVPAFIYWFKYNMFGAYVSQSLWLAVPILLGLGL
FT                   RHNRLYLIIIGSILSGILWLMWPGAWIIPVMYSVYLSALIYKGTIFRESLLTGLLLLVF
FT                   SLPLNILTGFLYVTVYHIFSLVLLISNIVIGYIEYRVTRVVGEYSRFAWRIIGSIMGYA
FT                   IGLASAFLLLDFISGYGVYEDYYRLYNPLYDYGIIGVLSVIAIIAVVRSHILVDLKNNF
FT                   LEFVLIAGFIIGLIASYFDPTLTVFTASCIVPFVSLSLISIASFLSSTSRGLYRVVYIV
FT                   VAAWILFGSILGNAIPSYALITTPPSVYYGDFTHDILHNKSIPESPLLKALSYIKNNTD
FT                   RESLIISYWGFSYWVVGYIGGRAHTLADYKGSLRGQRIISWIMISDENTAYQLIKKLVG
FT                   NNSNINVYVLVSEVVSIEKGGATPIANYAHIGRPIVIPSQTPGQTQVLYQPIGDIARIP
FT                   LYLSLINATIQSYIDYTKARAYFEAPLAWKDNTKQSLLVKLVVDALRKESLSVVNDVLS
FT                   PIPVEGVSPPQFFKHVSTIMLPLYPVDTGTTTLNVTYMVALYKVETNIS"
FT   gene            131675..132061
FT                   /locus_tag="Shell_0150"
FT   CDS_pept        131675..132061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31293"
FT                   /db_xref="GOA:D7DAU6"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAU6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31293.1"
FT                   /translation="MARIKKELLGHLLEYGYVIEKVSTLILAIVFLITIIIIPNWYRTF
FT                   LNYSLSPQLYGVRYIGTSILITVLMLVNAFVAYLIPHFAPSLRPRGFRMVKDRRTLSIY
FT                   LALIASLLSLSILSYVLLVSQLLM"
FT   gene            complement(132050..132547)
FT                   /locus_tag="Shell_0151"
FT   CDS_pept        complement(132050..132547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31294"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAU7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31294.1"
FT                   /translation="MYDVFLRLIREEIGSDKITLIHPAKIQEYESFIKNNIGDLAYMSK
FT                   DSKKLFNKVLENIVYDAELLVRLRLAKKSLGSDHPGEAIDKFILDKINSIVDFAKLYIS
FT                   KFLLGIGDKLIVKCKKECYVENRKYMPGDIVYMNAEEALIHYIEGNIELFINPYLEQIL
FT                   HQ"
FT   gene            complement(132540..133673)
FT                   /locus_tag="Shell_0152"
FT   CDS_pept        complement(132540..133673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0152"
FT                   /product="DNA primase small subunit"
FT                   /note="PFAM: DNA primase small subunit; KEGG: DNA
FT                   POLYMERASE ALPHA COMPLEX; K02684 DNA primase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31295"
FT                   /db_xref="GOA:D7DAU8"
FT                   /db_xref="InterPro:IPR002755"
FT                   /db_xref="InterPro:IPR014052"
FT                   /db_xref="InterPro:IPR023639"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAU8"
FT                   /inference="protein motif:PFAM:PF01896"
FT                   /protein_id="ADI31295.1"
FT                   /translation="MSRQELNNKFFIKKILREYYSQKPLEEPLYIHKREIAIHSLEDEA
FT                   YIRHLTFPSITHLYNFILNEKTPLHLYYSSAYYESPSIKKMELKGWTGSDLMFDLDSDH
FT                   YPGCGKILSICIEENTIYEGKIKKCPKTGSKPVIYPLIKTECIQKAYIDALRIKYILED
FT                   ELGLKNIKIYFSGNRGFHVKVIDEKIWDLGGDERREIASYISLENFDTNKLFPVVGKRN
FT                   KYVIITKNEYGIRKRVLDYLIKNNIVNGNKLFIKLPFKILEEIINDLAIPIDIVVTMDI
FT                   SRLSRFGNSINGKSGLITKHVEPREDYMFNTNDFSPWNGSIIVKPLIDVSGLQVFNEKI
FT                   NLKRGVKESFDSKTAVYLALKGIVKIVSDEKLVIKNV"
FT   gene            complement(133651..134397)
FT                   /locus_tag="Shell_0153"
FT   CDS_pept        complement(133651..134397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0153"
FT                   /product="proliferating cell nuclear antigen PcnA"
FT                   /note="KEGG: PCNA; proliferating cell nuclear antigen;
FT                   K04802 proliferating cell nuclear antigen; TIGRFAM:
FT                   proliferating cell nuclear antigen PcnA; PFAM:
FT                   Proliferating cell nuclear antigen, PCNA"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31296"
FT                   /db_xref="GOA:D7DAU9"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAU9"
FT                   /inference="protein motif:TFAM:TIGR00590"
FT                   /protein_id="ADI31296.1"
FT                   /translation="MKLRFADARAWRYAMSAIGKIIDEGAYKIQENGIRLRAIDPSRIV
FT                   MVDFHIPREGLIEYEFDKEETIGVNMEDLTKILRRAVKGDELELQTLEAGRLAVVFLGR
FT                   GTRMFIIPSLETIAEELPELKIPFTVKAKMLPSTFRDVVKELEPISDAIEFRAIKDEQK
FT                   IIAKASGDMVEAEIELSVENGALIDFEASEDARAIYTIDYLSDISGASQAAEELAFEFA
FT                   TAVPCKIEYVLPQEGRLIFYVAPRVE"
FT   gene            complement(134484..134654)
FT                   /locus_tag="Shell_0154"
FT   CDS_pept        complement(134484..134654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31297"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAV0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31297.1"
FT                   /translation="MTRDNRCVDRELFEKSLDQLNDLLLEAYYSTPPYIASKTLIKRAK
FT                   ELVQSLLETLS"
FT   gene            complement(134651..134965)
FT                   /locus_tag="Shell_0155"
FT   CDS_pept        complement(134651..134965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0155"
FT                   /product="Transcription factor TFIIS"
FT                   /note="KEGG: DNA-directed RNA polymerase III subunit RPC10;
FT                   K03019 DNA-directed RNA polymerase III subunit C11; PFAM:
FT                   Transcription factor TFIIS; SMART: Transcription factor
FT                   TFIIS"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31298"
FT                   /db_xref="GOA:D7DAV1"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR006288"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAV1"
FT                   /inference="protein motif:PFAM:PF01096"
FT                   /protein_id="ADI31298.1"
FT                   /translation="MKPVKKGDTYYLVCTRCGYKIKATEKDLKLYRISVKIEHSNKEKT
FT                   TVVDEEERLRGLPITREVTCPRCGYHEAYYWVVQTRAADEPPTRFYKCRRCGYVWREYE
FT                   "
FT   gene            complement(135448..135741)
FT                   /locus_tag="Shell_0156"
FT   CDS_pept        complement(135448..135741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0156"
FT                   /product="RNA polymerase dimerization"
FT                   /note="PFAM: RNA polymerase dimerisation; KEGG: similar to
FT                   DNA-directed RNA polymerase II 13.3 kDa polypeptide
FT                   (RPB11); K03008 DNA-directed RNA polymerase II subunit J"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31299"
FT                   /db_xref="GOA:D7DAV2"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAV2"
FT                   /inference="protein motif:PFAM:PF01193"
FT                   /protein_id="ADI31299.1"
FT                   /translation="MSGVEDMELKVLKKTDTEIIIEIIGEDDTLGNLIAKEAMKHPKVV
FT                   YASYRIPHPLQNKLEIMIDVEPGADINEVLLEITENIRKFLREFKKEVEEKL"
FT   gene            complement(135745..136371)
FT                   /locus_tag="Shell_0157"
FT   CDS_pept        complement(135745..136371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0157"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31300"
FT                   /db_xref="InterPro:IPR019202"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAV3"
FT                   /inference="protein motif:COG:COG3286"
FT                   /protein_id="ADI31300.1"
FT                   /translation="MPLTKRFFHIPCKGDECFKLAELIREKAPQVELVEINITDTGLYI
FT                   EMYGYRTDIRNAWEYIRRLVSSAKASEQYSKKGTRRIKIEYLVEKKKKTFSPVLLSEIL
FT                   KHKGFKADLSDYKDEIITDAPLEVIEELIDNIWDVIEKIKYDVRGTTTKYFLTAASILT
FT                   DMDPQEVIMKAYSIGLLFKDEDEKYRLGKEWRRAISEFLNKVMTK"
FT   gene            complement(136380..136946)
FT                   /locus_tag="Shell_0158"
FT   CDS_pept        complement(136380..136946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0158"
FT                   /product="RNA-binding protein (consists of S1 domain and a
FT                   Zn-ribbon domain)-like protein"
FT                   /note="KEGG: similar to exosome component 1"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31301"
FT                   /db_xref="GOA:D7DAV4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025721"
FT                   /db_xref="InterPro:IPR030850"
FT                   /db_xref="InterPro:IPR039771"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAV4"
FT                   /inference="protein motif:COG:COG1096"
FT                   /protein_id="ADI31301.1"
FT                   /translation="MEKIRQGILVLPGDVLGVEEEYFPGQGVYVNGKGYLRSQLVGRVL
FT                   IDIVKRTTNVRSVHGKPYVPKVGDIVEGIVSSVSEDLAFIDIYATEEKPTRTTSFTGIL
FT                   HISQASSEYIETMYDAMRIGDIVRARVINNNHPFQLTTKEPGLGVIAAFCTKCGSPLRK
FT                   QDDKLVCPVCGNVEKRKISASYVFR"
FT   gene            complement(136960..137595)
FT                   /locus_tag="Shell_0159"
FT   CDS_pept        complement(136960..137595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0159"
FT                   /product="Methyltransferase-like protein protein 5-like
FT                   protein"
FT                   /note="KEGG: similar to Methyltransferase-like protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31302"
FT                   /db_xref="GOA:D7DAV5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAV5"
FT                   /inference="similar to AA sequence:KEGG:100167732"
FT                   /protein_id="ADI31302.1"
FT                   /translation="MLINKAKLEKILSKYPSISNPKRQYEQYETPSSIAASMLWNAFIR
FT                   KDITGKKIADLGCGNLKLGYGALFLGAKLVVGVDIDESLVGQAESILRDLGGDYSAKTL
FT                   LINSDIRDLFINSVDTVIMNPPFGVVRRNRGLDILFLKKAMEISESIYTIHKYSPRLTR
FT                   IIEELANAFGFKIIYSEQLLFPIPMLFETHRRKIYRVKVIFYVLKRKQ"
FT   gene            137705..138565
FT                   /locus_tag="Shell_0160"
FT   CDS_pept        137705..138565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0160"
FT                   /product="protein of unknown function DUF114"
FT                   /note="PFAM: protein of unknown function DUF114; KEGG:
FT                   rhi:NGR_b00930 periplasmic serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31303"
FT                   /db_xref="GOA:D7DAV6"
FT                   /db_xref="InterPro:IPR002825"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAV6"
FT                   /inference="protein motif:PFAM:PF01972"
FT                   /protein_id="ADI31303.1"
FT                   /translation="MDGYGDIISFLFWLILLYLIIHPQLQYKSLQSARLKIIRGMEKKY
FT                   GWRIITMIHRQERIGFLGIPMYRFIDIEDSEAVLRAIRNTPENQPIALILHTPGGLVLA
FT                   ASQIAMALKRHKGKKIVIVPHYAMSGGTLIALAADEIIMDPDAVLGPLDPQLQTPKGTF
FT                   PAPSLIKIAKMKGDKASDDTLIYGDIAEKALREIQEFIVQLLKDKMPEEKASEVAKKLT
FT                   EGYYTHDYPITVEHAKELGLPVKTDVPPEVYLLMNLYPQAIQQRPGVEYIPRPHVPYYH
FT                   GKHEK"
FT   gene            complement(138569..139612)
FT                   /locus_tag="Shell_0161"
FT   CDS_pept        complement(138569..139612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0161"
FT                   /product="diphthamide biosynthesis protein"
FT                   /note="KEGG: DPH1-OVCA2, DPH1; region containing DPH1 and
FT                   OVCA2; TIGRFAM: diphthamide biosynthesis protein; PFAM:
FT                   Diphthamide synthesis DPH2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31304"
FT                   /db_xref="GOA:D7DAV7"
FT                   /db_xref="InterPro:IPR016435"
FT                   /db_xref="InterPro:IPR022428"
FT                   /db_xref="InterPro:IPR035435"
FT                   /db_xref="InterPro:IPR042263"
FT                   /db_xref="InterPro:IPR042264"
FT                   /db_xref="InterPro:IPR042265"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAV7"
FT                   /inference="protein motif:TFAM:TIGR00322"
FT                   /protein_id="ADI31304.1"
FT                   /translation="MSGSFCESYEVDYQALINTIQEKNASTVFIQAPDGLKKLYKCIGE
FT                   HIIDKLPSIKIYYSASPSFGACDIPLEEIEAVKPDLVIHIGHNKYPFLSREINYDIIYL
FT                   PAYYKWKPTNDIINMLINELKKYNAEKIGLVTSIQHVHSLKEIAEKLGEHGYIAYIGKP
FT                   TYNVMMPGQILGCEYSAALKIYSKVDAYLVVAGGIFHALGLSLIVDKPVLILDPYRLQV
FT                   TYPSSDIKRLKAKRYYILSKLRNEVIRNVGVIIGSRPGQYRPTLIKYIENLLGEHGIKY
FT                   YLFTSTYLSREQLISIDNAYNLDLYVITSCPRLPIDDFNDFYKPVITPGELVMILKNIM
FT                   EKYVYPW"
FT   gene            complement(139651..140175)
FT                   /locus_tag="Shell_0162"
FT   CDS_pept        complement(139651..140175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0162"
FT                   /product="ribosomal protein L10.e"
FT                   /note="KEGG: 60S ribosomal protein L10; K02866 large
FT                   subunit ribosomal protein L10e; TIGRFAM: ribosomal protein
FT                   L10.e; PFAM: Ribosomal protein L10e/L16"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31305"
FT                   /db_xref="GOA:D7DAV8"
FT                   /db_xref="InterPro:IPR001197"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR018255"
FT                   /db_xref="InterPro:IPR022981"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAV8"
FT                   /inference="protein motif:TFAM:TIGR00279"
FT                   /protein_id="ADI31305.1"
FT                   /translation="MPLRPARCYTHFSGPPYTRREYIPGVPQPKIVKFEMGNVHGDYDY
FT                   RAELVMIEAGQIRHNALEAARVMANKYLSTTIGDQNYFLKIRVYPHHVLRENKMMAFAG
FT                   ADRLQDGMRQAFGKPIGTAARVYPGTIVMEVRVGKEHVEHAKEALRRAASKLPLPARIV
FT                   FKPLKPGLKPI"
FT   gene            complement(140270..141316)
FT                   /locus_tag="Shell_0163"
FT   CDS_pept        complement(140270..141316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0163"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; THUMP domain protein;
FT                   methyltransferase small; KEGG: similar to THUMP domain
FT                   containing 3"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31306"
FT                   /db_xref="GOA:D7DAV9"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAV9"
FT                   /inference="protein motif:PFAM:PF01170"
FT                   /protein_id="ADI31306.1"
FT                   /translation="MELLYTVNPGIEDIASEEIRAELGGVTSFEKMSGHVYHVVDNVSF
FT                   EAIYRLRSINRAFILLFKSRVGPRTNDLVKLREELVSSLETIHYYITPHTSFAVDTERL
FT                   GSHEYTSMDISRIVGEIIIRKVEEKTGVKPVVNLRTPHIIIHVFVRDENFFLGVSLTGS
FT                   RSLHRRGYRIYDHPAALKPTLAYAMLTLSGTRDKQVIVDPMCGGGTIPIEAGLLHEEAL
FT                   IYGYDRNPKHVRGAKLNAYASGVYGKVVFGVWDARRLHVIFDEQVDHIVSNPPYGIRYG
FT                   DPVVIRKLYRDFLGSAYKSLKPGGRLTIITTEYNYVLKKAGDIGFRVIHKRTVQHGGLY
FT                   PKIVVLEK"
FT   gene            141447..141570
FT                   /locus_tag="Shell_R0007"
FT                   /note="tRNA-Leu1"
FT   tRNA            join(141447..141486,141523..141570)
FT                   /locus_tag="Shell_R0007"
FT                   /product="tRNA-Leu"
FT   gene            complement(141760..143280)
FT                   /locus_tag="Shell_0164"
FT   CDS_pept        complement(141760..143280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0164"
FT                   /product="CRISPR-associated protein DxTHG motif protein"
FT                   /note="TIGRFAM: CRISPR-associated protein DxTHG motif;
FT                   PFAM: CRISPR-associated protein DxTHG"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31307"
FT                   /db_xref="InterPro:IPR010171"
FT                   /db_xref="InterPro:IPR019016"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAW0"
FT                   /inference="protein motif:TFAM:TIGR02549"
FT                   /protein_id="ADI31307.1"
FT                   /translation="MNSSSFRVLVVAPWGYPKGWDEAKYCLRKASDRGIDIGGCCISCS
FT                   SSLTLYLLLKSYDEVDDARLLIIGSDTVIKPDINDLRGNVEKWFYETVKDLFNRTKCDG
FT                   LEKNPEWVNDIYVGVVPGIGEYHGYYFKGDIIKMFLESYRNIVLNIESFKPSVIVLDTT
FT                   HGLNILTIATLYATVAASIVYGKKIYTFNSEPYPPGRRAGKHRQLEKSEKLESEEKQIQ
FT                   DVPSLNIHNISLLQKIIDFLRALDSLRYLSEKQLNKLLKGLREKRVHDKYVELMDKTVC
FT                   MVEALRSGLLGLLYSNSKLSNGRNIPFTVNNIYNSLKKIYQVDYNRPWITPDITDNTVE
FT                   YRSLLPEELAKYIPILDFLQKYMVEEYSRLLNLEPLYLKEFAKHVSRILDRNGYWDRKQ
FT                   IIIKEASELTETACEASKDTGREIIDAKLLKEYWAKKKGIQSIGNDKIVDPRNFVAHAA
FT                   LNHNIIKYVKVEWRNHECGIIEVEYDYNKLVKTLKNIGGASKIHECIR"
FT   gene            complement(143398..144687)
FT                   /locus_tag="Shell_0165"
FT   CDS_pept        complement(143398..144687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31308"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAW1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31308.1"
FT                   /translation="MDLDRLLDAWFLMRIATLGANIRTREKPWLDFTFHQAMNLCHIFA
FT                   VAKDMRLITWLAVDEYSKTLNFPLRKCEELGFNTSYESFSKFLKELDHGAGVFILAHWL
FT                   AYIFNYREKADLIWLNFPIFYSIANELYNGKKVDELEKIIIGRKRLRDPWTGLKYTHVY
FT                   YNTPRKLLLRTLRTLSNYGGSLANYIDEKLRECSCIDENNWIRLLAAILNILTYEREEF
FT                   RIGDLCKYAEEKHFLLPRNIEPYRLNKLKVSGTKRLWAALRDYIVNPYFRLLLINSLSE
FT                   NNPIKPFLKQLHEDIVEYEGYLEQLELPGDVWNKVFLDRYIVRLGEKYPELFRKNNKII
FT                   TGDSRTSARRLYQWLSRHVIYGPRVQRERLFPVYLDVTFGLRKGDLELFMNKSESIKRR
FT                   IEKEIDHLRAQKDVLKAYDILRHELNKNIF"
FT   gene            145172..145984
FT                   /locus_tag="Shell_0166"
FT   CDS_pept        145172..145984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0166"
FT                   /product="CRISPR-associated protein, APE2256 family"
FT                   /note="KEGG: dol:Dole_0745 CRISPR-associated protein
FT                   APE2256 family; TIGRFAM: CRISPR-associated protein, APE2256
FT                   family; PFAM: CRISPR-associated protein APE2256"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31309"
FT                   /db_xref="InterPro:IPR013442"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAW2"
FT                   /inference="protein motif:TFAM:TIGR02619"
FT                   /protein_id="ADI31309.1"
FT                   /translation="MVTVGTSIIRNASFHESVEAGVRERLAKWSMAPPHSGEDVEAGNR
FT                   AVPSSKEFREVLGFVSGSPRRASAELNAFIGYLERLVSRGIDGVSHYLVLFGSDTGAGW
FT                   FSTRILEEYLGSLVGQDLSRTWGVRGHFIGGVEAYRVRGLGVNFQDGILNLLGKVKKIV
FT                   ISMGKGYDRVLANLTGGFKPESAAILVVAGMLGIDTVYYIHEAMREVAEIPVIPLTIEP
FT                   NAKKILENALENNIGGAEQKLLEKLGLPLTGKKLTPWSKKLLETLLYP"
FT   gene            complement(146098..147528)
FT                   /locus_tag="Shell_0167"
FT   CDS_pept        complement(146098..147528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0167"
FT                   /product="protein of unknown function DUF402"
FT                   /note="PFAM: protein of unknown function DUF402; KEGG:
FT                   sfu:Sfum_0345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31310"
FT                   /db_xref="GOA:D7DAW3"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016730"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAW3"
FT                   /inference="protein motif:PFAM:PF04167"
FT                   /protein_id="ADI31310.1"
FT                   /translation="MCTGVRVRGITATAVSKILLDKGYRIVQASNIIRERLNLPLDTSP
FT                   ADVTVKDADKDELLVLGFYGHADKVYNDLVEELEYAFKWISPVGLHSIHVGLIRDKIGD
FT                   KCIVEIGNNVKGILPRCNLDIGKKVLVGVAKAPIKPGEEALLTRNIRVIGKYVSIIYGK
FT                   PSLTISEHIRDRDKREYLLAIAMSKIMGSGLGVHLRSSSKYAGKEEIEREIDELKQKLG
FT                   ELLDKAKHIEDAPKILYEGEFIGLIGLTSLAKEKLDSYRDKVIPTITRHHSLKSCNNAM
FT                   SDIVDYSEILLRHSVSKETIHNSLLDYILEKNKSLPKIRIIHKKPDGITHTLSPGTIHE
FT                   IVKSENGVKIVLKRTLKSIGVYDGLGVEKKPRDIDYMVIEENSWIISHNYYRGNEWLGS
FT                   YININTPPEILPGTIKYHDLLIDVIVKNTGEAYIIDEEELKTYYEKGIIPEKLYRKALE
FT                   VAKYVLENKDSLRRNTLL"
FT   gene            complement(147563..147835)
FT                   /locus_tag="Shell_0168"
FT   CDS_pept        complement(147563..147835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0168"
FT                   /product="Protein of unknown function UPF0147"
FT                   /note="PFAM: Protein of unknown function UPF0147"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31311"
FT                   /db_xref="InterPro:IPR005354"
FT                   /db_xref="InterPro:IPR023130"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAW4"
FT                   /inference="protein motif:PFAM:PF03685"
FT                   /protein_id="ADI31311.1"
FT                   /translation="MGVRLMDNETKIRNAMYMLMSIINDTAVPRNIRRAATEALNHLRN
FT                   PKLTPGVRAANAISVLDSISQDPNMPINTRTKIWQIIAILETVRD"
FT   gene            147982..148338
FT                   /locus_tag="Shell_0169"
FT   CDS_pept        147982..148338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0169"
FT                   /product="Sjogrens syndrome scleroderma autoantigen 1"
FT                   /note="PFAM: Sjogrens syndrome scleroderma autoantigen 1"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31312"
FT                   /db_xref="InterPro:IPR009563"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAW5"
FT                   /inference="protein motif:PFAM:PF06677"
FT                   /protein_id="ADI31312.1"
FT                   /translation="MSGKIDPVKKMAELLKSGATMLGETCPVKGCNLPLFKLPSGEIVC
FT                   PVHGKVYMVKTEEEALEVKEKVSLKSVLDKLENKVLLILDDLSSNSIPQTSELIEWLEV
FT                   LERIRRIKKLISEK"
FT   gene            complement(148352..148951)
FT                   /locus_tag="Shell_0170"
FT   CDS_pept        complement(148352..148951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0170"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="TIGRFAM: thymidylate kinase; KEGG: scl:sce0834
FT                   putative thymidylate kinase; PFAM: thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31313"
FT                   /db_xref="GOA:D7DAW6"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAW6"
FT                   /inference="protein motif:TFAM:TIGR00041"
FT                   /protein_id="ADI31313.1"
FT                   /translation="MSESNGFFLVLEGIDGAGKTSIAFKLMDFLVEKGFSVHYTYEPYD
FT                   TLYVEALKKKYDEYRDAYLDALTYAADRLVHIRTDILPYLRRGYVVICDRYYYSSAAYQ
FT                   SAQGAPIEWVLEINKYALKPDLTIYLDVDPHIGVKRREGLNTRFPEYEKLDFLYKVREN
FT                   YLWLVKKGYMVLVDANREFDKVYRDVEKIVFEHIVF"
FT   gene            complement(148952..150160)
FT                   /locus_tag="Shell_0171"
FT   CDS_pept        complement(148952..150160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0171"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="KEGG: noc:Noc_2211 transposase IS605; TIGRFAM:
FT                   transposase, IS605 OrfB family; PFAM: transposase IS605
FT                   OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31314"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAW7"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADI31314.1"
FT                   /translation="MVEVTLTVPFKYEKSGEIRRLLVDFRDMVNFCIEKAVQSGVTSYA
FT                   RLRKLVYGEWKRRWDYSTHFCHSACRIASSMLKSWRRKTRRGEADPKKPPKAKKLFIRF
FT                   DQQLVKFDGERLRISVKPRRFLYVKLRYGEYQRRFIEEWRRGNLRIGEITMNENKVIIP
FT                   FKKEVDLTNPSDWIAIDINESNVTGVSSNPHILRIEHNLRTIHTTYYEIRRRIQKLSRY
FT                   KPITSRRLLKKYSGREKRKTHDLCHKISKMIVDFAKKEGLGIIMEDLRGIRKRIKYNRN
FT                   LNRRLHSWNFRKLQFMIEYKAKLNGIPVVYVNPRNTSRLCPICGGRLAPNGRRLLKCRK
FT                   CGYINDRDIIACINMLRMRGVPVPPESLSMKFEGKNPMKMERGRLAVAKAIKVTANQNG
FT                   GGS"
FT   gene            complement(150248..150643)
FT                   /locus_tag="Shell_0172"
FT   CDS_pept        complement(150248..150643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0172"
FT                   /product="protein of unknown function DUF126"
FT                   /note="PFAM: protein of unknown function DUF126; KEGG:
FT                   sme:SM_b20269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31315"
FT                   /db_xref="InterPro:IPR002840"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAW8"
FT                   /inference="protein motif:PFAM:PF01989"
FT                   /protein_id="ADI31315.1"
FT                   /translation="MKTFPIKIVVDGDCEGEPVVINRSISFFGEVDPVKGIVRPENISI
FT                   TGKALVFRGSRGSTVGSYIIYALKYYGKSPSCMIVENAEPILITGCVLSDTPLFVVYNY
FT                   NELTRHVLEKTRTIIHKKGQKHIVLLS"
FT   gene            complement(150640..151812)
FT                   /locus_tag="Shell_0173"
FT   CDS_pept        complement(150640..151812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0173"
FT                   /product="protein of unknown function DUF521"
FT                   /note="PFAM: protein of unknown function DUF521; KEGG:
FT                   bam:Bamb_5490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31316"
FT                   /db_xref="InterPro:IPR007506"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAW9"
FT                   /inference="protein motif:PFAM:PF04412"
FT                   /protein_id="ADI31316.1"
FT                   /translation="MYLTREQEKMINGEYGWVAAKALKVIVKVGEALGAEKLVPITHAH
FT                   VSGISYSNIGEPGLLFIKELYENGGRSRAYTTVNPGCIDLLGYSHIISREYYDKQLVIN
FT                   KFLEGMGFKPTYTCIPYFHRIPGVNEHLAWGESNAVIIANSFYGARTNREGGPLALAAA
FT                   ITGYTYYAGLHLLDNRVAEKKIVLPKNLSEDYYGATGLWIGEHVREIPILENAPKNIYD
FT                   LKILLAAAAASGSHGLIVIDGLTPRETYRISDHVEKIFVEKTSLEKYMGEEPSSDQRIL
FT                   GYIGCPHLHPSELFWLVKYLSEKSSPRRDNALLVSIPGIYAETYRDLLEFLRLRGVDVA
FT                   VGTCPIVSRLKNGFDIVVTNSGKAAFYLRRLHGLKVSLSSFKKVVEAVYG"
FT   gene            complement(151812..153089)
FT                   /locus_tag="Shell_0174"
FT   CDS_pept        complement(151812..153089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0174"
FT                   /product="UbiD family decarboxylase"
FT                   /note="KEGG: bpy:Bphyt_2187 UbiD family decarboxylase;
FT                   TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   Carboxylyase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31317"
FT                   /db_xref="GOA:D7DAX0"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAX0"
FT                   /inference="protein motif:TFAM:TIGR00148"
FT                   /protein_id="ADI31317.1"
FT                   /translation="MYINEYLLRLEREGKKTIHVGELNREYEPTRIISNNRDKLVFFSL
FT                   NDSVAECYANILSNREDLYRLFGSSNDVEVYNRILDALNNPADLDTHSFNDYYRTSDFG
FT                   LQKLPFIKYYGEDGGYYLTSSIYISCINNICNASYHRTMLLSDEKAVLRIVPRHLDYIV
FT                   KKHHEKGYDAPAAIVLGVDPYTEIAAATNPPLGVYEVAVAAKLSGDNRVVKTPIYQIPV
FT                   PATASIVVEGVITRETAWEGPFVDILRIPDKRRKQPVFKMEAIYVHREIPPLYHAIVPG
FT                   LWEHIYLMGFPREPLIYDSVRKISPSIKGVRLTIGSGGWLHAVVSIHKTKPGEARNIGL
FT                   AVINGHPSVKHVIIVDHDIDIDDPYMIEWALATRVRGSEDIIILRNMRGSTLDPRGNEG
FT                   VGDKVIIDATKPFNEPWDKYRYAGIP"
FT   gene            complement(153096..154343)
FT                   /locus_tag="Shell_0175"
FT   CDS_pept        complement(153096..154343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0175"
FT                   /product="GTPase or GTP-binding protein-like protein"
FT                   /note="KEGG: AAA family ATPase Grc3 (predicted); K06947"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31318"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032319"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAX1"
FT                   /inference="protein motif:COG:COG1341"
FT                   /protein_id="ADI31318.1"
FT                   /translation="MPTVELRKDEAIKIFGPAAINIASGAVEVLGKKFNTNDKFIVHKT
FT                   RSYIVVALTDSKLDVNLGSEASIQAVEEDDPYHEWVSIANEILSKGYRRIMILGGVDYG
FT                   KSSFSTLLSNKALDNNLDPALIDADVGQADIGPPGFISMSYPTQQVIWMRMLKPFKLRF
FT                   IGDIKPQHHIGLIIDKLKELINTAEKDHRKPIIIDTDGWIGDSYALMYKYRLVEEVKPD
FT                   ATIVIGEEYWEFFDKLSLLGTNIYKVKAPRIRKQRSREERRALRSDKYREFLVDSQIIK
FT                   VSLKNVLITNMPLFMGKPISLDSLNVSPLEKVLYAAKTPDKLYLVLSEPVKLQGFDELK
FT                   TRFNVQKIRTLISGFEKNLYVAIVDKNGDEYPGQVLKIDFRNETIHVRSKYRVEPSIIR
FT                   FSHIRLTEEYTENILE"
FT   gene            complement(154346..154993)
FT                   /locus_tag="Shell_0176"
FT   CDS_pept        complement(154346..154993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31319"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAX2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31319.1"
FT                   /translation="MIRRPLVIAVYEPRWFIRVIDILGNRRINYTVYDGAENLPYYSVL
FT                   YTDYEEFVREASVRDDVKIIYDPNDSLRGLEESILATMFKTEYREVSIGIDPGNKPYIV
FT                   VIGDGEILYHGYVSLDKVSDKILMYLSSIPAHRRIVRVGAGYNGLEIASNLRRKINVDI
FT                   EVVDEYETTPRSNRSSQTSSLNKKLLEILKPYRNKDAYAALRIALRKGIRVY"
FT   gene            155159..155788
FT                   /locus_tag="Shell_0177"
FT   CDS_pept        155159..155788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0177"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: wol:WD0887 DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31320"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAX3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31320.1"
FT                   /translation="MVTGNPGLDRVIRGSNSVLFFGGAGSGKTTLLLTIASNICIDKND
FT                   PCLYISTEETLHYERVARSPQKFANVFFTEIYDFDELFDFIVFKLPILGFRRVFIDSIN
FT                   SLYRVIASEEESITRYGLLLGMLWKNTVDRGGFLFGSAQVRMGYEDEEYEVVASGMNIL
FT                   DYWFKTIIYLGWEDAKRMARIVKPVEYSDESYYFLISGEGIEWVHD"
FT   gene            155781..156299
FT                   /locus_tag="Shell_0178"
FT   CDS_pept        155781..156299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0178"
FT                   /product="protein of unknown function DUF46"
FT                   /note="PFAM: protein of unknown function DUF46; KEGG:
FT                   hch:HCH_02040 CDP-diglyceride synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31321"
FT                   /db_xref="GOA:D7DAX4"
FT                   /db_xref="InterPro:IPR002726"
FT                   /db_xref="InterPro:IPR032690"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAX4"
FT                   /inference="protein motif:PFAM:PF01864"
FT                   /protein_id="ADI31321.1"
FT                   /translation="MISPEYYFIYWFLKYYLPPMIANASPVLVKGTHRIDFSHIFIDGK
FT                   PLFGKNKTWEGFYIGVLMGFLASISISIILCEEEYVLIGLGSSVSALIGDLLGSFIKRR
FT                   INIASGEPLPIIDQLDFALMSTLYYYLLGMEEFVSHPLYMLYSLTIILALHIITNNIAY
FT                   YLGVKDKRW"
FT   gene            156388..156675
FT                   /locus_tag="Shell_0179"
FT   CDS_pept        156388..156675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0179"
FT                   /product="Ribosomal protein L44E"
FT                   /note="PFAM: Ribosomal protein L44E; KEGG: 60S ribosomal
FT                   protein L44; K02929 large subunit ribosomal protein L44e"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31322"
FT                   /db_xref="GOA:D7DAX5"
FT                   /db_xref="InterPro:IPR000552"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAX5"
FT                   /inference="protein motif:PFAM:PF00935"
FT                   /protein_id="ADI31322.1"
FT                   /translation="MRIPKVIVTYCPRCKTHTPHTVTIYKHGKRRSLAEGERRYAAKKK
FT                   GYGSKRKSEQKRFAKVTKKVVLKLKCRQCGYIIHRRGIRMKKYELVEVTR"
FT   gene            156675..156884
FT                   /locus_tag="Shell_0180"
FT   CDS_pept        156675..156884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0180"
FT                   /product="Ribosomal protein S27E"
FT                   /note="PFAM: Ribosomal protein S27E; KEGG: ribosomal
FT                   protein S27; K02978 small subunit ribosomal protein S27e"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31323"
FT                   /db_xref="GOA:D7DAX6"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAX6"
FT                   /inference="protein motif:PFAM:PF01667"
FT                   /protein_id="ADI31323.1"
FT                   /translation="MVKKRKILIPQPRSRFLKVVCKVCGAENIVFSHATFPVRCKVCGT
FT                   VLVKPTGGKAYILRDRAEIVAELG"
FT   gene            156967..157054
FT                   /locus_tag="Shell_R0008"
FT                   /note="tRNA-Leu2"
FT   tRNA            156967..157054
FT                   /locus_tag="Shell_R0008"
FT                   /product="tRNA-Leu"
FT   gene            complement(157467..157691)
FT                   /locus_tag="Shell_0181"
FT   CDS_pept        complement(157467..157691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31324"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAX7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31324.1"
FT                   /translation="MKTLISKNKTVRIRQEKKRQTFIRIVPVVSSLFWEIMRRYARRIP
FT                   YKHEPLFMITPRQARNIVYKFTKRYLRKR"
FT   gene            158252..158404
FT                   /locus_tag="Shell_0182"
FT   CDS_pept        158252..158404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31325"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAX8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31325.1"
FT                   /translation="MGKEYQTRWEKSPSHVSPDIGKHHDWDLRARDEIGRKITDIVHLR
FT                   VKEEE"
FT   gene            complement(158640..158912)
FT                   /locus_tag="Shell_0183"
FT   CDS_pept        complement(158640..158912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31326"
FT                   /db_xref="GOA:D7DAX9"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAX9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31326.1"
FT                   /translation="MSIGRALTNIGLGIAGFLFSMVMGAITAFLIIAYPWSFRLISILI
FT                   ILVIALPASKIKRLWLRILIIIGALIGTIGASVLIYLFVLLIAIT"
FT   gene            complement(159130..159918)
FT                   /locus_tag="Shell_0184"
FT   CDS_pept        complement(159130..159918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0184"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   atc:AGR_C_1817 3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31327"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAY0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADI31327.1"
FT                   /translation="MFNINGYRVLVTASSRGMGYGIAKVLVREGCRVVINGRNKERLEK
FT                   SVEKLRNIGSSEVYGVQADLTIREDVERLVDETINYLGGLDALVYVTGPPRPGYSSELS
FT                   LEDWEYAVNLLIKSALWLTYKALPYLEKSKNPSITYLTSIAVKEPIPNIALSNTLRISI
FT                   HGLAKTLAKELGPKGIRVNTVLPGYIMTDRVKQLIEDRTRRENKSEEEIIKEITTEIPL
FT                   RRIGEPEEVGYLVAYLISPYASYINGASIPVDGGRLKSIF"
FT   gene            160009..160944
FT                   /locus_tag="Shell_0185"
FT   CDS_pept        160009..160944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31328"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAY1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31328.1"
FT                   /translation="MVCGMLIIKGTGFNVGIVSEQSFLNNLFYSLNNLFPKRYIPKYTV
FT                   STSSGEGGIDAFISWISGEGFSVEKYVLRDNGVDEYFVRSNLPRPYINESPYFFLLQVI
FT                   ARSIVKNNYLVLTDSISFVFNDETYLLAGYPHTGKSTLLALALMNDAIPLSTENTVVSV
FT                   SEDGVRIVGGTSVLVYDPRIEDIYGVKLEYDSMTRHGYRIVDLEKHYPSRNNYYGELVD
FT                   AIYVLHSSFKSVGVDAEPVKGRKILKTLWYFASALLRGLDYYQPHPLVLSTRIIDDKVE
FT                   YMLRLVSEKYSGRFYEVYGRHDHIFKYIVG"
FT   gene            160965..161258
FT                   /locus_tag="Shell_0186"
FT   CDS_pept        160965..161258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31329"
FT                   /db_xref="GOA:D7DAY2"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAY2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31329.1"
FT                   /translation="MGLGLLLILLGAILIVIEIATPGFFIAVPGTILIIYGVLLALFPE
FT                   LINIPYVPWILFFLSFPIGYITYLIYRKLSPPSPPVTESYEGLVSKVGGRNI"
FT   gene            161525..162175
FT                   /pseudo
FT                   /locus_tag="Shell_0187"
FT   gene            162209..162359
FT                   /locus_tag="Shell_R0009"
FT                   /note="tRNA-Ser1"
FT   tRNA            join(162209..162246,162308..162359)
FT                   /locus_tag="Shell_R0009"
FT                   /product="tRNA-Ser"
FT   gene            162431..162506
FT                   /locus_tag="Shell_R0010"
FT                   /note="tRNA-Arg1"
FT   tRNA            162431..162506
FT                   /locus_tag="Shell_R0010"
FT                   /product="tRNA-Arg"
FT   gene            162628..162810
FT                   /locus_tag="Shell_0188"
FT   CDS_pept        162628..162810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31330"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAY3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31330.1"
FT                   /translation="MGKSMFISKLVRLSILGLVKDKIGYTSTCMVLDTAEKHAKLVLKE
FT                   KQLMILLTGINKAWF"
FT   gene            163060..163773
FT                   /locus_tag="Shell_0189"
FT   CDS_pept        163060..163773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31331"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAY4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31331.1"
FT                   /translation="MKRRYVSLAIIILAVTIVAVVNGTAFIYRTLQGNVQVTDITSGQN
FT                   EGTIAQYGMACTGFYVKGADSGNTIHSDILPDAGTNHDVSITSSGSEWYGVKVDWGDIA
FT                   CQWDNTTDQQTYTLYKSATINVKVTNGDWYFKDLLGFGYPSVITGPDTIYVRIKVASPL
FT                   TNSNIDSAKLIIYDASTQSQAGVIYLRSNTLSNPIQLSPGDGFQIDLELSATGSVSSDS
FT                   FTVLFYVSSSNEAPR"
FT   gene            163886..165076
FT                   /locus_tag="Shell_0190"
FT   CDS_pept        163886..165076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0190"
FT                   /product="peptidase S26B, signal peptidase"
FT                   /note="TIGRFAM: peptidase S26B, signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31332"
FT                   /db_xref="GOA:D7DAY5"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAY5"
FT                   /inference="protein motif:TFAM:TIGR02228"
FT                   /protein_id="ADI31332.1"
FT                   /translation="MPGVWRVLSYVGVIVVLALFAGKLLGLPVALMIVYGSSMEPSLKP
FT                   FDLVLGVHPDIVGGVGRGDVVVWCDPGDVWRTSCVVHRVIDVRGAGGENIVITKGDALT
FT                   YPDPPVRLSRVSYVVVAHAPNLVTLLLLTLIYVIGIIYHSVYLPYISHRRRLIVYPGTI
FT                   ALLLVIYYVITNTIYIGSGMLDTSPTTISFPRLYREDLSFNTYSGLVNISLSYNSSLSP
FT                   INSPKCGVIEPINASLIPEKFTIANGSANIIIRIPPNVFQELWRIDSKRVSSWSLPSPP
FT                   AKVSTSILLSCVLRFNGGILKSTYSLKFNWIEPVAKPYGDDKVVVENHNPVPINASVEV
FT                   YSYYQDKVIYRESIVLKPFTNNIIDLPKTGEGDVLVVYIHYVFLGHVRSIGVVVHA"
FT   gene            165069..165761
FT                   /locus_tag="Shell_0191"
FT   CDS_pept        165069..165761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31333"
FT                   /db_xref="GOA:D7DAY6"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAY6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31333.1"
FT                   /translation="MPSRRENSIIQVYEQVAMEATRYYWLGSLARIGLASSSIVVLAAS
FT                   TLILWITLNPLYVFKDPLINGEVGFVYYSLYSFGKPLQIPVLDSLTKLSFILIFSSTLS
FT                   SALVAPALVTVLVKPKMPRIYLEVAAAGNAIGGLNTSLLISFLRVLYMNIISSIPITAS
FT                   IHTQYGVFIFYRSTSWYTEVGLLSLRLWPIYPVLAGVLIGSAGATIYYITRYYEEILEL
FT                   PPIPVNPT"
FT   gene            165791..167329
FT                   /locus_tag="Shell_0192"
FT   CDS_pept        165791..167329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31334"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAY7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31334.1"
FT                   /translation="MTRINRITRSLAAVAAVAIILSAIVAYQTVFTGRSLNGEVEVQPE
FT                   SIIWYEDPGTPNVDVSIENGLKANITITTHPPDIVLKERHAIYNNTFDQYPSELNASPG
FT                   CSNVWGWDSTGHYIYYPISGEGWYCYIYPSNIDISSYVGNGSKVYVAAITWRSAFYYAG
FT                   VFRVGYTFLNDTTWDNYLIGLRNELLQGRTGDNANATAYYYDYFVNGNYIGYYIYLLNQ
FT                   SSLPSGALGFEYGYRHNLSAGMDFSTWNAGLWGKGLTINSSDTLQVLEAHINETYRIMP
FT                   NRVGVGVHVENLEGTQNSEKVYFDNLVITVNAPPWLVNVSGLQPGWRVVLENSTGGVID
FT                   DAIVGSDGIAVLEVWGYLIIPNATIKVYDSSGNLIVNKSFDRVIGGDLYELTGFMGTII
FT                   NIYSNLTTGFRSGLGLVSTNSTVNDAYVYIYLYNMSGYRVGPIGIRDGNIAVNTTNYIW
FT                   MKPPSSWSSKWGAGYVELVAYMPGGTYKLRLKQEFTLSPGIYIYGYIDITIRSS"
FT   gene            168338..169246
FT                   /locus_tag="Shell_0193"
FT   CDS_pept        168338..169246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31335"
FT                   /db_xref="GOA:D7DAY8"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAY8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31335.1"
FT                   /translation="MSIIIDSDRGRRVAEILYNAYYTTGIFGYRSPPESVLPKGMVRGS
FT                   LQHVLFVTLTVSIDYMRDAQALWESARRTFEDPMTRYLFDPKALYETPINKIMRDMLKY
FT                   GLAKRPRKDSYIWKTVGATFYKKWGGDPRSFLRSCGWDAPTILKRLKSDTHLDRGRLVP
FT                   DYPYLRGDKIGPLWLRMLWDIVGVKDLRNLDKVPIPVDVHVARATLATGVVRGRFSGRL
FT                   EDLFEYIRRAWFLSVKGLKAGDRSMIALDLDEPLWHLSKYGCSRRDKDTGYCPLQSFCV
FT                   VREYCVKGRIWINNGYVVMDT"
FT   gene            169243..169698
FT                   /locus_tag="Shell_0194"
FT   CDS_pept        169243..169698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0194"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bac:BamMC406_6709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31336"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAY9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31336.1"
FT                   /translation="MKTLCIVPCGKRKIWDKYPNKGPTKARYVYIGAFAKKCREYAEKF
FT                   CPNSWVILSAKHGFLFPDDIVPGPYNVSFNDKKTNPISIEELKAQAHMKGLYRYDRIIV
FT                   LAGRNYAEIVKKVFSNKEVVTPLSKYKGLGYMMQKLNEAIRRGVPLH"
FT   gene            169854..170753
FT                   /locus_tag="Shell_0195"
FT   CDS_pept        169854..170753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31337"
FT                   /db_xref="GOA:D7DAZ0"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAZ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31337.1"
FT                   /translation="MNKILVFGIIFLLVYAEASVFTPINSMVTGTDVSGAGRPKILFIY
FT                   YYWLPNYGPAYWFIRNLSMYGDVVFIRADALANQSDQYIMDYLRQFDIYATINAGYGPW
FT                   LCLVDFWSKYPRLVNIIRLLVREEGKSILVVVASTSNSHPISDMVYAECLDTPDYWINY
FT                   EIASSNITVGINNITGRSLHIHLYGGKPLIILPNKHDWLSRRAALAVYGYYGKGKYAVL
FT                   SIDLFQSSNHIRGDIEKLLSNIIQWLTNKETRENKTIINPPIENLTITSTILITPLIIT
FT                   LIGAYIIKQHRTNPHKQP"
FT   gene            complement(171259..172521)
FT                   /locus_tag="Shell_0196"
FT   CDS_pept        complement(171259..172521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31338"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAZ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31338.1"
FT                   /translation="MVTVRLIGLFLFYSYVKGYPIKFFGEVKDRVLRDAYKAGLLTARV
FT                   LAIRDVIETLKRIPLELIYETSYEDRIDIVARGRIDFPKTIALYGSGRLLIVSSINKRL
FT                   YDSPETLLLANIALEIKEIIEDLEENVSAENYLLNKIIGLILDDLRETYSSVSWITELA
FT                   GIVEREDYDSLLQLCDTVLERGNYGYYFLAKSFKQYLQTIMNIGEEIAVHGKPEHTGSI
FT                   VGVELERIFEIYTHYLTTYALLSKLERIGVKEIIVDHKGEFIEINVEENGENISYRIYH
FT                   SKGFSDKSWLTRNKQVIGGPEAGRPDITITINKGDGEEIVFVMDAKQRRSLEDIYRELR
FT                   IVLGYMNEYNVDKGAIIYNATYTQKTNNQHKPIPINDKNKYVAIIPLNFRKINKIKELD
FT                   QLINEHINIAEENIIEKIKQA"
FT   gene            complement(172550..174256)
FT                   /locus_tag="Shell_0197"
FT   CDS_pept        complement(172550..174256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0197"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="KEGG: sml:Smlt1846B hypothetical protein; PFAM:
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31339"
FT                   /db_xref="GOA:D7DAZ2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAZ2"
FT                   /inference="protein motif:PFAM:PF07728"
FT                   /protein_id="ADI31339.1"
FT                   /translation="MYSYKRLEPSKYWVEINNWSLPIPAHIGVALWGPIKGRHAAEYNA
FT                   IIKSLKQFSELTIIHYVGSRAIYIHSKKGEVKKAFIGRSILREEDNKNIKEYTWYELRN
FT                   ELTRLLQKNSSTQKNIDLNQYLERAEEKIRKRIGNISGISFFLLRLSNFQEYEDPINYG
FT                   ETKNISENIIKQGWYLASLRESEYMKIHSMGMKEEYHKPKPSHPILIDYEGFKNHVIDN
FT                   DGFYSEEILDDLVAGYNKGKHLLLVGPPGTGKSYLAELLAKYLNYELVSTTASSTWTRY
FT                   DFIGGPIISSKGFKWKSGVFLSALAKHIEYISRADEDKKSGENKGFKGVLLLIDELNRC
FT                   EADKVLAEFFTIYPGIDPSQWKLPQSLIDEIKNYDDRDDAAETILKHVKANNTLPWGFR
FT                   IVATINTWDITHLFTLGYALLRRFHIVRVFPQKISNANEEVLKKIVSRKASNVLKEISN
FT                   VDTQRLSDVAEELTRIYRIFINNDFPLGISYIIESAIDAYNLISMNPSKSIKNVIDEAL
FT                   SSSLASILDPEISKIMLPKKYIDALEKIMESGELNDYKGLIEMVGNIVSKF"
FT   gene            complement(174265..174708)
FT                   /locus_tag="Shell_0198"
FT   CDS_pept        complement(174265..174708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31340"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAZ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31340.1"
FT                   /translation="MSSTIDDEAKPLYYLVIYSRNNMGISRFYAGTTRSRGVLEVKIRC
FT                   NPQLLIQYALRSGFKKKGGRKIMTFTTDNWETYAKVLIYAVITSNLRTYKKKLQAMEAV
FT                   KTLTYLDLKYWAGIIVERFRERKYPGILRPARALRILLEIDKR"
FT   gene            complement(174708..178127)
FT                   /locus_tag="Shell_0199"
FT   CDS_pept        complement(174708..178127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0199"
FT                   /product="protein of unknown function DUF499"
FT                   /note="PFAM: protein of unknown function DUF499; KEGG:
FT                   sme:SMc02155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31341"
FT                   /db_xref="InterPro:IPR007555"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAZ4"
FT                   /inference="protein motif:PFAM:PF04465"
FT                   /protein_id="ADI31341.1"
FT                   /translation="MGFKQHVSVREDVLDPSFDEKLAPEIYEVVYGTAPRIYMDPREFF
FT                   ERTYLTDSMKTILSEIGNTLTEGKGRKVYPIIAFFGGGKTHTLLTIYHAVLNPSYTYLL
FT                   SDEVYKLYRNVKGVEVVVIYGKDSRLAPSPIKPLEGGSRKIKTLWGYLADRLKRYELVE
FT                   RDDKNETCPDQSVLKKLLQGRKVVILVDEILDYIDSILSSKYKNKEGYVSEVVRFFDRL
FT                   AQAVESTNNVLVITIAAEKKPGGIEPQPRYKRISEFVRDLLDALLRVAGNVYAPISRST
FT                   ELFNVVKKRLFSEVRVDEAKNEIRKLISTYNEFKEVFGDTSKLREDIKKTYPFHPSYIS
FT                   VLREIAERVTGNRTRFLMRISRLLLRKLLRSNEDPVLIMPWHIDPVELGVEGLFFMGDY
FT                   SDYQRIYADEIVALDNKIPKESERKNLIKIILRTIFLSTYPYDSLKAEPVFPTSKEIVQ
FT                   MVYEPKFFESNRYKPVDIVDALSEIKISNYTVFLHYDESTDRYWYSRIASIKEWIRREA
FT                   KKILEENRSHVENLLMENIHKLMTSRLIEVGRAREASVYSMERFRYAEIFDAKNISVYR
FT                   YASEAEVPDSSSYKLVAILYNKPKEIEELIYKFRGIERTHANTVVAVTISTKDKLESLL
FT                   EYQALLRAAEIIMDRINELYSGYAKEIKDIERSIASYQKRMIENILLTNILNFFDQIYY
FT                   PAVKDSRRIVEKTYATSSDKSISEKVVSALSSPSIGKIVRSLNFESLKTYLSKVEIEIK
FT                   PGRKISVGDVINVFKTRPELPMVREDRIKDAIKEGVLNLEIALIDEFNRRYFKRIYSPN
FT                   DITSFTDKDRGEEPTRIQESFIIMHWRDALKEILEEIKSDIEENDGTRIDNGILKLNYY
FT                   VVYRNKRYSIKDIEKFPDWEIILRDGFIVKEEKILKTGINLVVEPSYIEISPDESVDVR
FT                   IEAQPLGDYGGNVKITVSSDAVTDHGVLEGQVPFKTWIKINGSRIRQQTLITIRAIDDN
FT                   GNSYEEIITVKPKTSVIDIHEPGVLEEGDVLISIKSSISNKNYRDILELINKLTELLSK
FT                   PDEKVFIVNKMELHVKSREYGVSDVLFKQADPAIVYDVVSELLESMGSNIFVEGSFEAE
FT                   FPKEITINSTLKRILDKYIRYADIIVTIVRRK"
FT   gene            complement(178159..181272)
FT                   /locus_tag="Shell_0200"
FT   CDS_pept        complement(178159..181272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0200"
FT                   /product="protein of unknown function DUF1156"
FT                   /note="PFAM: protein of unknown function DUF1156; KEGG:
FT                   afw:Anae109_3988 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31342"
FT                   /db_xref="GOA:D7DAZ5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR009537"
FT                   /db_xref="InterPro:IPR014455"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAZ5"
FT                   /inference="protein motif:PFAM:PF06634"
FT                   /protein_id="ADI31342.1"
FT                   /translation="MLEKKLIETPSFPSIEISEKAISEKGPGRPPYWEMVFWWTRKPLI
FT                   TARAVIAGSIIPADKIDPEAFKQYILRLDKKTPHRFNPVFQGELAGLKKLFKETSLLDP
FT                   FAGFGSIPLEALRLGVGKVIAVELLPTAAVFLKAVLEYPLKAVSDPKWKNLVKDVEKYG
FT                   KWIIEQLKNDQDLKELYDEDTAIYIGTWEIQCPRCKRYTPLIGNYWLARVKKNNKYTRI
FT                   AYMKPVKRNDRVDIEVVDINKEYKIPFLDKDKIKSNKIIIPRGKQTIELEVPEKNIDAR
FT                   REKATCLYCKNKIGYINPETGQHYPEKSNLPSSLRKKVIFYPKYALKQWNTLLEKYLSG
FT                   ETSLEELKKAPARPRILVKVKTRGKEIEFAPATQEDQEKLWKALEKLKQIWKDPDLPTE
FT                   PIEPYCSSTYHTIVWGIDKFYKLFNPRQLLTLIKIVKLIREVGKKIEEEKLKKGWTREE
FT                   AFRYAEAVTTYLAIALCKLVYLNSIVNIWDSTWFKIASSMSVRGIAMSWNWVDARPINN
FT                   LAGSWSRSLNALIRSLLYLVSVIPSNKYRVDVLLDDAAVFNNVASDEKFDLIVTDPPYR
FT                   DDVPYAELSDFYFIWLKRALSDVENGRLAPRFHQDLFFRRVGAVWKPISTQWESFAKRE
FT                   ASFNPGRYRDYVGNNQDAKKYAYERYLELLGDSFIAMREHLKDDGLLVTYYNHTDPDAW
FT                   RDLLWAGWARGGFKITATWPLDTESKQSIVKRGKRSLDTSLVIVWRKRSHSDRVGVFSD
FT                   VYREAVEAAKSYAGDVWKQHRGLDAFIGVMGRVLEVATSYDKIVFPEKRDKLSSFLGIK
FT                   DNEGGIESVGRIIREIVFPAAARGLIDYLVGMSTFNVSSPEALFYLLFKLVFLRDPETA
FT                   RKLLSKEKKLDASSITILSIASGINVGDMVKKRIVIEKRAASTSRKEYVLNSPLSIEPS
FT                   KLRIFLEKRRGINPDKPRITNSIDALHVLEYYASKYDKSTFEKLVSKLQEQPGGPSFIN
FT                   EAKGIAYVICSYFEGDPEQQLSMRILEYMGVKCGPAKPSYRTIDNYIK"
FT   gene            181392..182423
FT                   /pseudo
FT                   /locus_tag="Shell_0201"
FT   gene            complement(182446..184053)
FT                   /locus_tag="Shell_0202"
FT   CDS_pept        complement(182446..184053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0202"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31343"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31343.1"
FT                   /translation="MVMYYLSDSLRKAYECSHNRSCIERYAEGSQIEAIKLFEKVAKGY
FT                   IGLGAVQGPPGTGKTSVFDLGTRGILDEILGYKGKILYLYIAPTNHLVIEAFTRFVANL
FT                   FYKGYDVNVILDLIRVYGSKIEPCRKGSMGISIDNKILPCDKIKKLMKSIDPRNVRFVF
FT                   ATEYQRISPKLVEKPDEIRFIVDEASKTPFFRVFLPIARSIIRNPEEAYPKSMIVLGDP
FT                   QQAISISTEFKTFRIPLLMDYIKRILERRNLEEYYKFLDTTFRLPGPTETPISRGFYEG
FT                   KLKAKEHFKVRYNKLLAGGLEDVLNKSKTIMGKILDLSKSSVKLVVEAIDKALTNGIPL
FT                   IVFKTRKFPSGDTYHRSRAYLGYLTGLYLSIISIMLRGGRPAFGVSLTAPYSDLAYSTG
FT                   YYLKKKLVEAGIDTDHLRYATVQSIIGGEDDVIVTMLGKEWLARNDFSYYSFATIRPET
FT                   MYFNEHQVLNVQLSRHRLLMIIIGNTDKLKRSAHHAKIKGKYIYQYRIAGESIEKTIEG
FT                   IELLKENGNVISKSFRIV"
FT   gene            complement(184047..185822)
FT                   /locus_tag="Shell_0203"
FT   CDS_pept        complement(184047..185822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31344"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAZ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31344.1"
FT                   /translation="MVIEKYIVDLTGQELCGIGVQKILSGTSHLVRASNVARGAAFCIY
FT                   AARLAEAIGAVTDFVSIIPGRGRLTHQLLAVALPQIFYGLNRVDFVKGRLPYSTIESYV
FT                   RNAYNDLVEAGILNKEAVEESGSKLVNESIMYAVNMINSLSRVMPIFINKMGLNEGSLR
FT                   LFTELFMYSYRFHIVGIIDAVIEDPISRKALVIEWKTGRTPENWEIAQAYTYALMEAER
FT                   LGYDDPVGAVRDREDVVPIVIRPTGNIKVYSIADTYRTAGKTINKYELIRNILLSAEHL
FT                   VLTITEYKDYVDNNTAKICSIKGLHGQKISAFRRAPKDLPRSNPVKYGNKYPCRICMYR
FT                   EACEFYTKTYKDWTLLDRLAYRARHAVYKIRENAQKPIKELYNLYIANNNNIEKLIEAI
FT                   VRRENTLGESGNRIDYFEKASLSESYEIILERQVREYEQSIEPIKLKTLREGKPVLIIF
FT                   NDPYVNNPLLRLSFHGRVEEIEIKPSRKGDKIYVHVAAPNIPSRLQLEILRRTVSHNLQ
FT                   YLEKIIGVEINVDLTQLELQAIDAFHRGSRGIAKRNDKLKILAKTTKKIRKEYKEAMFS
FT                   VLFTEGLLKGENESW"
FT   gene            186053..186649
FT                   /locus_tag="Shell_0204"
FT   CDS_pept        186053..186649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31345"
FT                   /db_xref="GOA:D7DAZ8"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31345.1"
FT                   /translation="MLEISDIILTGILEGLRRKPVLIVHFLFATILAMILEIFVRTIIN
FT                   YFHISALNYSEAILVSIFVILILTLNKYISLWNKIWDSLYENLYEKSPEESALKQLENV
FT                   FKDPQGFLREIMDKTIYDFLDKESILEKVWPIASKLLLFYYLAWISGIYLVDLSIYLST
FT                   NYQLTVLGLLMEKPIVYFTLINISHRNSKFIHKAL"
FT   gene            186690..187307
FT                   /locus_tag="Shell_0205"
FT   CDS_pept        186690..187307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31346"
FT                   /db_xref="UniProtKB/TrEMBL:D7DAZ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31346.1"
FT                   /translation="MIDLQYLRILFEKFVSPEKYLVKKIRMSKGRNKSLNTLMKIFLNA
FT                   PPIQNIFLNIVSLPSHINFDRLFTVDFFQLPNNDRYENIINEIIRDGPLIGYWLEPINN
FT                   NNVNLKKSGKKRVLKKVYPPILSNLLSDSCWYRVIEESSGDKESEKLIGYAMISVIAID
FT                   KTVRYKSKKTRNTWKPETIRGEAIFILLLGSEKLLELKLALI"
FT   gene            complement(187336..187533)
FT                   /locus_tag="Shell_0206"
FT   CDS_pept        complement(187336..187533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31347"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB00"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31347.1"
FT                   /translation="MVRCPYCGYEGDISEFKLLRDPWKFRFYTVKRLECPKCHGIFNYY
FT                   YGISPKGKKSEFTIRVKPRK"
FT   gene            188011..188541
FT                   /locus_tag="Shell_0207"
FT   CDS_pept        188011..188541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31348"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB01"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31348.1"
FT                   /translation="MDRRDVLLNIIMYFNKIYKKPLDGRKKLQKLLFLVEHLDIESGKL
FT                   SRSRGLTGYKFIVYSYGPFSKDVYRDLESLVKEGIVEERMETWRQESLLYTYIDDGKPR
FT                   RIYYYRILDENRVPKLPREVEDKIKLVIEKYGSLPPMKLESHVNELLKLTPKKKVEYWG
FT                   EFIDDYLEEEGFE"
FT   gene            188534..188725
FT                   /locus_tag="Shell_0208"
FT   CDS_pept        188534..188725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31349"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB02"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31349.1"
FT                   /translation="MNRIVATKRKPINVSENLALRPATQNPKIIGKIYKQLTSLNNQKM
FT                   NSFLYISSIDFFLALLMY"
FT   gene            188797..189270
FT                   /locus_tag="Shell_0209"
FT   CDS_pept        188797..189270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31350"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB03"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31350.1"
FT                   /translation="MTSATGLFSLNIAYIMDEQDYPDYIKLYIEPEVIFGGSARQLDYA
FT                   IVDQRDPVNVLVLAEVKRIITTHNLSDYVHNSFKVFNEILKESQNYFSDNRFLVLHIHL
FT                   APWFSGETELYEVLKALDAVSIFANVSVIVSRGEDIDRFEEDLAPFLEQIIHS"
FT   gene            complement(190580..191596)
FT                   /locus_tag="Shell_0210"
FT   CDS_pept        complement(190580..191596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0210"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; DNA methylase N-4/N-6
FT                   domain protein; KEGG: mpt:Mpe_A2383 DNA modification
FT                   methylase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31351"
FT                   /db_xref="GOA:D7DB04"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB04"
FT                   /inference="protein motif:PFAM:PF01170"
FT                   /protein_id="ADI31351.1"
FT                   /translation="MKKGKLQRNSNVAGMRRVSYDDYLEFLKNNRAVEIEGNRISLEPI
FT                   RVKRLYPLPQELTDISTTVWSFPKRGSWATHRGDYRGNWPPQMARALILAYTMPGETVL
FT                   DPMIGSGTTCIEAKLLGRNCIGVDINYNAVILTLHRLYWLEKYLEKQASTQEIFGGEYS
FT                   PVSIEDILKARVEIYHGDARNLDKISSNSIDLVATHPPYYNIIRYSRTKKIPGDLSGAR
FT                   RLEEYLAMIQQVGKEAFRVLKPGRILGILIGDTRIHKHYVPITHHVLETLLKTGFILKE
FT                   EVVKIQHKMKTTREIWSKLKNKDFLLIYHEKLFILRKPIDKKEYRKYKYSTYMKLNV"
FT   gene            191823..193757
FT                   /locus_tag="Shell_0211"
FT   CDS_pept        191823..193757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0211"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="KEGG: scl:sce6598 hypothetical protein; PFAM:
FT                   Fibronectin type III domain protein; SMART: Fibronectin
FT                   type III domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31352"
FT                   /db_xref="GOA:D7DB05"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013431"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB05"
FT                   /inference="protein motif:PFAM:PF00041"
FT                   /protein_id="ADI31352.1"
FT                   /translation="MNKILALLFLSIMILSIPAIVPNNTVGSAGGEMGPYWFKDYYNVP
FT                   GHILDLYDFDTVFAPNGDIVVAGNIYGFGAGEIDALVMRVNRCGEIVWYKSYGGVEDDI
FT                   VSSAIIAPNGDIIVAGWTGSFIEDGDWDLWILRLDGNGSIVWEKDYGGSTDDGGTKVSL
FT                   AIDPSSGDIVVATSTLQSDNYGGLWNNIWLLRLDKHGNVKWEKTYGVESDEDYAFAVSI
FT                   APNGDIVVGGETSGSYWVGDNIVSGAWVLRLDPNGDIIWQKVYETPQAYEEISGILVLP
FT                   SGDILVSGSSGSLSEVMHSWIAYLDGGGNVKWSKTYIRSIEEGGSISEPVLAPNGDIIG
FT                   RDIYTIAVSQDGSLKWAKWMIDGAMAGPIISPDGTAAVAGIEAHGFAIGRFNISNVPEY
FT                   SGWQNPNDPGWDGWGSVDLKVYDAELIVTSSNIAPNTLPGSPRNINVEIHEAEHNAISN
FT                   ITSNTIWSVSSISEPQNLQATTNNNNVELTWDPPIDNGGCRIVEYRIYRGTNNNNLEYY
FT                   ASVNGSTTSFTDKNTANGQTYYYRVSAVNNIVEGPKSNIASATTTSSTPSETTSTTPTT
FT                   TIGTTTTTTSTSTSHTQTTPPQTSTEKTSNTPSENTSPNNQGFPYETAAIIAVIIIIPL
FT                   LAYTLIRLK"
FT   repeat_region   193885..194172
FT                   /rpt_unit_range=193885..193910
FT                   /note="CRISPRS"
FT   gene            194403..196097
FT                   /locus_tag="Shell_0212"
FT   CDS_pept        194403..196097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0212"
FT                   /product="ABC transporter, ATPase, predicted"
FT                   /note="PFAM: ABC transporter, ATPase, predicted; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31353"
FT                   /db_xref="InterPro:IPR019195"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB06"
FT                   /inference="protein motif:PFAM:PF09818"
FT                   /protein_id="ADI31353.1"
FT                   /translation="MVFSSDRVYLVVDEIGVFLGRFAGRGFGYYKSLRNVVFDYDGVKA
FT                   YFTRIQSDPYAPPSVFQIVVPGKIHGLKLKGYGKNDYLALSDYLYRRLYSESVKYRRKC
FT                   GSGYSCFLGVPKPSPIMIYRSGAEIVGEDIVLRIFIGLPASGRRILVKPLNHILSVIIP
FT                   RIINKFRNMYRCEEEIWERILYLRDYLYIQKLLEEENAVAFIANNSVLPRESSISQKPL
FT                   ANAVPFRVEDRFSREIRVPSGKTVYGLIIPRGLTVITGGGYHGKTTLLEALQDGIYPHI
FT                   PGDGREYVVSRPRTVLVKAEDGRFIHRVDISSFIKKIPGGGDTRDFISRDASGSTSMAA
FT                   SINELVEVGVDNILLDEDTSATNLLYKDEYMSKLLYDDPITTITQLARSFTEKTRTNLV
FT                   IVSSASSILLSKAGFIILMRNYKPTIRSRKEMGLVDKLPDKQYIPPRERRVFRGIRGVK
FT                   KIRAKGSKLILKYVDGIVFELDLKNNPRIIENGQVKMIATILKWIIREKINGSTRELVE
FT                   TINNVFREKGFRGFTSMVPPDLGWVDGLDVAWTINRLYNVVFEKRPS"
FT   gene            complement(196193..197098)
FT                   /locus_tag="Shell_0213"
FT   CDS_pept        complement(196193..197098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0213"
FT                   /product="dihydroorotate dehydrogenase family protein"
FT                   /note="KEGG: geo:Geob_2780 dihydroorotate dehydrogenase
FT                   family protein; TIGRFAM: dihydroorotate dehydrogenase
FT                   family protein; PFAM: dihydroorotate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31354"
FT                   /db_xref="GOA:D7DB07"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023359"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB07"
FT                   /inference="protein motif:TFAM:TIGR01037"
FT                   /protein_id="ADI31354.1"
FT                   /translation="MDLTTSVTGIVFKHPVMNASGILAASINGVRILAKTGVAGIVTKT
FT                   LTLEPREGYLPPITIPLDYGLLNAVGLANPGIDAVNVLVEEIHRYGLPAIVSIGGRDPG
FT                   EFQVLAEKALDAKPEALELNLSCPHTPGFGVDAAATDKALKHIALNVSSISSIPVWGKL
FT                   GFSRRIVRESEILLSNGVDAVVLINTLPGMFIDVYVGKPVLTHGYGGLSGPAIHPVAVY
FT                   SVYKVYEELGAEIIGVGGVVDWKTCVELLLAGAKAVQIGTGFYMVGYDIVHNILDGVKK
FT                   YMEEKGFSRISDIIGYAHRK"
FT   gene            complement(197089..198393)
FT                   /locus_tag="Shell_0214"
FT   CDS_pept        complement(197089..198393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0214"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: dal:Dalk_1370
FT                   dihydroorotase, multifunctional complex type"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31355"
FT                   /db_xref="GOA:D7DB08"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB08"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ADI31355.1"
FT                   /translation="MIPQIVYRGLIYDLHGLRKATLVIENGFIKETLDPWENVSGEIVL
FT                   DYRRDKNVIAFPGFIDIHVHLRDFKQSYKETIETGTKAALHGGITVVGEMPNTVPRINN
FT                   LSTLEKRIKILENNSYTDYYVYIDVPENKLDVEQMIRNPIVMGIKLYPEKIGAPTLDYA
FT                   LEKLGKTNKILILHPEEQYMIDKYRTGLDEYYWFRDVRIETESIRHISILNSKFNVKTH
FT                   ITHITSYLSLLEAKRFGYTVDTCPHYLLLDYERFNAKNCYVKVLPPIRDHQNRALLYDL
FT                   FVSGHIDVLASDHAPHGVMEKMCCPKTCPPGINGVEVLSVFAGDLVSKGIISLDQMYRL
FT                   LSYNPSRILGLRKYGVLCRGCRGNLSITRFNCKTRIKPEYIVSKAKYSVYDSWEFHSCV
FT                   EATIVGGELGFHRGKGFSRRLRGEAVGVVEGYSWI"
FT   gene            complement(198390..199166)
FT                   /locus_tag="Shell_0215"
FT   CDS_pept        complement(198390..199166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0215"
FT                   /product="Dihydroorotate dehydrogenase, electron transfer
FT                   subunit, iron-sulfur cluster binding domain protein"
FT                   /note="PFAM: Dihydroorotate dehydrogenase, electron
FT                   transfer subunit, iron-sulphur cluster binding domain;
FT                   oxidoreductase FAD/NAD(P)-binding domain protein; KEGG:
FT                   sat:SYN_02220 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31356"
FT                   /db_xref="GOA:D7DB09"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB09"
FT                   /inference="protein motif:PFAM:PF10418"
FT                   /protein_id="ADI31356.1"
FT                   /translation="MKTILKHSIRYYSIKLLSNNKISSNLYLLMFKTLDKPVTEPKPPQ
FT                   FIMLWVPGYEAIPMSVAGFNGENNTLSILVKPVGPTTKYLASMSCGSYLGMYGFLGREY
FT                   IPPGNKFLFIAGGSGLAPILYYLKYLGCTPHKCHVLFGCWRRGEIGDAPRLISKLGGKP
FT                   YTACLGECDYQGTILDAYTRINLEGYDAVIVSGPPEMIKNMLDKVNNTVNHYFILEETI
FT                   KCGIGLCGKCSLGKLDKLLCIDGPLFNYEDTVRVYS"
FT   gene            complement(199144..199614)
FT                   /locus_tag="Shell_0216"
FT   CDS_pept        complement(199144..199614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0216"
FT                   /product="aspartate carbamoyltransferase, regulatory
FT                   subunit"
FT                   /note="KEGG: cvi:CV_0370 aspartate carbamoyltransferase
FT                   regulatory subunit; TIGRFAM: aspartate
FT                   carbamoyltransferase, regulatory subunit; PFAM: Aspartate
FT                   carbamoyltransferase regulatory subunit-like"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31357"
FT                   /db_xref="GOA:D7DB10"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB10"
FT                   /inference="protein motif:TFAM:TIGR00240"
FT                   /protein_id="ADI31357.1"
FT                   /translation="MEEKLVVTKIRNGIVIDHIPAGKALKVLKVLGITGSEGLRVALVM
FT                   NVESRKLGRKDIVKIEEKYLSMKELSLIALIAPTATINIIKEYKVVEKQKVKPPSIVKG
FT                   LIKCPNPTCISRKKNEPIKSLFKLKSTNPIMLECQYCGYVLRGDEIEDYIET"
FT   gene            complement(199617..200552)
FT                   /locus_tag="Shell_0217"
FT   CDS_pept        complement(199617..200552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0217"
FT                   /product="aspartate carbamoyltransferase"
FT                   /note="KEGG: aspartate carabmoyltransferase, chloroplast /
FT                   aspartate transcarbamylase / ATCase (PYRB); K00609
FT                   aspartate carbamoyltransferase catalytic subunit; TIGRFAM:
FT                   aspartate carbamoyltransferase; PFAM: aspartate/ornithine
FT                   carbamoyltransferase carbamoyl-P binding domain;
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31358"
FT                   /db_xref="GOA:D7DB11"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB11"
FT                   /inference="protein motif:TFAM:TIGR00670"
FT                   /protein_id="ADI31358.1"
FT                   /translation="MSFPRGDVLSILDYSRENLEYLFSVADQMEKYLSEKKKLNLLDGY
FT                   IIALAFLEPSTRTMYSFQSATYRLGGKTLVFTSETATSLAKGENYADTIRMLDSYSDLI
FT                   VIRSKYEGTARYAAEIAENPVINGGDGRHEHPTQAMIDLYTMYKIFGGIDGLTIGILGD
FT                   LKYARTIASLLYGLTRFKPRKVYLISPGILRLREEVRNKIVELRLPFEETTSLQDVIDE
FT                   LDVLYVTRIQKERYPDPIEYERVKNLYRISIDILRNVKKEFRILHPLPKIDEIDYRVDE
FT                   TPYAAYFYQAKLGVPLRMALLSLVLGVWRD"
FT   gene            complement(200592..201203)
FT                   /locus_tag="Shell_0218"
FT   CDS_pept        complement(200592..201203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0218"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /note="KEGG: hypothetical protein; K00762 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31359"
FT                   /db_xref="GOA:D7DB12"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB12"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ADI31359.1"
FT                   /translation="MKNESVLEEIVIDLYRNKLFKIGEYRLTSGKISPYYIDLRILPSY
FT                   YDIYSRIIDISISKLKPLKFDIVVGIESAGIIHASFIACRTRKPVGYVRKKPKQHGTRR
FT                   LVEGIVTGKKVLVVDDVATTGGSLEHAVNAVRSEGGTVEKAFVFIDRQEGARERLRRLG
FT                   VELVSLMNTWFIINVLVKHRIIDEQTYYMIKNYLDRETHG"
FT   gene            complement(201200..201892)
FT                   /locus_tag="Shell_0219"
FT   CDS_pept        complement(201200..201892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0219"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /note="KEGG: wpi:WPa_0101 orotidine 5`-phosphate
FT                   decarboxylase; TIGRFAM: orotidine 5'-phosphate
FT                   decarboxylase; PFAM: Orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31360"
FT                   /db_xref="GOA:D7DB13"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB13"
FT                   /inference="protein motif:TFAM:TIGR01740"
FT                   /protein_id="ADI31360.1"
FT                   /translation="MNSRIIVALDITNKPLNWFIDFINTTKKLVAGYKFGLPFLIRYGL
FT                   EGFKEISKLIDNKHYWIIDFKLADIAPIMINTVDQLVKIGYNTYIAHAFIGLEGGLLKL
FT                   KEFLSKHNSKLLLVASMSHKGSLDIIDKCLPHILEAIKKLKPWGLVAPATRPERIVEIK
FT                   NFLLENNIPAKIFSPGIGAQGAAPGTAIRFGADYEIIGRMITLSNNPVKIIEETNKIHK
FT                   DIVGEDHR"
FT   gene            complement(201889..203493)
FT                   /locus_tag="Shell_0220"
FT   CDS_pept        complement(201889..203493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0220"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="TIGRFAM: CTP synthase; KEGG: mxa:MXAN_1096 CTP
FT                   synthetase; PFAM: CTP synthase-like; glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31361"
FT                   /db_xref="GOA:D7DB14"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB14"
FT                   /inference="protein motif:TFAM:TIGR00337"
FT                   /protein_id="ADI31361.1"
FT                   /translation="MVKYVFITGGVLSGLGKGVITASTGLLLKSIGYNVTAIKIDPYVN
FT                   VDAGTMNPYMHGEVFVTEDGGETDLDIGHYERFLDQNLTKKHNITTGQIYYSVIMKERR
FT                   GEYLGKCVQIIPHVTDEIKERIRSIANETHADIVLVEIGGTVGDIEGLPFLEAIRQMRI
FT                   EEGYGNTVAIHVALAPIISTGEQKTKPVQHSIQELRRIGIQPDIVVVRSPRELEEENRA
FT                   KIALYSNLSKEAVYSDPDVDTIYRIPIILHRQGYTRYLAEKLRLEYREPDLSKWYDFLE
FT                   KLTNPEKKIRIAMIGKYTKLHDSYISIIEALKHAGAWNNTGIELGWFEATNIENGKLSL
FT                   EKLLDYDGAVILPGFGKRGAEGKIKAINFLRENNKPLLGICFGMQLMVVEYARNVVGLE
FT                   RANSREIDPNTPHPVIDLLPSQYNVKHLGGTMRLGAHPIHIEKNTIAWQIYRKEIVYER
FT                   HRHRYEVNPKYIDKLENTGLKISGWSPEKYPEFIELPKYKTLYFGSQPHPEFKSRPLTP
FT                   APIYYYFIKKIVEELKH"
FT   gene            203590..204159
FT                   /locus_tag="Shell_0221"
FT   CDS_pept        203590..204159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0221"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: mca:MCA2827
FT                   phosphoribosyl transferase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31362"
FT                   /db_xref="GOA:D7DB15"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB15"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ADI31362.1"
FT                   /translation="MTGEKIKLEYISWKQLHIALVNLARTMISDGYRPDIIYAVIKGGL
FT                   VPARILSDLLEVGRIGFIGVKFYKGVGTREAKPELTLPPTHPVRNKNVLVVDDVVDSGR
FT                   TLQLVLEELNRYGAKNIKSLVIYVKPWSPIYPDYYYKETRNWVVFPWEMIETYRETSIS
FT                   PEDLGEDKTIFQSILRSLFGNPRKNA"
FT   gene            complement(204130..205554)
FT                   /locus_tag="Shell_0222"
FT   CDS_pept        complement(204130..205554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0222"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; K05284
FT                   phosphatidylinositol glycan, class M"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31363"
FT                   /db_xref="GOA:D7DB16"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB16"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31363.1"
FT                   /translation="MVYLVNLDKRDIITVLIIVVLMLIPRLIVAPYTSGSDIPQFAGFA
FT                   DTFLRHGLCFYKFADTKHSSTENWPYSWPYVYGPGLVLFLAPLRLLASSPIIHYWDQQV
FT                   YYVYVSMDWIIASKSLFILFDVLSTIMIYVIIRGLGYKWKSSAILASLYAFNPMTIYIS
FT                   SIYGMFDQIPLFFFLVGIYLLYVRSGDKSWRKILGAFSSGLSIGFKHTFLFSAALIFYD
FT                   LIMRRDKRFRKTLFVSSLVIGALVLFIPFELACFSSIEMFINNALSSSEPGYTYPVCYS
FT                   FNGLSSLATYINEHTGKNMMFLIEYWWLPAITLLAMILIAYLGYRDPIVYSSLAYIVFT
FT                   TTYWRVNHQYLVPAIAFSIILFAKLRGYTRCRFLAILYIFLIGLWPIMFPTSWWAHVHI
FT                   REPNMDIWNLLDRFSLMVFDEESYLLYSLVLTITGYIFVFEVVSAGLSRIHYRVVAEKI
FT                   IGTTKKLLRIFPRISK"
FT   gene            complement(205621..205695)
FT                   /locus_tag="Shell_R0011"
FT                   /note="tRNA-Glu2"
FT   tRNA            complement(205621..205695)
FT                   /locus_tag="Shell_R0011"
FT                   /product="tRNA-Glu"
FT   gene            205890..206474
FT                   /locus_tag="Shell_0223"
FT   CDS_pept        205890..206474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0223"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   sfr:Sfri_1446 signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31364"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB17"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADI31364.1"
FT                   /translation="MRIWEIARKPKLVIRDLSLPLSVVRSKARRAGETVIPVLKDLVED
FT                   KVVGYLTPIELIMPTSHHTTIRVRDALREHPVLFQDMSIGEVFDKLREFKTIGAPVVNS
FT                   VDEMKLQGVVSYNDILNYLIKAGYRPIAESIAEIMTVKELDKYVVSANDRVNKVWSRIV
FT                   YRGQPGVVVRSLDEPIPQGILTYHEFIRTSR"
FT   gene            206565..207173
FT                   /pseudo
FT                   /locus_tag="Shell_0224"
FT   gene            207145..208464
FT                   /locus_tag="Shell_0225"
FT   CDS_pept        207145..208464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0225"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="KEGG: pna:Pnap_3173 transposase, IS605 OrfB;
FT                   TIGRFAM: transposase, IS605 OrfB family; PFAM: transposase
FT                   IS605 OrfB; putative transposase IS891/IS1136/IS1341
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31365"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB18"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADI31365.1"
FT                   /translation="MQGSSLVIREDVRMYSVDFSDERIRELITWYVKSLQRAIDEIWEN
FT                   MEWKYDFKRRYAKVRIPVIPRNKEFKKYLRDKLMKDNPYTKHWVDAVIRTAYSIMENWR
FT                   KRYVKGMARKKKPTVKRRFARCKITLMKVDYSRKTIRITLKPYEYIEVSYANQWFSKRI
FT                   DEWKVGGVVLKDDRVLIPFKKENTYRVNREIAWDCNEKTIDGFSPQMGFVQVDLRKLIT
FT                   ARIRYQEKRSRIQSLMKRKPKSARKLWEKYSRRERNVCRDIERKIAIEIVNAFPNTLHI
FT                   FEKLNKQKMISKRKNKNKNLRKRVARISWINIIREVEMRAPVKKVDPYFTSKTCPLCGY
FT                   VNKDLRGQVFECPRCGWRIDRQKNASINIYLKMKGFPPSPNTFYRVVTKRMIHSGKVWM
FT                   RRGSGVTQIGGETNEMLPNERGDEAGVPQSLHRQIKAYVG"
FT   gene            208489..209715
FT                   /locus_tag="Shell_0226"
FT   CDS_pept        208489..209715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0226"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="KEGG: dol:Dole_2980 signal transduction protein;
FT                   PFAM: CBS domain containing protein; SMART: CBS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31366"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB19"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADI31366.1"
FT                   /translation="MLRGVLVATQDMPVEAVAEVMAKHDIPLVPVIDDDGKVIGVITYE
FT                   DIIRAYLEGAKPGRVRVPVKIPLPIPVRAEERIQYVSREQALTQVLVEKAAPVERAGIL
FT                   ADDIMVEELPAITINDTVEHARKEMLRRKTDYLLVLDEEENIVGVVTKWNMLYALGLKG
FT                   PLWRRRTKDRYFIDYIMTRNVPRVNPDTPIEDVALEMVNSESEVVFVVNESGEIIGYIT
FT                   KDQIIDAARKLLVDLLVENVILPGKTGSVHPFHSLYHVVNKMKALYLDALTVYDGSRVL
FT                   GVVSANRLLFVAFEDAVTGIKSRRLIWVRKLVRGAARRGRYVKITPLVALDVMVPYKKY
FT                   ISPNTLLTRAIDLMKEANLNGIPVLSDDRQVVSIISKNDILRELARRAKKLVKVEKKII
FT                   EKREEKAKT"
FT   gene            complement(209815..209910)
FT                   /pseudo
FT                   /locus_tag="Shell_0227"
FT   gene            210005..210108
FT                   /locus_tag="Shell_R0012"
FT                   /note="tRNA-Gly1"
FT   tRNA            join(210005..210044,210070..210108)
FT                   /locus_tag="Shell_R0012"
FT                   /product="tRNA-Gly"
FT   gene            complement(210119..210805)
FT                   /locus_tag="Shell_0228"
FT   CDS_pept        complement(210119..210805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0228"
FT                   /product="Translin"
FT                   /note="PFAM: Translin; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31367"
FT                   /db_xref="GOA:D7DB20"
FT                   /db_xref="InterPro:IPR002848"
FT                   /db_xref="InterPro:IPR036081"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB20"
FT                   /inference="protein motif:PFAM:PF01997"
FT                   /protein_id="ADI31367.1"
FT                   /translation="MIYIFVLYGCVFMVLEDVVEKVLANDILFIDNVLKKKDEVREEAI
FT                   RITRDILRYSTEAVRLIHLGKYEEAWRNISRAGELIVGLRELLADHPDLYYSGLIYNSL
FT                   SEYAESYITYKLIVDKEMPSYKEIGVPYIPYLQGLGDVVGELRRHVLSLLGNGEIGEAM
FT                   KYLEVMETIYLWLRKLNYPDPLAPGLRHKVDVARRLVDDTKVLLINTRNAYMVSKKIDE
FT                   ALKSKD"
FT   gene            210846..211014
FT                   /locus_tag="Shell_R0013"
FT                   /note="tRNA-Tyr1"
FT   tRNA            join(210846..210881,210976..211014)
FT                   /locus_tag="Shell_R0013"
FT                   /product="tRNA-Tyr"
FT   gene            complement(211091..211285)
FT                   /locus_tag="Shell_0229"
FT   CDS_pept        complement(211091..211285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31368"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB21"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31368.1"
FT                   /translation="MTKNLLGSKDPDGYYIVKAPQSLANIIVKRYRGQIELIEMGDEII
FT                   VRTKSRRVALGIIKMLERK"
FT   gene            complement(211364..212128)
FT                   /locus_tag="Shell_0230"
FT   CDS_pept        complement(211364..212128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0230"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: bmn:BMA10247_1720 cation-binding hemerythrin HHE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31369"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB22"
FT                   /inference="protein motif:PFAM:PF01814"
FT                   /protein_id="ADI31369.1"
FT                   /translation="MRMSLYDLVVDNIVDIIHNIDLEKLKLLLEQEFIDEYKSNNCAED
FT                   LYNDIMKRGNGIFLYSIRDSIFLELLVYNGVITNIGPGKLEINEKEDVKNMLRSLNNPC
FT                   IITVYRVKQPTYRFINKYLCGIKIMDQLHIEMFGLMDNLILAIIRGDLKNLKNLAEKLY
FT                   EHTEKKHFKTEEDLMLQTKYNKHYKEDYKIHITWHKDFLKIISEIKKNAEKKDYISLLE
FT                   NLLMIFHTYFDKYLEEADAKLAKYLKSLGNIS"
FT   gene            212250..212621
FT                   /locus_tag="Shell_0231"
FT   CDS_pept        212250..212621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31370"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB23"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31370.1"
FT                   /translation="MNIRQVLESENDPDKLLGDILRVLAVYRKLWVSEIVSEIASLRKT
FT                   LGEEEVGEKQVREALYKLMSKNIVVGDRRTRTTFRGSVEEYLVELNITPDLANLINKDE
FT                   RLRKYLTEKYNALKQLGEK"
FT   gene            212728..213447
FT                   /locus_tag="Shell_0232"
FT   CDS_pept        212728..213447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0232"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31371"
FT                   /db_xref="GOA:D7DB24"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017271"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB24"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ADI31371.1"
FT                   /translation="MNTGKRLPDYVINAVSKRIAGDILLSDEPGKYIRKWREIYGLGQV
FT                   DVARLMSVSHSVLSDYERGKRAAGRSFIRKFISALMKHDSARGWIITRRIARLLSIYIE
FT                   GILDIGEFREPLRLDELVDMVKGILLTSNIEHRPILGYTVLDSVATIQSISANEFVRIL
FT                   GATSDRVVVFTNITRGRSVMVATRVSPIKPSVIVLHGIKKVDPLAIRIGDIENIPLIQS
FT                   TIDIGEVIKSFRQRSLI"
FT   gene            complement(213454..215595)
FT                   /locus_tag="Shell_0233"
FT   CDS_pept        complement(213454..215595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0233"
FT                   /product="alpha amylase catalytic region"
FT                   /note="KEGG: vsp:VS_2593 neopullulanase; PFAM: alpha
FT                   amylase catalytic region; SMART: alpha amylase catalytic
FT                   sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31372"
FT                   /db_xref="GOA:D7DB25"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB25"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ADI31372.1"
FT                   /translation="MVETQDVKETILAWLNGKMYIIIRREIYGKGRKGRYIVKFTRHWP
FT                   PNAKNIYLIGEFTSLYPGFVKLRKIGEQGIVYLKLWPGEYGYGFQIDNDFENIYDPDNE
FT                   EKKCVYTSFFPEYRKCLSKLTIREPSNPLDRIIHIEEPGFIHRFNNEIIIRLIAPREIN
FT                   DPLIDLGKEIREPSTKYVLGNNIVYQYIVPNRSVLRYRFIFNYNDKTLFYGDEGVSTNS
FT                   SYIVVDTTSIPGVDEPRWYMGTLYYQIFIDSFENGDPKNDPPNKIRRIIPREHGYYGGD
FT                   LAGIMKHIDHLEDLGVETIYLTPIFPSTSYHRYDTIDYKSIDKYLGSMKDFEKLVRKLH
FT                   DKKIKIILDITMHHTNPCNKLFVKALREGENSPYWEMFSFLSPLPKEVAELVLKYIGGE
FT                   ECRSRELYRHDYFKNNKPFYEAFFNIWLMAKFNHDNPETVDYFLDITKFWVDKGVDGFR
FT                   IDVAMGIHYSWIKQYYEYVKNTYPDFLVLGELAENPRIYMNYYDSAMNYYLRKAILELF
FT                   IYKRIGLNEFISRINSMYAYIPHYKALSLYNMLGSHDVPRIKSIVQNNKLLKLMYVLIF
FT                   ALPGSPVIYYGDEIGLEGGRDPDNRRPMNWDRGSWDLELYEHIKKLIRIHKSCRSIRHG
FT                   YFSAENWDNNLLLIKRWINDEETIFILNISKQNISIDLGKLGKYRFDIYSGNSIDQHVN
FT                   NVLLREYGFLILGSKPCNI"
FT   gene            complement(215574..217259)
FT                   /locus_tag="Shell_0234"
FT   CDS_pept        complement(215574..217259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0234"
FT                   /product="Cl-channel voltage-gated family protein"
FT                   /note="PFAM: Cl- channel voltage-gated family protein; CBS
FT                   domain containing protein; KEGG: sfu:Sfum_2352 Cl-channel,
FT                   voltage-gated family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31373"
FT                   /db_xref="GOA:D7DB26"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB26"
FT                   /inference="protein motif:PFAM:PF00654"
FT                   /protein_id="ADI31373.1"
FT                   /translation="MPGLKLIALSLIVSFISSLFIAGFIYALNAYGSVIDETISSNLLL
FT                   ALIAFLSIIAGYLILRVTHAKHAMGAGVENIIYEYHLPFRKLRKTNLVSKFFSTITTIG
FT                   GGGSGGLQGPSIYFGGYIGGLLSDRLKLSYPERKALMLSGIASSLSYIFQAPLGSLFYA
FT                   IEIPYRKDLETKYIIPVFSSSIIGYVMSSVIMGKVIYMPQITISLARILEPINIVIYVL
FT                   LSLFITVLVYVFIYLDRLIEKYKKTMLGTNDLLPVFMLAALVGVTVFIFPQVGGIGYDK
FT                   FLEIYVEKIYLKTPLLLLVLIILKMIATSATIRSGASAGYFGPSLFIGGLSGLVFYSII
FT                   GKHLSSLPPLVYVYAGIAAFYGAASTAPLGISILVTEISGSYTLIFPTILSSFIVRELM
FT                   GNTVLYKTQRKTRLRASIERIITVAYRANSIDPKILNAGIHDAAHSIPVPLLLGDPTDK
FT                   AYHIYINSNHTYIPVVDENHTPIGAIDVKKLVSTKDSVITPKIINPIPTIEKSITIKEA
FT                   TRLLSRYNVETLLLKDEKGEYAGIITTENLEKYILSRIWWKHKM"
FT   gene            complement(217336..217440)
FT                   /locus_tag="Shell_R0014"
FT                   /note="tRNA-Val3"
FT   tRNA            complement(join(217336..217373,217400..217440))
FT                   /locus_tag="Shell_R0014"
FT                   /product="tRNA-Val"
FT   gene            complement(217589..217676)
FT                   /locus_tag="Shell_R0015"
FT                   /note="tRNA-Leu4"
FT   tRNA            complement(217589..217676)
FT                   /locus_tag="Shell_R0015"
FT                   /product="tRNA-Leu"
FT   gene            complement(217686..218351)
FT                   /locus_tag="Shell_0235"
FT   CDS_pept        complement(217686..218351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0235"
FT                   /product="phosphotransferase KptA/Tpt1"
FT                   /note="PFAM: phosphotransferase KptA/Tpt1; KEGG:
FT                   cvi:CV_2425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31374"
FT                   /db_xref="GOA:D7DB27"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR022928"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="InterPro:IPR042081"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB27"
FT                   /inference="protein motif:PFAM:PF01885"
FT                   /protein_id="ADI31374.1"
FT                   /translation="MKPIYKCRICGEYVETPIHCGVEAKLLLDANKRLKLSKLLSGLLR
FT                   HYPWEASLRIDSEGWVDIDELVEGIKTRWRNKELYQWLSKEHIIAVAKLDPKGRFEIRD
FT                   NKIRARYGHSINVKIKYELEYPSTQLYHGTSMDKLAKIMIEGLKPMKRQFVHLTTSLEN
FT                   AVETGKRRGKPVVLIIDTMCLKEKRIPLYKATEKIYLAPKVPPKCIKQTFKPLKLGNK"
FT   gene            complement(218385..219044)
FT                   /locus_tag="Shell_0236"
FT   CDS_pept        complement(218385..219044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0236"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31375"
FT                   /db_xref="GOA:D7DB28"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB28"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31375.1"
FT                   /translation="MDLLYESIWATLLFIWVMIVVYPITKNLYKYMRRKGLSHIKAVYY
FT                   NRKIIHILAGGLVALSVPYLFETPLLPAILAAVLAIATYMPHRRNKLMDWFQTEDNMYE
FT                   VHFCIMWGVVITFAWLIFHNWWYGVIPIVFMAFGDGVTGIVRNMLYNRRTKAWIGNLAM
FT                   ALVTIPIGYLVLGPLGGVAGLLASIIEHFEIKPLIDDNITVPLASFLVLLIGIPPC"
FT   gene            219215..220072
FT                   /locus_tag="Shell_0237"
FT   CDS_pept        219215..220072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0237"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: nam:NAMH_0581 permeases of the
FT                   drug/metabolite transporter (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31376"
FT                   /db_xref="GOA:D7DB29"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB29"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADI31376.1"
FT                   /translation="MKDNYSSILKHYLALLGTVILWGTSFPVIKILVSNVNEYTYVWVR
FT                   GLLSTVFLTPLILHYISKKNVSRECVKGGLLAGIFYGLGLFFQGWGTAYTTASNSAFIT
FT                   GLNVLFVHLIIASMYKRYSIRLFASLVSGILGLYMLSSPTTIGRLGDFLVLIGAVMWAL
FT                   QIIVFDKYSKCNPFILVYFMFIPTQTFILFDPAPISILETRINVLLGFIYLAIFCSIGA
FT                   FALQAYGQKKVPPETAATIFLLEPVFASIFAYLFLGETLGFKQLIGASLILLSMYLASK
FT                   HLLK"
FT   gene            complement(220408..221166)
FT                   /locus_tag="Shell_0238"
FT   CDS_pept        complement(220408..221166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0238"
FT                   /product="ParB domain protein nuclease"
FT                   /note="KEGG: sdn:Sden_0583 ParB-like nuclease; PFAM: ParB
FT                   domain protein nuclease; SMART: ParB domain protein
FT                   nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31377"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR023098"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR040867"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB30"
FT                   /inference="protein motif:PFAM:PF02195"
FT                   /protein_id="ADI31377.1"
FT                   /translation="MSGKGKVIIKLPKTVIPVKYVEPVLIDVDRLLPHEEIVPGRLKDL
FT                   MEKIRSEGVVDMPIIVTPIPGTDKYLVVDGHHRWAAVKELGYKKVPAIIIDYFDENVKL
FT                   KTWYPAIIGSINKILGEIRKKGIRIEKCKDKDNVYEDEELGKYAFVIIGKNNECYKIHG
FT                   SINEQKIVSKILSKLNLEGEYTLVYYGEKDEALRDLEKGEIDYLFLRKPPTKNEVIEIA
FT                   KHNQVYSPKTTRHILPYIPAITNTPLNKLK"
FT   gene            221184..221318
FT                   /locus_tag="Shell_0239"
FT   CDS_pept        221184..221318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31378"
FT                   /db_xref="GOA:D7DB31"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB31"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31378.1"
FT                   /translation="MLLYMLVIYVEVYLAYIHTYRLVNEKIRMREKHGLLIVIYYLIP"
FT   gene            complement(221296..222231)
FT                   /locus_tag="Shell_0240"
FT   CDS_pept        complement(221296..222231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0240"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: afw:Anae109_2506
FT                   D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31379"
FT                   /db_xref="GOA:D7DB32"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB32"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADI31379.1"
FT                   /translation="MVKILVAAPIHEKALEKLRNAGFQIVYEEYPSEDRLVELIKDVDA
FT                   IIVRSKPKVTRRVIEVAEKLKVIARAGVGLDNIDLDAANEKGIQVFNAPSAPTQSVAEL
FT                   AIGLMIDVLRKIAFADRKMREGAWAKKQCLGRELRGKVLGIIGMGRIGTAVARIAYHGL
FT                   GMKIIYYDARRCPKDIEKEIEAKCVDLDTLLKTADIVSIHVPLVPATKHLINEEKLRLM
FT                   KKTAILINTARGGVVDTNALVKALKEGWIAGAGLDVFEEEPLPPEHPLTKLDNVVLTPH
FT                   IGASTVEAQERAGVEVVEKIIGFFKGSSNK"
FT   gene            complement(222361..223506)
FT                   /locus_tag="Shell_0241"
FT   CDS_pept        complement(222361..223506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0241"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; aminotransferase
FT                   class-III; KEGG: gbm:Gbem_0736 aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31380"
FT                   /db_xref="GOA:D7DB33"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB33"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ADI31380.1"
FT                   /translation="MSSYEDAVKEVLSIIWPKPLKLFTAGPVACFPEVLEAMKAQMFSH
FT                   RSSEYRELHRDTTVRLADFLEAKKSTVLLIPSSGTGFMEASIRNAVTPGGKVLVTIIGA
FT                   FGKRYREVVESNGRTAVVLEKAPGEPVLPEELDDALKKNSDVEAVTITYNETSTGVLNP
FT                   LPELAKVAKEHDKLVFVDSVSAMGAADIKVDEWGLDLVFASSQKAFGVPPGLAMAAVSD
FT                   AVFEKAKTIPNRGWYFDLLKYKKYLETQWSTPSTPPIPQIIGLNVVLRIIEKIGGKEAW
FT                   LKMYGERAEKIRKGVLDLGLELFAKPGYYSPTITVVKTPPGIKGVEVYEAMRKRGFEIA
FT                   KGYGPIKEYTFRIGHMGYITDEDIRGLFDNLREVIEELKKK"
FT   gene            223741..224064
FT                   /locus_tag="Shell_0242"
FT   CDS_pept        223741..224064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31381"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB34"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31381.1"
FT                   /translation="MVEDIDYSEYIPEDLLEEIEEIMEYEKKNKRRNKKIYPSSRDIVE
FT                   TVKEAALMARGVHPDEFPDIVLRLLKEKGFDTRYVTVKRIWRVYENLVRKGVIPDTLHV
FT                   VSW"
FT   gene            224071..224460
FT                   /locus_tag="Shell_0243"
FT   CDS_pept        224071..224460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31382"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB35"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31382.1"
FT                   /translation="MVKGIYVKLPTGIWVRIKGKISRTIVSRNKSKRSISYTLLGESID
FT                   KPPKTNNDPQAKYYISATRVTKYILRLLDETRTSKYIMIIKPITKEKYEVLIYGNSAEA
FT                   RKAHKIAEEMNILKQPPKKILEKLK"
FT   gene            complement(224452..224664)
FT                   /locus_tag="Shell_0244"
FT   CDS_pept        complement(224452..224664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31383"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB36"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31383.1"
FT                   /translation="MSNENNKGFICKKDGKPMYLIEETEKMSNGKHRAIFYYKCPICGY
FT                   RIEAEQVIVTVENDEIIVNRRVRLL"
FT   gene            224766..225872
FT                   /locus_tag="Shell_0245"
FT   CDS_pept        224766..225872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0245"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: sat:SYN_01769 Xaa-pro
FT                   dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31384"
FT                   /db_xref="GOA:D7DB37"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB37"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /protein_id="ADI31384.1"
FT                   /translation="MKPQINKLYELVEKSGVEEVLLAAPDNIEYFLGIRTIADSVLLLH
FT                   YKKGGNLRIYVPLLEYYRFRDTLSKLGVEVIAVSKTVKPSDARIVESDWKTLIGKLASS
FT                   DKVGFDKSHVSPLNTLITSIYGDRIVDLSSEINKYRMRKEDWEIKSITRAVEITGKGIY
FT                   EVANNLNDRITEAEVAGFFEYRVRREGVDEYAFPPLTLFKPGNSYPHNLPSNTRLGRKN
FT                   LVLVDVGVKYNGRCSDITRMIIWRKISEEERKAVEAVNEAVDNVIDNIQPGIEAGKLAD
FT                   IAVKTLEKHGLSERFIHGLGHGFGVLVHEPPYIRIGEKTKLEPGMVFTVEPGVYFAGKY
FT                   GVRIEEDVLVTERGVRVLSKMIERIITP"
FT   gene            complement(225862..226677)
FT                   /locus_tag="Shell_0246"
FT   CDS_pept        complement(225862..226677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0246"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG: hap:HAPS_0108
FT                   inositol-1-monophosphatase (IMPase), putative mRNA turnover
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31385"
FT                   /db_xref="GOA:D7DB38"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB38"
FT                   /inference="protein motif:PFAM:PF00459"
FT                   /protein_id="ADI31385.1"
FT                   /translation="MRIDEELERIAFRIAGESAGYLRDLYGLEPLSSIVGRGASGDTTR
FT                   KIDALVEEYAIELLRGTGLDLYIVSEEAGIVRIGENHQFIVLMDPLDGSLNYTLGIPGV
FT                   AVSLVFYDINSDDFTESIAGAVANVFLKEIYSFDKSNVYVNRVRVEKYYSRMSGINVVY
FT                   TNTAETFRKVYLFMKKEFGGEVRLRVIGSAALESVYAALGRIDLFLHNTGRLRNLDVAG
FT                   GVSIAKRLGVPVLGLDGKKIICSPKRIEFIKSLVIGKPGVEKIVEYFKE"
FT   gene            complement(226664..226849)
FT                   /locus_tag="Shell_0247"
FT   CDS_pept        complement(226664..226849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31386"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB39"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31386.1"
FT                   /translation="MLRNNKGIIAIIFIEILLDYFFKATKTRYIDEYYTINNECLLKSK
FT                   VELVESWIEMIIYENR"
FT   gene            226876..226968
FT                   /locus_tag="Shell_0248"
FT   CDS_pept        226876..226968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31387"
FT                   /db_xref="GOA:D7DB40"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB40"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31387.1"
FT                   /translation="MANIEYKVVDSKEYGDRTFFVGEVVDYTYN"
FT   gene            227198..228448
FT                   /locus_tag="Shell_0249"
FT   CDS_pept        227198..228448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0249"
FT                   /product="von Willebrand factor type A"
FT                   /note="KEGG: son:SO_4385 von Willebrand factor type A
FT                   domain-containing protein; PFAM: von Willebrand factor type
FT                   A; SMART: von Willebrand factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31388"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB41"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ADI31388.1"
FT                   /translation="MEYIKASFRMGKDSIIEGREDTIPFVLSIKGVYSAHPPIAFLIVI
FT                   DTSYSMDGEKIFRAKQAALGLLDILRDKDYVGVYGFAGKFYKVLEPVPATKRGEVERAI
FT                   ISLKLGSGTNIYDTLKKLVEETKKVLQNGALSLVRIIFITDGEPTVGKKNPKKILEMAK
FT                   KLREAGASALIIGVGTEYNEKLLSRMAMALNGEFEHISDPASLEKLISEYAKSTQEVSA
FT                   KNVAVLLRLSPGFRVDIYNSLYNNVPEGVEVEIGDIHYRETIDIVGDITTPPLLIGEAH
FT                   IGDIHISYVNPETEEREFATPIPMKIKVKPPEEASTVKIDEKVLAEARMMRTATKIQET
FT                   LGKRKAKDLEKELEELIETTMRVGSESLTAKTLNIKERIEKEGLTPETSKEMASVISRI
FT                   ISGRLKEEKKEEGEKNE"
FT   gene            228441..228791
FT                   /locus_tag="Shell_0250"
FT   CDS_pept        228441..228791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0250"
FT                   /product="FHA domain containing protein"
FT                   /note="KEGG: scl:sce5065 sigma-54 dependent transcriptional
FT                   regulator; PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31389"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB42"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADI31389.1"
FT                   /translation="MSEEKVEPKNSILILKVVKSNFFMPQTEWSLEPGEYVLGRYPTND
FT                   IVIPDPYVSRRHARIFYENGEWHIEDLDSTNGTIVDNEDIRGKGPKKINNNSEIVVGLT
FT                   ILSATIKEESQE"
FT   gene            228884..230479
FT                   /locus_tag="Shell_0251"
FT   CDS_pept        228884..230479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0251"
FT                   /product="serine/threonine protein kinase"
FT                   /note="SMART: serine/threonine protein kinase; KEGG:
FT                   Kinase, NEK"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31390"
FT                   /db_xref="GOA:D7DB43"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB43"
FT                   /inference="protein motif:SMART:SM00220"
FT                   /protein_id="ADI31390.1"
FT                   /translation="MVEFKPFTKIDKASKEFIDPVVLSYVMLKQKIIAVNKRAKLVNCL
FT                   NHLKNKSVEVLKQNSILYVVMKSIGSKWTIRSIIAGTLIIAMVYETKDGVQLIGGLAYN
FT                   TLSKEIYPKNPVVKYSVGVIPIDALPDNIKVYIEESLREKREEKPPYIWVNKVLYDLYI
FT                   EKILTDKGAYMYVLLGRDKFEHRYAVKIPREKTVDGKPLAVNTNTNALNEVLKGIINSL
FT                   EVYSATRDSIRKGLASKGYDEYYADQLILYRKYILRPRAIIMLRTSFSDEEYLESPPII
FT                   LEDYANLGDLDTKIKSKPLDQRELAFLAVRLAGALALVHINHFIHMDIKPQNILLIEDG
FT                   AEPYGYAPLLGDFVGLPHVFDSIIELKKSTPEYADPIALVRGRASYNYDVYSLGITLFY
FT                   AATGKKLKSRILLNLLTLKNIYGTPVPLRVFLVENPELVQYARKLEALYHEYNSKKHKM
FT                   PVETFVTQLLSIIEDYDREQIKIIDKALPSRLANIIKKSIILNETDRYQDSVSIWLDLL
FT                   NSIKELGYTNLIPS"
FT   gene            complement(230585..231616)
FT                   /locus_tag="Shell_0252"
FT   CDS_pept        complement(230585..231616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0252"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="KEGG: glo:Glov_0622 phosphate uptake regulator,
FT                   PhoU; TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: PhoU family protein; SpoVT/AbrB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31391"
FT                   /db_xref="GOA:D7DB44"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB44"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADI31391.1"
FT                   /translation="MVEKRKIQKTGSSSYIVTLPKDWIDGMGLKSGDYVLIYEHEGKLI
FT                   VTPPKLEAGMLTGEIRVLKPVDNDQVFRILVAMYLSGYSNITVTFDKNIPELAKRISEL
FT                   KNRARIKLAGIEVVDETYNSVVMKILLDLKELPLIRATRRLHLIVNNMLLDALKAFHTK
FT                   DTGLADAVLQRDDEADRFHFMIVRQLALALLDIRIMNELGISNPVEALNYRILARNLER
FT                   IADHAANIAKRTYHRPDECMLCKETYDIGLRINNLFNKAMDGLYRLSRQQSEEVIFEAQ
FT                   DIIKIIDDTLFNKILVGNISDQEKIVLTMVFDSLRRITRYSSGIAEAALNIRASKSSVI
FT                   EIK"
FT   gene            complement(232085..232375)
FT                   /locus_tag="Shell_0253"
FT   CDS_pept        complement(232085..232375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31392"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB45"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31392.1"
FT                   /translation="MELHMDPSYKRVLLRLIIDAGLEEDFTKWLEQQGYKYIFGRLDNI
FT                   PGELIETYIKIRKLLSNEDEDEELFREIMKMEEVEPPEKRNFIPAKKKLPK"
FT   gene            complement(232453..233661)
FT                   /locus_tag="Shell_0254"
FT   CDS_pept        complement(232453..233661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0254"
FT                   /product="PhoU family protein"
FT                   /note="PFAM: PhoU family protein; TrkA-C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31393"
FT                   /db_xref="GOA:D7DB46"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB46"
FT                   /inference="protein motif:PFAM:PF01895"
FT                   /protein_id="ADI31393.1"
FT                   /translation="MPLKAPRPVKYEPIPVIDLLMEMNVYSRLMLDLAYYSVVVKDTSI
FT                   AYEVQRIEDKLDADWSLLVMQASLAVRSARDAEEMVSVYRMANALDKLSDSAADIAMLV
FT                   IRDIGISEPVRAALLESEEVVTTIKVQNKGLEGFSVGRLYEIMTGFNILAIRRDNYWII
FT                   NPGENEEIRLGDILIVRGTLDSLNTISNILGDKLALKKPVVEERENKIAKKIAYMKNIT
FT                   DVMIDLAFHAVVNNDKLAAIEVLNLEEIVDDTTHKMILTIIEKFHDNPEEAAGLLSFVI
FT                   SMENVADAAAELVTPLASNLPIHPIVKSVEEESIERIVRLKIPPSFKETSLGKLGLDEL
FT                   GAIPIAIYRGRKIIPLPNEDTVIKPNDILIVKIYSGMEENLNEKLDNYNIEIEGIEIRE
FT                   EED"
FT   gene            complement(233779..234876)
FT                   /locus_tag="Shell_0255"
FT   CDS_pept        complement(233779..234876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0255"
FT                   /product="eRF1 domain 2 protein"
FT                   /note="PFAM: eRF1 domain 2 protein; eRF1 domain 1 protein;
FT                   eRF1 domain 3 protein; KEGG: eukaryotic petide chain
FT                   release factor eRF subunit 1; K03265 peptide chain release
FT                   factor eRF subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31394"
FT                   /db_xref="GOA:D7DB47"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR020918"
FT                   /db_xref="InterPro:IPR024049"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB47"
FT                   /inference="protein motif:PFAM:PF03464"
FT                   /protein_id="ADI31394.1"
FT                   /translation="MKSLYVDRRQLREIIKELKKWSAPATVLLSLYIPPGRPVSDVLNM
FT                   LRQELSITDNIKLKKTRSAVQRALKAAIERLSKIPKIPENGLALFCGEDMDTGDFICLM
FT                   FVPPEKVPVYFYRTDKHFHTEFLEEMVIENNLVGLIIIERDAATLGLLKGSRLEILKEI
FT                   EDYIPGKHHRGGQSQRRFDRIIEQMVHDFYKRVGERAKEKFLPLLEQGKLKAILIGGPA
FT                   YSKYDFIEGDYLDYRLKQLVLPRLIDVSYQGEVGLREMIMKASDLLKEQEYVDALKAVE
FT                   EFKLHLAKDDGMIIYGEEDVKRALEMSAIKTLIIDEDRPDAHQWAELAKKHGAKPVFLS
FT                   DDVPEGAWIKKTFGGLVGILRYRIY"
FT   gene            235012..235662
FT                   /locus_tag="Shell_0256"
FT   CDS_pept        235012..235662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0256"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="KEGG: sfu:Sfum_2757 SUA5/YciO/YrdC/YwlC family
FT                   protein; TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31395"
FT                   /db_xref="GOA:D7DB48"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB48"
FT                   /inference="protein motif:TFAM:TIGR00057"
FT                   /protein_id="ADI31395.1"
FT                   /translation="MNILKANYINPSMNIVREAYRILENCGLVVGITDTLYGIFADPFR
FT                   DECVSKVYVAKKRSRKPIPLLASSPKAVFSITDADHFLQRFLETIWPGPITVVLKPMDN
FT                   MFSEKIHLGTGKIGFRVPASPLPRKLAQLNGGFITGTSANISGLKPARNIDEAIKQLGN
FT                   NVDLYIDSGTAPIGEPSTVIDLTSEKPIIVRDGAVSYRSIIHLYKHIVLKNHD"
FT   gene            235838..236455
FT                   /locus_tag="Shell_0257"
FT   CDS_pept        235838..236455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31396"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB49"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31396.1"
FT                   /translation="MSSKILYVNASGTEIFVLENLRGKISFNEILETITSDWLYILLLR
FT                   KVVSFATVFKTLTQQCRGKLCYARIYFYELKNQPIQLIFKIFDRSSTILINSDPPIEKL
FT                   LKRIIANPKFGETVVFISNLGKDNIVIDTEQANDLKVARKLYMELSPIVFGRGFGRLVA
FT                   MNMEKTGAGYNVILCVDKEGVSVQSTYERVNLLIKSISQCIR"
FT   gene            236509..236817
FT                   /locus_tag="Shell_0258"
FT   CDS_pept        236509..236817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31397"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB50"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31397.1"
FT                   /translation="MIIRATLLIGDDDYSKIVREIVEYVVNHINSNFENYELLIVLKVE
FT                   NTIFNNKPILIVEDLDPIIIDKLPSVETLLNIFMVAGDAKYLDLIDRSPVSVENNIL"
FT   gene            complement(236814..237224)
FT                   /locus_tag="Shell_0259"
FT   CDS_pept        complement(236814..237224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31398"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB51"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31398.1"
FT                   /translation="MPRCPYYLNGLCYSPKTIEKYGSPSDEPVSLGYCLSDNYNECPYY
FT                   TARSGEELYKYMGVEESANIYLPIHIIPCNYNSECPFFEVKQIDENVCVARCTYLDKYI
FT                   TRSSVEKCIKYWDKCPFYRMASEKAAHSLSKY"
FT   gene            237779..238295
FT                   /pseudo
FT                   /locus_tag="Shell_0260"
FT   gene            238285..239268
FT                   /locus_tag="Shell_0261"
FT   CDS_pept        238285..239268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0261"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /note="KEGG: mxa:MXAN_6283 hypothetical protein; TIGRFAM:
FT                   cysteinyl-tRNA synthetase; PFAM: TM1410
FT                   hypothetical-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31399"
FT                   /db_xref="GOA:D7DB52"
FT                   /db_xref="InterPro:IPR004352"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016062"
FT                   /db_xref="InterPro:IPR016063"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB52"
FT                   /inference="protein motif:TFAM:TIGR01370"
FT                   /protein_id="ADI31399.1"
FT                   /translation="MINKLWLIGILIVIGIVLTMCAQYYVQYSESERKSYGLKVRNWAI
FT                   QLQGADPREIASSGFELVVIDYSRDGSEQGKYTPEEIQKMKNSGVIPIAYLSIGKAEDY
FT                   RFYWKREWYTNPPKWLGREDPEWKGSYAVKYWSEEWKTILHTYLDKIIEQGFHGVFLDG
FT                   VDEFEHWSDPNNGEDVYLSEDEAARRMIDLILDIANYCRSRVNGEFYIIPLNGERILKY
FT                   DNGTLINIVSGWAAESLFYNGTKQWSSEDWNWIRENRLPYLDFVLSKGKPVFSIDYVDD
FT                   GSGYFGANKERIDNYREKAISRGYIPYVAISDRELDELNIIKGVQP"
FT   gene            239558..240187
FT                   /locus_tag="Shell_0262"
FT   CDS_pept        239558..240187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0262"
FT                   /product="transcriptional regulator protein-like protein"
FT                   /note="KEGG: Viral A-type inclusion protein repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31400"
FT                   /db_xref="InterPro:IPR022285"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB53"
FT                   /inference="protein motif:COG:COG1318"
FT                   /protein_id="ADI31400.1"
FT                   /translation="MVSEEKKIPEPLSEEITIDLSKVPLVPQGKREIQQLEMALIIATL
FT                   YSPEVLELIRDPIERATWVDSLAVAASALARQKAGYPISKIAEEVGRSETMIRAHLSGK
FT                   TKAGRLVLQTYEKLKKGQLKIVVPFIKVPKEMVERVQRLEEELKLLSNVKKEYEEKLKK
FT                   LQEEINKLKAENEKLRSEIDEKNQIINTIKEKLPALKELIEYVEKL"
FT   gene            complement(240213..240563)
FT                   /locus_tag="Shell_0263"
FT   CDS_pept        complement(240213..240563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0263"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31401"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB54"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31401.1"
FT                   /translation="MEIMLEQPYFVGEDMVKQRFIVRSRNILWKGNVEAARIGNLGFNK
FT                   IKKIISNSISDANRGYTYEMVGRINSRYMYEVRLVKSNTLKYDGVSSVQIKIYETNGKA
FT                   FMNMDIVPHDYA"
FT   gene            240767..241066
FT                   /locus_tag="Shell_0264"
FT   CDS_pept        240767..241066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31402"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB55"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31402.1"
FT                   /translation="MGFAVAVIDDQGRVIDYSAPINMSFDTLREAIRLGYDVFRMINVI
FT                   VREIGYEKPRNITVKMDNYEITVFSRGSKIVVVILSNEEAVPVAVNTSKATMET"
FT   gene            complement(241050..241781)
FT                   /locus_tag="Shell_0265"
FT   CDS_pept        complement(241050..241781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0265"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="PFAM: TatD-related deoxyribonuclease; KEGG:
FT                   pca:Pcar_2900 Mg-dependent DNase TatD"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31403"
FT                   /db_xref="GOA:D7DB56"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB56"
FT                   /inference="protein motif:PFAM:PF01026"
FT                   /protein_id="ADI31403.1"
FT                   /translation="MIKYIDMHCHCHEYSVEELSRFIGKNISLVCVSDDPVSSWKTLEL
FT                   KKKLGITPCIGIHPWEAHKYSEKHAKEIVELAVKNNVKCLGEVGLDKRFVSKTYDRQLR
FT                   IYEIFLKAAKEYDLVLNLHTAGAWREVYELLVKNDINRAYFHWYTGPLNLLDEIISSGY
FT                   YIGINPAWKIQDKHRKVIMYASLENMLTESDAPYKYKGLELRPDYVIETVEYIAKVKNI
FT                   QVEHVLLKINDNYEKLFKSPL"
FT   gene            complement(241795..242211)
FT                   /locus_tag="Shell_0266"
FT   CDS_pept        complement(241795..242211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31404"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB57"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31404.1"
FT                   /translation="MKNIFYRVEKPGKIVLNKISKEENIALVIITPSKYRAICNGIDFQ
FT                   EFVWGGERISLWIVDREQIKCYVDKYVLQPIIENIYYVSRKDTYSIPDTILNKLSYVKE
FT                   IIQELEKDTGFEKFFIMPSDKDLIQDNFIYVKSS"
FT   gene            242382..243065
FT                   /locus_tag="Shell_0267"
FT   CDS_pept        242382..243065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0267"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: saz:Sama_3361 phosphoglycolate
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31405"
FT                   /db_xref="GOA:D7DB58"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB58"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ADI31405.1"
FT                   /translation="MVSIRAVLLDYDLTLMNNLLDFYDAYNEALKKFVGKTLGFNEFYR
FT                   LLINYSLQTYIPPDVDQLSFWRYFRQVYRTRYGYPMEGAYYFLYWVKALGLKTIIISGR
FT                   ECHESSIWEELKRFGLDEYIDKVYTMFNTFILGGVEEELFDKTWLIGYVLSSYGLDGDE
FT                   VVYIGDYRQDLLSARRSGIRFIGIAFSKERKECLQRLGAEYVGSNLYDVTYYLWRIIEE
FT                   IEFKK"
FT   gene            complement(243091..243387)
FT                   /locus_tag="Shell_0268"
FT   CDS_pept        complement(243091..243387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31406"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB59"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31406.1"
FT                   /translation="MSNINLTPHEIKYFSRKVRLKILHEDDDVVLMTAPNEDQLIEIIK
FT                   ELISEKPMNLREIHTILSGIASEDKIRRALLTLVEDGLAVMDDDGRYSIVPGL"
FT   gene            243519..244871
FT                   /locus_tag="Shell_0269"
FT   CDS_pept        243519..244871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0269"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: mxa:MXAN_6449 B12 binding/radical SAM
FT                   domain-containing protein; PFAM: Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31407"
FT                   /db_xref="GOA:D7DB60"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023980"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB60"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADI31407.1"
FT                   /translation="MVGDVAVIIYYDQRAKYSIHALTAAIDPLKNVDVYLVEKKSGFLE
FT                   FARNISGKYRKCIIGLSIQTIMLADDPYLDFIIKLNKHKGKCISIAGGPHPSGDPIGTV
FT                   KSLGFDYAFIGESEKTIQDFVYAVINGDDLLNVKGLFTIVDDKPVYTGKQKPIRLDDYP
FT                   PFPYWRPLFNPIEISRGCPYGCKYCQVSYMHGFFMRHRSIDNIVEYTGCMVEKNIRDIR
FT                   FISPDSLAYGLKTMSREPRLDLIEELLSRLYKKYVERKGARIFYGSFPSEVRPEHLTRD
FT                   AARILRKYVANKNIILGAQTGSDRLLKLIGRKHSIEDVYNAVENAVKYGFIPNVDYIIG
FT                   LPGETRDDLYETIRSIKKLVSMGARIHLHVFLPLPGSPYAWMPPGKVPSWVRKELMKLI
FT                   GAGKAYGQWIHQEKLALKIDMLRRRGIIMPRIKAGSMQRPVSTHLHYSVPP"
FT   gene            244964..245296
FT                   /locus_tag="Shell_0270"
FT   CDS_pept        244964..245296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0270"
FT                   /product="protein of unknown function DUF167"
FT                   /note="PFAM: protein of unknown function DUF167; KEGG:
FT                   swd:Swoo_1329 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31408"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB61"
FT                   /inference="protein motif:PFAM:PF02594"
FT                   /protein_id="ADI31408.1"
FT                   /translation="MSENNEVINKILKILQESREGVIIPIYVKPNSDRDALVLEGDELV
FT                   FYTTEIPEKGRANAALIRFLSRNIRLPHNKIDIIYGARTRSKKVLVRDMEAEKLAEKLA
FT                   EIISSQ"
FT   gene            complement(245280..245609)
FT                   /locus_tag="Shell_0271"
FT   CDS_pept        complement(245280..245609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0271"
FT                   /product="transcriptional regulator"
FT                   /note="KEGG: pca:Pcar_2311 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31409"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038767"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB62"
FT                   /inference="similar to AA sequence:KEGG:Pcar_2311"
FT                   /protein_id="ADI31409.1"
FT                   /translation="MSQDEFLTLREKIMDLLMKTDKPLTVDEIIAYLGLSPRDHRLVYD
FT                   ALEHIAKTIRRRTDNRMELVMIPPRCLKCGYVFKDLKKPRKPSRCPRCKSERISPPAFI
FT                   IIEKK"
FT   gene            245678..246937
FT                   /locus_tag="Shell_0272"
FT   CDS_pept        245678..246937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0272"
FT                   /product="threonine dehydratase"
FT                   /note="KEGG: ank:AnaeK_3529 threonine dehydratase; TIGRFAM:
FT                   threonine dehydratase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31410"
FT                   /db_xref="GOA:D7DB63"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB63"
FT                   /inference="protein motif:TFAM:TIGR01127"
FT                   /protein_id="ADI31410.1"
FT                   /translation="MFITGGKASYPDIESIYKLSLEAREAIQEFIHKTPLVYNYTISNI
FT                   VGYDTYLKLENMQKTGSFKVRGAVFRTYTLIKEYEGRGEKLPGVVAASSGNHAQGVAYA
FT                   AKVFGIPAIIVMPKTASSTKINATKSYGAKVVLHGEIYDEAYEKAMEISREKGYVFIHP
FT                   YDDPYIIAGQATIGHEIIDELKKPGVVLVPIGGGGLISGIAVAVKKRSPSTKIIGVQPV
FT                   NASAMLHLIQGRIEGYRPKPSIADGVVVKKPGDLTSRIVRELVDDIVVVDEEDISYAIN
FT                   FLLERAKIVAEGAGALSVAALLSRQYSPIRGPVVAVISGGNIDPALLSRIIMHELAKDK
FT                   RLLSITGELWDKPGELGKVISVLAKYDLNIVDIRHDRWDPKLLPSKAKLEIVFEAKTSE
FT                   DVKLALAELERIGYRFKVKE"
FT   gene            complement(246927..247604)
FT                   /locus_tag="Shell_0273"
FT   CDS_pept        complement(246927..247604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0273"
FT                   /product="HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like)"
FT                   /note="KEGG: avn:Avin_07410 phosphoserine phosphatase;
FT                   TIGRFAM: HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31411"
FT                   /db_xref="GOA:D7DB64"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB64"
FT                   /inference="protein motif:TFAM:TIGR01488"
FT                   /protein_id="ADI31411.1"
FT                   /translation="MRKNNYLGLIVFDCDGVLTNHYSSWALLHEYFGSKDNRYFAELYR
FT                   RDLISYLDWMKIDIALMIHSHGKPIHRREVIEALSQIKIVPEAKQVFQKLKDMGFTVGI
FT                   VSSGVDVLVKQACKELGSDFCLYNELLFIDDELIPGGKPYVPLKEKARIIKQLAEQYGL
FT                   TMDLVTYVGDSVWDIPVFKEVGLSIAIEPCGDACSEADYSVKNLLDTLKIIENYYSKKS
FT                   LIL"
FT   gene            complement(247591..248223)
FT                   /locus_tag="Shell_0274"
FT   CDS_pept        complement(247591..248223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: CEP110; centrosomal protein 110kDa"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31412"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB65"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31412.1"
FT                   /translation="MVRYPDFLRHIVNTKLSELSHKYRELAGHLDEVRKEISKAEPKYE
FT                   FSSFGGNPENLANYLLSDDFNLLISSFKAANAIKVLEEILVEAKKAYSELPNVVKAIDT
FT                   VLEKIRESEKGAAIVSHTSLKDLALKIENILKELKIKADIKTRDNDIVLSIPNKGSIVI
FT                   KPYEANLETIISITTKIKPEKLEEILKKASEILNLEEPRRVAENKEK"
FT   gene            248354..248659
FT                   /locus_tag="Shell_0275"
FT   CDS_pept        248354..248659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31413"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB66"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31413.1"
FT                   /translation="MARHKARKHKWNPYTSEVQRFSVYPRIQTPREESVRVGETFTVPI
FT                   NDVDEKGRGITSYRGKRIIVYNASLGSKVRVKAVKVVGDTIYAQIIKTLSEADTEY"
FT   gene            248692..249042
FT                   /locus_tag="Shell_0276"
FT   CDS_pept        248692..249042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31414"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB67"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31414.1"
FT                   /translation="MENNVVLDLLRFLGPEKANQLFIGEPIKGRDSWRLLDHIRSKYRY
FT                   ENLYEDESEETECYIVIVRFSNKYIYSLIKEGNESKGYLLEILSPSDVTTTIRLAKEEF
FT                   MKCINKLESSKK"
FT   gene            complement(249063..249557)
FT                   /locus_tag="Shell_0277"
FT   CDS_pept        complement(249063..249557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0277"
FT                   /product="protein of unknown function DUF355"
FT                   /note="PFAM: protein of unknown function DUF355; KEGG:
FT                   gsu:GSU1185 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31415"
FT                   /db_xref="InterPro:IPR007153"
FT                   /db_xref="InterPro:IPR036902"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB68"
FT                   /inference="protein motif:PFAM:PF04008"
FT                   /protein_id="ADI31415.1"
FT                   /translation="MNSNIKIHVLDIPVPKGTNIIIGRSHFIKTVEDIYEALATSVPGI
FT                   KFGLAFIEASGKRLIRWEANDEDLKKHAIDSALKIGAGHVFVLYIKNAWPINILNTLKH
FT                   VQEVVNIYVATANPVQVIVAETDQGRAVIGVVDGYTPLGVEGDDDRRERHEFLRKIGYK
FT                   K"
FT   gene            249720..250346
FT                   /locus_tag="Shell_0278"
FT   CDS_pept        249720..250346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0278"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC607524"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31416"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB69"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31416.1"
FT                   /translation="MKTKILRPVRIGDDKVEVTVFSEEEKSWEKHRIRSSKNILDRMMA
FT                   MANNMVIMNLQDNAYVFSEVEAPGLRAIVGEGMVEGVETILSPKPSLLLSIEFGKKTND
FT                   HGEIIHKIKPEPNTWIYEGSIINKNIDYDLVILKTADGPRIILPDELYIPQRKSSGGKK
FT                   TKKKKRRKRKHASKKSVKKSAKTSKTTKKSKKTKKTRRRKRRRKK"
FT   gene            250343..251071
FT                   /locus_tag="Shell_0279"
FT   CDS_pept        250343..251071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0279"
FT                   /product="purine or other phosphorylase family 1"
FT                   /note="PFAM: purine or other phosphorylase family 1; KEGG:
FT                   aha:AHA_3168 uridine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31417"
FT                   /db_xref="GOA:D7DB70"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB70"
FT                   /inference="protein motif:PFAM:PF01048"
FT                   /protein_id="ADI31417.1"
FT                   /translation="MNEKTLPHIKAKPGEIAENVIAVGDPGRVKILAELLDDYKVVNEH
FT                   RGLLVITGNYKDIRVSIATHGMGCPSAAIVFEELGMLGARKITRLGTAGGMREDLEIGD
FT                   IVVATGAAYTRGGCGLGQYMPEACAPTSPDPVLTTKIMEKLSGTGTRFYSGPVFSSDAF
FT                   YAEDPGFAKKWSSRGVIAVEMEAAILFALGWMRGWRTAAVLVISDNLLSEKEEFATSEE
FT                   LKEKINIAAKAVLEAYRSLK"
FT   gene            251188..252630
FT                   /locus_tag="Shell_0280"
FT   CDS_pept        251188..252630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0280"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /note="KEGG: sfu:Sfum_1634 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA
FT                   synthetase class Ia; tRNA synthetase class I (M);
FT                   Cysteinyl-tRNA synthetase class Ia DALR"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31418"
FT                   /db_xref="GOA:D7DB71"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB71"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADI31418.1"
FT                   /translation="MLLLYEIKLYNTLTRKIEEFKPVSPGFVKMYVCGPTVYDYNHIGH
FT                   GRVYVVYDALKRYFALRGYHVIHVMNITDIDDKIINRANREKRDWREVAETYTRDYLES
FT                   LRKLNVKVDLHPRVTEHIKEIIEFIQTLIDKGYAYIAPSGSVYFEVDKYPEYGELSGRT
FT                   NKELWSQEKEFISEKKKPYDFALWKAWKPGEPYWEAPWGRGRPGWHIECSVMSSRYLGK
FT                   QFDIHGGGTDLIFPHHENERAQSEAAFGVKPWVKYWVHTGMVMMGSEKMSKSLGNIIPL
FT                   REAFKEWGPETLRLWYLTSHYRRPLVFTEESIKQTQKYYERLVSVTNTIKKLSREAVGL
FT                   HRMNDEDLKILDKLLEIRSRFHEALSNDFNTPQALAVISEFMTLVFKEIQYNPKYMLVL
FT                   TAYKLLREFNIVLGVLDKYLAETPEELETLLDNVINIVVDIRRELRERKLYDLADRIRA
FT                   ELGKHGIILMDRGKETTWMRRK"
FT   gene            252631..253347
FT                   /locus_tag="Shell_0281"
FT   CDS_pept        252631..253347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0281"
FT                   /product="endonuclease (RecB family)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31419"
FT                   /db_xref="GOA:D7DB72"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB72"
FT                   /inference="protein motif:COG:COG4998"
FT                   /protein_id="ADI31419.1"
FT                   /translation="MVLSAKRKWRSSEEIALQFLEQQGFRIIDRHVKVKIEGVEVSEID
FT                   AVVEDGKGEKYAVEIKAGTIDVNGIRQAYVNAQLVGYKPLIVAKGFADDSAAALAEKLG
FT                   IKVYQLKDYYLVEAEELETLVKASINNIIQELLDTLLTEKKLGPEEYDFLEKMATTKTI
FT                   KELADKQNITINDVARKIRRLQKKGILSYKHKNYQYLRLEAQLLILRENINRAINKLNL
FT                   ILDQISNLLKTPKNQP"
FT   gene            complement(253583..254608)
FT                   /locus_tag="Shell_0282"
FT   CDS_pept        complement(253583..254608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31420"
FT                   /db_xref="GOA:D7DB73"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB73"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31420.1"
FT                   /translation="MGANMANKNILFLSRECGFIDNFIYDKLVKEKFSVEYADLTSVYE
FT                   HIKGLGLVKRFRIFFKLLLEMIKRANSYDFIICSPVDSWFLSQVFSLVISRPRKTVIII
FT                   PPSPKHIFGLLRLFKLYLFRFSLFLLGLLGVSTLLVFTTPYEKEYLETVIRSRNYIYIP
FT                   LIEPRVSMVRELIYSDKPLIIISYDDWINDQVFHNALETFRELGVQVRYVIVSSKPIIH
FT                   ACNGNYNAICIISDDISEIIKHSTLVIVKRANPESNRILVEAIMNGRPVISSKKIGMAY
FT                   IYSDTGLIVFLSKWALETFTDTVLKILNRIDYFKKVSLKNIPKPLKSDYGIYILIDFLE
FT                   N"
FT   gene            254664..255791
FT                   /locus_tag="Shell_0283"
FT   CDS_pept        254664..255791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0283"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: pae:PA0069
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31421"
FT                   /db_xref="GOA:D7DB74"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB74"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADI31421.1"
FT                   /translation="MTNILQLKKQLRKTIASKLTSKEIREAIRDHHARRKPRPCGMTIH
FT                   TGIGCSLRCTYCYIEDMGFNWIAKPYPLTGLQLVYALLYNPYFVPGEYGTLIAMGSVTE
FT                   PFLGVTREKTFEYIEAIATYLKNPIQFSTKMYLTRRDAYRLKQLDPGISPLITIVTIRY
FT                   KDKLEPLAPPPEKRFETIKNLRSKGLKPILFLRPIIPGIIEEEYVEILEKARDSGAVGV
FT                   VVGSLRVTNRILDRLRKAGLDIGEIIRRLPRKPRGNEQVPINTRDLKEEIIRYARKIGL
FT                   VAFPEACMANIYTHGRICWKMIHHKIVVPGVEPPQISIDELKKIAEENNVVLKKATRKK
FT                   YFIKMLLEGDRISKALFSEYVKCRFGYCVKILRSK"
FT   gene            complement(255799..256035)
FT                   /locus_tag="Shell_0284"
FT   CDS_pept        complement(255799..256035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31422"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB75"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31422.1"
FT                   /translation="MMPKTPSVILREELAKRQLELLDIYHGKEKDIIRVKDKMSGKVFL
FT                   YETKTFVRDMDKDRITELANNIQEKLKELVSKK"
FT   gene            256111..256557
FT                   /locus_tag="Shell_0285"
FT   CDS_pept        256111..256557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31423"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB76"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31423.1"
FT                   /translation="MLVNRYLKLRMKWGNGSLSVELNEDILTIYSPNFLLELRPRTIIV
FT                   DNCRGYRVGEDNKRKYIYIYLKEKINPYTSPPQITPTKKPILLGNYQLVYTTTKYDLYY
FT                   TIITPGYTLYEYVIITNDEVGIALSRKRETYFEETDNKLVIYLV"
FT   gene            complement(256558..257358)
FT                   /locus_tag="Shell_0286"
FT   CDS_pept        complement(256558..257358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0286"
FT                   /product="aspartate/glutamate/uridylate kinase"
FT                   /note="PFAM: aspartate/glutamate/uridylate kinase; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31424"
FT                   /db_xref="GOA:D7DB77"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR024192"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB77"
FT                   /inference="protein motif:PFAM:PF00696"
FT                   /protein_id="ADI31424.1"
FT                   /translation="MSINRDHDNVVFVKLGGSFITYKDKPYSINYAALKKTVDILSSVY
FT                   GKTRLLLGNGGGSFAHFVVEKYKMYDEKILLVNCHRATRLLNSIIVDYLLDHGLLVSTM
FT                   QTSAIIYGGKRGFVSFIKPLKYLLRNNIIPSIYGECIIDENQAVRIVSTEEVFSILAEH
FT                   IKVSRIVLLTDVEGVFTCDPKRCEDAELIPRIDRNNIDTVLSRLKETMYMDETGSIYGK
FT                   VKYMASLSKKLRIPVFIVSGHDVENAVNAILYGKVLRGTVIDMS"
FT   gene            257586..258914
FT                   /locus_tag="Shell_0287"
FT   CDS_pept        257586..258914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swd:Swoo_1993 phosphoribulokinase/uridine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31425"
FT                   /db_xref="GOA:D7DB78"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB78"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31425.1"
FT                   /translation="MILGSKIAEKISMVLTYRNGLLLLLLINIFLLSTSIFSWNYYDVR
FT                   YFLEWAKVVRDHGILYVYKYARKVAYPPIAVLTFVLPHLLATSITTSLPIIRLIDKLPL
FT                   ILAFNLIFIFLRNKHGLKTAHYWLANTVPYLVIMVYQFDLLPALFILLAAYELAKPDRD
FT                   PLKTAVYLSLAILYKQILVFLALIPLIIYYKEKRFRDLKKYVAAGIAVASIVILPFLIV
FT                   DPYAFIYKVLLYHSQRYPQELSLWAIPLYLYNYDYTRLPSWITDAWLPIYVVALILYFM
FT                   KIIKINRFDEPIIYKYFVIYILMTLIISKVNNLGYLTWALPLLAIIINSKNNMFDGLRF
FT                   LYIAVSWIEGILYPFVTLFAASVVYGSVFIVEDLSYYSALWSIERSIDRTMFVFSLIDY
FT                   MRVYFYNVFEALYRGMGISATIYTLLYNWYLAHTIYKIYKYYP"
FT   gene            259005..259808
FT                   /locus_tag="Shell_0288"
FT   CDS_pept        259005..259808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0288"
FT                   /product="diphthine synthase"
FT                   /EC_number="2.1.1.98"
FT                   /note="TIGRFAM: diphthine synthase; KEGG: similar to DPH5
FT                   homolog; K00586 diphthine synthase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31426"
FT                   /db_xref="GOA:D7DB79"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004551"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB79"
FT                   /inference="protein motif:TFAM:TIGR00522"
FT                   /protein_id="ADI31426.1"
FT                   /translation="MLYFIGLGLSINHLTLEAIDALRNADKVYIDTYTNIVPDFSLDKL
FT                   VGLVGEEKEFVMAKRELLEGKNIYYIVEEASKKNIAILVPGDPFIATTHDAIRVEALRR
FT                   GVKIRVVNGLSIYSLAPSRTGLQAYRFGKTVTLVYPDYFKPYSTIETIYDNLDRNLHTL
FT                   LLLDLKIEENKAMTIPEAIDILIELDERRVLENIIGVGLAQLGSSMEKIVADRLADLKK
FT                   YAYPSPPHSIIIVAKPHPVELDNLYYVCGLPEHLYRRYSVSKTYP"
FT   gene            259865..261052
FT                   /locus_tag="Shell_0289"
FT   CDS_pept        259865..261052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0289"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   dat:HRM2_41780 ABC-type Fe(3+) transport system,
FT                   periplasmic substrate binding component"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31427"
FT                   /db_xref="GOA:D7DB80"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB80"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADI31427.1"
FT                   /translation="MRKLIIYLLILAILLYPAYTGAIKTSISSVIVTDALGRTIVLNKT
FT                   PEKVVSLAPSITETLFYLGLQRFIVGVDNISYTDPYFGIEEYVKNHNISPVGGYWWSTI
FT                   SVEKILALNPDIVFADKGAHQPLLNVLEQYNITVVYLNGGSAKSIQDIYSDLDIIAQVF
FT                   NVSSNKISEFINDLETEINKYHNLIAEKGTIKALAVVGIYNGIWVAGKSTYIDDLLSRL
FT                   GLINAAETIGWKAVNIETIAEWNPDIILVTSTGIDNQTLRNAGLYDLGVPVVLLNQTIT
FT                   DALSRPSPLIINVPRMIYSIIDEYFGSKTVTTTTTTTTTTTITTTTTMTTTTTTTTMAT
FT                   TSIESTTTNSPSNSIHTATEKEVEKGTDYIMITILVVSAFIIGLLLGYALFRKTR"
FT   gene            261064..262017
FT                   /locus_tag="Shell_0290"
FT   CDS_pept        261064..262017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0290"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   pcr:Pcryo_1284 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31428"
FT                   /db_xref="GOA:D7DB81"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB81"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADI31428.1"
FT                   /translation="MNTRTIFILISTFLLILLFITMYFSIYGGHPLSVLVLKYRFYRVI
FT                   EAVTAGFVLGFAGAYLQASLRNPLVDHYILGIGSGALFTVYLAYLLFSSVQLLVYSSIA
FT                   IIGGLTALAITVLIAESIGGGATSYVLAGLGVNSLFSGLSVLLSYFILTVNPYALYLLV
FT                   GSFIVASPAYLPIIIFSIILVVTGYFPLAKPLNALILGDEYAYQLGYNPRIYRLASILL
FT                   AGISSSLIVSCFGLIGFLGLVAPHIARLLVRSSDNRYVLFLSGLLASILLLITDDISRI
FT                   LLVSVTGEVPAGAIVSVFGAPFFLFLIVSRRRGGVR"
FT   gene            262014..262787
FT                   /locus_tag="Shell_0291"
FT   CDS_pept        262014..262787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0291"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: cff:CFF8240_1762 ferrichrome transport
FT                   ATP-binding protein FhuC; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31429"
FT                   /db_xref="GOA:D7DB82"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB82"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI31429.1"
FT                   /translation="MIRFENVTVKYRGVITALKNIDITIKEHMVTCIIGPNGAGKTTLL
FT                   KTIAKITSYDGSIYIDGRELREYPLRTISKLISYVSQIEAVDILSLTVKEALLTARYPV
FT                   SKAFFETSEDLRIVEEVSKMLQINDLLDRRLSELSSGELQRVVLGLGLVKKPKYLLLDE
FT                   PDNHMDLNYKARLMEWIRDWRRFSNIILTTHDIMFGTDIGEYFVILHRGTPVFIGDKND
FT                   LLKHYDILEKIYGVKIARISVNGKTRLVPLYEIIS"
FT   gene            complement(262782..263375)
FT                   /locus_tag="Shell_0292"
FT   CDS_pept        complement(262782..263375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31430"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB83"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31430.1"
FT                   /translation="MNSIDMEQLARLINELPGMSEQDKIKYLSIILIYYENKCAGRVFV
FT                   YKTLGYTERKTRSRINKLVDKGFLHKTNYSVCISEQASETLRGLVINRYDLGKQVLVSM
FT                   NGFPQGILEDIKYKILRFRDYIVIYTMDPGSLEIIGYTIGDKIDIPGLPGELAIKYERL
FT                   VRDLVENDSLFILWNHYRKYIYDSILLFSLYKVL"
FT   gene            complement(263372..263920)
FT                   /locus_tag="Shell_0293"
FT   CDS_pept        complement(263372..263920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0293"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: plu:plu0841
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31431"
FT                   /db_xref="GOA:D7DB84"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR016291"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB84"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADI31431.1"
FT                   /translation="MKPALIVIDMLEEFVHGRLKSPDAEKIVPNIKKLIDTARNNGIPV
FT                   IYVADRHFPVDHELKLWGEHALINSEESRIIKELEPTSRDYVLYKRSYSGFRDTGLDML
FT                   LRDLGIDTVFLTGIHTHICVLHTAWDAFYYGYNIYVVKDAVAAFSREDHEYALKYMEKN
FT                   YGAKIVDTKEALKLLGSKA"
FT   gene            complement(263987..264928)
FT                   /locus_tag="Shell_0294"
FT   CDS_pept        complement(263987..264928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0294"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   pca:Pcar_1586 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31432"
FT                   /db_xref="GOA:D7DB85"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040084"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB85"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADI31432.1"
FT                   /translation="MDSIVFGPVPSRRLGLSLGVNNVYNKYCSYSCVYCQAGRTTRLII
FT                   DRISFYDPYKLVEAVIREVEEKKPDVVSFVPNGEPTLDKNLGLEARLIKERISVPLAIF
FT                   TNASLIYREDVVEDLLLFDIVSVKVDTVNEETWRKLNRPHPELSLEKILEGIINFSKKY
FT                   RGKLITETMLVKNMNTSIEEYEGIADYLSNIRFDKAYIQAPIRPPAEKFVTIPDKDDFL
FT                   IAYNIFAEKLGENRVEVLNYPEQPLFKFSENLVEEVLRTINVHPIRLDYLKYIADKRGA
FT                   NFEEILDKLLKTGKTMIAEYNGKKFIVPRRKT"
FT   gene            265723..265848
FT                   /pseudo
FT                   /locus_tag="Shell_0295"
FT   gene            266080..266331
FT                   /locus_tag="Shell_0296"
FT   CDS_pept        266080..266331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31433"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB86"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31433.1"
FT                   /translation="MSDLITVRVPREIKEKMRKYRNINWSEVVRKAILERLAIEEAREK
FT                   KLMASKVMDSIREKILRTHGPTNYDSSEAIRYWRELRK"
FT   gene            266334..266476
FT                   /pseudo
FT                   /locus_tag="Shell_0297"
FT   gene            complement(266527..266691)
FT                   /pseudo
FT                   /locus_tag="Shell_0298"
FT   gene            complement(266714..267910)
FT                   /locus_tag="Shell_0299"
FT   CDS_pept        complement(266714..267910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31434"
FT                   /db_xref="GOA:D7DB87"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB87"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31434.1"
FT                   /translation="MQKIIPAFIVIVVIIASLIMQYPITIGQQNSSSYGVPLEAVEEYS
FT                   AVNLSDLKGKEFKVFYIHREGEVVDRLNQILYLVSDDPSSIAGHLELVGTRELGPEKIY
FT                   VFHGVYSGKDVVVALGDMGSFLIRIGDGRTGSYMSYYMTYNYINIIKKTMTVSTRYSIK
FT                   YAGQYGERTAYERIGYICNVSGGTTTCTVPANQSVQKILYNPYEVYYIYIDGYRVEPPI
FT                   RVRCCVPEYNSGLRAVYVEGFIPWLTSRVDVFRVDEAYLNKIVSLAKQAGMNVKSYDDL
FT                   IIEDMYLHRGNGTLSPIILLRKDYTLFWVELGKDGPIPGPSAGLLDSGRFSSGNEDKGI
FT                   RIDWESILSSTEAVSTNSTSSKEPHTPLVLVLTIFITLVSVAFLTGYYLGYKRQGSKL"
FT   gene            268675..268806
FT                   /pseudo
FT                   /locus_tag="Shell_0300"
FT   gene            268864..269025
FT                   /pseudo
FT                   /locus_tag="Shell_0301"
FT   gene            269021..270325
FT                   /locus_tag="Shell_0302"
FT   CDS_pept        269021..270325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0302"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="KEGG: noc:Noc_2211 transposase IS605; TIGRFAM:
FT                   transposase, IS605 OrfB family; PFAM: transposase IS605
FT                   OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31435"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB88"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADI31435.1"
FT                   /translation="MGARGQTVRVARTVVVESARIPRKLFKVFVEVEGMYRNMVEQLTI
FT                   YAVRNTITSFTRLKALKYRELRRLYPKLPSHYAYTACQDSSTRAKSFIRLKKLGQIDSD
FT                   YPRVEKVSIWLDDHLWRLEGYTSIKIATHKGWIRIEFEPHKQYWKYINGGWKPASEAKI
FT                   KLDKRNKKIKIYLVLIKDIEPYKPRGYIPVDVNEDNIAILVDDKPVLLETNMKKITLGY
FT                   YYRRKRVQEKYDKIYGVKSRVKKKILRKLREKKKKHSIRWKTANIIVREAVRRGYGIAL
FT                   EQLGRRSANNMIKKVRDRQLRHRIYQASFKSIQNAIAEKAREYGVPVIYVDPRNTSRQC
FT                   PIHRAPILYDNGSRIGKCSIGGEFWHRDVVACYNILSRTLGVDGSYAPKPLGITVDGRP
FT                   VPLASTAAHDPIVLDRGLWERWKSPPKIHKYRMTR"
FT   gene            complement(270469..271332)
FT                   /locus_tag="Shell_0303"
FT   CDS_pept        complement(270469..271332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0303"
FT                   /product="Haloacid dehalogenase domain protein hydrolase
FT                   type 3"
FT                   /note="PFAM: Haloacid dehalogenase domain protein hydrolase
FT                   type 3; KEGG: sat:SYN_00870 mannosyl-3-phosphoglycerate
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31436"
FT                   /db_xref="GOA:D7DB89"
FT                   /db_xref="InterPro:IPR006381"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB89"
FT                   /inference="protein motif:PFAM:PF08282"
FT                   /protein_id="ADI31436.1"
FT                   /translation="MGGEKIVVISDMDGCLLNKTYDYRKSIDAIKYVLENNILLILNSS
FT                   KTRYEIEYYIEKWGLHGKTIFTVENGAATFIPKKLVDKNSLVHDMLKKYEHSIIDEYIV
FT                   IVNGLKTSIIEQKIIDIIEETREKILWLKDFTPQKFSELTRLPIEQSILALKREYSYLF
FT                   HPLVRGEIINKIVEEIKARGLNVSTGSGTIYLITGNHDKGLATQRTIEIIKEIFNKNIV
FT                   TIGVGDGYNDIPMLKTTDYSILLNCRKDIIQELSNKNNLTITCRNGSDEWLKMVKRTVE
FT                   SIVKKQ"
FT   gene            271429..272619
FT                   /locus_tag="Shell_0304"
FT   CDS_pept        271429..272619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0304"
FT                   /product="mannosyl-3-phosphoglycerate synthase"
FT                   /EC_number="2.4.1.217"
FT                   /note="TIGRFAM: mannosyl-3-phosphoglycerate synthase; KEGG:
FT                   hypothetical protein; K05947 mannosyl-3-phosphoglycerate
FT                   synthase; PFAM: Mannosyl-3-phosphoglycerate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31437"
FT                   /db_xref="GOA:D7DB90"
FT                   /db_xref="InterPro:IPR012812"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB90"
FT                   /inference="protein motif:TFAM:TIGR02460"
FT                   /protein_id="ADI31437.1"
FT                   /translation="MRVEMPRYMERFGAIRFYNVQRVLELSGGKTSDFSGEVPGTINVG
FT                   SGDIEEIEANMTIIVPVKNENPKVLEGVLSGIPHDAFIVVVSNSKREPIDRYRIELDTL
FT                   FQFYRLTRRPLMVVHQKDPVLGQALKEAGYPYIVGDNGYVKDGKGEGMIIGLLLAKYLG
FT                   RRYVGFIDSDNYIPGAVNEYVHIYAAGFYMAKSPYAMVRIKWPYKTKFVGKRFYFRRRG
FT                   RVSEITNRYMNMLIASITKFETDVIKTSNAGEHAMTLELADRIGYSSGFSIEPYQIVYM
FT                   LEEYTGLKSSRFPEIMKDTIEVFQIEPRNPHIHEEREETHIPEMIKQSLATIYHSRLAD
FT                   EFLKNRIREELLARRAISRDEEIPEPTKYPPLIEADARKIFKMLEESSDTLIIKEF"
FT   gene            272793..274073
FT                   /locus_tag="Shell_0305"
FT   CDS_pept        272793..274073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0305"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase; Glu/Leu/Phe/Val
FT                   dehydrogenase dimerisation region; KEGG: nme:NMB1476
FT                   glutamate dehydrogenase, NAD-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31438"
FT                   /db_xref="GOA:D7DB91"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB91"
FT                   /inference="protein motif:PFAM:PF00208"
FT                   /protein_id="ADI31438.1"
FT                   /translation="MAEIPASLYEKDPTYQMAVKQLREAAQLLGLPDEIVEVLRHPERL
FT                   IQVKIPIRRDNGKIEVYLGWRSQHNSALGPYKGGVRYREDVTPGEVVALSMWMTWKNSL
FT                   AGIPYGGGKGGIRVNPKLLSQRELEELSRKFFAALARNVGPDVDIPAPDVYTNPQTMAW
FT                   YFDEYSKIVGYNAWGVVTAKPVELGGLHARTVSTGYGTALTAREAAKRWIGGIEGKTVA
FT                   IQGFGNVGQYAAKYLKEWGAIVVAVSDRSGGIYDPNGIDVEEAMKVKAETRKVTNYKKG
FT                   NVKIISNEELLELDVDILIPAATENVITKANADRIKAKVISEGANGPTTPEAEEILRKK
FT                   GVVIVPDILANAGGVTMSWIEWSHNRMGCWLTDEEALSRLDRIMTHNFNRVFDEWQKKF
FT                   SDHPMRTAAYAIAVDRVVRAMKLRGWI"
FT   gene            complement(274077..274337)
FT                   /locus_tag="Shell_0306"
FT   CDS_pept        complement(274077..274337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0306"
FT                   /product="Protein of unknown function DUF504"
FT                   /note="PFAM: Protein of unknown function DUF504"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31439"
FT                   /db_xref="InterPro:IPR040459"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB92"
FT                   /inference="protein motif:PFAM:PF04457"
FT                   /protein_id="ADI31439.1"
FT                   /translation="MPKRMGEIEYWLRRLFFSGRKDDYVIYIRYRIDGEEELRPIPGKF
FT                   IDDIRRGYIIVGEDMIPFHRVEEIRTRDGKIVYKRRKNMGL"
FT   gene            complement(274369..274695)
FT                   /locus_tag="Shell_0307"
FT   CDS_pept        complement(274369..274695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0307"
FT                   /product="protein of unknown function DUF134"
FT                   /note="PFAM: protein of unknown function DUF134; KEGG:
FT                   tau:Tola_0308 protein of unknown function DUF134"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31440"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB93"
FT                   /inference="protein motif:PFAM:PF02001"
FT                   /protein_id="ADI31440.1"
FT                   /translation="MPGRKMGWRVGRPRKPRIVRYDISGKITWVPLINGLPARKSPPII
FT                   LEPDEFEAYRLVYSHGLTQEEAAVKMGISRGTLWRLLVSARRKIGYALENLAPIIIEPK
FT                   TETS"
FT   gene            complement(274736..275833)
FT                   /locus_tag="Shell_0308"
FT   CDS_pept        complement(274736..275833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0308"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: scl:sce4204
FT                   geranyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31441"
FT                   /db_xref="GOA:D7DB94"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB94"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ADI31441.1"
FT                   /translation="MDNYMELLEFARRITNEALREVFDTVDAEARGVSSKVVDIPFISR
FT                   DYTLRGGKRLRAFLVLIGYWSRKWGYGSIDSVKYLMAGIEFLQSYLLVHDDIMDEDEIR
FT                   RGGPTVHVWFDKKCREGGLIGRCKHYGVSQAIIVGDYLESLAVSMFTRLNLPDYALKEL
FT                   IKTYTRGIRLVAYGQFLDVLIANTPLQKVSEDDVYNIHLLKTASYTVELPLHLGAIASL
FT                   MYDKELLTELSQYALPAGIAFQLQDDILGLYGDPKVTGKPVGSDVREKKKTLLIVKAYQ
FT                   LADTGDKKFLEELYDKKKPEEITDEDVRRVQSIVRETGSLDYSVKKMNEYVERARNALK
FT                   SSIIINESAKKVLDWLLELFVRRRH"
FT   gene            complement(275887..276615)
FT                   /locus_tag="Shell_0309"
FT   CDS_pept        complement(275887..276615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0309"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="PFAM: 5-formyltetrahydrofolate cyclo-ligase; KEGG:
FT                   hypothetical protein LOC100248560"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31442"
FT                   /db_xref="GOA:D7DB95"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB95"
FT                   /inference="protein motif:PFAM:PF01812"
FT                   /protein_id="ADI31442.1"
FT                   /translation="MNTIKELKKKIREHIWSLMEKKNIARFPRPVYGRIPNFVGAEQAA
FT                   AKIRSLDIWGKAGVVKANPDSPQKPLRYYALIDGKKLVMATPRLREGFLLLDPSKIPST
FT                   KYGYASTIRGAFIYGKKISLREIPMIDLIITGCVAVDRRGGRLGKGGGYAELEYAILRE
FT                   IGSIDEQVYVVTTIHDIQIVDHVPLEPHDLTVDIMATPTRIYIVKPRPPKPKGIIWELL
FT                   GEKRKLGVFRELESIVKERS"
FT   gene            276782..277435
FT                   /locus_tag="Shell_0310"
FT   CDS_pept        276782..277435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0310"
FT                   /product="Orotidine 5'-phosphate decarboxylase"
FT                   /note="PFAM: Orotidine 5'-phosphate decarboxylase; KEGG:
FT                   mfa:Mfla_0250 hexulose-6-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31443"
FT                   /db_xref="GOA:D7DB96"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB96"
FT                   /inference="protein motif:PFAM:PF00215"
FT                   /protein_id="ADI31443.1"
FT                   /translation="MRPVLQIALDVDDLFKALSMSTRIVAELGCGNIWIEAGTPLIKAW
FT                   GRIGIDVLKKSTNCFVVADTKTMDTGAFEGEIVLSAGADAYTVLGLADGSTIRESIDKA
FT                   HEYNKLLIVDLINHPNPYNRALELDKLGVDVVLYHVGIDVQRSRGLTIDQLIDEIKMLR
FT                   KNINAKIAVAGGIKHGKAKPLVDAGADIVVVGSAITKAEDPVDSARKFLEEILS"
FT   gene            complement(277442..278548)
FT                   /locus_tag="Shell_0311"
FT   CDS_pept        complement(277442..278548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0311"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="TIGRFAM: tryptophanyl-tRNA synthetase; KEGG:
FT                   hypothetical protein; K01867 tryptophanyl-tRNA synthetase;
FT                   PFAM: aminoacyl-tRNA synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31444"
FT                   /db_xref="GOA:D7DB97"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020653"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB97"
FT                   /inference="protein motif:TFAM:TIGR00233"
FT                   /protein_id="ADI31444.1"
FT                   /translation="MTIKLDPWGHFAIKEYDKLFKQFGIEPIDKATPLLPKKHYFFDRK
FT                   IVFGHRDFDKWLQALRNGEKVAVLTGFMPSGHTHLGHLMVIEELRFLQELGAHVKIVIA
FT                   DAEAYAVRRLSRKETIKYGIEYIAHAIAWGLNPEKTEFYFQTAQKTEYYRLIQMFSRRV
FT                   SMAEMEAIYGDISPGKIIASLTQAADILHLQLPEYGGYKHVLVPVGADQDPHLRLSRDI
FT                   ADRFHTELGLNRPASFYHKFIRGLDGNKMSSSRPDYAIFLLDKPDIIKRKVMMALTGGR
FT                   ATAEEQRKYGGIPEKCTVYELYMYFLYKDDRELYKLYKECVEGKILCGEDKRIAAKLLV
FT                   EMLTEHQKRYKEVMEEGIVQKIVKIPSF"
FT   gene            complement(278552..279721)
FT                   /locus_tag="Shell_0312"
FT   CDS_pept        complement(278552..279721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0312"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: guanine deaminase;
FT                   K01487 guanine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31445"
FT                   /db_xref="GOA:D7DB98"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB98"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ADI31445.1"
FT                   /translation="MKNPSPAGKVKKGSPALSQLIINTYHLLYGYELEDIGKSHIVVEN
FT                   GVIKEINHGFRRDADYTVGAVLPLPVNAHTHLNDYRVPEHCIGYNLSTYAGSKGVKHPL
FT                   IQLIKNPILPKELAYVMAQYSIVVDYQEHFWRCNEFREELSGYGVKYIGLSRPTRYDLE
FT                   EIGYVLKNCDGIGISNPLKLPSWVVIEYAQISNDKIVSAHVSETKTMEEHGSLHYLLNY
FT                   RVKPPHIVHGVYLEDWEYKLLADEDIVLVVNPRSNLWFTGKLPRIDKALKYGVKVAVGT
FT                   DNAGCFHPDVWVDTLLLETIYKDIDPKIFLEMTIINGYYAVKQKPLIIREGEKAYFMGV
FT                   DLGIANDRSGNIYGSIINRVIWSPYKIFVKENNLYIHTVKYHFKRLNGA"
FT   gene            279812..280498
FT                   /locus_tag="Shell_0313"
FT   CDS_pept        279812..280498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0313"
FT                   /product="34-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="PFAM: 34-dihydroxy-2-butanone 4-phosphate synthase;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31446"
FT                   /db_xref="GOA:D7DB99"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:D7DB99"
FT                   /inference="protein motif:PFAM:PF00926"
FT                   /protein_id="ADI31446.1"
FT                   /translation="MVSWLDIRNALLNGKPVLIFDSIEREAETDMVFYAGIIDYKKIAY
FT                   LRKYAGGQICFVSGGLFREALDLPFLQDLIIKYPSIRVLATRKPRYGDPPAFNIWLNHI
FT                   ATKTGISDYDKALTIKTLSEIASLIYKGYMEEARDRFLKEFYAPGHVPVLTSRGLANRR
FT                   GHTELSVALSLITGLTPSMVIAEMLDEGQSLSYEDAKRFATRNGLFFIDGVDIVAEAEK
FT                   RGFLND"
FT   gene            280491..280961
FT                   /locus_tag="Shell_0314"
FT   CDS_pept        280491..280961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0314"
FT                   /product="riboflavin synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="TIGRFAM: riboflavin synthase; KEGG: bba:Bd3037
FT                   riboflavin synthase beta chain; PFAM:
FT                   67-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31447"
FT                   /db_xref="GOA:D7DBA0"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR006399"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBA0"
FT                   /inference="protein motif:TFAM:TIGR01506"
FT                   /protein_id="ADI31447.1"
FT                   /translation="MIKIGVVDTTFSRVDMAKYAIEVIEENLPEAEIIRYTVPGIKDIP
FT                   VAARKLLIDEGCNAVLTLGWVGPGQVDKYSYLAMSVGLIMLQIMTGKHVIDVTVHEDEA
FT                   SDPDELYNIAVDRARKHALNLVMLVKYGREALTQYAGKGLRQGRPDAGPIKE"
FT   gene            280982..281434
FT                   /locus_tag="Shell_0315"
FT   CDS_pept        280982..281434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0315"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="TIGRFAM: 6,7-dimethyl-8-ribityllumazine synthase;
FT                   KEGG: predicted protein; K00794 riboflavin synthase beta
FT                   chain; PFAM: 67-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31448"
FT                   /db_xref="GOA:D7DBA1"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBA1"
FT                   /inference="protein motif:TFAM:TIGR00114"
FT                   /protein_id="ADI31448.1"
FT                   /translation="MARIGIVVSEFNYDITYLMLQKALSHAKFLGLEVTYVFKVPGTYE
FT                   IPFAVASLLKRNDVDGVVALGAVIKGATKHDELVAGQTARKLMDLMIQYGKPVGLGIIG
FT                   PGATRMQALERVEDYARRAVEAVAKMINRSRSLEEKKFTSETVFIE"
FT   gene            281487..282179
FT                   /locus_tag="Shell_0316"
FT   CDS_pept        281487..282179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0316"
FT                   /product="GTP cyclohydrolase IIa"
FT                   /EC_number="3.5.4.29"
FT                   /note="PFAM: GTP cyclohydrolase III"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31449"
FT                   /db_xref="GOA:D7DBA2"
FT                   /db_xref="InterPro:IPR007839"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBA2"
FT                   /inference="protein motif:PRIAM:3.5.4.29"
FT                   /protein_id="ADI31449.1"
FT                   /translation="MIRLLKYRKWTEELGYDREWIIQKKQARTYDILQTLFSKKNGFVV
FT                   PLRYDHYLALSNGIDKETHQEILTEIDPVTPYGVKIVSIAHKYPAIGQLIASRLLEEKP
FT                   GKIIYLDGVEDENVVVHIDFNSVTMYTEMTSIFESYMRILELYDIVTKYVFQLGGITSY
FT                   LGGDNMLAVVPENKLDELLELIPSYLKAGVGLSYVPRKALLLASKALTIIRSGKVDKRF
FT                   LILRDEDV"
FT   gene            complement(282154..283425)
FT                   /locus_tag="Shell_0317"
FT   CDS_pept        complement(282154..283425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0317"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31450"
FT                   /db_xref="GOA:D7DBA3"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBA3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31450.1"
FT                   /translation="MLINNADHRTSIFKNLISVIMIFMLIIMNSPIISFALYWNMEDVI
FT                   TLHIKLSLLDNKPLPNAEIIVKPTIYSTHEYTGKTNNDGVATITTEYNAITKTVYIKVY
FT                   YWIYGEIYSGKINVDNENITITLNYTIFKTSINIYNEYLEPASITYKLLYVFGNNQTML
FT                   LENNTATTQILINGVIDNHYLLLNNNTLQNYVLQLNTMEKHSITIRFNQEIIEEKKIIV
FT                   DTHNPIVSVERSTYSIRKINHEYFYKILLTINICDGVNTEDTRLYVKYYYPKEKEQEPF
FT                   KIYLAGFKTNGSTTISIYNVSSSGIINETNKTLILNITAVDPSGKSTTLFKTIYLSILT
FT                   KPNHTSTTTTTTTITTKYSIGKNTSTASNTLFSTNTSNLSTSYFNPPHSGGGEAEALAY
FT                   IYYLGPIISATLLLYEFIRLRLGE"
FT   gene            283649..283876
FT                   /locus_tag="Shell_0318"
FT   CDS_pept        283649..283876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0318"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein; KEGG:
FT                   Os10g0378300; hypothetical protein; K03926 periplasmic
FT                   divalent cation tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31451"
FT                   /db_xref="GOA:D7DBA4"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBA4"
FT                   /inference="protein motif:PFAM:PF03091"
FT                   /protein_id="ADI31451.1"
FT                   /translation="MIKGGWIIVFITASDPGEAERIAEGIVKEKLGACVNIVDKIHSIY
FT                   WWQGKIEKGDESLLIIKTRGSAYVGFGRPT"
FT   gene            284024..284167
FT                   /locus_tag="Shell_0319"
FT   CDS_pept        284024..284167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0319"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31452"
FT                   /db_xref="GOA:D7DBA5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBA5"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADI31452.1"
FT                   /translation="MYRVLPKMRMTIPKEVAEKMGLKVGDKLVVYFDNKKQRMVVEKWR
FT                   KG"
FT   gene            284164..285165
FT                   /locus_tag="Shell_0320"
FT   CDS_pept        284164..285165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0320"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31453"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBA6"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADI31453.1"
FT                   /translation="MTIRGRLILNSIVDKAWLLLLMRNFRDAVEYAHNLLRKNVSENDI
FT                   VKLLASRILSNAHYSYSALQRAKMYRQQPYLKLKKPQLFSIGKRNEKGNRNIRFLSTDR
FT                   VQIKIPSATGKHRWITAGVRFGRKYISTIKKLINNSIPYGAGVYINSGLELHVNVPLEL
FT                   YTEKLKVGNKNTKNDKGYIASFDFNSDRICMVIVSREGRILDVKNKHFPEVTSPGYSGR
FT                   KARDKRMKALAELVDYAYHHNVTDYVAEILSRPKKKSRSKTGNRKSSRWALREFVTHLK
FT                   TLVARYGGKPHFINPAYTSVDAIPLSKQLGLDIHTTSAYLLAIRFIKGYEEL"
FT   gene            285195..285338
FT                   /pseudo
FT                   /locus_tag="Shell_0321"
FT   gene            complement(285354..285662)
FT                   /locus_tag="Shell_0322"
FT   CDS_pept        complement(285354..285662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31454"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBA7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31454.1"
FT                   /translation="MKNTDTHKSIEQYIVCRHDCPPRVLEALAMNGFAVKAWTENCEKE
FT                   RFKKIVVELFNGTRINSECRFDEEIKQSLRIINIYIGFARRNKAWEKLEIIEGEEEK"
FT   gene            complement(285670..286014)
FT                   /locus_tag="Shell_0323"
FT   CDS_pept        complement(285670..286014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31455"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBA8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31455.1"
FT                   /translation="MTTARRMFIINKLLRKKNVVGKVAARYVAAGFNVTINPPLKGVDF
FT                   TASKHGVRYAGIVLWQKKKIGEEIISKAKEIADKYKVKPIIILYGSGPVIDKDTVAKAG
FT                   EAGIIIKRIR"
FT   gene            286158..286796
FT                   /locus_tag="Shell_0324"
FT   CDS_pept        286158..286796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0324"
FT                   /product="Conserved protein implicated in secretion"
FT                   /note="KEGG: hypothetical protein; K12193 charged
FT                   multivesicular body protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31456"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBA9"
FT                   /inference="protein motif:COG:COG5491"
FT                   /protein_id="ADI31456.1"
FT                   /translation="MSTPWFGNNQQTIGDKIKSLFKNDREPIEKKAIIAHYRVKTALGR
FT                   INSYLSKIEQRDRELFQNVVESLVKRDERKAKMYAKEVSELRKVAKQLITVQYALEHAS
FT                   LKLETFLVFGGAMRELQPIVSVMKEAVGIVRSLAPDVWIDLQVALRELETSMNTGVADI
FT                   SAEIDVGLDNDARKIFEEAKTVAEQKLKEHYAELPKILTEAEKSGEASP"
FT   gene            complement(286845..287369)
FT                   /locus_tag="Shell_0325"
FT   CDS_pept        complement(286845..287369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31457"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBB0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31457.1"
FT                   /translation="MVKDTLLEARNVVRSAMELIDKRILSRSTELKIRIVSVASRIYEI
FT                   LSFIDAILGGTIDRIGEKDTGKIVSIGTYFYLAPYKDSFTLIRSKPYTITISYKKGEGK
FT                   LYVKTKNFRAIITPTTMELTKLSLKINVDLRSAEDISKKLPEIKYLLRSLGRIVEYQLL
FT                   PVAEKRLGLKL"
FT   gene            complement(287429..288457)
FT                   /locus_tag="Shell_0326"
FT   CDS_pept        complement(287429..288457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0326"
FT                   /product="AIR synthase related protein"
FT                   /note="PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: aeh:Mlg_2063 AIR
FT                   synthase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31458"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBB1"
FT                   /inference="protein motif:PFAM:PF00586"
FT                   /protein_id="ADI31458.1"
FT                   /translation="MKLNKAYYEGGKPSWEFLSGLLSMFPIRDPDLIVGPSIGEDAAII
FT                   RFKDGFLIVHSDPITAATRRIGWLAVHIAANDIAVRGAKPRWLLPVILMPPKHSLEQIE
FT                   SIFRDIGSAAQSLDATVIGGHTEFTPGIPRPIISMTAIGYSMDKVVLTRNARPGDKIFV
FT                   IGRVGGEGASVIAWDFEDLLLRKGISRDIIATAKEYFTDISIVDKALLIRDYANSMHDP
FT                   TEGGLLQGLREVAKASNTRIILDADKVVLDPIVKEITSTLELDPLKILSSGALIASVPG
FT                   ENTRQVEDLLKEKGYKYSIAGYISEHVRGGELIVNQNGKTIRIIEDVVDEIYKLWSRDS
FT                   YI"
FT   gene            complement(288423..288731)
FT                   /locus_tag="Shell_0327"
FT   CDS_pept        complement(288423..288731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0327"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31459"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31459.1"
FT                   /translation="MVFCLRVCDICEHKPAKYKCPVCGRHVCEDDFDFEKGVCKVCSET
FT                   LCEICGKYPSIGYCMVCGRNGCEDCLIQVTPVSYVCKDCIRQGRYRLETKQSLLRRR"
FT   gene            288757..288987
FT                   /locus_tag="Shell_0328"
FT   CDS_pept        288757..288987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31460"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBB3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31460.1"
FT                   /translation="MNIILLLNKLLYKAAYNMAYPGQVLAMLYRIKIARCIDALVKIDS
FT                   ENELGRILEEIRKLCPIDSKMYLHIVREENL"
FT   gene            complement(288991..289839)
FT                   /locus_tag="Shell_0329"
FT   CDS_pept        complement(288991..289839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0329"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="PFAM: TatD-related deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31461"
FT                   /db_xref="GOA:D7DBB4"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR011589"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBB4"
FT                   /inference="protein motif:PFAM:PF01026"
FT                   /protein_id="ADI31461.1"
FT                   /translation="MFADAHSHTNPISGLGARRIAPKFKNSGGWFIALVSLPPYYYRFN
FT                   DLTLDNYAKTIELLINEAKIMRSYGLKVRLLAGFHPAEVDEHFRRGRDLKSIVEFADEV
FT                   FKLIIDYHRKGVIDGIGEVGRQHYSTAPSRIVASELILIKAMEYARDYDMIMHLHLEQG
FT                   GWVTVESIDRLRKITGIGSEKVFLHHVDYDTSVWGEKYGYWYTVPAKKRILSKVLSEER
FT                   NHALVESDFIDDPKRPGVSSYPWDIPKRIKELLSEGVISVENVYKSMIDNIVKAYRVEP
FT                   P"
FT   gene            289998..290717
FT                   /locus_tag="Shell_0330"
FT   CDS_pept        289998..290717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0330"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31462"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBB5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31462.1"
FT                   /translation="MAGRKKYKVLTIRVDEETYRKLLVKAEEEGYSMISDYILALINQA
FT                   VRAETTPSYDKLKTRIKRYVQDVVNEQLMVVENLKRQVIELYDKIDGLEKRINDIDKKI
FT                   QEISSKITRPTPIRRERPVRQRKTGIERLREEKVLFESRLTGLRYRDKFFSYLERMGAI
FT                   VIPLRGERVAVDAEFWENFKKKLFEEIDTDNEEIIKEKLDPLEYQLFLRLRSEPLIFFD
FT                   AKTKKWKPISESRIFSQ"
FT   gene            290790..291863
FT                   /locus_tag="Shell_0331"
FT   CDS_pept        290790..291863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5915 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31463"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBB6"
FT                   /inference="similar to AA sequence:KEGG:MXAN_5915"
FT                   /protein_id="ADI31463.1"
FT                   /translation="MVKSKSISELLKYVDILGDTSAIVVGESFAIDGFAEKPVRVISHA
FT                   HYDHIVGLKDSILYSKQIVATPPTHDLILTLGYVGGRELRMLYKNKMVRLNYYEEYTYG
FT                   GEKLVLIPSHHIIGSAQVLIEIGDLRIGYTGDFKLGENTKIMDGLDILIIESTYGDPSY
FT                   RRPFKNEVEDLLVDIVLDGLEMYGKVVIFGYHGKIQEAMQILRRNGVKEPFLMPKRIYE
FT                   VTRIAEKYGYEIGGYYNMRSLKGREILKSNRYILFEHFNKANHRRLGNNTLYIVLSGWE
FT                   FNGPIKKIDRYTWLVALSDHADFDELIEYVEKAEPRLVIVDGSRQGSAEALANELNKRG
FT                   WKSLVLPGPRVLPSSII"
FT   gene            complement(291976..292662)
FT                   /locus_tag="Shell_0332"
FT   CDS_pept        complement(291976..292662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31464"
FT                   /db_xref="GOA:D7DBB7"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBB7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31464.1"
FT                   /translation="MQSTFLLLSTLFLVPLALISGIVSSFNNLQTITGEIRYLVIVDGA
FT                   RSDNPLDMVSFQCVISLKIENNKVESISASNFIINNIPDSVSYRFQEFVKTVIIKWFNS
FT                   FSLFDKVESNYKTYISVNGKIIEAYIVSGNNGVEYREANTGLYVGGDKELQISIETISP
FT                   MHPKYRYNLSIISYLFSIKPEQIINSLAVIEPPTSIVRNTTIIIAATITVLAVRTLMKW
FT                   KDYSIM"
FT   gene            complement(292664..293194)
FT                   /locus_tag="Shell_0333"
FT   CDS_pept        complement(292664..293194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0333"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: afr:AFE_0492 inorganic pyrophosphatase; PFAM:
FT                   Inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31465"
FT                   /db_xref="GOA:D7DBB8"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBB8"
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /protein_id="ADI31465.1"
FT                   /translation="MIYDKIGPGKNAPNEVHVVIEIPMGSSIKYEIDKETSLVFVDRIL
FT                   FTSMHYPFNYGFIPGTLEEDEDPVDVLVLGYEPLYPGVIIKARPIGVLETEDEKGRDAK
FT                   IVAVPVEKIDPRFENIKDINDLPENFKERIAHFFEHYKELEKGKWVKVIGWKSREDALN
FT                   RIREAIERYRESM"
FT   gene            complement(293307..293729)
FT                   /locus_tag="Shell_0334"
FT   CDS_pept        complement(293307..293729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: PPL; periplakin; K10386 periplakin"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31466"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBB9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31466.1"
FT                   /translation="MSAVVREFSSFADLIKSIDEELNMLKQQLADYLRRLEDIRAKSEQ
FT                   ERRLRELLKNLTGEEQTSKGKVVDLKDVKLYVNPDAQQEATVMEEIIDRINKTIQSLQS
FT                   IRKSLEPLSNVEVEAKIVVVYKEGAPSSIILKLSST"
FT   gene            complement(293788..294678)
FT                   /locus_tag="Shell_0335"
FT   CDS_pept        complement(293788..294678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0335"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   KEGG: xfm:Xfasm12_2118 succinyl-CoA synthetase subunit
FT                   alpha; PFAM: CoA-binding domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31467"
FT                   /db_xref="GOA:D7DBC0"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBC0"
FT                   /inference="protein motif:TFAM:TIGR01019"
FT                   /protein_id="ADI31467.1"
FT                   /translation="MGVLVNKNTRVLVQGITGREGSFHTKLMLEYGTKIVAGVTPGKGG
FT                   MNVYGVPVYDTVYEAIENIGEIDASIIFVPAKFASDAVFEAIDADIKTIVVITEGIPVH
FT                   EELEFVKYAKKKNTVIIGPNTPGIMVPGETKIGIMPAHVFKPGKIGLISRSGTLTYEIA
FT                   RELGKKGYGISTVIGLGGDPVTGLNFVEAYELFIKDPSTRAVVLIGEIGGDAEERFAKY
FT                   YAELSMKKPVVAYVAGKTAPPGKRMGHAGAIISMGVGDYQSKKQALLKANIPVAEKPSD
FT                   IPILLGSVFEKLYNN"
FT   gene            complement(294685..295824)
FT                   /locus_tag="Shell_0336"
FT   CDS_pept        complement(294685..295824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0336"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, beta subunit;
FT                   KEGG: nis:NIS_0838 succinyl-CoA synthase, beta subunit;
FT                   PFAM: ATP-grasp domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31468"
FT                   /db_xref="GOA:D7DBC1"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBC1"
FT                   /inference="protein motif:TFAM:TIGR01016"
FT                   /protein_id="ADI31468.1"
FT                   /translation="MKLYEFEAKEIARNNGVPVPRGNIAKTPEEARTVAEKIGGEVVLK
FT                   AQVLVGRRGLAGGVLFASNPLEAEKVARELFNKRIRGEKAQLILVEEKICIDKEYYLSL
FT                   TIDRSNREIVYLVSPLGGVEIEELVKKYPNKLLRIRVDPMIGYKSYMSRLAAKFLGLPK
FT                   ELWPSIHKIMNSMYNIMKNYDADLVEFNPLVKTCSNEIVAVDAKITIDDNSLYRHPEFA
FT                   EKYGRELSKLEAIAKKLGFSYVELDGDVGIMCNGAGLTMATMDMVAYYGGRPANFLDIG
FT                   GGASRERVKEAAKLLLKHDKVKVLLINIFGGITRCDEVARGIIEAVEETGVKKPIVIRL
FT                   LGTNEEIGRRLLEEKGYSVFSEADDAVKKAVEIAKNLPR"
FT   gene            complement(295858..296253)
FT                   /locus_tag="Shell_0337"
FT   CDS_pept        complement(295858..296253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0337"
FT                   /product="metallopeptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31469"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBC2"
FT                   /inference="protein motif:COG:COG4900"
FT                   /protein_id="ADI31469.1"
FT                   /translation="MIKYVEAEDVCCLINVIVHFLRDYFKHIDLERIKCFRSTGSKSYA
FT                   YARIHGLPRIWIKALGVKPMYIVEVLSERYDPLDIEDKIQVLIHELLHIPYGFTGGLRP
FT                   HGKYVNKKIIHKLYGLFVERGGLEFFT"
FT   gene            complement(296255..296569)
FT                   /locus_tag="Shell_0338"
FT   CDS_pept        complement(296255..296569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31470"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31470.1"
FT                   /translation="MDLRVYRNEDVEEIIAAIPVNHYHVRFLIKFRDQTILLQEATVAA
FT                   LLRAYAYTALHPFRKGIILRRKALGKKEKKPGYATHQLIEVADSEDEAVKIITDIIGEK
FT                   "
FT   gene            complement(296663..297640)
FT                   /locus_tag="Shell_0339"
FT   CDS_pept        complement(296663..297640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0339"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31471"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBC4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31471.1"
FT                   /translation="MKTDHSYRSTDLLNKIIGIMRILIQYNYGKDYEIHRSSREAIVQI
FT                   HNSKLLEQLGHRNITRNNRIIFEYPLIIRHQLCILPRLIDLESIEKEKEIIGSAILYKL
FT                   FPRNHGSNYIIIIDDLSRSYILTSYYLSLYIEKYNNRKVDPIIFYKYLREILKLRKIMD
FT                   EAKNLERSLKIRFDPELHEKYIVTINQLDNITPIIARLWEENKELFDRVNSIVEEEKLF
FT                   EEEIMEKTNRLVKKEIELIDNYLVEKINEIVSSIIDDGYVALKFSDIIRSAKKQSLNID
FT                   EKLSIIQRYLEKNYGCRDILLVDGEEYYVLIKVSKIPIIPINIF"
FT   gene            complement(297630..298583)
FT                   /locus_tag="Shell_0340"
FT   CDS_pept        complement(297630..298583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0340"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: similar to
FT                   ribokinase; K00852 ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31472"
FT                   /db_xref="GOA:D7DBC5"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBC5"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADI31472.1"
FT                   /translation="MPKTSSKPIHVAVGNLNIDITMYVSRLPMPDESVFAEEIMMGPGG
FT                   SASNYSIAVTYYGHTAYLIASTSLNQLVDSILEKLNSIGVITRFVKRVEENPGIVNVVV
FT                   IPGGEKIMVKYRGANELLSPNDVPKQLLEEATIVHMASIPPTIASEIAMRATGLGALVS
FT                   YDPGAYALYDEEKIVSILDNINILFLNRAEARSITGGKIENLLKYGTDLIVIKKGPGGA
FT                   YVLQQGGTVYHGVSKPIRPPIDSTGAGDAFDAFFNAAYIDYKDLGKALSYALAAGALKV
FT                   MCRGSILCWDKHLFSKQLNETIVEEIKEPENWILED"
FT   gene            complement(298589..299458)
FT                   /locus_tag="Shell_0341"
FT   CDS_pept        complement(298589..299458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0341"
FT                   /product="uridine phosphorylase"
FT                   /note="KEGG: ara:Arad_9873 uridine phosphorylase; TIGRFAM:
FT                   uridine phosphorylase; PFAM: purine or other phosphorylase
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31473"
FT                   /db_xref="GOA:D7DBC6"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBC6"
FT                   /inference="protein motif:TFAM:TIGR01718"
FT                   /protein_id="ADI31473.1"
FT                   /translation="MERGKKLSSASAPVDESGRVYHLGVKPGDVSKYVLLPGDPGRVKR
FT                   IASFWDKAWRVAEHREYLTFSGRYKGVFISATSTGIGSPSTAIAVEELARVGSTTFIRV
FT                   GTTGALNRNIGVGDIIISTGAVRFEGTSKQYVFPEYPAVASFDVTLALITAAEELGVKY
FT                   HVGLTVSSDSFYVGQERPGYKGYLPPFQRGLIDFLRSVNVLNFEMEAAAIFTLANIYGL
FT                   RAGSVCAAIANRETEEFIVDAGVDDAIKVANEAVKILSEWDQIVGETGSKTVSAKTILE
FT                   WYKRIGRL"
FT   gene            complement(299744..300040)
FT                   /locus_tag="Shell_0342"
FT   CDS_pept        complement(299744..300040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31474"
FT                   /db_xref="InterPro:IPR025354"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31474.1"
FT                   /translation="MNNYSREEFFWKIHISKHAMRRMKERKICLEDIYDTINDPYMYFY
FT                   DSWNDLYLAVNIRGYAVVYAFHGNILEIVTVLGRREFKALLSKYGSSRYKHLS"
FT   gene            complement(300037..300552)
FT                   /locus_tag="Shell_0343"
FT   CDS_pept        complement(300037..300552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0343"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="KEGG: dal:Dalk_3260 phosphodiesterase, MJ0936
FT                   family; TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31475"
FT                   /db_xref="GOA:D7DBC8"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBC8"
FT                   /inference="protein motif:TFAM:TIGR00040"
FT                   /protein_id="ADI31475.1"
FT                   /translation="MLIGVMSDSHDNIYAVDKALNKFIEHRVEAIIHLGDIISPFIVRR
FT                   MKNILKDIKVYGVLGNNDGDIYLLNKLFTANNWELYSGPSIINLGNRNFVIMHGYDGIE
FT                   HTEKLAKTLLSIEGVDAVLFGHTHRVLVQYINNKLLLNPGETCGYLTGKSTIALLDTKD
FT                   LSVEVLEI"
FT   gene            complement(300598..301161)
FT                   /locus_tag="Shell_0344"
FT   CDS_pept        complement(300598..301161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0344"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; CS; KEGG:
FT                   gur:Gura_2833 heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31476"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBC9"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ADI31476.1"
FT                   /translation="MSRWDDYNKRRRRGFFDVFDEIFRQMEEEMNRLLREFETMEPREF
FT                   IEEAGPTRRFGPYVYGFRITIGPDGKPMIEEFGNVKKVEGKRMISEEREPLVDVFEQDD
FT                   SITVIAELPGVEKDKIKLEVSDDRRKLIISASDTNRKYYKEVELPAEVDPGSAKATYKN
FT                   GVLEVTLKKIKRSEKKKGYEVKIE"
FT   gene            301274..301951
FT                   /locus_tag="Shell_0345"
FT   CDS_pept        301274..301951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0345"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: dps:DP2785 riboflavin biosynthesis protein
FT                   (RibD)"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31477"
FT                   /db_xref="GOA:D7DBD0"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBD0"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ADI31477.1"
FT                   /translation="MERPYILVFSTISVDGGLSVKGKRYRLSSDRDIYRLHYFRSIVDA
FT                   VMVGANTVIIDDPLLTVRLPDYKGKQPYRVVVDGKLRVMPELRVFDTRHAPTILITSIN
FT                   NKDREMIRRFLSRGVRILFVDTDKYDPSKIDLRKAVEKLYREFSIRKILVEGGGQLIAS
FT                   LFKNRLIDELYLSISPLIIGLNKTSLIEDFLDSPVRLVLKNIFVDHITGEIIVNYKPFY
FT                   EDH"
FT   gene            302033..302449
FT                   /locus_tag="Shell_0346"
FT   CDS_pept        302033..302449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0346"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   dol:Dole_0570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31478"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBD1"
FT                   /inference="protein motif:PFAM:PF01894"
FT                   /protein_id="ADI31478.1"
FT                   /translation="MKVYTREIVLSTNKKFQLVDITYEVEKIVEDSGVKNGIALVFAPH
FT                   ATAAIIANEHESGLMEDIITKIKELTEPGSSKWKHNLIDDNAHAHLGSALIGADRVFPV
FT                   INGRLVRGTWQNIFLVEMDGPRSRRHVIVTVIGE"
FT   gene            302454..303629
FT                   /locus_tag="Shell_0347"
FT   CDS_pept        302454..303629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0347"
FT                   /product="Quinolinate phosphoribosyl transferase"
FT                   /note="PFAM: Quinolinate phosphoribosyl transferase; KEGG:
FT                   ilo:IL0103 nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31479"
FT                   /db_xref="GOA:D7DBD2"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR035809"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBD2"
FT                   /inference="protein motif:PFAM:PF01729"
FT                   /protein_id="ADI31479.1"
FT                   /translation="MRLYVASEKEIVDGAVSDIYFVRTTRILREKGVRRKVRMEYHTTS
FT                   LPKGYEWAVYAGLEEILYVLKDKPVTVYSLPEGTLFKPGEPLLIIEGYYDDIAVYETAL
FT                   LGIMRHYTSIATKAARMKRLAIDKTLLFFGLRALHPALAPMADRAAYIGGLDAVSGAIS
FT                   EKYLGLKPVGTMPHALIIVFGDQVKAWKAFDEVVEEGVPRIMLVDTFCDERMESLLAAK
FT                   VLGKKLYGVRLDTPSSRRGNMRKIVEEVRWTLDIHGYKHVKIIVSGGIGEKELVELRDI
FT                   VDSFGIGTSISFPKSIDISADIVEIYDNGEWIPVSKRGKLPGAKQLYRRRPGLNDYIGL
FT                   LNRSTPPSPDYKPLLKKYIDNGELIEKLPSIQEIRNYVLEQLREVPEPEPV"
FT   gene            complement(303633..304304)
FT                   /locus_tag="Shell_0348"
FT   CDS_pept        complement(303633..304304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0348"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31480"
FT                   /db_xref="GOA:D7DBD3"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBD3"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ADI31480.1"
FT                   /translation="MVGEKLIIFDIDGVLIDSYSGIPIFYEKILPNMLGIDRDYSRFLL
FT                   YMEYIYDQAGTLREEWWPKYFSINEETLTYLLARYWEIRTETSELEPGTRSVLKNLKSR
FT                   GWIIGSVSYRDDIYGLKLWRIKNAGLHDLFEDIIVVGEDAPSRIEGIRILARKYKPKTI
FT                   VYVDDKIQNLYRILGKLENIVLVWYRYSWINGVLEKHVSSSRIHVIHNMYELEKLLDEI
FT                   S"
FT   gene            304394..304645
FT                   /locus_tag="Shell_0349"
FT   CDS_pept        304394..304645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0349"
FT                   /product="MoaD family protein"
FT                   /note="TIGRFAM: MoaD family protein; PFAM: thiamineS
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31481"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010038"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBD4"
FT                   /inference="protein motif:TFAM:TIGR01687"
FT                   /protein_id="ADI31481.1"
FT                   /translation="MVTVKLRAFSIFSDIFGKEEILNIDGKISVKDLVDYLKKNNKLFE
FT                   ETIKQIPVIILVNGKSVNEEYVLKENDEVAIIPPASGG"
FT   gene            304648..305112
FT                   /locus_tag="Shell_0350"
FT   CDS_pept        304648..305112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0350"
FT                   /product="molybdopterin biosynthesis MoaE protein"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE protein; KEGG:
FT                   psp:PSPPH_1124 molybdopterin converting factor, subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31482"
FT                   /db_xref="GOA:D7DBD5"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBD5"
FT                   /inference="protein motif:PFAM:PF02391"
FT                   /protein_id="ADI31482.1"
FT                   /translation="MPYIRVGLTESIIDVDSIVNELIEHTKGLGGAIVSFIGYVKGIVD
FT                   DHRVYELQYTAYQPYTEEVMEKIVVEEVRRNNLLGAIVIHRIGNLKPGDPTIYIFVSAN
FT                   TRKEAFKGASEILERIKHEAPIFKLEKRDDGEYWVIGDGRRVARRRAKNT"
FT   gene            305072..306076
FT                   /locus_tag="Shell_0351"
FT   CDS_pept        305072..306076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31483"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBD6"
FT                   /inference="protein motif:COG:COG1665"
FT                   /protein_id="ADI31483.1"
FT                   /translation="MVEELLGEEPRILDHFYLLLKNYCYAVVVGNMHSNSFLIGYVKYC
FT                   LGKNSIWRDNLGYYDRIVNYYSPRKVYDSTPWKTYIPCYDSIIPVIPRSKIIKIFNPIN
FT                   RLNEIISMPKDQLEQLTANLSSILYSSIHRYALGVTGSLLIKIHNPVISDIDMIVYGWR
FT                   ESLNIIEFINENKDVFPGFTGERLKRWIYSNAESSGLPPSKVEKLYRRWRRGSFMGRDY
FT                   SIIYNNGVFKHLDTCKAWRTIGHITVKAYLMGGLDALNYPSRSSIDQYYLVKNREELRS
FT                   DIEYVLSFDALYIGKLFDGGWVIISGLLQHEPLEDRYRILVGGREYKGYIEPL"
FT   gene            306091..306687
FT                   /locus_tag="Shell_0352"
FT   CDS_pept        306091..306687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0352"
FT                   /product="Icc protein-like phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31484"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBD7"
FT                   /inference="protein motif:COG:COG2129"
FT                   /protein_id="ADI31484.1"
FT                   /translation="MVSKILAISNINGREDLIPYIVYLASTEKIDIVLFCGNIVSPLII
FT                   EEISKRIKGRVLGVAGNLDDPSVIKMLKSINGFIDGRIVEVYGLNIGGVGFNPELSVNR
FT                   LLRENKDLDILVSFYPSIKASINNGVGMIDRLIKTLHPQIVVFGRGYRKCLVNDKYVFP
FT                   GEGHKGFYALIKLGKKDYEAKIYCRHFQDVVMDNY"
FT   gene            306733..307608
FT                   /locus_tag="Shell_0353"
FT   CDS_pept        306733..307608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0353"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31485"
FT                   /db_xref="GOA:D7DBD8"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBD8"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADI31485.1"
FT                   /translation="MFDWGTYNALNTLTKAAVLGMRLTEIPPRDFSRKTRGLDYFEAYR
FT                   DFATKAFTTIIAHGPYYNLVSDHPEIAKRILKAMRAAVKKAAMAGASIFNVHLGWRVFM
FT                   DDRDLEAVADMVKKMLEVAPENMYISLETTYTRRQIGSLDEIKSIIEMVGSDRVIPSVQ
FT                   LENMFMYETRIDQHGNFIQADKQVNKDFWLNVLRKTLEISKGYLSLRFSQVTGVYFGRR
FT                   LLKKRTPLGKGYPSIQPLAEALAQFMVREVRDKGLSLKMHIIYTGPPETKYEDTIDLYA
FT                   SIMRRVVQYI"
FT   gene            307668..309506
FT                   /locus_tag="Shell_0354"
FT   CDS_pept        307668..309506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0354"
FT                   /product="type III restriction protein res subunit"
FT                   /note="KEGG: DEAD box helicase Mph1; K10896 fanconi anemia
FT                   group M protein; PFAM: type III restriction protein res
FT                   subunit; DEAD/DEAH box helicase domain protein; helicase
FT                   domain protein; SMART: DEAD-like helicase; helicase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31486"
FT                   /db_xref="GOA:D7DBD9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBD9"
FT                   /inference="protein motif:PFAM:PF04851"
FT                   /protein_id="ADI31486.1"
FT                   /translation="MTGFNLKVKPRDYQIEAAKWALSNKRSTIVMPTGSGKTLIAVLFS
FT                   KELLEKKLANKVLVLEPTRILVEQTARYFEKTLGIKALSIHGRYPPEKRIELWRKAKVA
FT                   AATPETALNDVKQVIQNNYDAIIVDECHHTTGKDAYAKFMKITEKVFKWRLGLSAHIPK
FT                   SRRHEIERYIGKIRIWSWADERIRKYVPDWIGEIYEAELNDAEKQVLEGLEEARLEYTG
FT                   KYRGLVNLAIRWFVRDGALALRESLEKETLLASILSHIKPMLENRKVRPLHKLDALKRV
FT                   LNDHEGFNKAIIFVDRVIVAEYLGKKLMHYNPVIIVGKTRLGTDLREVLRRAHSSETRI
FT                   VVSTSAGEEGIDLPEADLLIIWSNVASPLRFIQRHGRILRLTGKKGLKFVAYIATPDTP
FT                   DMDSLLDALELARKNGVDVPIDEETLEALWRRTTRNRILSVLSGKPMPLEWISEITGMP
FT                   RDLVEKAIKRLEDKGLVIYIYTFLGKTYALVDDLFILKENFEEYLTPDTSLAARIKPYV
FT                   ENKELRMVSGTYNQVITKLIRLLRRYGEFTRISASLQIPLETGALQQIMLHYTFRINNE
FT                   EVLEAIIRNIYSASKYYRFITKTPWPSNNAEHYGES"
FT   gene            309507..310121
FT                   /locus_tag="Shell_0355"
FT   CDS_pept        309507..310121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31487"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBE0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31487.1"
FT                   /translation="MVSIISIEDFMKLIRNYKSISMIIGSGLEYSLGLSGFYDYKPARQ
FT                   KIINENIIVNCSSLNKKVLEIINLFTETLKSDRFQSAIITSPYCLYRCMCDQEKLLKDK
FT                   IIPLIGCFKCSDCCIDEPEYKGLGEKVNYKSLARSIVEVTSAEALIITGFTPTLSPANM
FT                   LPLIAKFGKPKIFLVDTFNNPYISIVDYYVETPSYKLFKVL"
FT   gene            310484..311869
FT                   /locus_tag="Shell_0356"
FT   CDS_pept        310484..311869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0356"
FT                   /product="acetyl coenzyme A synthetase (ADP forming), alpha
FT                   domain protein"
FT                   /note="KEGG: rme:Rmet_4362 CoA-binding; TIGRFAM: acetyl
FT                   coenzyme A synthetase (ADP forming), alpha domain protein;
FT                   PFAM: CoA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31488"
FT                   /db_xref="GOA:D7DBE1"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR014089"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBE1"
FT                   /inference="protein motif:TFAM:TIGR02717"
FT                   /protein_id="ADI31488.1"
FT                   /translation="MKPLFEPRSIAVIGASRSPGKIGHTIMKNIIEYGYKGRIYPINPK
FT                   ADKILGYKAYKSVLEVPDEIDMAIIVVPEQIVLKVAEECGRKGVKVLVVIASGFSEVGN
FT                   IEAERKLVEIARRYGMRVLGPNIFGITYTPAKLNATFGPKDVLEGPIAFITQSGALGIA
FT                   LMGWTIMEEIGISALVSMGNMADIDVIDVSKYLAGDPNTRVITIYLEGLKPGTGRKFIE
FT                   EMKKVTAKKPVIVIKAGRSKRGAAAAASHTGSLAGSDNLYQAAFKQAGIIRAYTTEEMF
FT                   DWARAFASQPLPRGEETIIITNGGGVGVLATDAAEEHNVKLLDPSPELKEKFKKAMPWF
FT                   GSARNPVDLTGQAIVENYVEALRIAFESGEIHNIILLYCRTAILDPRDLAKAVIKLYEE
FT                   YKETNYSKPLVAGFVGGEDVREAVRLLNKNGIPAYPSAERAVASIAKMIWYMRYLNKIK
FT                   SRK"
FT   gene            complement(311885..312223)
FT                   /locus_tag="Shell_0357"
FT   CDS_pept        complement(311885..312223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0357"
FT                   /product="t-RNA-binding domain protein"
FT                   /note="PFAM: t-RNA-binding domain protein; KEGG:
FT                   nam:NAMH_1243 methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31489"
FT                   /db_xref="GOA:D7DBE2"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBE2"
FT                   /inference="protein motif:PFAM:PF01588"
FT                   /protein_id="ADI31489.1"
FT                   /translation="MSSSEVSYEEFMRIDLRVGFVKEAEKVKGSKKLLKLKVDLGKLGE
FT                   RQIIAGLGAWYSPDDLIGKYIVVVANLKPKRIFGLVSQGMLLAADSEDGVPVLLSVEKP
FT                   VKPGTRIR"
FT   gene            312363..313490
FT                   /locus_tag="Shell_0358"
FT   CDS_pept        312363..313490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0358"
FT                   /product="Thiamine biosynthesis protein-like protein"
FT                   /note="PFAM: Thiamine biosynthesis protein-like; Queuosine
FT                   synthesis-like; KEGG: bpn:BPEN_246 thiamine biosynthesis
FT                   protein ThiI"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31490"
FT                   /db_xref="GOA:D7DBE3"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBE3"
FT                   /inference="protein motif:PFAM:PF02568"
FT                   /protein_id="ADI31490.1"
FT                   /translation="MVRYGSVTTRFMISRLRDSIVKVLNRNNYRYENVDVVGGSRVIVS
FT                   GLNSSVAEEVADKLAKIFGVSSTSPAIMVDYDLSVIIDALLEMIAHDRPKSIRLKVMGG
FT                   PGYNRLFLEKLLASIIINEAKTYIDLRSPDKEYIIDIRQGKTFIINKIYRGVGGLPYGV
FT                   EGCLVVLLSGGVDSSLAAWYALKRGTRIIPVFIDLGKYWSEQARKRFYESISLIYEWVP
FT                   WDKIKFYIVRGAEKIVESANIPARLRCLLCKANMYRIASIIADKEKCLGIVTGEAVGQV
FT                   ASQTLRNLYILSRLSPKPVYRPVAFMDKLEIIEQARKLGFHILSRDVGTCLLKPPHPET
FT                   SASEKDYYILKKVLQDTMDTAVKLVEQANIKYYPT"
FT   gene            complement(313471..314181)
FT                   /locus_tag="Shell_0359"
FT   CDS_pept        complement(313471..314181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0359"
FT                   /product="Protein of unknown function DUF207"
FT                   /note="PFAM: Protein of unknown function DUF207; KEGG:
FT                   Tyw3; tRNA-yW synthesizing protein 3 homolog (S.
FT                   cerevisiae)"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31491"
FT                   /db_xref="GOA:D7DBE4"
FT                   /db_xref="InterPro:IPR003827"
FT                   /db_xref="InterPro:IPR022908"
FT                   /db_xref="InterPro:IPR036602"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBE4"
FT                   /inference="protein motif:PFAM:PF02676"
FT                   /protein_id="ADI31491.1"
FT                   /translation="MSFKINLSAWQRRKTEFWNRLWEDLEIGYLDEDLIGILLILNSDK
FT                   NIYTLSSCSGRITISDSTYPWSREESSVVFKKHIPITINEILDILKKPVVRRLWLNSTG
FT                   PILHLSTNSLEYADKILSLARKAGLKHSGIISMNPDKGYIIELTSGVKVSHLLRSRGIL
FT                   LAEEDSLREIVDVANEVLLEGKKVLIRMFKVFRSELPWNPDNNIVSDLKNRGINIDKYD
FT                   PYKIYGKIIRLDNT"
FT   gene            314277..315107
FT                   /locus_tag="Shell_0360"
FT   CDS_pept        314277..315107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0360"
FT                   /product="Protein of unknown function DUF516"
FT                   /note="PFAM: Protein of unknown function DUF516; KEGG:
FT                   SORBIDRAFT_10g023620; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31492"
FT                   /db_xref="GOA:D7DBE5"
FT                   /db_xref="InterPro:IPR007508"
FT                   /db_xref="InterPro:IPR018033"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBE5"
FT                   /inference="protein motif:PFAM:PF04414"
FT                   /protein_id="ADI31492.1"
FT                   /translation="MEIYGIAYSINDPAGSGMAEYIVKYYGLGKSDVCRDAITCYVGDN
FT                   FVLAGFREDVIYFDFLDDRLPENVSRYIILSRHSSAKKVRSYTVHHTGNFGPEAPYGGR
FT                   PRILSIANPIVSHKLLINLKMLAEEYGRINEYEVSYEATHHGPTDVRKPLNFIEIGSSI
FT                   DEWKDPVNHEIAALAVIKFLENPRHKCVPVTGIGGGHYPRKHTKMAFEKNYCYGHIMAK
FT                   YALQHLSPEILEEMIVKSDPVPQRIVVEKKGTRREHRRVIEQYVLGKGIILEYI"
FT   gene            complement(315109..316173)
FT                   /locus_tag="Shell_0361"
FT   CDS_pept        complement(315109..316173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31493"
FT                   /db_xref="InterPro:IPR011635"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBE6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31493.1"
FT                   /translation="MVEGKLLKFVEKKFSGDIIYTSAIPNTRIGGLIPSRQTIPLSLVH
FT                   PKNAELEYALLDIGVLVPSQHINWRVKLNGISVTKEFKPHIMSPAGNLYFAKLVYDVTS
FT                   IIKTPEGLRRRRANITFKLEGGDHIIIEQLAILALYSSSEAESTLTYYSGALSLKPGES
FT                   SSLKINYGGGNGKLRTTIYMPSTIAKGEILLNNNSLLNIENVQGMDEHIMELKSIPRQN
FT                   IITFKHLETNTTYFPKEMRISNILLYNTEYVKPELSMEETNIPEIIHKEQELEITVSNK
FT                   GESTPDKAMIVVMSLGNVVARRKIKKLDPGEKTTEKIKIKLQPGEYELVFRIIWGKLSK
FT                   TWYKDIRYRVKVVE"
FT   gene            complement(316309..316548)
FT                   /locus_tag="Shell_0362"
FT   CDS_pept        complement(316309..316548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31494"
FT                   /db_xref="GOA:D7DBE7"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBE7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31494.1"
FT                   /translation="MASRDIVAAIAGFVLIGFSMYVFLISLQLMINRDVPSSLLAALIG
FT                   FVALSGGVSLIRTWSLARYVEKAEKKEESARGSP"
FT   gene            complement(316551..317825)
FT                   /locus_tag="Shell_0363"
FT   CDS_pept        complement(316551..317825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0363"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: srz-91; Serpentine Receptor, class Z"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31495"
FT                   /db_xref="GOA:D7DBE8"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBE8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31495.1"
FT                   /translation="MRNNISRGLIENFSKKLGDPVFQSRLSIVVVLLLNLYFLNIFVNL
FT                   SYIIRAGIIQIILFILILLWFIGIAARKIYLSSLYYVLVSGLLVYEKAVGPSIFTTAVI
FT                   ASIWLLLSYTFTDVLLKRSIRRRHLLSIKALLLSITIIGGIYATYLFISYIVASTVIYV
FT                   YSYIESVTPSIFQTFYEVFISTHVGSLILFSLIIFVIYYIIDNYITGLISDTLFLNIDF
FT                   AINRIRTLVYSQAHDLLKGKDPFQKIYVRSILFVVFFYIYGLLYPVISIIRDIIQITWL
FT                   SYIVWITVWFVVSTIIYRILRDRFLNILIPRQSLGFKALKITNNIRSRRGLYLSLTLLF
FT                   LYIGFIYVVDRNPSVIMDLLFTSLGLKPPTYMGGRSQATIIISRLYTVFCNNLIYYIEN
FT                   YFYSIEEAYSMLSKLLRELIVFLWG"
FT   gene            complement(317822..319165)
FT                   /locus_tag="Shell_0364"
FT   CDS_pept        complement(317822..319165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0364"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   hch:HCH_00266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31496"
FT                   /db_xref="GOA:D7DBE9"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBE9"
FT                   /inference="protein motif:PFAM:PF01882"
FT                   /protein_id="ADI31496.1"
FT                   /translation="MRESGISATSNLYVLLGLAGLLASLDIWLNKTITAYTLYIVGIVI
FT                   AIILGTRLLVELSARQIYRLEIRREFLDPLVEKNKVRIKIVFRNNSSIPLFYVSINDLY
FT                   PSLFKLVEGSNTVSATLLPYSGFEYEYIVETILGKHTFHGLEIIVKDPLGLFNYKTTID
FT                   PEKKIVNIKPKPAAFPRRVLSVWTRRGLGMGKARMRGLGQEFYELREYFPGDDYRLIDW
FT                   KSFARLRKLYVKEFEREANLSVVFVIDVSPDSMRGIIGSTPLEDMARISAGLSKILLER
FT                   GDWVGVVIRGGKIVRSGYGRGRIHFTRIINSLSNIDWDIKEPGISLGELILNEASKLPR
FT                   RAKTLFFVLTTLLNKYEADELINASSKLRSLGHLVFIVQLIPELYEEKYLKGLESAIFS
FT                   GLTLDRYVLSKQIREYLGRRGVKVVSVGPDDIYVMIYRLIESYRAVIV"
FT   gene            complement(319165..320145)
FT                   /locus_tag="Shell_0365"
FT   CDS_pept        complement(319165..320145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0365"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="KEGG: bba:Bd2797 putative Mg chelatase; PFAM: ATPase
FT                   associated with various cellular activities AAA_3; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31497"
FT                   /db_xref="GOA:D7DBF0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBF0"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ADI31497.1"
FT                   /translation="MQNTLSNKDFDPGFASSISRKIIENASKIIVGKKDVIRYILISIY
FT                   AGGHILLEGVPGVAKTLIAKTIARSLSLSYSRIQATPDLLPSDIIGTLVFDPRVNDFRP
FT                   RKGPIFANIVLFDEINRASPRTQSALLEAMQEKQVTIEGITFKLPEPFIVIATMNPIEM
FT                   EGTFPLPEAQLDRFLLKIIVSYPDTDEEKEVLRRIHYIEKFNILPVTSAEEILAIKAML
FT                   PKVNVSEELIDYIVSIVKKTREHPHVRLGGSPRASISLLLTSKANALIDGRSYVIPDDI
FT                   KFVAKPVLRHRIILRPEAEFEGITTDQIIEDILNETPVPTPGVQS"
FT   gene            complement(320123..321571)
FT                   /locus_tag="Shell_0366"
FT   CDS_pept        complement(320123..321571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31498"
FT                   /db_xref="GOA:D7DBF1"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBF1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31498.1"
FT                   /translation="MRLKLFIIFLLIIGLLAAFYIPGITIKVEASLYVGTCSPLSLDWS
FT                   GTSILVQRLRNEGYNVVIVNKNSELINELNRGGLLLIIGPDKSLSANNTDLDLIEKYFL
FT                   NGKINIAVLDENITSNNLLHRFHIHVNGTMILDMMLTQDPQYPLTIIKSLDNETKYVRL
FT                   NWASFIVNDTRINRPVNIISITYGILDLNSNGKIDDEEIAYFIKTREKTGFNEWITGII
FT                   IVYPRSKLFVMSDSSPLINTELGRNLTVSEIIYNYVKQLSDEKSKRVIIPNYLYRRKNI
FT                   QQTIPFHSSILFLLFANFLEQADQFIDAIISQYSILGPIALLLTILGLIGLMKSVFDLK
FT                   ELVEFKHEKVREYKIIIETIITANLLDKKFLKNREKILIKRYWKLLRQAFIIVKNFDLE
FT                   EVLASKSYDKLRLLGIVDRKKFKKLLWLYRVYLKINGKSRLPIVFNWRRTMIKYVLLVE
FT                   DLLNLLGYTILKKEGFRDAKYLIK"
FT   gene            complement(321577..322692)
FT                   /locus_tag="Shell_0367"
FT   CDS_pept        complement(321577..322692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0367"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31499"
FT                   /db_xref="GOA:D7DBF2"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBF2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31499.1"
FT                   /translation="MKNIMLAKIVLKKIYVWFFLTVFVFMTLISMITYGEVQRNDKYVP
FT                   TDTYPMDENKLLQQLSLLKQLNDSIVNSYVSEINQSIQNGDYEKAYMLLNELNNYLKTK
FT                   YNSDLNSNMDLAKTISLIDSIQNLTENGVEVNLTSYLYELGKLLNNESLIQDAYKLRHG
FT                   EVVNNDLISELINYMKQYKGGVRETSGSETINPRNPLEGGVQENPLVNIFNFPNIGVSN
FT                   ASVFNPPTIPLFNFSKYFNIILYIIMGSLVLAVLYYVRQPIRQYLDILFTKIDEKKMII
FT                   KARIGKTTLSRAIMLYYKWYSIAKRHGYRRKPSETPRELLSKIRIEDLRTIGEHVTRIY
FT                   EENVYGKYEVDEALISKVERELRSLFISKNR"
FT   gene            322772..323575
FT                   /locus_tag="Shell_0368"
FT   CDS_pept        322772..323575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0368"
FT                   /product="photosystem I assembly BtpA"
FT                   /note="PFAM: photosystem I assembly BtpA; KEGG:
FT                   ara:Arad_9790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31500"
FT                   /db_xref="GOA:D7DBF3"
FT                   /db_xref="InterPro:IPR005137"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBF3"
FT                   /inference="protein motif:PFAM:PF03437"
FT                   /protein_id="ADI31500.1"
FT                   /translation="MKLYGMVHLPPLPNSPQYRGEKIDVILKYAINEAEKLVKAGFDGV
FT                   VIENYMDYPFPIYEKDPVKLRLIEYIARKIREKFPNVLVGLNILRNSGLESLDIACRNN
FT                   LDFIRVNVYMETVLAPEGIIKPLAYELIKYKERNGCNVKVYADVNVKHSQPLMSYTMVL
FT                   RNMCSRGLVDGVIVSGEHTGYPTPVSRVYVAKKICSDKEIIVGSGVNHQNIGLYIGLAD
FT                   AVIVGTSIKNEGITSNPVNIQKAMSLVKRVRRIKNRLFKGLGINT"
FT   gene            complement(323558..324181)
FT                   /locus_tag="Shell_0369"
FT   CDS_pept        complement(323558..324181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31501"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBF4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31501.1"
FT                   /translation="MSDCNKVLEKIIQWLKQGSPNSKKLIDFPWEVEEENGVYKAVNPM
FT                   FPISIYISCDDTIGVVRLQTPLDFETITMSKNERLLLYYKLLRLSVAPMIKYVLVGDEA
FT                   VPTVIVDLSVKTLGKNEFNDALAMHLAAVNAIIRELGLEEKYKSKLFLELLSLVKKHLE
FT                   EGWGRNKLVEYLTKYARIKKEQAEEIIDALLKEVTGRTESSIYA"
FT   gene            complement(324266..324853)
FT                   /locus_tag="Shell_0370"
FT   CDS_pept        complement(324266..324853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0370"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   dol:Dole_0539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31502"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBF5"
FT                   /inference="protein motif:PFAM:PF03692"
FT                   /protein_id="ADI31502.1"
FT                   /translation="MTRYYVLKPGDKIRYTCRRSGRCCSTGPNVALTAYDICRIARYMN
FT                   VDWRELRGKYIIAIIADMIAIPALRGMGDGKCAFLQYKNGVPTCKIYPARPLRCRLYPF
FT                   IPASPSNPNKIYVDPYCPGVGVGEEIEPPWKLLHQYYWEVTKHYSRIYELVFKEGYEPL
FT                   DALEKLIDEVCREAENNPEWTSYEYLDKLYNR"
FT   gene            complement(324859..325071)
FT                   /locus_tag="Shell_0371"
FT   CDS_pept        complement(324859..325071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31503"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBF6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31503.1"
FT                   /translation="MFKLLTRKKKKKENSKVNTDENKAPPGVLLDDDEELTIIYSEEQY
FT                   GSRCSTCPFRKFCPFRKLRERKRER"
FT   gene            complement(325142..330250)
FT                   /locus_tag="Shell_0372"
FT   CDS_pept        complement(325142..330250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0372"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: pat:Patl_3544 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31504"
FT                   /db_xref="GOA:D7DBF7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBF7"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADI31504.1"
FT                   /translation="MRFNMGLASTILIITIIIHSIISPTYYIVDNGKPIHKKYLSQAWF
FT                   TLKDKDHDYISDNLLNTRNKIVRAIIVFSSRISSYHLKLIQTLDGKIIGGPWRNVLNGV
FT                   AVEIPHYNLQLLREALLRTDYDLDGYSDLLFIEEDTRMNPDLHYATRQINIRPRIWDLG
FT                   FKGKYVTVALIDTGIDVDAPGINRSRIIYSYDATLTGIDPLRDELDHGTHVASVIIGEN
FT                   NGSNGNLVLSKGPFTITNTGSQDHITFLLTPIPVYSMGELKVKIYIAPYNNNYTYEAYL
FT                   YKTIKYENVLDAIKNNDLEYVCSNSSWETKYISDLDGNQYINAETLLSYNITSKDDYGN
FT                   YVIGLRHNSSNIYLWFNASVPSIISRDKYPISSGVAPEANIAIFRVADDQGNIYLSYVL
FT                   NALDEISRVKNIYNISVISISLSSTKYSASLEEATKNLAEQGIVIVASTGNYGVREDLN
FT                   ATSIYPAGFPWVISVGAVNGFNNITYYTTIGGYSSIYKVIKPDLLAPGGDYDHTIYTSD
FT                   SNNEGDTPFYSIIDKNLSIIDIEPSDYESSMGTSISAPIVAGVAAILISILKSTNISPN
FT                   LSLWDRVVEDYGIGATMLIKEIMESSCYETYPLIRSLNGTLSYDLVRNQYSPSLDHGLK
FT                   DIHEGFGVLDAYAAVNYTFMLKDYLLYLYGLRNNYTYDYSLNKDNAPLIIYNGDLRNGT
FT                   IYNATKYFMKNSLLFGNSVAGIPAHFERFILTINGHKFLSRFGVRITSYSNDPLRTDLD
FT                   AYIYLLNTSGWDPQLLNHTVSTYGVLDKITYITPPPTENMDNHIYYVAVKRATEDSAGG
FT                   RFRLVIGPGLTAKFVNGSYIWINTTAASPPDTAKYGLIIIYYRNSSGVYLYKHVITTTT
FT                   NLNGLAHISKYINIINGNYSLQDDWQWYVSIIYTRDPRDTYNITQENIVEGPVYVRVSI
FT                   GEPVKLYLSGPHMVMDNESFRITATLYLNDTRQPLSNKQILFYESSNRVNWTYIGSSIT
FT                   DMNGSAEIVLAKPMNEIYYYIAVYPGDNMSQYTLTNNILQVRVYGVTALYINVSKTSLY
FT                   TVEPVNISIKLFLKNSGIPVSGEKIDVWLSSDNGVTWHKIFSGITDKNGFLNYTHIFLS
FT                   SNEYLLKANYSGSFKHLLFDAESNIVSLSIHRAPTRIEAETNSTNVKVYESAIFTISLN
FT                   HTCNKIVRPVRNAKVYLEIYNKTRNSWIITNMSTTDSNGYASITYRFTRNGTYIFRARY
FT                   EGNTTFIGAATNTITIHVKKLNTQFIIINKPISGATEEPIHILAKLVDEKHRPIRKSIV
FT                   WLEKLVNDTWIKISYNTTDENGIVYLSWIEDKSGIFNYRLLYGGKDYVYNPSIRNFSLT
FT                   IASTSTKLSLVSSSKEILVNTTFTLAAYLYSNKKSIRQATVYLQKRINNTWITIGKNIT
FT                   DTTGHTIFKIYEPYAGNYTYRAVYYGNLTFSGTISNYVEIRIVPVETFLLLEAPKSAYV
FT                   KERILVKARLNTLFPFIKPLSQQPVELWINTKGADWSKLAVNYTDQYGIAYFYISFNNS
FT                   GTYLIKAVYSAPGKNNYRQIYSDTHSDTIILKVLKIQTFLLLFTNTTRAGKHETILLAA
FT                   RLVDYKLLPIVNATIDFYIINNSRLVYIGTAITNSTGYAVLAITYNFSDTTTFISVFNG
FT                   TNKYQKTLSNYVKVKYIEENINSNNIFDQNNLLLLLLLVILPITIFFYVYIRKKTSKGK
FT                   DLGNN"
FT   gene            complement(330334..331854)
FT                   /locus_tag="Shell_0373"
FT   CDS_pept        complement(330334..331854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0373"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="KEGG: dat:HRM2_35850 hypothetical protein; TIGRFAM:
FT                   carbohydrate kinase, YjeF related protein; PFAM:
FT                   YjeF-family domain protein; protein of unknown function
FT                   UPF0031"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31505"
FT                   /db_xref="GOA:D7DBF8"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBF8"
FT                   /inference="protein motif:TFAM:TIGR00196"
FT                   /protein_id="ADI31505.1"
FT                   /translation="MVITVNEMRILETNTIGLGIPLIRLMEAAGKSIADTIASRISPKE
FT                   AGKIVVLMGRGGNGGDSLVASRYLASKGYHVEIVPAYRPELINHPDTRENYQIVSRMNS
FT                   ITIHKPGIIDPIRDAGVIIDGLLGTGVKGALREPIKTLVEEANKTSARLKVSIDTPTGL
FT                   NPDTGEIHGVAFKADITVTFHDVKLGLLKKPDITGEIVVANIGIPPDAQTYVGPGDVLY
FT                   SIPPRKPDTHKGMAGKIVVIGGSYRFTGAPALSGLAALEAGSDLAFIIVPSSVRKIIAS
FT                   YSPELITLPYNGEYLEPRHVETILEYIVEVRPHVVVIGPGLGRLPETLEAAKKIIDELL
FT                   KKNISLVIDADALRTIEYGKTMFNGKTVLTPHRGEFKAFTNITLSGKPAEDVEKVVEAA
FT                   KTLNATILLKAPIDIISNGHQTKLNKTGNPYMSIGGTGDVLTGIVASMLAKTNNPFISA
FT                   CIGAYINGLVGDHLLHQKKTVSPMNIIKALNYTINNPLEVHMKTYLNK"
FT   gene            complement(331985..332632)
FT                   /locus_tag="Shell_0374"
FT   CDS_pept        complement(331985..332632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31506"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBF9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31506.1"
FT                   /translation="MNNWIYEQLLSCPAIMVLGHINIAHCEGIVLFPILNYRVNILSSM
FT                   DEKRIINNIPKQLLPSKIEKICMNIAEGKIYSSDFLTDAIIKTMFYGGFNIFINRSSKA
FT                   VPVVLDLINTSMYKFFLETNNVMIKGSPPTRLESWVVFATALRTGDIELFREACIDLKG
FT                   EIAGEKCMINTPHGRLVVIPKDRFNRNELDKRKYIEIVPDNSPIRHVVKIDQ"
FT   gene            332785..334026
FT                   /locus_tag="Shell_0375"
FT   CDS_pept        332785..334026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31507"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBG0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31507.1"
FT                   /translation="MISNTHLKIAGLILIVLVALSMISLPASLVLAGDGQGKEENGGLD
FT                   ENIRVRFNLTMSFNEALDLAYTVRNVSYPMFEWGQTQNITLANTLLRHGDSLLEKAINM
FT                   SSTNETKATLLALAAAAIYSRAPIVAYPVLGKTIRNNLGENRSLTNNTVLAVIGKAEEI
FT                   KNLISEAKNISAQFNITPLRIVDFLVADATGKINTSLQLLEMNYTGRALSYAVRAYHEY
FT                   IRAYTWIIKSVFIEKLNLGETPRITEKIIIKKVDKKVMEKLIEHMPRWIKAKIMEKLRK
FT                   GLIKDIVDLRRHVRLIVKIYKERLENITADQITKTAVLVIIAGSKLPGKQGQAIKEWRS
FT                   KHRLYNPRSLYNYTLSIVKKVQNETNATGIDLLEQVLHQLEINIENDTGIHVDLTQVLN
FT                   IIITIHVIRHGPRH"
FT   gene            334093..334917
FT                   /locus_tag="Shell_0376"
FT   CDS_pept        334093..334917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0376"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31508"
FT                   /db_xref="GOA:D7DBG1"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBG1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31508.1"
FT                   /translation="MSRSAVFALLIIVFLVLGTSIYCNAQNMDDNVRGISIKIVYDPYM
FT                   DYGIVTYEILFSKTMENTIIDLPLVADNINDIINVTGSEGQVFPYTYINENTSISILIN
FT                   NTDTLIITYEISGFMDEVGIDAYSGILDLSLLSGMNVSVEIVLPSVFNVSTEPRSSYVE
FT                   YDDGLTIIKINNPGIYAVYVEKSLLATTTTISPPTTTTTPAPLSSITSTTTTTTTTPST
FT                   TTVSSHSMTTTTSPTSPNTVSPRETVGLSPFMIGLIIAVIVIIVLIALLLRR"
FT   gene            334936..336087
FT                   /locus_tag="Shell_0377"
FT   CDS_pept        334936..336087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0377"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31509"
FT                   /db_xref="GOA:D7DBG2"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBG2"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADI31509.1"
FT                   /translation="MYKHIVLILFAIKQFFSILNILWLESVMGIIVLLKNVSLISLLLI
FT                   AALFIVLNGMFPACSQESLYVSRIDISVFYDVIDDLGFVEENISLNTVPTQLIEIDAPL
FT                   IPPPIGGRGYYELINISYSSNHKNVYLSYSVDRKNNMVKLVFNATRTVLVRYAIYNYLD
FT                   EIGVGVYGLLIDLSNFSIANSIHARIRIIGNYTVDVYPSLNTGITKSKDVVAIELNDPQ
FT                   PYTIIIVEEGFGGITTLPTTSPTTNVETGAQQQPLAVLETNNLILILVVAVIALLLLYL
FT                   FWRRHGADVEVETIAPGDILSDETVRDIIVTVGDSGGEIKQSDLVRATGRPKSTISRKV
FT                   KRLAEEGYTEIIRKGKYNIVKLTPQGKEIYEKIKSGEKSKNER"
FT   gene            336077..336613
FT                   /locus_tag="Shell_0378"
FT   CDS_pept        336077..336613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31510"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBG3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31510.1"
FT                   /translation="MSDNITPLYAHGYFYMHETGLVDQVIVFDYWDPDRYYWKLLSKPV
FT                   KLEEERVFLANNMQYYLDQEKVLINDVEAPPKVVDVEIGVRGKPEIAYIVFLIEFKGEL
FT                   KEGLNVYENIYEEEEAEYEYIVYWFMPENARIVKAELGVPYRVEPNGRVLFFKVKPGTR
FT                   VGGREAIYFEIKQDV"
FT   gene            336850..337980
FT                   /locus_tag="Shell_0379"
FT   CDS_pept        336850..337980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0379"
FT                   /product="DNA primase, large subunit"
FT                   /note="PFAM: DNA primase, large subunit; KEGG: Prim2; DNA
FT                   primase, p58 subunit; K02685 DNA primase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31511"
FT                   /db_xref="GOA:D7DBG4"
FT                   /db_xref="InterPro:IPR007238"
FT                   /db_xref="InterPro:IPR023642"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBG4"
FT                   /inference="protein motif:PFAM:PF04104"
FT                   /protein_id="ADI31511.1"
FT                   /translation="MSITIIDYRNYPFLADLNDTLNYRWPGLKLSDIISLPNNYPRLRA
FT                   KVLLKSIVSKRKILPPKSTSEDEVLAFYTLISIVKLLKDKKLASMVAVTYAKYAYRYLQ
FT                   NEPINTLLKISSILGLKAEIPRNYPLIPIDVKRNKPIFEPRPIGIDLKDYLKLTAKRLA
FT                   RDPKYSLVNQIVYRGKVFLNKKVFSRILEEAIYYKILSIIENIEVKENKFQELLEEAKK
FT                   VLDEVGWLQKRMLDIEVEKNTEGVIDFEAFPPCMKLLLNRLRSGENLGHHERFTIAAFL
FT                   ARIGMDVDSMLEFFKNAPDYNEKIARYQLEHIAGLRGSRKKYLPYSCESMKALNLCPIS
FT                   GQCKGGKNPLAVYKYNVRMKYLKKTSKETRTKQASR"
FT   gene            337984..338589
FT                   /locus_tag="Shell_0380"
FT   CDS_pept        337984..338589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31512"
FT                   /db_xref="GOA:D7DBG5"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBG5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31512.1"
FT                   /translation="MVVSNNNDKTKVHEYVSAIFSAPFIALYILLRLTIDKTIDDLVTF
FT                   TILSIGLVIIPLVFPLFIAFRQGYEWDYPIRSTRIVPFSIVTIFYFITLGLTIYFRCSN
FT                   EIIFLALSYSMNGLVSLLISLKYKVSIHLVGIAGPMTYFYLLGYWIDAFILCLIAFITA
FT                   YSRFYLRRHTMPQLVMGVIIGIIFTYISYLIVYYYNSV"
FT   gene            complement(338716..339948)
FT                   /locus_tag="Shell_0381"
FT   CDS_pept        complement(338716..339948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31513"
FT                   /db_xref="GOA:D7DBG6"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBG6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31513.1"
FT                   /translation="MASVLKGSSKKTSWLIIFLVILFNIISPSIVFGNKSLYAQPINYS
FT                   KESGSNNFKVSGLYIAMYTLEASGIYASKYMLQKSLSGTIRLSIAYEIAINVTFHPNSE
FT                   IYDYEYKLTSFIVSGNNVKKSIIEAINKSMDKLVNKTFRESSNSVDPMIKLKLKNFSAT
FT                   LTKTGRNGDVTGITIFDDVYCYEIKYYYLGSLENTSYMDTVSMYREIITSIPLYYYEIT
FT                   YNRHNLGYIREKILIINNGLGQGLSKIIITNSTFFTYGKTGSIGKIGFIGLNTSYTNIQ
FT                   MDVSVINETIQLNITSYAPYRVLLLLDSKTDIKYSNIDLVKYNASTIVLYVSGIFDKPQ
FT                   NVRIKLRGSPIKLHETNDLIGLKGLTVEERGVLSLSDAIFVIIFDISLILILIEIIRIA
FT                   YRKFNQILVTD"
FT   gene            complement(340255..341652)
FT                   /locus_tag="Shell_0382"
FT   CDS_pept        complement(340255..341652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0382"
FT                   /product="Fmu (Sun) domain protein"
FT                   /note="PFAM: Fmu (Sun) domain protein; KEGG: geo:Geob_1091
FT                   sun protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31514"
FT                   /db_xref="GOA:D7DBG7"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBG7"
FT                   /inference="protein motif:PFAM:PF01189"
FT                   /protein_id="ADI31514.1"
FT                   /translation="MVKLLSRYPEHSGRKIRMINYRRIVYAVIESVGLGFRVKPVQEAI
FT                   RRVVSRYRISDPIVDRRVSGIVYSIYRYQGLLDKIVSDIAGFNPSSLPYNVRAALLVAA
FT                   YVSQLDEKMSSSMKKTFKRYILRYLGEKIGDKAVREKIIGKTKLLFSNKWSPNSGEDRV
FT                   LLKYRVSPELYRALARALRELGENLDDFLNSTMKIKYRVFRVNSLKAKPEAVYKFLKDS
FT                   GYRVELGKYSRRAIRVYGSIGKEIIRFIETGILVPQDESSIVAVEILDPKPGSRIGDLC
FT                   AAPGGKTTYLAEYTGLKSRIYSFEIYRDRARRLRLMLERTGTDKSVQVFVRDAREAPSI
FT                   LGNNSMDYVLLDPPCSSTGALARNPDVRWRYSVEDAEKLVVLQRELLDSAWKILRKDGK
FT                   LLYTVCSVLPWEGEHIIKDFLEKHWDAMLISLNKPFKQSPILPGTMRAWPHIHGTIGFY
FT                   YALLKKK"
FT   gene            341784..342959
FT                   /locus_tag="Shell_0383"
FT   CDS_pept        341784..342959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0383"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_01902 mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31515"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31515.1"
FT                   /translation="MVLKIGFASTYPPTHCGVGEYSRMLITALKSLYPRIKAYVFADKR
FT                   GGDRRFDELAKVDIIPSFEHEETSYRKLLDNLALIDGVDILHVQHEYGIFGKHNGLIEA
FT                   VEEAREERLVGKIVITMHTVDHPYTLRSGTLEFQRQLNKFDAIIVHSALQEFELIHQGI
FT                   DPSKIIRIPHGTLLNPYLWLPRFKLAESLGISEEQLVGFLIGVPGFLRKDKGLDILVKA
FT                   VKPLLHDGDYTVIVAGETRDPVLRKELEEMVRNGPNMIFIERWLTSEEILKLVALVDAV
FT                   VLPYRDRPASYSVSGILHLSMGGLKPIIGTRAPRLIELYHHAPRMTVPVRNPDELTRKI
FT                   RWLRINYDVAIAYMSSLYSYAVRTEWRRTARRHLSLYAYVLGIEKSILSGE"
FT   gene            342991..343557
FT                   /locus_tag="Shell_0384"
FT   CDS_pept        342991..343557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0384"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="KEGG: sfu:Sfum_0998 appr-1-p processing
FT                   domain-containing protein; PFAM: Appr-1-p processing domain
FT                   protein; SMART: Appr-1-p processing domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31516"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBG9"
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /protein_id="ADI31516.1"
FT                   /translation="MEICKINYRGVVVRGVRGDITELDVEAIVNPANSSMLMGGGLAGV
FT                   LKRKGGEIIENEAKKFAPVPVGKAVVTIAGALRAKYIIHAPTMEKPAMRIKPENAYKAT
FT                   FAALTKAFDLSLNKIAIPGMGTGVGGLSPSDAGKAMAKAIKEFLDLVPSGIKEILIVDL
FT                   NPEIPRMVCRSLEEMIGETGNEYQS"
FT   gene            343541..343807
FT                   /locus_tag="Shell_0385"
FT   CDS_pept        343541..343807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0385"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein; KEGG: bmi:BMEA_A0733
FT                   molybdopterin converting factor, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31517"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBH0"
FT                   /inference="protein motif:PFAM:PF02597"
FT                   /protein_id="ADI31517.1"
FT                   /translation="MNIKVKYMLWLREKIGLEQEEFKLDRETSLEDLVRIIILKHREAE
FT                   KYLSNIFSDDNPFIILVNGIPRKKNYILKDNDLVTILPPVSGG"
FT   gene            343924..344628
FT                   /locus_tag="Shell_0386"
FT   CDS_pept        343924..344628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0386"
FT                   /product="5 10-methylenetetrahydrofolate reductase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31518"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBH1"
FT                   /inference="protein motif:COG:COG0685"
FT                   /protein_id="ADI31518.1"
FT                   /translation="MDYLFELVPWKKKLIDEIVDLARDFFSIYTIPEGPGGYPGIYSLA
FT                   TAMYLKYKYDLKAFPHIRLYDINRLALLSIANAVEAYGLEGLVLLRGDKPWKGIIVEDI
FT                   GTEEALSLLKKKGYRFEKGAIISLRYPYEKIIERIRLGADFYHVINYDASKDQLLTRIY
FT                   REANRLGVKIYVFILLGIGGNKGLFAKLNQPYISPGELKDRLEALRNMCDGVVLSTPLE
FT                   PLEGIRVFMKYA"
FT   gene            complement(344629..345615)
FT                   /locus_tag="Shell_0387"
FT   CDS_pept        complement(344629..345615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0387"
FT                   /product="Methionine synthase II
FT                   (cobalamin-independent)-like protein"
FT                   /note="KEGG: cha:CHAB381_1170
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31519"
FT                   /db_xref="GOA:D7DBH2"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBH2"
FT                   /inference="protein motif:COG:COG0620"
FT                   /protein_id="ADI31519.1"
FT                   /translation="MHGKIRTSHVGSFPLPHSLDNLRIIIDDLWRIKLDAPPYPQLRSF
FT                   IDIYLKPLADNGLLKEKNGFYFLDSKESLKDIEYFEPSIYEAEYMIKYLREKKYGFKWL
FT                   RAPVTGAYTLASRIYLSKDISVGLHGTLLREKTLLEYIIEYVRKHIMYMGKLGYNILFI
FT                   DEPVLGIIVGKRRILFGFSKEEIIETINHIFSQAPGEHGIHVCGRISPKLFETLAITDK
FT                   LDILNFEFHDNSMNIESINPNLLEENNKVLAPGIASAKKPVIESYEELSDLLRKIGEKT
FT                   MWRIDLVSADCGFGGLATESGDPYEAYHIGLEKLHRIINIVKLLQKN"
FT   gene            345711..346382
FT                   /locus_tag="Shell_0388"
FT   CDS_pept        345711..346382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0388"
FT                   /product="Methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /note="KEGG: geo:Geob_2541 cobalamin B12-binding domain
FT                   protein; PFAM: cobalamin B12-binding domain protein;
FT                   Methionine synthase B12-binding module cap domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31520"
FT                   /db_xref="GOA:D7DBH3"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBH3"
FT                   /inference="protein motif:PRIAM:2.1.1.13"
FT                   /protein_id="ADI31520.1"
FT                   /translation="MGVEELFDKLYSCLVDLDKDCVLDNVQKLLEKGVKAIDIVLGPMS
FT                   KAMEKIGRLYEEGEYFIAELMEAADIFKEAMKILEPRLRMEAKSMASGRKRLKIILATV
FT                   KGDIHDIGKTLVGVMLQAAGHEVIDLGVDVDAEKIIDAIKKYKPQIIGLSALLSTTARY
FT                   MRVIIEELEKNGLRGKVKVLVGGAATTSEFAEKIGAGGWAPNAIEAVKLVNKIAEEYRD
FT                   A"
FT   gene            346375..348012
FT                   /locus_tag="Shell_0389"
FT   CDS_pept        346375..348012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0389"
FT                   /product="Uncharacterized metal-binding protein-like
FT                   protein"
FT                   /note="KEGG: geo:Geob_1421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31521"
FT                   /db_xref="GOA:D7DBH4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR027980"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041414"
FT                   /db_xref="InterPro:IPR042259"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBH4"
FT                   /inference="protein motif:COG:COG3894"
FT                   /protein_id="ADI31521.1"
FT                   /translation="MHRKCEEVTINVVGYGKISACKGDNLGEILASKGIMPLPCGGRGL
FT                   CGLCRVKVYGETNPITGNEIVHGLSGNERLACQVIVMGDLVVEAEKPRIISVPRYSINI
FT                   PLKQINPVINIVRLEKPPYINKDYVVINGLKPSNYILLEDMILSTTGDPEKILLVDLGT
FT                   TKIAYQAVTMSGEVIGEKIHINPLNIYGSDIITRITHILEKPESLREMGSSLRKEVNNV
FT                   AEEYNIGSIFIAGNSVMEHLYLGLPIETLAEKPFQPLFHGPFLTYTYDKPTILAPLIAG
FT                   YVGGDAYSELIASLKLALKKPYMIIDLGTNTEVLLVTNDKIYATSTPAGPAFEGHLARG
FT                   STIVYGGIYKVEIIGSRNSEPVFNYKYIHKPYGLLGTGIISLVAELLRHKYIDERGRFL
FT                   KGYKRINNVKTYVIDKDQQIFFTQKDLREFQKAYAAVKTAWIILCRRAGIKCEDLEHVI
FT                   IAGSFGSNIESRDLIDLGLVPVVENSRLVYAGNMVLSGLKIMMLDSSMFKIYRSILEKI
FT                   AHINLAEDKDYMKTWIKCLNIVSLRGSK"
FT   gene            complement(347992..348927)
FT                   /locus_tag="Shell_0390"
FT   CDS_pept        complement(347992..348927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0390"
FT                   /product="Tetrahydromethanopterin S-methyltransferase"
FT                   /EC_number="2.1.1.86"
FT                   /note="PFAM: Tetrahydromethanopterin S-methyltransferase
FT                   MtrH subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31522"
FT                   /db_xref="GOA:D7DBH5"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR023467"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBH5"
FT                   /inference="protein motif:PRIAM:2.1.1.86"
FT                   /protein_id="ADI31522.1"
FT                   /translation="MYDEWTKQLEYRIGKYIIGGKPGKNPVWLIGSIFYLGDKLLLSEK
FT                   GDFDKEKAKAKIEEAISIAENYSLVFGLDVVFPSIESIDKILPFISEYDIPIFLDSPDP
FT                   VIRAKSYLAAKELGINDRVIANGIFIDSPEEEINALRDSGIKTSVIMAFDPRNPLKSIS
FT                   PLERLRLLETTLLSLARKSGVEQVIVDAIVIDPASIAFSAETIFEAKKRFGYPSGCAPA
FT                   NALGPVSKSKTSIGEMYGVHGGVAVYLRIHGADYIMYGPVSRIKYIAPAIAMADSLLGY
FT                   SLRRKGERISSIHPIKKILRKVQKLFATSK"
FT   gene            complement(349186..350532)
FT                   /locus_tag="Shell_0391"
FT   CDS_pept        complement(349186..350532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0391"
FT                   /product="MATE efflux family protein"
FT                   /note="KEGG: sun:SUN_0162 sodium-driven multidrug efflux
FT                   pump protein; TIGRFAM: MATE efflux family protein; PFAM:
FT                   multi antimicrobial extrusion protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31523"
FT                   /db_xref="GOA:D7DBH6"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBH6"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ADI31523.1"
FT                   /translation="MSISIPLPRFFDRKLLSRVVNISLPMIISELSNSIYSLTDTYFVK
FT                   GLGTVALAGVGLGSYLSWLFFVVLSLFYNGVLIYVAQAYGAGKLVYARRGLSEAVVYGA
FT                   IIVFAISVLGYYYGGYILMLQAGGTGPVWEVAKAYFSVRVLGLPISLIAWSMDAGLRAI
FT                   GATKQSMYVNLYSVGLNIVLDPLFIYGYAGFPRLGVVGAALATVISIALMMPLEYYYLA
FT                   KHELAPNRIYKPKIVFKIMNLGLPVMIERLIFAGGNNIYISLISRCGEEALAAHQIGVR
FT                   IESLIYMPGFAFSMAASALVGQEIGAENISGGRRIGWETIKLGVLFITLTGVAVAATSY
FT                   YITMPFATDPIVHKLASIYLIIAGLSELGLGLAMVIGGAIRGAGDTRTPLIINAGSLYL
FT                   FRIIPAMILVNYLGVIGAWLAMFIDVYIRGIIFLIIFTKYFEKLARKIV"
FT   gene            350679..352625
FT                   /locus_tag="Shell_0392"
FT   CDS_pept        350679..352625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0392"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; peptidase S15; Acetyl xylan esterase; KEGG:
FT                   swp:swp_1880 peptidase S9, prolyl oligopeptidase active
FT                   site region:WD40-like beta propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31524"
FT                   /db_xref="GOA:D7DBH7"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBH7"
FT                   /inference="protein motif:PFAM:PF00326"
FT                   /protein_id="ADI31524.1"
FT                   /translation="MNKPEDLAHLKIVSSPIITVNGDKVFFTLTSINMDKDRYETNIWV
FT                   YDLSTNNYAPLTKGPMDQSPEPDRRGEKIAFISRRDAESEKDRGNGIYILDLKYSREPR
FT                   LVAWFKGGVRGVKWSPDGKYLLAIINEGEPEEDVKHIDDMPIWFNGVGFVYNMSSHLII
FT                   LDPDSGEYEKITSGKIFVRSASWSNNGRYIAYILSKDRVNPYLSELHIYDLVEKKDRVL
FT                   LENITTYFTPTWSPDDKYIALIFHRRERGFSTHYKVYLINPDTGEEKCITCGLDRNVLN
FT                   TLNSDVRAPSNTRELYWDKDYNLYFLVSEKGITHLMAYNPISDQFIEVYGREGFVVDDY
FT                   SVSLNGKIALLGMTPYEPRELYLYEKDSLRKLTFFNKFYLSRIELGKVEKFVFKASDGA
FT                   EIDAWIMYPSKTGEKIPWILYIHGGPKTSYGWSFIEELHYLASNGYAIVYGNPRGSDGY
FT                   SEEFADIRGHYGERDYQDLLEIVDEALKRYSFLDPERIGVSGGSYGGFMTNWIITHTNR
FT                   FKAAVTQRSISDWISMYGTTDIGHYFVEDQIRCNPWRNPETCLEKSPIKYVENVETPTL
FT                   IIHSQEDYRCWLDQALMLYNALKLKGVDTKLVIFPGENHDLSRSGRPKHRMERLKEIKE
FT                   WFDKYLKKKDKQS"
FT   gene            352666..352793
FT                   /locus_tag="Shell_R0016"
FT                   /note="tRNA-Thr1"
FT   tRNA            join(352666..352703,352758..352793)
FT                   /locus_tag="Shell_R0016"
FT                   /product="tRNA-Thr"
FT   gene            352927..353601
FT                   /locus_tag="Shell_0393"
FT   CDS_pept        352927..353601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0393"
FT                   /product="protein of unknown function DUF124"
FT                   /note="PFAM: protein of unknown function DUF124; KEGG:
FT                   scl:sce6258 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31525"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBH8"
FT                   /inference="protein motif:PFAM:PF01987"
FT                   /protein_id="ADI31525.1"
FT                   /translation="MKWEIVTRPSYSLLQVVLEPNENVTAEPGAMMYMAGDINVKTHTG
FT                   GLGKAIARKLLGGESIFMNTFIAGPRGGEVWFAPSLPGDIKYIALNGSRNLIIQDTSYL
FT                   AHHGDIKLSVAWRGLRGLLAEGEMFWLRASGVGGVWINSYGGIIEKELGVGEKIIIDNF
FT                   HFVAMDDGMKWNIRRFGGLKSFLFGGEGLVIEVEGPGRIYVQTRSLPPFMQLIAKYIGR
FT                   RK"
FT   gene            complement(353852..354115)
FT                   /locus_tag="Shell_0394"
FT   CDS_pept        complement(353852..354115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ftn:FTN_0844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31526"
FT                   /db_xref="GOA:D7DBH9"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBH9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31526.1"
FT                   /translation="MLEKTAKILRYGVFLGLAILLVGLFINNLLHIDLLVYIGLITIVV
FT                   TPMITLFSISIMLLLRKDYRSFTLSIILLLVLIISIIVAFLE"
FT   gene            complement(354138..354890)
FT                   /locus_tag="Shell_0395"
FT   CDS_pept        complement(354138..354890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0395"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   bba:Bd2161 putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31527"
FT                   /db_xref="GOA:D7DBI0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBI0"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ADI31527.1"
FT                   /translation="MLDLIILFLGALGIGFVSAIVGIGGGTLMIPFMVLVLNYDVKEAI
FT                   ATSLVSIIVTSSSASSIYLRRRDVDLKTAFLLEPPTAAGAIVGAFLTISLPTRIVEIVF
FT                   SLLLLYVSLSMLIDAFKRKRIDAKNHMVSKQRKGLGVLIAFLAGLTSGMLGIGGGVLKV
FT                   PLMTIVLGLPIRTAIATSSFMVGLTASAGSLVYLLKGYVNPYAVAALALGIIPGATLGA
FT                   HMLKKISPRILKIIFSVILMYASIRLLI"
FT   gene            complement(355017..355675)
FT                   /pseudo
FT                   /locus_tag="Shell_0396"
FT   gene            complement(355755..356309)
FT                   /locus_tag="Shell_0397"
FT   CDS_pept        complement(355755..356309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0397"
FT                   /product="Protein of unknown function DUF998"
FT                   /note="PFAM: Protein of unknown function DUF998; KEGG:
FT                   swp:swp_4416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31528"
FT                   /db_xref="GOA:D7DBI1"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBI1"
FT                   /inference="protein motif:PFAM:PF06197"
FT                   /protein_id="ADI31528.1"
FT                   /translation="MSSNKCSWIDAIIFILSFSFPLIMIALAISVSPWFNILNNALSDL
FT                   GHAVKSGAAPIFNLGLAIGGILIIMVGLRNLYMWSKIKGSLIISMGIFLNLIGVFDEVY
FT                   GWIHFLVSVLFFLSIITYFIALSILDKSWIAVLLIISHIVMWYMHFALRIPRGAAVPEL
FT                   LAVFTFLPFYIRDYLKSYNKQ"
FT   gene            356379..356897
FT                   /locus_tag="Shell_0398"
FT   CDS_pept        356379..356897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0398"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   sat:SYN_01175 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31529"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBI2"
FT                   /inference="protein motif:PFAM:PF01980"
FT                   /protein_id="ADI31529.1"
FT                   /translation="MIRQEYDIRLEPIGIVHTNASIEDIKNSYMGVEGVVEVFPEYEEG
FT                   LDRIEGFSHIIVIAYLHMVSDENRKVLKVRYRRLRRFGIEIDDLPLVGVFCTDSPHRPN
FT                   PTALSILELVERNGRFLKVRGLDLYDGTPVLDIKAYTPDRCIENIKVPWWVKKLEERIR
FT                   KALGELKWI"
FT   gene            356905..357669
FT                   /locus_tag="Shell_0399"
FT   CDS_pept        356905..357669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0399"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: dal:Dalk_2887 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31530"
FT                   /db_xref="GOA:D7DBI3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBI3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI31530.1"
FT                   /translation="MFEMIIFQNVSKYYGGTPALKNISLRIEPGKVNILLGPNGSGKTT
FT                   LMKLILGIIKPDAGKISVYGYDPVQDPIPIRRITGYVPEDDTLYHSLRVKEYLEFVART
FT                   YGLKPGVAERNIERVIDAFMLRDKIHEFTGSLSHGYRRRVLLAAAFIHDPQIYLLDEPF
FT                   IGVDPRIARALKTVLKNKAKNGYLVLLSTHVLEIAEALADNIILLYKGRIISTGSLREV
FT                   LEKARTEGLEEAFLSLTMSRLQVEEIVKALMG"
FT   gene            357674..359266
FT                   /locus_tag="Shell_0400"
FT   CDS_pept        357674..359266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0400"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rlt:Rleg2_0975 multi antimicrobial extrusion
FT                   protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31531"
FT                   /db_xref="GOA:D7DBI4"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBI4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31531.1"
FT                   /translation="MNILDPESFYLASIFIREAIYRSLSRYRVRRGIHGYLVKLLMPSI
FT                   DDKVLVYNMKWFVTGMMSGLFIGLWIPIVSYGSNLVGLPSISKAFIASYLIMAMLISIV
FT                   IILDLIYQVTASIRDLGITKPIEYMPIKYESIEKAASYSIIVGGGLSLLLGTGLSIGIM
FT                   ASIVLKSFPPMIMMPLGFASLVFLVYPLTIIIYSRIKPGTNSLVSLAIYLFVIITVLSF
FT                   YVYFMGLGSRYMVLSVIRDYMFIFPIPYVYASINGFDPESTLYCLLYFVIGLVSSLYIP
FT                   RKYGVKIIWFQRKSYGNSKRILSRSKIITLGLKDLYLLIRDHTRQKQFYGELAAVLTPL
FT                   YIPLFNPAVQSFLKALNSVSSIVLIGLYGLIAYILAVITVPILIFVEADRNKLLYAYPL
FT                   SREEVVLGKTIASTILFFPIPFISLIIVSFLISWLHGLIVFYTFISYWVSGAYLSNSLI
FT                   LRFLWGRLDAWTELSLGIVRRLLLLFILSIPLMFFTPLILFFFVFKPQIALYLLLLSPL
FT                   PINIYVGIRTLTT"
FT   gene            359298..360023
FT                   /locus_tag="Shell_0401"
FT   CDS_pept        359298..360023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0401"
FT                   /product="NMD3 family protein"
FT                   /note="PFAM: NMD3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31532"
FT                   /db_xref="GOA:D7DBI5"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBI5"
FT                   /inference="protein motif:PFAM:PF04981"
FT                   /protein_id="ADI31532.1"
FT                   /translation="MARFCIYCGAEDTPDNPVVEGVCLRCRIKRGEIIEQVKKEIRVDF
FT                   CKVCGAVRIGYKWIDTGGFNEALHHIVYNLLGGLVKPGIGVSDLRIDRYELVTSASWRT
FT                   VVRVYFRGVYGGKEFVYPLDFIVYLNPTKCPRCKMVESGEFEAVVQIRDVQFKVLEKAL
FT                   EKVFSRDKRLRQDLVDYIEVKNGIDIYFYNHGAARKLSRKLSSMLGLVVKENYEVAGMR
FT                   SGKQRARLYVSLKPSNISH"
FT   gene            360083..360613
FT                   /locus_tag="Shell_0402"
FT   CDS_pept        360083..360613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0402"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="SMART: Transcription regulator, AsnC-type; KEGG:
FT                   mes:Meso_2418 AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31533"
FT                   /db_xref="GOA:D7DBI6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBI6"
FT                   /inference="protein motif:SMART:SM00344"
FT                   /protein_id="ADI31533.1"
FT                   /translation="MARNFDNADIKLIQMLTTDGRTSISKLAEVTGLSYTAIRNRIIRL
FT                   INKGYLEIKPFVNTKILGNTAAIIRFRTKNPEKLAEILSKCNKSLGVMINHDGVIAMVY
FT                   SKNKIEIAAFISRLISLDPDIEEYYIEYGKIPSNTMIPIKNPAPSCENCLYYQLKLCSG
FT                   CLPLLRIKNNNRK"
FT   gene            complement(360614..360898)
FT                   /locus_tag="Shell_0403"
FT   CDS_pept        complement(360614..360898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31534"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBI7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31534.1"
FT                   /translation="MGKKPRWGRDIGFLFRKLIINYHRFFHGDYVNSDGRRLLEEILRM
FT                   IIYEHPEYKRRIYKIRRDPSLYNILKLGEDIVGPRIYEWVEEGINPFYY"
FT   gene            361011..361691
FT                   /locus_tag="Shell_0404"
FT   CDS_pept        361011..361691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0404"
FT                   /product="adenylate kinase"
FT                   /note="KEGG: mca:MCA2066 adenylate kinase; TIGRFAM:
FT                   adenylate kinase; PFAM: adenylate kinase; adenylate kinase
FT                   lid domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31535"
FT                   /db_xref="GOA:D7DBI8"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBI8"
FT                   /inference="protein motif:TFAM:TIGR01351"
FT                   /protein_id="ADI31535.1"
FT                   /translation="MLRIVLIGPPGAGKGTYARYFSKKYCIPHISTGDIFREEVAKGTE
FT                   LGKRIKDILDRGELVPDEIVIEIVRKRLRQPDTAKGFILDGFPRTIRQAEALDEIATLD
FT                   AVIHIYITMEEAVRRLSNRYICPKCGRVYNLLFNPPKNDLRCDDDGTPLIRRSDDEPEV
FT                   IRRRYKIYYETFQPIIEYYKKKNLLIEIDNTIGSDKGIPLLERTLIDKGILKLKPCNPN
FT                   VSIK"
FT   gene            361793..363151
FT                   /locus_tag="Shell_0405"
FT   CDS_pept        361793..363151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0405"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="PFAM: phosphoadenosine phosphosulfate reductase;
FT                   KEGG: gem:GM21_0790 phosphoadenosine phosphosulfate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31536"
FT                   /db_xref="GOA:D7DBI9"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBI9"
FT                   /inference="protein motif:PFAM:PF01507"
FT                   /protein_id="ADI31536.1"
FT                   /translation="MINIIVRSSKDADAVKATINKFYRDWNIGVYTLHGARKIDDINYW
FT                   LEKTISDDKFYLLLLGREEKDIVDELRKNKPDNLAIYIVPRKKVRNTRIEHLAWIFDIG
FT                   KSIFRLAVGWRNDLKAYVFSQYNGVRLEDYSIDPAYDIFLGIGKEFKDNLEKILGDKIC
FT                   KLPLLVRKYGGEHDIYCGDRKVAILHISDEGVVPKGEITRKTYDEPSEEKVLEANKQVF
FT                   SLYEKISIKLLEKYREWADTVIVPWSGGKDSTATLLLALKVFSKNKVKAIYADTGTEFP
FT                   WNHKYIDEIAEDLGVEVIRVYAGIDKGILDEGYPMPRHDNRWCTYRKIKAIEETIEKLS
FT                   DGNILLVKGDRDGESRARSMRPPVYVEGENKIVVTPLKFWSAAHVQLYMLMNNVELNPL
FT                   YYKGFYRIGCYICPALRSWEVYIMMNDPELRSVLEKYPLYKLFIRMRKNRISS"
FT   gene            complement(363156..364127)
FT                   /locus_tag="Shell_0406"
FT   CDS_pept        complement(363156..364127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0406"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; Queuosine
FT                   synthesis-like; KEGG: sfu:Sfum_0716 PP-loop
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31537"
FT                   /db_xref="GOA:D7DBJ0"
FT                   /db_xref="InterPro:IPR000541"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBJ0"
FT                   /inference="protein motif:PFAM:PF01171"
FT                   /protein_id="ADI31537.1"
FT                   /translation="MPKCRICGRKAVVYLRHSRLWLCSEHFNEFIENRVMRTIKRYNLI
FT                   RKGDRVLLGLSGGKDSVVLAHILSKLRESIGFKLYLAHINLGIGEYSEKNAEVAKKISE
FT                   KTNAPLIILDLRKILGVGIPELALKTRRPPCSVCGVVKRYLLNALAVELKANSIATGHN
FT                   LDDMATFILKEFLVQNLEQIPKLAPRIEGVKDYLVAKIKPLYETYEEDIKKYAELNNIL
FT                   YVEEKCPLADETTLTWHLKKHLRDLEYRFPGLTIGFIRRLVKNIEKYPKPGDTIRRCSI
FT                   CGMPSSGKICSFCKITEKALGKPMGPHAREYIKEIVDKSIID"
FT   gene            complement(364174..365115)
FT                   /locus_tag="Shell_0407"
FT   CDS_pept        complement(364174..365115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0407"
FT                   /product="triphosphoribosyl-dephospho-CoA protein"
FT                   /note="PFAM: triphosphoribosyl-dephospho-CoA protein; KEGG:
FT                   mmb:Mmol_1342 triphosphoribosyl-dephospho-CoA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31538"
FT                   /db_xref="GOA:D7DBJ1"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBJ1"
FT                   /inference="protein motif:PFAM:PF01874"
FT                   /protein_id="ADI31538.1"
FT                   /translation="MDKHWFYAELLSYSILLEVSGYPKPGNVHRTKNLPGLVFEDFLYT
FT                   GISSVKWFRKGIIRGLRGYSKIVFGDIIYGIVHDTISYRGVNTCLGSSLLLAPISIGIG
FT                   RCIGKRIENIKCYIEEALKALKNTTVYDSIYFYRAVRLAKPSYIRKNDDTGEYVNVWDK
FT                   SFRSKLIARNQRLHDILEYSAGRDIVADEVVNGYPRSIDGKMFFQERFSEHKDWNRGVV
FT                   ETYLYLLSKHKDTTITRTHGENTAYKIMVKARETLKTVLAEKNDWMKPVIELDIYLRKQ
FT                   NINPGSIADIVVSTIAFILLNKNFPYTPKHGK"
FT   gene            complement(365231..367204)
FT                   /locus_tag="Shell_0408"
FT   CDS_pept        complement(365231..367204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0408"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: viral A-type inclusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31539"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBJ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31539.1"
FT                   /translation="MGLKGERIDWESYFSLYNIEYEILLNALEKILSQERACRLKDLLR
FT                   PQVFPKLNPNLVAKLIDRGLLKRVRRGEEYYTITTRGITAFLSVAKHIYEVIDELRESD
FT                   YLTIARKVSNRVFLGGIYRVREVHNKLVKRTLDILSLIGVVESKNNKYIVVDYDKRVKA
FT                   LAFFLRKVSALTTIRNIEELVHIACNSLLIPIDYENQVLIHIMSYGAVIGEKDPRRALL
FT                   DLLFKTRNIAYEKLKRGKLVEAAAYEAMGLEIIRIIEKMGLIDEKNLRDLRSKYIFHFY
FT                   VIMGEFLYSNLLFDLAKTMYHWAVQVAHENPVLAKEAKRVNAKYLLSLARSLAEKGRYE
FT                   EAISRLQELVGYYKSTGSIRESLIAKALINEYIAELEIRKHKPCNAYRTLLSAVSIYNE
FT                   LGGEYRSRAEALRVKALISQAECYISSKKDIGKAIEILEKAREKAIDILSPHLRNVVES
FT                   ILHELIASQKVIEEKYSEAAEEYLESARYYSIRGNNYRSLLNQARGYKFKGYSQILENN
FT                   FSEALEKFIEANTNYYKLLKHTIRKYYKTRKLNYYVLKESIKGYYDTNALIHSLKIILD
FT                   NNPSIKEEISIIMESLIEAGRMKEQEILATTIDLLNNNEYDKAKAFLRQIINDNDASPR
FT                   TKMLTHTLSKITDKLQIMRETI"
FT   gene            367364..368482
FT                   /locus_tag="Shell_0409"
FT   CDS_pept        367364..368482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0409"
FT                   /product="peptidase M29 aminopeptidase II"
FT                   /note="PFAM: peptidase M29 aminopeptidase II; KEGG:
FT                   ppd:Ppro_2115 peptidase M29, aminopeptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31540"
FT                   /db_xref="GOA:D7DBJ3"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBJ3"
FT                   /inference="protein motif:PFAM:PF02073"
FT                   /protein_id="ADI31540.1"
FT                   /translation="MVDPRTSNLARLIVEYCIEAGKGDEVVINAGVEAVPLVREIVKYL
FT                   VSRGGYPVMVNLSDESISEVFYRYATKDVLEHISGIEKYMLENIDASISIISPSHTKPL
FT                   ISIDPEKMKIRSAARRELTKIFMERSARRELRWAVTAYPTRALAQEAGMSIIDYEDFVF
FT                   HATYADTDDPVKKWVEIREKQQKIADFLNKVSELKYEGPGIDLFLRVEGRKWINDDGKY
FT                   NMPGGEVFSAPIEDSVEGYVEFDYPAIWRGVEVEGVKIVFKKGVVVEAHARRGEEFLKK
FT                   MLETDEGAKRLGEIAFGLNYNITRFTKEILFDEKIGGTIHMALGAAYPESGGKNVSAIH
FT                   WDMIKDMRKHKVYADGDLIYENGYFIKDVLGL"
FT   gene            complement(368771..369346)
FT                   /locus_tag="Shell_0410"
FT   CDS_pept        complement(368771..369346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0410"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31541"
FT                   /db_xref="GOA:D7DBJ4"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBJ4"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ADI31541.1"
FT                   /translation="MAVIVEAYHIQFKDSFLHREKMFPYKIALLIIVALSFLYINIYVY
FT                   ILLALIGIIHFLLIREYRIILYSLLIYIPPALLIVLVDYLAGTLSYRIVATLFFGYTSF
FT                   IYILLFYATTPIQQLYKYLGRNVFTLSLLMLHNTVSELYEVIKSKKARGWEPGFNIYNH
FT                   FLLVFEAIRITIMRIEEITTALRSRGID"
FT   gene            complement(369330..370049)
FT                   /locus_tag="Shell_0411"
FT   CDS_pept        complement(369330..370049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0411"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tau:Tola_1666 cobalt ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31542"
FT                   /db_xref="GOA:D7DBJ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBJ5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI31542.1"
FT                   /translation="MPEIIAEKLSIGYRREKPILQNIFFRIQKGLHILLGANGSGKTTL
FT                   LKTIAGLINPLEGRVLINNFEPYKLKRKEAAKYIAYTWQNPYYGFVEARVIDEIKFILR
FT                   TTGARGNWEIVEKLVPRELYEKNPYMLSGGEAKRVSIASVLVGDQDIWLLDEPFNDLDY
FT                   EGTVSLLEIIREARRRGKLVIVSTHQVPLMDQLKPDKYLLITRKGELIVNDWHRLSDDE
FT                   LVNAGVLARSMICGGYR"
FT   gene            complement(370056..370547)
FT                   /locus_tag="Shell_0412"
FT   CDS_pept        complement(370056..370547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0412"
FT                   /product="protein of unknown function DUF988"
FT                   /note="PFAM: protein of unknown function DUF988"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31543"
FT                   /db_xref="GOA:D7DBJ6"
FT                   /db_xref="InterPro:IPR010387"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBJ6"
FT                   /inference="protein motif:PFAM:PF06177"
FT                   /protein_id="ADI31543.1"
FT                   /translation="MSAKFSIMAARLSVIAAVYAALTIALGPLAYGEIQVRISDAMLIL
FT                   PFLAGFGWDAVVGLTIGGFLANLASPFGYIDWVFGPIANFLAALGVYASKKIFGENIVG
FT                   LVIGEILAIIAITLVIGYGELYLVFGIPWMVIIYVLIGEVISIGIGGTIIYGAFKRLRG
FT                   "
FT   gene            complement(370647..370958)
FT                   /locus_tag="Shell_0413"
FT   CDS_pept        complement(370647..370958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31544"
FT                   /db_xref="GOA:D7DBJ7"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBJ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31544.1"
FT                   /translation="MNLYGLKKIREILELIDTILGIISQIIVYLTYIYLILLIRLSIST
FT                   IMLRIILWRRRLPNKLRKRIIEIYEDKALEMLDVMNLLKNVLSWNTLFSPNSREENNI"
FT   gene            complement(370962..371408)
FT                   /locus_tag="Shell_0414"
FT   CDS_pept        complement(370962..371408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31545"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBJ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31545.1"
FT                   /translation="MNSEVEERLEKIEQLLEKVLLKINMLEEKLRLMGIDSSELRIANM
FT                   LVSALSLPPIIALESSKRVLEIFSARTGLDEISKAIIESLSTCEKLSVSEITRRVRAIR
FT                   GKASRRIIAEKLEILEDMGMVVSTKLPNKHLYMLARCISRNWKS"
FT   gene            complement(371490..371882)
FT                   /locus_tag="Shell_0415"
FT   CDS_pept        complement(371490..371882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31546"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBJ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31546.1"
FT                   /translation="MSEKTSEEEMIEAETTKQELEAVAEFINKLKDTVKELLTTLVDSI
FT                   SGKKLGEDVASFYESLKNKGLPEDLAIKMTEEYFKKRLSTIPDIGSLMKQFTSMKHPEI
FT                   PFSIKGAGLEEQGEGEKEEDKNENEK"
FT   gene            complement(372011..372631)
FT                   /locus_tag="Shell_0416"
FT   CDS_pept        complement(372011..372631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0416"
FT                   /product="6-phospho 3-hexuloisomerase"
FT                   /note="KEGG: mca:MCA2738 hexulose-6-phosphate synthase/SIS
FT                   domain-containing protein; TIGRFAM: 6-phospho
FT                   3-hexuloisomerase; PFAM: sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31547"
FT                   /db_xref="GOA:D7DBK0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR017552"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBK0"
FT                   /inference="protein motif:TFAM:TIGR03127"
FT                   /protein_id="ADI31547.1"
FT                   /translation="MVSALVEGFAKEAMAEIANFIFKAINVISEEEKNKMTEELVDAYR
FT                   RGARILVMGAGRSGLVGKAFAMRLLHIGFQVYVLGETIVPRIREGDLVVAISGSGRTRL
FT                   IVTAAEAAKMVGAKVIAITTYPDSPLGKIADIIVRVPGRTKIAKEEDYFTRQILGIHEP
FT                   LAPLGTLFEDTTMVFLDGIVVELMKKLGKTEEDLKNEHANIEL"
FT   gene            complement(372791..373690)
FT                   /locus_tag="Shell_0417"
FT   CDS_pept        complement(372791..373690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0417"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   ppg:PputGB1_0113 radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31548"
FT                   /db_xref="GOA:D7DBK1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBK1"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADI31548.1"
FT                   /translation="MVYLKVIRLFDPWKNPLCTCPRKYSLHPYTGCSHFCLYCYATSYI
FT                   GRKPSMPKKNFLRNLKHDLPRINKNLVVEMSTSSDPYPPLESWMMLTRKTLELLVQNRI
FT                   KVLITTKSDIVVRDYDLLLKTPSAVMLTITTLNDDLARKLEPGAPPPTKRIRAVKLLSE
FT                   KNLPVGVRIDPIIPGINDDPLEIKELIEEIANAGAKHIVTSTYKARWDNFKRMINAFPE
FT                   HEEYWRKLYVEKGEKIHGYIYLPRNIRARILKPVIEYGLRNGLTVATCREGLGREYFKA
FT                   PSCDGTHLIRNHPLLARK"
FT   gene            373796..374374
FT                   /locus_tag="Shell_0418"
FT   CDS_pept        373796..374374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0418"
FT                   /product="ZPR1-related zinc finger protein"
FT                   /note="TIGRFAM: ZPR1-related zinc finger protein; ZPR1-like
FT                   zinc finger protein; PFAM: ZPR1-type Zinc finger domain
FT                   protein; KEGG: ZNF259; zinc finger protein 259; K06874;
FT                   SMART: ZPR1-type Zinc finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31549"
FT                   /db_xref="GOA:D7DBK2"
FT                   /db_xref="InterPro:IPR004457"
FT                   /db_xref="InterPro:IPR004470"
FT                   /db_xref="InterPro:IPR040141"
FT                   /db_xref="InterPro:IPR042451"
FT                   /db_xref="InterPro:IPR042452"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBK2"
FT                   /inference="protein motif:TFAM:TIGR00340"
FT                   /protein_id="ADI31549.1"
FT                   /translation="MDVAKKILEYTVKCPVCGSEMKVEEYLYDMPLVGKVIISSGRCQR
FT                   CGYKWSDARLAESRGPRKIIYRVEKPGDENALVIRASTASIIIPELGVEIKPGPAALGY
FT                   ITTVEGLIMDIIEKTEFICSEPDAPLDECKKKLDQLRKARDGLIKYTIIIIDPGGVSTI
FT                   VSDKKREEPLSIEETNALEKEVSGNGFSK"
FT   gene            complement(374427..376244)
FT                   /locus_tag="Shell_0419"
FT   CDS_pept        complement(374427..376244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0419"
FT                   /product="adenine deaminase"
FT                   /EC_number="3.5.4.2"
FT                   /note="TIGRFAM: adenine deaminase; KEGG: bmi:BMEA_B0626
FT                   adenine deaminase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31550"
FT                   /db_xref="GOA:D7DBK3"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBK3"
FT                   /inference="protein motif:TFAM:TIGR01178"
FT                   /protein_id="ADI31550.1"
FT                   /translation="MVLPRIFHYDVDERISLIQTITGKKPADIVISNVNLVLAPTGEIL
FT                   DNASIIISGKRIAGAGKYSELHRFIGKNTLVIDGENNYAMPGFIDPHIHIESSLLTPHG
FT                   FAKLALKHGTTTVVADPHEIGNVLGSRGVEIFIDEARNLPLKILIDIPSCVPATDPSYG
FT                   LETTANIIGVDEVEKLAALEGTIGLGEVMDFISILNANKAVLEKIRVAHRYGLIVNGHA
FT                   PLLRGAELDAYIDAGIWSDHESTIYEEALEKARKGMYVFIREGSAWKDLKALLPLIKDH
FT                   SIDHRFLSFASDDINVVDLMEKGHMDRIINIAIEYGVDPVKAIQLATIGPATRIHLEDH
FT                   VGVVGPARLADIVLSKNIEYIKPHTVIASGEIIYYKGESRKTFNNYKYPEEALNTVKLA
FT                   KTPGPQEFIPRINNREGIVEVNIIGVTPGSALTKHVVEELAVKDYKVLADPSRDIIYAA
FT                   VIDRHKASGSMGKGFIKGLGFKAGAIAQTIAHDTHNLIVAGNNPEDMSRAVKRIVEIQG
FT                   GIVVVDKGKIIGELPLRLAGLMSIEEPETVYEKYKKITKELMERYGLEFESFFMTLALV
FT                   ALPVIPEIRLTDKGLVNVREAKLMPLINK"
FT   gene            376392..377792
FT                   /locus_tag="Shell_0420"
FT   CDS_pept        376392..377792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0420"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   atrazine chlorohydrolase/guanine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31551"
FT                   /db_xref="GOA:D7DBK4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBK4"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ADI31551.1"
FT                   /translation="MADIYIRGGWIITMDPRRRIIRDGAVAVEDGYIKAVGKREALDKD
FT                   YRYHSDIVIDAQRDIVLPGLINTHVHLAQGLLRGCADYLPLIPWLKDRVWPLQGNYKPE
FT                   EALVSAQLVVAEMLRTGATTFLETGLVGRYGPDNIIEFLHKSGIRAAVARHVMDMTGYA
FT                   LEENILHEGLVELGDISFNDTIRLYHEYHGWDDRIWIWFGPRTPGAVSVELYRKISEKA
FT                   RDLNTGITMHLAEVKADVEYTMAKFGKRPVEFAHWVGLTGPNVVLVHVVWASDEEIKLL
FT                   AKTKTTVSHNPCCNMKLASGAARISDMLREGVNVALGTDGGPSNNDYDLLREMKHAALL
FT                   QPLRTLDAKAVRAEQILEAATINGAKALMIDKMVGSIEVGKKADIIVVDYWQPHLKPLN
FT                   NPISHLVYSAMGSDVKHSIIDGKLVMFDRKILTFNVDEVLEKADKAAHDLYERAGICVE
FT                   PDTIWPIE"
FT   gene            378128..378298
FT                   /locus_tag="Shell_0421"
FT   CDS_pept        378128..378298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31552"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBK5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31552.1"
FT                   /translation="MAEKLKFFDLKAKKYFETDKYEVIIKETKRGKIKIAFAVSPYTGK
FT                   RFARILGPVKE"
FT   gene            complement(378357..379625)
FT                   /locus_tag="Shell_0422"
FT   CDS_pept        complement(378357..379625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0422"
FT                   /product="cysteine desulfurase, SufS subfamily"
FT                   /EC_number="2.8.1.7"
FT                   /note="TIGRFAM: cysteine desulfurase, SufS subfamily; KEGG:
FT                   mxa:MXAN_1156 cysteine desulfurase SufS; PFAM:
FT                   aminotransferase class V; Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31553"
FT                   /db_xref="GOA:D7DBK6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBK6"
FT                   /inference="protein motif:TFAM:TIGR01979"
FT                   /protein_id="ADI31553.1"
FT                   /translation="MINVEEIRKDFPILNRTIRGRRIVYFDNAATTQKPIQVINSIVEF
FT                   YTKYNANIHRGLHTLSQEASELYEKAHEVIAKFINAYSWDEIVFCYNTTDAMNIVAYAW
FT                   GLKNLREGDEILLTIMDHHSTMLPWRNVAKMKNARIKYVDITSDGYLDYNDLENKISDK
FT                   TRVVVFPVMSNVLGTINDVKRIVKLAHEVDAIVVADGAQSVPHTPTNVRDMGIDFLGFS
FT                   GHKMLGPTGTGVLWGRRDRLEEMMPFKVGGDTIKDVTLDNVVWHDLPWRFEAGTPNIAG
FT                   GIGLAEAAKYLMKIGMENVRQHEKELVEYTLKRFEELGEEIIVYGPKNPLDRGGVIAFN
FT                   IRDLHHHTVGKALDLFGIAVRTGMHCAHPLHYRLGLKGTVRASYYIYNTKEEIDYFIDS
FT                   LNKIIQLKEALKNQPVEEVCTGT"
FT   gene            379758..380180
FT                   /locus_tag="Shell_0423"
FT   CDS_pept        379758..380180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0423"
FT                   /product="protein of unknown function DUF296"
FT                   /note="PFAM: protein of unknown function DUF296; KEGG:
FT                   gme:Gmet_0490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31554"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="InterPro:IPR025707"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBK7"
FT                   /inference="protein motif:PFAM:PF03479"
FT                   /protein_id="ADI31554.1"
FT                   /translation="MFKLKNIHVFRIPSGEEIVSYINEYAEKHGIEAGMLSIIGSLENV
FT                   EIGYYDRGLNKYVAKTFPGTYELVSGNGNISLKEGKPMAHIHVVIGDRNYNAHAGHLVK
FT                   ATVYVAEVVILEFEGDKKLVREHMGGDLWLWRTSEE"
FT   gene            complement(380211..381011)
FT                   /locus_tag="Shell_0424"
FT   CDS_pept        complement(380211..381011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0424"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   vei:Veis_3555 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31555"
FT                   /db_xref="GOA:D7DBK8"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR037950"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBK8"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADI31555.1"
FT                   /translation="MSQQVEFKPPNGYEYVLFLSFDLDVDSAEQYRGSDPVALSRGRFS
FT                   VRRGLGKVLNVLNKYGLKTTFFVPGWVAATYPQIVKVLVDDGHEIAAHGYIHERFDEFK
FT                   DIYYEDQLFKRMIESIETFTNHKPIGFRAPYWRFSKNTLSLLFKHGFKYDSSLMDDEYP
FT                   YIIERNNHFLVELPVDWRLDDWPYLEYYRTLTPRELLDMWIDEIEYASQNHGYVSITMH
FT                   PQCIGRGARINILDKIVEHAVETNAWIPQGRVLADYVLKNLLEK"
FT   gene            381144..382493
FT                   /locus_tag="Shell_0425"
FT   CDS_pept        381144..382493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0425"
FT                   /product="Fmu (Sun) domain protein"
FT                   /note="PFAM: Fmu (Sun) domain protein; KEGG: dar:Daro_3159
FT                   Fmu (Sun)/nucleolar NOL1/Nop2p"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31556"
FT                   /db_xref="GOA:D7DBK9"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBK9"
FT                   /inference="protein motif:PFAM:PF01189"
FT                   /protein_id="ADI31556.1"
FT                   /translation="MARLDLEKEMVLALVEAVRLSERIKPSQDAKRRAFRKYGILGSKR
FT                   DPLVTAVFYGVMKRLGILDLYIRSIVGVNPYIIDPWLRAALRVLLEIKVYRDPSRRTLR
FT                   YLRGSVAKLLSSKTHPFVGMYYARIYDKIINENYVFKPRNEDEELLVKYMLPPWYVRKI
FT                   IGLLGNVEAEKLFKALDKQLPLSVRVNTLKTGVEEVLEILRREVKWVRRSSIVSTIIKF
FT                   PGPYNFDKSDLFRKGYIVIQEEAAAVASLILDPKPGMTVVDMAAAPGGKTQHIAELMGN
FT                   EGVIYAFDVDKKRIDRMQGILRRTGVRIAKIYREDSRKAPEILGEKIADRVLLDAPCSS
FT                   DGTIMKNPDLRWRLREEKIAELQKLQYEMLEAGWKLLKPGGKLLYCTCSMLLEENEHII
FT                   EKFLRKHRDAEIIPLNKPYDPGFLPGTMRAWPHRHETIGFFYALLKKKSG"
FT   gene            complement(382509..382910)
FT                   /locus_tag="Shell_0426"
FT   CDS_pept        complement(382509..382910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0426"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: lpp:lpp1107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31557"
FT                   /db_xref="GOA:D7DBL0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBL0"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADI31557.1"
FT                   /translation="MVYSVLCLLFWGLWGFVLKLAYSNLSWVETYFLSSLSSFILMLFV
FT                   VSIHGLRLPSLNTYSALAFLAGFFGGAGYVFFVKALEHGKASVVIPLTALYPAITAVIA
FT                   LIVLREKISVYQGIGIVLAVLASILLSLK"
FT   gene            complement(383094..383168)
FT                   /locus_tag="Shell_R0017"
FT                   /note="tRNA-Arg5"
FT   tRNA            complement(383094..383168)
FT                   /locus_tag="Shell_R0017"
FT                   /product="tRNA-Arg"
FT   gene            complement(383348..384241)
FT                   /locus_tag="Shell_0427"
FT   CDS_pept        complement(383348..384241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0427"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: tgr:Tgr7_2040
FT                   auxin efflux carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31558"
FT                   /db_xref="GOA:D7DBL1"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBL1"
FT                   /inference="protein motif:PFAM:PF03547"
FT                   /protein_id="ADI31558.1"
FT                   /translation="MDPLTTVFLLFGFIGLGVLSRVLMGNNKLFNSFMNALNKFIYYIL
FT                   LPIVFLDTFASRGVELADINIALTAFIYVVISVVVLLKIPLNHDHELRNSVVITSIFQN
FT                   NVFLGFPVLLIMFNDISAAAMYSLVIFILHITIAGLLAARRENILVSILEIPVIYGFIA
FT                   GTIIHYTIYEQYQVLTPITAYTHSLLSYSAVYVLGYTLPLTLAHVKQYMKALYITGLWR
FT                   FLASPLIHYTILLFLTIPNLYWKEIMILSIMPPAVMNTVIAKVYNWKPELVASITLILT
FT                   LTSLIIIAAIILIQII"
FT   gene            complement(384264..384989)
FT                   /locus_tag="Shell_0428"
FT   CDS_pept        complement(384264..384989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0428"
FT                   /product="PA14 domain protein"
FT                   /note="KEGG: scl:sce2099 hypothetical protein; PFAM: PA14
FT                   domain protein; SMART: PA14 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31559"
FT                   /db_xref="InterPro:IPR011658"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBL2"
FT                   /inference="protein motif:PFAM:PF07691"
FT                   /protein_id="ADI31559.1"
FT                   /translation="MGRFALIKTKEGLLRGLKTLYYRWEGSNPPDDLLLLKPIREDVSP
FT                   WINYTWWSNPAPGVPAEFFAVAWLGFIYIDKPGVYRFYVTTDDGSRVWIDGKLLIDAWK
FT                   DQPPTTYVSEPIPLSKGYHRLKYYFYNRYAFAQAVLGWIPREGEAGVIPKDKFYHVMSD
FT                   KVFFEGVPEDYTVEVLPSGGNKKICISRGGICGVKVLFDELPMEAIIRVLDTSGGVVYE
FT                   TPEKITLWGGDELKLVEIK"
FT   gene            385084..385422
FT                   /locus_tag="Shell_0429"
FT   CDS_pept        385084..385422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31560"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBL3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31560.1"
FT                   /translation="MKRKIVFEVIIDNDSAKCMAEYHPRGYMRAKHDHLDIGPECKVLN
FT                   TLFVLAKNRGVSLKCLNRNGCLSIIVPEINYEALICIQNYRVKCRNRIYLMITRRGNLY
FT                   IPVTLIKA"
FT   gene            385509..386348
FT                   /locus_tag="Shell_0430"
FT   CDS_pept        385509..386348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31561"
FT                   /db_xref="InterPro:IPR039967"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBL4"
FT                   /inference="protein motif:COG:COG3294"
FT                   /protein_id="ADI31561.1"
FT                   /translation="MENNSVILKLVRGEAIMVVINAGLVKKIVNDKPLLRKAYEALISD
FT                   PEVQALWDMSNIMAVKRLKYNDHGPVHAQIAAGASLYLYQLLLNAGVGSTLIRDKVVDD
FT                   PEQAWIVPLYGALLHDIGNSIHRDLHEKLGALLAKPIIDRALEKIIDDQRTRIMLRQEI
FT                   MHSIFCTAYDAVCLTVEAGCVGVGDGLDMAEGRARVPYRLGGISIHSVSALSIKKVEVV
FT                   PGEKVPIKILVHMSERAGIFQVDEVLMPKIKTTPLKDYVEVYAIVNGEPLKTYTPRK"
FT   gene            complement(386408..386917)
FT                   /locus_tag="Shell_0431"
FT   CDS_pept        complement(386408..386917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31562"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBL5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31562.1"
FT                   /translation="MRIKSLIGYVDRDHLELDEAHVIGGIKSVYINTKHLTVIGFVNVK
FT                   NLLITKNLLVIGGGRIKKLVGENIILKTDNTPLIIDELKAREAYLLGGKHPVIIYDALL
FT                   FSTFLKHALINKLKAKKIFFSSRARVKVLADCNELYFLDPHTCIEELQCKPSKTVYKYE
FT                   LVGESE"
FT   gene            387002..387994
FT                   /locus_tag="Shell_0432"
FT   CDS_pept        387002..387994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31563"
FT                   /db_xref="GOA:D7DBL6"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBL6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31563.1"
FT                   /translation="MIVDLVLEVHLLLEVIGVDTRIAERMARILSKMKDRLETLNLFDE
FT                   RFYPSRRDDRENVLRYFIVMVAMDHRLSRFGKPYEACLPNDDCYHGADLLYRLGKIKYD
FT                   NDPGFFSPENLSKITIDDVKKWLSIGDAEPPDPDIRAFLLRDLGVKLLKLYNGSVEELL
FT                   DRSNNLIHGTINEPGLVDNLRVFRAYEDPVEKKPLLFAKFIIARGLFSPRDRLDPIIDN
FT                   HLSRIAYRIGLVMVSGNLWNKIRRGVEVDREEDILLRLNIRRAYRIVALKSGIDPGVID
FT                   DYLWIMGRKICLRDKPPLCDQCLFKQICMARKNSNFMVKEHIYYNTWYY"
FT   gene            388020..388367
FT                   /locus_tag="Shell_0433"
FT   CDS_pept        388020..388367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31564"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBL7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31564.1"
FT                   /translation="MEEKKPSLKDILKLPKLERLVMDYFLKHISVGEIIAIIELREEVK
FT                   RLRDPDLVPEFDDVIIELEIGRAINKLLRNNFLEYRSGCYNLAPHLREELKKKLGELRP
FT                   GFPKHLEELIS"
FT   gene            complement(388364..389242)
FT                   /locus_tag="Shell_0434"
FT   CDS_pept        complement(388364..389242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0434"
FT                   /product="methyltransferase-like protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31565"
FT                   /db_xref="GOA:D7DBL8"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBL8"
FT                   /inference="protein motif:COG:COG2521"
FT                   /protein_id="ADI31565.1"
FT                   /translation="MKNMEECMFKPVKAYWFTKPLIDLLWRSRGIVEATFDLGLTWDEI
FT                   RVYDGFLIINGHKIYLEEVTPSEPDRVVVYRRDNGEIYEVVRRDDGNYYKLKTTGIDKA
FT                   PTVEINGIHMHRIIGIDPWSDSRIKTRTAKVRRGDRVLDTCMGLGYTAIHSYLRGARTI
FT                   YTVEIDPNIIWVAEHNPWSHGLSNNGIKIIRGNIIDVIQYFDENYFDKIIHDPPRFSTR
FT                   TGDLYGLNLYKEFYRVLKPGGIFYHYTGEPRRHGSPSIVKGIGERLRLAGFHPVVYRVK
FT                   AQGYIAYKPVY"
FT   gene            complement(389245..389655)
FT                   /locus_tag="Shell_0435"
FT   CDS_pept        complement(389245..389655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0435"
FT                   /product="putative transcriptional regulator, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31566"
FT                   /db_xref="GOA:D7DBL9"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBL9"
FT                   /inference="protein motif:PFAM:PF01402"
FT                   /protein_id="ADI31566.1"
FT                   /translation="MSSKRRFGVSIPSDIADALDKLAELTGSDRSSIVAEALRTYLHDH
FT                   LHYMIPHKCTGFIIVVKKEKNVSPSIVIDKFKDIIQSYNHTHYEGKCIEIFFVSGYSGR
FT                   IAELDRKLRSMGCSVRYIPLQSINKIEEITKE"
FT   gene            complement(389652..390515)
FT                   /locus_tag="Shell_0436"
FT   CDS_pept        complement(389652..390515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0436"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: ppf:Pput_1966 ABC-3
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31567"
FT                   /db_xref="GOA:D7DBM0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBM0"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ADI31567.1"
FT                   /translation="MKDKLYIVLIILIILYGILLSIVYNPVWVIVMVSAGIAYGFMSNI
FT                   VSVRKLYFLAGASPHAALFAVVLSIPLAYYLFSGAQFILSIIIGLLLIYIVGYSIYKGI
FT                   NTDIATAVFVGFAAAGSVIFAYYVLVNYPIEFDLTALILGDPLLTSFSDALVALTIAAI
FT                   VGLLIILTYREQLSIGVNRESAYLAGINVKIYDLVVFTLLGLTAIGLLRMVGYILEHVL
FT                   ILLPASIALSSARSANQALKISVLTALTASLIGLHLGIIFDLAPSGLTGLILLIYYLVA
FT                   LIGGRR"
FT   gene            complement(390515..391576)
FT                   /locus_tag="Shell_0437"
FT   CDS_pept        complement(390515..391576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0437"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   bpr:GBP346_A0794 putative cation ABC transporter,
FT                   periplasmic cation-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31568"
FT                   /db_xref="GOA:D7DBM1"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBM1"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ADI31568.1"
FT                   /translation="MKIQLLQAYIAILLITTALLFNTIPVYSINIHSINTVKGLFIVVS
FT                   FPNLISDIKQLTADNDQVVSVAPQGIDPHEYSLTPKNVEDLEKADIIISLAHAPFEKRI
FT                   HDLYVEGKLKGVLVEIPYIPGIIIRENPATHMPSYHMIIYDPFNYIVFIKYVAQKMGEL
FT                   NPEYKTYYLNKAKEIIKNVSSIIAETPQLNIVGVADTPVTVYSVEWLGIDIRYLLIKEH
FT                   GVQMTPQDLINVENGIKNKTIQAAIVTEPAVSQASKKLLELANKYSIPIIHVPSPLTQQ
FT                   PIPAKLAVISKEVIGLSENKSFININISSNTSSGSIAGTNIFLSKYYYDLVLFIIGSII
FT                   AALTIYEIIRRNP"
FT   gene            391659..392429
FT                   /locus_tag="Shell_0438"
FT   CDS_pept        391659..392429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0438"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: cco:CCC13826_1791 ATP-dependent DNA helicase
FT                   PcrA; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31569"
FT                   /db_xref="GOA:D7DBM2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBM2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI31569.1"
FT                   /translation="MVSITVENLTAGYGKYIVLKNLSFKHEGPGLIQVLGPNGAGKTTL
FT                   LRTILGLIKPMEGRITINGEDVTGNPSRVGKYVGYVPQTTGLSEPDYPLTVMELIECCY
FT                   VLRKPWPRMLVKSREKERIMKILEMVGLPREVWDKNFWDLSGGQKQRGYLARALVHDPL
FT                   ILLMDEPFSNIDPNGRVDLAELIGKLSRNKLVIATSHDPMLLLKYTTKILLVNRETYVY
FT                   GSPEEVLRKDIAEKIYGKAVLEVREHIHIIDSHR"
FT   gene            complement(392433..393512)
FT                   /locus_tag="Shell_0439"
FT   CDS_pept        complement(392433..393512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dat:HRM2_21790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31570"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBM3"
FT                   /inference="protein motif:COG:COG2848"
FT                   /protein_id="ADI31570.1"
FT                   /translation="MKPIIRSITVFAYKPKEEAYDEVLESINIAKDMLGIVKKSFEENG
FT                   YEVFTTRISLPRLSIDLIKKILDSIDVKDTLLSVGAIDVEDIDEELAIDITSRGYYFPI
FT                   YGLYRNPVEYSYKLSRLIISLADQDPLLATRVSIAYHKDPLETPYFPDSTSSGELGLGI
FT                   AFLYPHIIKRIIEETHSLKAVEERISQKISGIINTLRNISIGHYRFVVDYSISPWMEKS
FT                   VVDLIETMGYKLLTPGFNYGVYLLNDLIKNVSRRIGFAKGYNEVMLPYAEDSVLIDAGG
FT                   KGLLKAHHLLLYTTTCVAGPDMLVVPRDQEKLWRFLLDTYSVWMVKQKPLSTRIIPVSG
FT                   KPGDKVRLGKFGTAYIIDY"
FT   gene            393653..394189
FT                   /locus_tag="Shell_0440"
FT   CDS_pept        393653..394189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31571"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBM4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31571.1"
FT                   /translation="MLLKIFRGNIFVHDTYVFINIFTSSLLKEIPFLYAPLSIIDKKKR
FT                   TRTVEILLSTPTSGEDVRNVLKDKFYDRIERIREEGVDLERAKQLLSNVKSYPSIEYMF
FT                   RAFPRELLEYFVKNNYIWLIPFKEIYRLITDGKIIEILYRSPILNNRRIVRLRYDQELY
FT                   ELLKTLCIFNNNPRC"
FT   gene            394202..395395
FT                   /locus_tag="Shell_0441"
FT   CDS_pept        394202..395395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31572"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBM5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31572.1"
FT                   /translation="MSIDNLLSERIRSGNFSIKDLEVLMESIDKLKFQPLTVRNMFLKV
FT                   FESKESIHRLLELVLSDPDSFYELLSRYHVLVENTGTVLYKAYIVSALKKYGLNPKPAP
FT                   LIEKAIYSLIEAHHYISLYNPLVMLYIALNKPSSLRNAVIKPMADKIELYEANPNSSNL
FT                   YVFRDAVLFISIIIDPQGVIPLLYNGYEYEWIIDLIEKSGIKVLEPTKKLILTSYLRVL
FT                   KGLSESLRAITRGLNSLENFEKDLYYIGSARMAVEVLETYIEFTRSYSEKSLKRIISLM
FT                   NGLIGAGFSNVYETITYILGKELDSAAFIRSNKYLLTAFLLEMSLLSKMYEDGLIEEFD
FT                   TYEYLEKLVGIVSDKIKRIKNEIILMLDQDLEPYRTLKIRVLENRDSRFLSWLKTGE"
FT   gene            395374..395505
FT                   /locus_tag="Shell_0442"
FT   CDS_pept        395374..395505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31573"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBM6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31573.1"
FT                   /translation="MAKNRRITITVKGKESYDKWTLIQWIYEIKDILEEEYSIEISV"
FT   gene            395658..396494
FT                   /locus_tag="Shell_0443"
FT   CDS_pept        395658..396494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31574"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBM7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31574.1"
FT                   /translation="MRLIEGEAIVYNGILWLVKGFQHPVNKVIAYPRYDLVNKSKLTRY
FT                   HKIRYINNYYWDCIKLNVPVIDLEKARPYYGVNNFAGEEAVEALAHYLGLYRDQLLLTG
FT                   SSLIGDYSNDIDIIIAGADHGVVDKLYELVEDKVFNRISMYFLLKEYFSKHSSSMDINT
FT                   YLYIKGNTILHLQYNRRHINLKLVKYLRGVNECIEPVIDRHYFSGTILVIDSIEPYALP
FT                   AKFHVRIGDEYFILETYRELFSELKPGKYYVQGYIEVRDDYKVLNIDHGFIRLAKF"
FT   gene            396603..396881
FT                   /locus_tag="Shell_0444"
FT   CDS_pept        396603..396881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31575"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBM8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31575.1"
FT                   /translation="MSLKKEYNVSTKQIEMMAKILNIIKNKDIPVFSVKDLMNEYPYLS
FT                   YNCIYMRLKRLGEKGFVKRITRGGYIVTEKGKEFIQEIEKMLSKTRL"
FT   gene            396914..398068
FT                   /locus_tag="Shell_0445"
FT   CDS_pept        396914..398068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0445"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: hpa:HPAG1_0892
FT                   adenine specific DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31576"
FT                   /db_xref="GOA:D7DBM9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBM9"
FT                   /inference="protein motif:PFAM:PF02384"
FT                   /protein_id="ADI31576.1"
FT                   /translation="MNKMIMNRKIMKKYIWGQYFTRGEIVRKVIDLILEFKKYDKNIKI
FT                   LEPAFGTGNFIRVLKEKGFKNIEGCEIDPRFTKTPQDFFLYPLEKKFDLIIGNPPFTKY
FT                   NIKESYFYPKKYFQSPIHPRKYLPRKLLKKEKIRIENAFILKSIKHLKDKNSTIGFVLP
FT                   ASFFIEGKNLETKKVIAENFKTIIVYQNEGKMVDEPIPCVFAIFTNIKEFENKILLIYE
FT                   NNEKKVVKEVLDKEKLLTDEIIPKTYFYRKNNDLKGIPLSEFLLDKPVRYKKSFTKYNV
FT                   SAANILAKTRIPPGENVSDYYLAVVRVGNASVGRAGLINIKKDILNDMFYVFAFKEKYN
FT                   NNREIKEKICRILNENQEYFKNITIRVGSKSIKKRDILNFKIKI"
FT   gene            complement(398058..398726)
FT                   /locus_tag="Shell_0446"
FT   CDS_pept        complement(398058..398726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0446"
FT                   /product="Restriction endonuclease, type II, Pab1"
FT                   /note="PFAM: Restriction endonuclease, type II, Pab1; KEGG:
FT                   hpj:jhp0455 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31577"
FT                   /db_xref="GOA:D7DBN0"
FT                   /db_xref="InterPro:IPR018576"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBN0"
FT                   /inference="protein motif:PFAM:PF09522"
FT                   /protein_id="ADI31577.1"
FT                   /translation="MINMVECEVRWEDGRIVGLLPITLPTSKVRVKRNGEPIPARQTKL
FT                   REDDLLEWQISYKKDEEVLIEAGKMLEIAYNRGIITREELKQLRDYAVKVPQTFDKQFK
FT                   ILKEETNRAFLGEFKVFFRHIPIIHKDLDNGCFVEAELKHKQRAVGYQPMLYVFIPVRN
FT                   VVTNDAVGSLVGRTARPKEVVKWFPTKNDIIEIMKTFAVLSQKHREDVIEIIERIISKF
FT                   "
FT   gene            complement(399194..401608)
FT                   /locus_tag="Shell_0447"
FT   CDS_pept        complement(399194..401608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0447"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; aldehyde oxidase and xanthine
FT                   dehydrogenase a/b hammerhead; KEGG: ppd:Ppro_1519 aldehyde
FT                   oxidase and xanthine dehydrogenase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31578"
FT                   /db_xref="GOA:D7DBN1"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBN1"
FT                   /inference="protein motif:PFAM:PF02738"
FT                   /protein_id="ADI31578.1"
FT                   /translation="MSKPEYVDIVEKIYEKTKGKKTKEFKYIGKHIIKWDAIDKISGKA
FT                   WFTADLKKLYQNAVFVYSVRTKYAHALIKKIDVSDAEKYPGVIKVITAKDIPGINDVGY
FT                   VIPDQPLLADKKVRYIGDTIALIVAENYENALEAADLVRVEYEPLEVILDPLKIVEWGG
FT                   LQEKEHTLIHDERGSDVVSRYKIRRGDVKKAFQEAAVVIENEYRTPMQEHAYLEPEAAL
FT                   AIPQPDGGVTIYAKTQCPFDTRKAVAQVLGLPFNKVRVIAPPLGGGFGGAEDVGNEIAA
FT                   KTALAAIFTGRPAFLVFTREESIIGHSKRHPMIARYKHAATRDGRLLAVEAEIILDTGA
FT                   YASLGPFVGWRAIVHSTGPYKVPNAKVDLAVVYTNKVYAGAFRGFGNPQVAFAHERQMD
FT                   LLAEELGLDPVELRLKNILRNGDRTVHGQLLSHGVGLEEAILKAVEAANWYEKRKLYSQ
FT                   QKGLVRRGIGIAVFYHGNSIGAEGADFSSATIIIQRDGSIIFRTGLTDFGQGAIQGIVN
FT                   IIAETLGVPPSYVKVEWPDTASTPDAGPTVASRSTVMGGNAALVAAYKLRQRLNKLAGE
FT                   ILGCDPDDIVIDAPDVYCRSDPNLKITWQELVEQSFWKGVPIQEFGYFRAPPAEWDEET
FT                   GQGAPYMHYTFGAIISDVVVDLETGVARVKEAVTAYDIGRVINRTGAEHHAVGGYIQGM
FT                   GYALMEDIYHAPDGRVYNKNLSTYHIPTGLDIPEKIKAIWVEAGFNRGPYGAKGLGEPS
FT                   IVGIAPSIANAVAHALGGGRNVNKDINRIPLTPDYVYSIIKKHGLIKKYKA"
FT   gene            complement(401616..402158)
FT                   /locus_tag="Shell_0448"
FT   CDS_pept        complement(401616..402158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0448"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: [2Fe-2S]-binding domain protein; ferredoxin;
FT                   KEGG: scl:sce5894 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31579"
FT                   /db_xref="GOA:D7DBN2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBN2"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="ADI31579.1"
FT                   /translation="MEEKLVKVHLKVNGKEYTLEVPPYERLLDTLRYRLGLTSVKEGCG
FT                   RGECGICIVLVNGNPRHSCLTLTATLDGAEITTLEGLAPEGKLHAIQVAFLETRGVQCG
FT                   FCTSGFMLMAKALLDRNPDPSYEEIKEWLSSTLCRCGSYHYYFAAVKLAAKYLKEGKIY
FT                   FDEKEIRNKYHMKVIGR"
FT   gene            complement(402164..402934)
FT                   /locus_tag="Shell_0449"
FT   CDS_pept        complement(402164..402934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0449"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG: rle:RL3570
FT                   putative xanthine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31580"
FT                   /db_xref="GOA:D7DBN3"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBN3"
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /protein_id="ADI31580.1"
FT                   /translation="MIRDRRIPIPKHLVDLNAIKRELSFVEKKDDGIHIGGGTTLYELS
FT                   QTFLHKDKRFAGFVDVYKKFGTLALRFEATIAGNLVSATQYNDYITLLLVYDAKLRLVS
FT                   ANGERIVRLEDFLIDKRKVDLKPNELIYEIIFSEPPMNSSSSFIKFDRRELLIAGVVTG
FT                   AAFLALEDNKIADVKISFDMVREKRIPGRARKSEEFLKGKEFSEEILEKVAEEVLPTEM
FT                   ERVTDWWTNAEYRMDMSKVVLKRNLLRAYKRIKG"
FT   gene            403312..404328
FT                   /locus_tag="Shell_0450"
FT   CDS_pept        403312..404328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0450"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: cysteine synthase A; K01738 cysteine
FT                   synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31581"
FT                   /db_xref="GOA:D7DBN4"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBN4"
FT                   /inference="protein motif:PFAM:PF00291"
FT                   /protein_id="ADI31581.1"
FT                   /translation="MSLRVCNDIIECIGKTPIIRLQRIEKDQEVGFEIWAKAEFMNPTG
FT                   SVKDRMAYYMIKRAMDKGELKPGMTIVVPTTGNTGISFSALGSYFGLKVLIVIPEEMSA
FT                   ERFMLMKLFGADFLFTPGGESDAGKALEIARKLAEENPDKYYFFDQWGDEANVQAHYET
FT                   TGKEILDQIGCPDAFVAQVGTGGTLMGVAKRLKEECKNVIVAGAEPAECPIAYYWFKTG
FT                   KEGPWGRHEIEGVGDGFVPDIVKRYKHLLDDFVTSTSDEAITMARKIARLEALPVGISS
FT                   GANVVSAIKLGKSHGLGKEKKIVTILPDYAARYFSTRLFKKKREIVDRKKILEELGI"
FT   gene            complement(404418..405998)
FT                   /locus_tag="Shell_0451"
FT   CDS_pept        complement(404418..405998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0451"
FT                   /product="FG-GAP repeat protein"
FT                   /note="PFAM: FG-GAP repeat protein; Pyrrolo-quinoline
FT                   quinone; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31582"
FT                   /db_xref="GOA:D7DBN5"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBN5"
FT                   /inference="protein motif:PFAM:PF01839"
FT                   /protein_id="ADI31582.1"
FT                   /translation="MSILRMTIFIVLLVSILASPISYQIIEQPKYIGVWPTYKYNFKHV
FT                   GYVNIREIIGNNTYRFYAFDLLWKTHSELCVASSPAIGDINNDGYKEVVYSSCDGNLYV
FT                   VNGSNGEVLWKYPTGGMFADPTIYDVDGDGYYDILTVGASGNLYCLNYDGSEKWVINDR
FT                   MFSGSPAVGDVDGDDDVEVVMGSNDGYVYVINRNGTVEAKIYVGDMPATTPSLSDIDGD
FT                   GIDEIIIVEGTYLHVIDYSVNEEKYVVYSLDLGSYLVPPPVLYDVNNDGSDDAVIVSKD
FT                   AHVFIVDLLNGGIIGETKLNATDTFASPSIGNVDDDPEPEIVVGTMDGLYILNMSLNVK
FT                   KYFPDLQTYQSSPIIADIDGDGKNEIIFGLHTGEFVIVNATKPSGFFREVEWLYSTDAP
FT                   IMASPAISDVDNDGLPEILIGSRDYNMYCFKGLLVENQIITATTTTTTTTSVSTSPSNT
FT                   TTTTTTANTTTTTAPPPPLTTGSQTNTTKKIELPTGTGRFKPIINWGLVIPALIVAIIV
FT                   VLIVYYKTR"
FT   gene            406123..407121
FT                   /locus_tag="Shell_0452"
FT   CDS_pept        406123..407121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0452"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: xca:xccb100_4159 Na+ extrusion ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31583"
FT                   /db_xref="GOA:D7DBN6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBN6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI31583.1"
FT                   /translation="MEKYALIIEELTKRFGKVLALKGISFKASVGEIVGLLGPNGAGKT
FT                   TTLKAIAGALKPTSGRVYVFGYDSFREQVKVRNLIGVVPELPGLSPELSVYDNLFFVGR
FT                   IYGMKKHVVMDRIKELSEMLELKDLLRIKYAKLSKGLKRRVDIAAALIHDPKLLLLDEP
FT                   TTGLDVISASALREYIVKLPREGKTIILSSHYIDEVMNIAHKVILLVKGTKLVEGSPLE
FT                   LKRILKLDKHVKIILDKPIDSSVFDIIAKHIETKSIGYDLRFRHNIVEMRSSNVVKTIN
FT                   EVSDLIRKAGHEIVDIEVVPPSWSDVFKKYIEGFSAKNCEACPLYRGGCIG"
FT   gene            407114..407848
FT                   /locus_tag="Shell_0453"
FT   CDS_pept        407114..407848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0453"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: pca:Pcar_1576
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31584"
FT                   /db_xref="GOA:D7DBN7"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBN7"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADI31584.1"
FT                   /translation="MVRLRVVSIIFLYDLKKYYSKAPVISWGILTPLAIILLLYFSAGV
FT                   FGYSRIVPAMFVVSLLFAATSMSQVSVSFEKMSGSINMLYFMPVSIIEILLGKLLGGII
FT                   YGFLGTFIASIAVLATTGYSAIIRPLFFTYGIVVGSLLFSFISLLFAFAYEPIKAVALL
FT                   NIVRFLMIFLGGLIIPKPLMPRNILFIVYIFPSVYVADIVRFGLYNTWDYVDPYTSIII
FT                   SLIYLIVLIIVTVRIVSRTFYP"
FT   gene            407925..408170
FT                   /locus_tag="Shell_0454"
FT   CDS_pept        407925..408170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0454"
FT                   /product="ferredoxin"
FT                   /note="KEGG: dps:DP1865 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31585"
FT                   /db_xref="GOA:D7DBN8"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBN8"
FT                   /inference="similar to AA sequence:KEGG:DP1865"
FT                   /protein_id="ADI31585.1"
FT                   /translation="MSYVKVIVDRDTCIGCGVAPATCPEVFVLGEDNGKNRVVDKYTEK
FT                   IDEHISIGKVPEDLLECVKSAVDACPVAAIRYETEK"
FT   gene            408310..409617
FT                   /locus_tag="Shell_0455"
FT   CDS_pept        408310..409617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0455"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vha:VIBHAR_05158 transcriptional regulatory
FT                   protein CpxR"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31586"
FT                   /db_xref="GOA:D7DBN9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31586.1"
FT                   /translation="MGNENIENYLKALAHRIRRDIIRALAEKKHLSYTELMRITGIEDS
FT                   GTFAFHLKMLHGIVEKDPKTGEYSLTEKGWKLYKALKMFSDEKVEGETARVKESKPAEI
FT                   IRVSDKIEFTLTRGLAEKLCREGKKIYVSDVLMFKIEDMPEEVIECVLEGVNDVLFIDA
FT                   PPNLKPLIQIRSGDIGLIGRGGEFVSGLVSGLVKSVLSGISKTMSKTMSKTMSIGYEKK
FT                   KIPVHIKVDSLSDLEALDMTIDSSSISVFDSGDKIVFEGRRSVEGSVSIDKHIDKLEVR
FT                   SNSASGKLYFPLTFEEALINIDSSNINGTLKITKNIRSVIDSSNASIKIHDLRESNISL
FT                   TTDSSSANIELKYSSFTGTSHLKIKSDSSALNLNIYVPESTRIKAVIHGSYGYINVDGR
FT                   KTREYIDVDYDKSDSRIDIVVKADSSVVKVNIHREK"
FT   gene            409764..411032
FT                   /locus_tag="Shell_0456"
FT   CDS_pept        409764..411032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0456"
FT                   /product="Protein of unknown function DUF650"
FT                   /note="PFAM: Protein of unknown function DUF650; Protein of
FT                   unknown function DUF651"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31587"
FT                   /db_xref="GOA:D7DBP0"
FT                   /db_xref="InterPro:IPR006978"
FT                   /db_xref="InterPro:IPR006979"
FT                   /db_xref="InterPro:IPR033167"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBP0"
FT                   /inference="protein motif:PFAM:PF04894"
FT                   /protein_id="ADI31587.1"
FT                   /translation="MSRRSSWPRIDPKLCAVCRGRGWCGLSYCPLLARRMATYKLRRVV
FT                   GSRELFGSSPPSVFVGRHGYPYVNIGPSIPPITGDTSIYDLPEKWLGLKLEKILDYRWS
FT                   LVTGSRKHRVDDLSDSFIEKIHEIILSIKPVDVEVYLEKPPKPSIIFSEYEPPQGPRAP
FT                   IKNVRVVGNPRIPRIIDRVYQDKDFKAVDAIIELYKHNIPVTIIQRIFSVGALGVQHRR
FT                   RLVPTRWSITAVDDTISKYLVEKIKEYDEISGIEVYVRKYYDNLFIAILYPGKWSFEWM
FT                   EAWWPGSTWNPGEREVVVEGDYEGFKGRTTYPEIGGCYYATRLAIAEHLYGRKKQAVAI
FT                   VLREIYPGFNIPIGVWFVRENIRAMMRNKPVLKTNSIREVLEFIDKETKLGAEKWISSS
FT                   RLLKRILYVETIDKYLHRRISDR"
FT   gene            411034..411858
FT                   /locus_tag="Shell_0457"
FT   CDS_pept        411034..411858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0457"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   tau:Tola_1404 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31588"
FT                   /db_xref="GOA:D7DBP1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBP1"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADI31588.1"
FT                   /translation="MKIIFINVKRALSRSGLPDLDYALNPYMGCYHGCIYCYARLYTWI
FT                   NEIRENWGEIVAVKKNLINVLEKEIKYFRKGVVGVGTITDPYQPVEAIYELTRRSIELL
FT                   LRHGFHVSIQTKNTLILRDTDLLTKHRDNVDVGFTITSLNNKKSRLYEPRASPPSMRAY
FT                   ALKQLSIRGIDTWIFYGPVIPGYNDDLDTRTKIIELARETGSRILIDSIHVKKFMYNKN
FT                   HPLHQLIPIIRNYPWKRFLSETIKLCREYNVECIPGFAEPSKKESTLDSFMH"
FT   gene            complement(411855..412403)
FT                   /locus_tag="Shell_0458"
FT   CDS_pept        complement(411855..412403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31589"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBP2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31589.1"
FT                   /translation="MGVKISIPYNVFRGKNINIGLDAYFWKQVSKPYRKTLFVRPISKL
FT                   KGSPEHSTIVLPTRINHTEQMNDLWEIISIVKHEKIRLASKHQRWKLARFFLIPLPSKM
FT                   GDTSTLTELVYAEQIAKDIVSSNIKYHGIGWLIIEYDNIKSKIFLGNRIDKIYQWLLEN
FT                   DENFRNEFNKIIAGKTLGV"
FT   gene            412523..414754
FT                   /locus_tag="Shell_0459"
FT   CDS_pept        412523..414754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0459"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: kpu:KP1_5245 periplasmic dipeptide transport protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31590"
FT                   /db_xref="GOA:D7DBP3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBP3"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADI31590.1"
FT                   /translation="MKRLKALTRTASATIIIVIVIIGIIAAYYAFQGGGQQTTTTPPLT
FT                   TTTTTSPTTTTSSPAATTTTTTTPTGPKALVIETSQAYVVVGPKGSVVPQLPSDKKIIV
FT                   VSYEVDLEKTKPIENSTGFVDIDPAFYRNYTVDALIVAARKATDPFIRYQIYEAVHKLS
FT                   NEEAPTLWLGQYVLVRNRWSWLHGRYYHPTLAERYDLLWEDPDAPSVAIGIGDYVNDQH
FT                   TYSIITFGWPDTFDPAADYETFGWEIWHNIGDTLVTYWKTDTEHIVPDLAVAWAHNKEG
FT                   TEWYFVIRGGVKAYDPWHDVTYDISAVDVLFSIWRIARLQLDPSWMITEFLDVNSSSIL
FT                   TEDEFNQLLQSGGLVAEYKGQTVEPKSLNELLQLFGYSGDTAGVVKLKLYYPYGAILSI
FT                   LADPFTSTIPMKYFFDNVDELKGKYEQALSDSNNGKNPSAWANYIGVGEQEPTHLYLHQ
FT                   HPVGTGPYYIKEYEENSYMVLEYNPYYWNKTLWNTSPYGENGKPIHEKTIYLINDDAVS
FT                   RIEILKAGQADIGAIPLDRLKDIEGYQYPNSNHKIIVEKGALEPTIVYIVLNANKEPFN
FT                   NKLVRQALMYAIPFDRIKNDVYAGYLERLYGVIPAGFPGHNDDIATKYTFDLAKAQQLI
FT                   QQAGIDPTKYSFEIWYNSGNTQREKIATLLQTYWGQLGFQVTVRALQWGTLLTKTEKGD
FT                   FDVYIIGWAPDYLDPDNYAGPLFYGGTRFSILEFKLVNSVSEAQQVFSG"
FT   gene            414847..415845
FT                   /locus_tag="Shell_0460"
FT   CDS_pept        414847..415845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0460"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hpb:HELPY_0305 ABC-type
FT                   transport system, permease; putative dipeptide transporter
FT                   protein 2; putative membrane protein; putative signal
FT                   peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31591"
FT                   /db_xref="GOA:D7DBP4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBP4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADI31591.1"
FT                   /translation="MAELKRFLVRRLLTFIPTLIGVTLIVFVIAAVIPTDPARMWAGGE
FT                   KANPKVVEQLKKEYHLEGNIFERYYFVMYKLFTNQMVSPVTHHYIWDDLAKKFPVTLQL
FT                   TIIAFIYIIIIGIPLGILAALKRDTWVDTSVRILALTGVSTPIFWLAYLLIFLFFTQLG
FT                   WITLAGTPKPPYSYTGVPLIDASIRLDLPMLAEIFKRYSLPGFILGFMGIGVTARIVRN
FT                   SFLDAMNADYTEYAMARGLKKLRIYRHVFRNALVPVVTVLGLQFGGLLGGAPITERVFG
FT                   LPGLGNYMLNAIYQYDYLALMGAVFFVAIIYLTANLIVDILYAFIDPRVRY"
FT   gene            415863..417026
FT                   /locus_tag="Shell_0461"
FT   CDS_pept        415863..417026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0461"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ara:Arad_4734 dipeptide ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31592"
FT                   /db_xref="GOA:D7DBP5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBP5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADI31592.1"
FT                   /translation="MSEEVYEKKILDKITDKIIDGYAKLMDKIRPGWYRRNKARVDEWK
FT                   LMAYAFNRSPPGLIGFFLVIIFLVIAIIGPFIAPFSYDLPLSSFDQKAYLAPPGTVISI
FT                   PNNNIAKFFGVKPGNYTLVLGGDDYGRDLLSRILYGARTSLVVAILVMLVGPWIGIGIG
FT                   LIAGYYGGKTDETLMRLTDIFLAFPGLILAIAFSAVLPPRIQDFLNANPAIRNFFLSLF
FT                   ALKPQHAGAMAYLVSVIIALWIVWWPGYARLVRGQVLSARENVYVEAARALGVPTRWIL
FT                   LRHIFPNILGPVLVYLTLDFGGVILTEAGLSFLGVGAVPPIADWGRIINDGSQYFPNSW
FT                   WLVFYPGLMILLTVLGFNLIGDTLRDVLDPKTRRSVEFKLKKKKGEK"
FT   gene            417026..418042
FT                   /locus_tag="Shell_0462"
FT   CDS_pept        417026..418042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0462"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: dde:Dde_1182 oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein-like; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31593"
FT                   /db_xref="GOA:D7DBP6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBP6"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADI31593.1"
FT                   /translation="MSTKCDPIIEVRDLYVNFYTYAGIVKAIDGVSFKICRGETYCLVG
FT                   ETGCGKSVTAKSLTGLIRSPGKIEKGEVLYYPEPGAKPINLLQLSEDDLRKIRGSEISY
FT                   IFQDPSASLDPLYTIGYQVSETMYEHGRIKSIKEGIRRAIDILRKVLMPDPETRIKNYP
FT                   HELSGGMKQRSVIGISLSNNPKLVIADEPTTALDATVQDQIMDLLKKLKEKENLTVLLI
FT                   THNMGLVADMCDRVAVMYAGRIVEEADVYELFKNPYHPYTKALLRAVPNPLTKMEKLES
FT                   IPGTVPNLINPPQGCRFHPRCPYKTDICEREKPPDIWVGPGHRVSCWLYVEKKESGG"
FT   gene            418097..419020
FT                   /locus_tag="Shell_0463"
FT   CDS_pept        418097..419020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0463"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: scl:sce3461 oligopeptide ABC transporter ATP-binding
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31594"
FT                   /db_xref="GOA:D7DBP7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBP7"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADI31594.1"
FT                   /translation="MKGIFFTKGYVKAVDGVSFEVERGKTMGLVGESGCGKTTVGKLVL
FT                   RLLKPTSGKVYFEGKDIYKLKGKELKEFRKKAQMVFQDPYSSLNPRMTVFDIIYEPVKV
FT                   YKLKVSDPEKFILNLLYQVGLNESHLYRYPHEFSGGQRQRIAIARILALNPEFIVLDEP
FT                   TSALDVSVQAQILNLLKELQRKYNLTYLFISHDLGVVRYMSDWIAVMYLGQIVEYGPAE
FT                   EVFEKPLHPYTKALFSAIPIPDPEITRKREKLRVPGEPPSPINPPQGCRFHPRCPFKMD
FT                   ICEKTEPELIEYEKDHFVKCHLYSRK"
FT   gene            complement(419024..420793)
FT                   /locus_tag="Shell_0464"
FT   CDS_pept        complement(419024..420793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0464"
FT                   /product="oxaloacetate decarboxylase alpha subunit"
FT                   /note="KEGG: maq:Maqu_0971 oxaloacetate decarboxylase;
FT                   TIGRFAM: oxaloacetate decarboxylase alpha subunit; PFAM:
FT                   Conserved carboxylase region; pyruvate carboxyltransferase;
FT                   biotin/lipoyl attachment domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31595"
FT                   /db_xref="GOA:D7DBP8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBP8"
FT                   /inference="protein motif:TFAM:TIGR01108"
FT                   /protein_id="ADI31595.1"
FT                   /translation="MVKIIDTTLRDAHQSLLATRFRTRDILEIADLIDKAGFYSLEVWG
FT                   GATFDAAIRFLREDPWERLRLIRENVKNTKLQMLLRGQNLVGYRHYPDDVVEKFVELAY
FT                   KNGIDIFRVFDALNDPRNMKTSIRKAKEVGAIVQGAMCYTISPVHTIDYYLKFAEELLA
FT                   MDVDMITIKDMAGILEPHKAYELVSALKKEFKVPVNVHTHATAGLAVATYLESVKAGAD
FT                   YIDTAISPLAFGTAQPGIQTIYYALPPDKRPSIRLDIIDKISKKLVKFIEEKYQHLLNW
FT                   RILLPNPNVIIHQIPGGMFSNLIAQLREQNALDKLDAVLEEVPRVREELGWPPLVTPLS
FT                   QIVGTQAVLNVLFGRYKVIPKETKNYVKGLYGRPPAPIKEEIKKLILGDEKPVTVRPAD
FT                   LLEPMLDKCRSVLVEKGYLEKEEDILTYCLFPETALEFFEARKRGEIEKPVVKEEKPRK
FT                   VIKLYIDGQEYVVGVEGVNIDIIKSIAPIPTIAPVQPAGAPASSITTPASITGSETSYR
FT                   GEPVKAPMAGKILKILVKPGDKVVKGDKVVVLESMKMSTDILAPTSGVVEKIMAKEGDD
FT                   VEAGDILLTILPQ"
FT   gene            complement(420822..422174)
FT                   /locus_tag="Shell_0465"
FT   CDS_pept        complement(420822..422174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0465"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /note="PFAM: type I phosphodiesterase/nucleotide
FT                   pyrophosphatase; KEGG: dma:DMR_02860 type I
FT                   phosphodiesterase/nucleotide pyrophosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31596"
FT                   /db_xref="GOA:D7DBP9"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBP9"
FT                   /inference="protein motif:PFAM:PF01663"
FT                   /protein_id="ADI31596.1"
FT                   /translation="MRRAIVIGLDCAPPRILYDELRNELNVLGKLVGEGQRYIMRSSHP
FT                   PITIPAWMVMATGKTPGELGLYGFRHRVLGSYDKMYIADSTRIKEEPIWNTLGKHGVNS
FT                   IVVSVPPSYPPRPVKGYLISDFITPDHTKRYTWPPWLKKEIENRFGPYIFDVVFRIEDR
FT                   DKVAKELWEMTEQHFKVLEYLLTNKKWGFAWFVEIGVDRLHHAFWKYWDRNHPKHVPGN
FT                   KYEHIIPDYYKFLDEKIGLLLEKIPKDTLVFVVSDHGAKAMKGAFVVNQWLEEKGYLKL
FT                   KKKPEKPGEDLKPNMIDWEHTKVWGWGGYYSRFFINIKGREPHGVVEPKDVPELIEELK
FT                   HELRKIRGPNGEVWNTKAYTPRELYPLVKGDPPDMMVYFDDLSWRAAGTIGWNTMYLEE
FT                   NDKGPDDAVHDWYGVFTIYDPEETIGSGDKGIIDIHRIKDKMLQYIMEDKK"
FT   gene            complement(422296..422841)
FT                   /locus_tag="Shell_0466"
FT   CDS_pept        complement(422296..422841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0466"
FT                   /product="adenylylsulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /note="TIGRFAM: adenylylsulfate kinase; KEGG: hypothetical
FT                   protein; PFAM: adenylylsulfate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31597"
FT                   /db_xref="GOA:D7DBQ0"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBQ0"
FT                   /inference="protein motif:TFAM:TIGR00455"
FT                   /protein_id="ADI31597.1"
FT                   /translation="MKYLDKGFVVWFTGLPGSGKTTLAYKVAEILRDKGYRVEVIDGDW
FT                   ARKTISLGAGYTREERRIHLHRIAWVARLLARNGVIVLCSFVSPYRDVRKMIREIIEGE
FT                   APFVEVYVYCPLEECIRRDPKGLYKKALRGEIKHFTGISDPYEPPENPDIVVDTVKYSV
FT                   EENVAKIINYLARRFNIN"
FT   gene            423063..423293
FT                   /locus_tag="Shell_0467"
FT   CDS_pept        423063..423293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31598"
FT                   /db_xref="GOA:D7DBQ1"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBQ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31598.1"
FT                   /translation="MENEKRIKYTTVSIPITLYNRIKKLIENTGFTSVSQYVAYVLREV
FT                   VAAHEEEKYEEPFTEEDKQKIIEKLRRLGYI"
FT   gene            423314..424462
FT                   /locus_tag="Shell_0468"
FT   CDS_pept        423314..424462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0468"
FT                   /product="sulfate adenylyltransferase"
FT                   /EC_number="2.7.7.4"
FT                   /note="TIGRFAM: sulfate adenylyltransferase; KEGG:
FT                   scl:sce0740 sulfate adenylyltransferase; PFAM:
FT                   ATP-sulfurylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31599"
FT                   /db_xref="GOA:D7DBQ2"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020792"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBQ2"
FT                   /inference="protein motif:TFAM:TIGR00339"
FT                   /protein_id="ADI31599.1"
FT                   /translation="MIPRPHGGKLVNRIVSSKRRSALLEEAGELPSINISYERLIDLLD
FT                   IANGAFSPLEGFMVQEDYLHVLYDMRLANDLPWTIPVILDVDPMEISGVKEGDDIALKY
FT                   NNEIYAIMRIEEIYGWDKKEYARQVYKTTDPNHPGVAKTYQRKELLVGGTIDLLNQPHH
FT                   PLEHRILWPIETRVLFREKKWRTIVAFQTRNVPHRGHEYVQKAALTFTDGLFIHPLIGW
FT                   KKPGDYRDEVIFAAYEVLIKHYYPDNVVVLAGLMMNMNYAGPREAVHHAIVRKNFGATH
FT                   FIVGRDHAGVGDYYKPYEAWEIFDEFPDLGITPLFIREAFYCRKCGGMVNEKICPHSEE
FT                   YRVRISGTKIREMIRKGIMPPEYMMRPEVAKVILSFKDPFVH"
FT   gene            424528..424749
FT                   /locus_tag="Shell_0469"
FT   CDS_pept        424528..424749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0469"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31600"
FT                   /db_xref="GOA:D7DBQ3"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBQ3"
FT                   /inference="protein motif:PFAM:PF01402"
FT                   /protein_id="ADI31600.1"
FT                   /translation="MAEEEVSVKISIPKTLYEKITREAKDAGFNNIEEFIIYVLEQLVE
FT                   TSSVEGETMSKEDEEKVKERLRALGYID"
FT   gene            complement(424790..426523)
FT                   /locus_tag="Shell_0470"
FT   CDS_pept        complement(424790..426523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0470"
FT                   /product="sodium/sulphate symporter"
FT                   /note="PFAM: sodium/sulphate symporter; Citrate
FT                   transporter; KEGG: cps:CPS_2009 anion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31601"
FT                   /db_xref="GOA:D7DBQ4"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBQ4"
FT                   /inference="protein motif:PFAM:PF00939"
FT                   /protein_id="ADI31601.1"
FT                   /translation="MNRIVEITIIVLIAIVAGAIVYSVSPPDWPVQGTYTAEVFLHGKS
FT                   VGVLEFNLSDKHIVKNFSTGNNEVLQVALRSPGGVYVGKPLVFNVCLYRDNELVELSIK
FT                   DVSLTIKTPDNHLYKYIPTSKTDKCVEISVQPYIHAREAGFIFGSAIVLFASASIIHYI
FT                   ITGLYVTLALVLVGVQPASTAYQYYMAPLIMVFIAGSAMELVIREKGLDVRVARLLSRI
FT                   ARGPYTLILGISFLGSFLSMWMSNTAATYVMLPLAAALLAGIRDKAPRISSIAMVSLAM
FT                   GASIGGTATLIGTPPNLIAAEFLNKFAYGYYAIGFYRWLLIGLPAWIIGFTIGVLLAFL
FT                   YAKITASGELGIVKDYLKGIREKGEAKPWSRAEIIALTELLILVGLWITEPLHGIKTGI
FT                   AAGIGILLFFATGILNPKEHWKKLAWDLMVLFGAGLTLGSGLMKSGWANYLLSQLHSVG
FT                   SLGWAGFYIIGFTAYFIGTFISSHTSASAFIAPLTIPLGMTMAASLGLNPATGAALATV
FT                   VAVVSLNNAIALPISTPPSAIVYASGKANIKDLMIYGFLFGIVANAIIIAVLLHYWATI
FT                   L"
FT   gene            426708..427454
FT                   /locus_tag="Shell_0471"
FT   CDS_pept        426708..427454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0471"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: afw:Anae109_3653
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31602"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBQ5"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADI31602.1"
FT                   /translation="MKTLLISDIHGNLPALQTVLDNEVYDEIIVLGDIVDYGPFPGEVL
FT                   DVLRSIGARIIRGNHDHAVGYGVDCKCGEATHWVSVWFRENITNKLLSNNDKEYLARLP
FT                   LFIERDNALFVHGSPSNPLYDYLYPWIGYKEITEKISRIVTSRKYVFGKTIDKHRYKRI
FT                   YVGHTHVQFMLTIDSTQVINPGSIGQPRDGDPRAAYAVVENDTVIFKRIKYPVEKIIRR
FT                   YEELKIPDPYYSFLKQLLLTGRLPHR"
FT   gene            complement(427462..428898)
FT                   /locus_tag="Shell_0472"
FT   CDS_pept        complement(427462..428898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0472"
FT                   /product="tRNA synthetase class II (D K and N)"
FT                   /note="PFAM: tRNA synthetase class II (D K and N); KEGG:
FT                   afw:Anae109_2720 asparaginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31603"
FT                   /db_xref="GOA:D7DBQ6"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBQ6"
FT                   /inference="protein motif:PFAM:PF00152"
FT                   /protein_id="ADI31603.1"
FT                   /translation="MGSGKKYSDKQGSSLNNCSKNEWYNQGDKGCVLTSKTGLKSSKTY
FT                   SKPLYSKYRRTILLKHLKQCRDSRAVEIIAWIADKTGDKIVFRDPSGIELFKLRGIGSD
FT                   RIKSLPLETLLWLKGIVADDTIIVVDYKVIHKPVEERIIKYTRIDHIGLTDYAKNYAWY
FT                   FRNPKISSTIKLLSYVTRYSRGILYSKGFIELLPPMISVASDPGLRGAGKLKTKYYGET
FT                   YELTSSVIMFKQASAAVYEKVFFTARNIREEPPENIWTGRHLSEFTQLDIEWAMSGLED
FT                   VMRLAEELLYNVSKTIADKYMDLIYDIGERKEPVILKPPFPRIRYDEALELAEKLGEPV
FT                   EWGKELTHTAETRIAEYYDSPVWIIGYPAISRGFYYLPDRDDPRYNLDFNLLLPEGYGE
FT                   VIDGGAREYRYPQIVERIRKLGEPLHKYGWFIELVKQGGIPPSSGWGLGLERLTRYLAG
FT                   HKHVGYATIFPKLPGIAGTP"
FT   gene            429075..430358
FT                   /locus_tag="Shell_0473"
FT   CDS_pept        429075..430358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0473"
FT                   /product="phosphonopyruvate decarboxylase-related protein"
FT                   /EC_number="5.4.2.-"
FT                   /note="TIGRFAM: phosphonopyruvate decarboxylase-related
FT                   protein; KEGG: SORBIDRAFT_08g017020; hypothetical protein;
FT                   PFAM: 2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase; metalloenzyme domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31604"
FT                   /db_xref="GOA:D7DBQ7"
FT                   /db_xref="InterPro:IPR004456"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR042253"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBQ7"
FT                   /inference="protein motif:TFAM:TIGR00306"
FT                   /protein_id="ADI31604.1"
FT                   /translation="MVVKKLLYLVLDGMADRLSDPVTTLDIAVKPGLDHIARNGVCGLM
FT                   FTVGKGVAPESDEAVISILGYNPHEVYPGRGVIEAVGAGLSIREGYEVAFRANFATVDP
FT                   ATKKLIDRRVGRSLSTEEAHELAKAVDGLDLGKYGGYARVKATIGHRAVVVIGSDKYRL
FT                   SPYVSNSDPAYSRKGLLSVAVKEYEPYIKPVEPIEDTDEARRTAELANIFTEKAIEILD
FT                   KHPVNIKRREKGLLPGNAILLRDAGGTLPKTTPLPEKYGLKFAVLAEMPVEIGIGRIFG
FT                   ADTIALEPPIGDPSEVYSIRLEKSLEALKKYNIVYVHLKGPDEPGHDRNKELKKKKIEE
FT                   IDKYFVQPFLEKMSSDTAILVTADHATPPSIGAHTDDPVPIAVMAETIQPDQTTKLTEK
FT                   ECSKGKLGIIEHGWEMLPKIIKLLNLHP"
FT   gene            430623..431330
FT                   /locus_tag="Shell_0474"
FT   CDS_pept        430623..431330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0474"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="TIGRFAM: deoxyribose-phosphate aldolase; KEGG:
FT                   dal:Dalk_1620 ribokinase; PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31605"
FT                   /db_xref="GOA:D7DBQ8"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBQ8"
FT                   /inference="protein motif:TFAM:TIGR00126"
FT                   /protein_id="ADI31605.1"
FT                   /translation="MGIDSLIEKLSVKEFASMIDHTLLKPNADYKLLEKYVEDTKRYGF
FT                   AVLMLPPSLLLKAREIAGNTIRLATVIGFPLGNTFAGAKVLETRLASQAGASEIDMVMN
FT                   INYFKSGDYDRVLDDMKHVVLEARKNNISIVKVIIETGLLSDEEKVKATELVVESGADY
FT                   VKTSTGFLAGGATIHDVALLYRAAKGRIKVKAAGGIRHALDALAMIDAGASRIGTSTGD
FT                   KIIEEFIKLKEEK"
FT   gene            431511..432638
FT                   /locus_tag="Shell_0475"
FT   CDS_pept        431511..432638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0475"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31606"
FT                   /db_xref="GOA:D7DBQ9"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBQ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31606.1"
FT                   /translation="MLSNKISILLFLGIILALIPIGAVQPVVSGEDLSYYVKYLFTLDI
FT                   FTNVNFSMHTEMIILYNSTMASQDTIHVTISIEKISASLVSGTSTTTTTISPSGSGGET
FT                   EKLEYSVDIGLDNHYKSSFSGGEALRTVSTITNIPLSGMTAYYNISYLGMDTYNGLPVY
FT                   KYKVSMNTSDQDRIFEAEGETYLHIGTLQPLYMYLNMNIEGADSSGTLTYKLETLETNL
FT                   PAKATGLEEDLGKAEILAGGLPGANIVVKGQKGSTTINVTNNGDSPGYLILIYKNKELS
FT                   LSTIPVEQKSPYNILAVKPGESKTIDLGFILDKDIHIATEQISPSIDWGIIILLSIVAA
FT                   LVAGVIYALHRSVNKLKKLKSMTNEGTPPSEIPTQ"
FT   gene            433084..433983
FT                   /locus_tag="Shell_0476"
FT   CDS_pept        433084..433983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31607"
FT                   /db_xref="InterPro:IPR019267"
FT                   /db_xref="InterPro:IPR041165"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBR0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31607.1"
FT                   /translation="MLVTDIIGSRLLYSASPRTYYKAHIVLQVKGEAVLPPYTGKVVKT
FT                   LLISAEPGLEDVFSANYNPKPIAISTLAKRVNNKYLYLWKKSGSDVVLKVDPGDIVEFW
FT                   TGFTEDIASKMVEALTGLDGLELFNTKWSLLEYNIESYKLPAKPEEVPLDYRLDDAVAV
FT                   KVEFRTPALLLDPYKKTIYKRFLPTPGNVFSYNIGDLLRLTRDKEYIEVVILVNALLNE
FT                   TYTVLKTVKPVKYVYGKKSLPGIVGYAKYMIDWDLLVETKAKHLLENLLLHASIMGIGT
FT                   SRANGFGHVTIKVIQSNE"
FT   gene            433976..434188
FT                   /locus_tag="Shell_0477"
FT   CDS_pept        433976..434188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31608"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBR1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31608.1"
FT                   /translation="MSKEKDVAELLDEAIDLVDKIESFLTRIKPNEKIEQGLVFQIYQN
FT                   IVFLREKIVEARMKTLNKTNKKELT"
FT   gene            complement(434353..434808)
FT                   /locus_tag="Shell_0478"
FT   CDS_pept        complement(434353..434808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0478"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31609"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBR2"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADI31609.1"
FT                   /translation="MNKKKSIGDNKRILLDTSFLLPILGFETSERIMKAFYKLGSYQLY
FT                   YNEISILEALWKIVKVIRGEEEEVLRIRQGIRSIFETINHASIDDNAINNAVYMYRLGH
FT                   RDMIDNLLYSIALSRKLLLLTVDEKLIDFIEKHNLPRNNIIAPEQLD"
FT   gene            complement(434777..435028)
FT                   /locus_tag="Shell_0479"
FT   CDS_pept        complement(434777..435028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0479"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31610"
FT                   /db_xref="GOA:D7DBR3"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBR3"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADI31610.1"
FT                   /translation="MSVVVETKVGKKRVIVIPKAVAEAVKIREGQRIRIMAVGDRIVIE
FT                   PIRDAVWLAIHGKKIGRIMPEELEEESILEQEKIYRRQ"
FT   gene            436103..436507
FT                   /locus_tag="Shell_0480"
FT   CDS_pept        436103..436507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31611"
FT                   /db_xref="GOA:D7DBR4"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBR4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31611.1"
FT                   /translation="MDFYAIFSTAILLAVGVYLPNKRGKVIQEVAYFLFFSEILLIEGS
FT                   LIPYIGKWAESNAILFCLFYIILSFIFIIVFLNKFGKDILKGFGFNESGSLIIIIIIAL
FT                   YAITMPVGGVLLAFLHIAYGNSPRSLSLFT"
FT   gene            436529..436864
FT                   /locus_tag="Shell_0481"
FT   CDS_pept        436529..436864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31612"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBR5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31612.1"
FT                   /translation="MKRLLKRWGRGTRKIIESKMRIDEEYKKSVGIIIDDAKTIAEHDL
FT                   KTAKHKLLDLRKTPLYKSLNGEERDTLDNLILEAIEVRRRHDFNEIAETIEERIKELWK
FT                   RHQKTGS"
FT   gene            436908..437129
FT                   /locus_tag="Shell_0482"
FT   CDS_pept        436908..437129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31613"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBR6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31613.1"
FT                   /translation="MDEAVCDGLAASLLVKKYFTEVLGVENRDFEIKKVSYENGKFIIE
FT                   CCVHGGIYDSHYRAIVDENCRLIKVHKV"
FT   gene            437151..438731
FT                   /locus_tag="Shell_0483"
FT   CDS_pept        437151..438731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0483"
FT                   /product="serine/threonine protein kinase"
FT                   /note="KEGG: mxa:MXAN_5045 serine/threonine kinase family
FT                   protein; PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31614"
FT                   /db_xref="GOA:D7DBR7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBR7"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADI31614.1"
FT                   /translation="MDWKGGKRILKLSDEALEEAMRMRGEALEIAEKIRIESAKTMYWK
FT                   RLRGRNVSASIIDFIPATGVYYPGQRVCSRLRFKNTGNVRWTFYISYSVQDGSGKRYNI
FT                   RSHAVTLDPGEVSSWQYMCWDVPRNPVTGWYKVVMVVWKTMPEKDPNAIQLDFRERANS
FT                   FRVLRKEDFAPELASYYSDAEYVGGGGFGRVFKARRRDGKIVAVKIPVSLDREAGKSFI
FT                   RELEAWKRLRHRNIIKLYDYNILPIPYLEMEYADRSLEDLEKPMDVGEAARIILEVAEG
FT                   LKYAHMNGIIHGDLKPQNILLLGNTPKITDWGLAKFRKEDRSPRISPFTPLYAAPEQLL
FT                   EKFGEVDERTDIWQLGAVFYELVTGRPPFYSDDMVETMHKIISEKPVEPGRVNPEARSV
FT                   EHIIMKCLEKSKDKRYQSVEELQRDLAEYLKINYNRSLDETRIKGDLTRSRFFCAQLIL
FT                   LSARYKDYMETIKYLSIFKDYACEEERRQINSLIEQINIRMKREIAFDDELKNRIETLV
FT                   YNVMLKKRL"
FT   gene            complement(439026..440297)
FT                   /locus_tag="Shell_0484"
FT   CDS_pept        complement(439026..440297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0484"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="KEGG: hypothetical protein; PFAM: AAA ATPase central
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31615"
FT                   /db_xref="GOA:D7DBR8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBR8"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADI31615.1"
FT                   /translation="MYQEFHRLLDELDRLITEAREHEKHDPDTALYYYRKSLNIIISLI
FT                   RVTENRETSERLKSIGQKIYYRIEKIKGGRLPKRMGEGVIDKYINDAALEVGVPLNTDE
FT                   YNIVIKPIYSYFKTDVKEFGKILSFNNIKRTNPVLGEIFRIVELRFKRIYRDLSPNYCA
FT                   LLVGPSGTGKTTFARSLMGYIASLCKKSGRKWVYVEIDASRLLGMYMGQSEKTTKAVFH
FT                   TINRMLEDGLNIGVYFDELGGLFSKKAAAINASMGNVLNIFKQETGRLIDLAMRPGGTR
FT                   GFLLMLASTNYPEDLDENIIRRFGGNIVYVGLPHKKEIIFLIKDRLSQLKDIFIDLSEK
FT                   DLDEIAAAMRRKLYSIHDIINALERAKDKAALEAFNKGEKPVLNKNIIMKTIEEVNATN
FT                   SRERIEEMEKWLRNRGVSFRSSLD"
FT   gene            complement(440324..440944)
FT                   /locus_tag="Shell_0485"
FT   CDS_pept        complement(440324..440944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31616"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBR9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31616.1"
FT                   /translation="MQEVRISYRNTIEPVKKLVDELDNEELKGKSLEIIRRIEEIYAKA
FT                   NHFRELASAIYKDWQENYSIYRKTGSDIHQKMAKVQYVQYRKHLEKALNYYEAIYYLVD
FT                   NIIKIITLVEENRRIDILNTLADMANIDPVAQRAKYLKYKDRMEKMMEGYSIVEEGEEI
FT                   EGIDKEMEKEFRELEMKEAKKKPKEEVAPEKEWKKVIMDKEQA"
FT   gene            complement(440950..441579)
FT                   /locus_tag="Shell_0486"
FT   CDS_pept        complement(440950..441579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31617"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBS0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31617.1"
FT                   /translation="MVFRRIFRRKDEEEELYQLLAQVGMIGEQFKKKAKERERQAEKLM
FT                   DELSKVVLVKGESHPETRHLAARAVRAQKNARLFMDLGYEFIMMADDIETAIGLHDMSV
FT                   IFDKISSKLRNIFSRGGFKIPIKPFKGVEDIRQYLGQAIQMISRQLEGDMVNVEEEDIT
FT                   NAIELAKAKATGRHIPREKKEKPAYKSEEVDKLSDIEKKLSDSSGD"
FT   gene            441749..442402
FT                   /locus_tag="Shell_0487"
FT   CDS_pept        441749..442402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31618"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBS1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31618.1"
FT                   /translation="MGGEKKGYAEKLYWELQSKKEIDLGKHGGYRVYYKNKFDREYLLF
FT                   LERRRKLYSFFSSPAVRKLLIDIRENNDDYEALYHLSRVDKIIVIKYTKDIGGNLPPLP
FT                   AGDKVEVIVIEPETLLNKADPDLGIKIFPDKKDSLSRILYNKYLYKDLRVDKIKSYIRR
FT                   RIEEAKASNGKLWVCLKELKKEYKYENEEFWKEFIHMIKNDEDFIYQDEYITTR"
FT   gene            complement(442427..443476)
FT                   /locus_tag="Shell_0488"
FT   CDS_pept        complement(442427..443476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31619"
FT                   /db_xref="GOA:D7DBS2"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBS2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31619.1"
FT                   /translation="MPANNDLHRIINTYLDNYRYNPRLREVICRDQTQIIQTEEEEIIK
FT                   HRILAIKRRGSRYKGYIIFIILFLAIFKGSLYFFSSPWTKYVLTPANMVLDLIMAILIF
FT                   SQPLFFSIARIASRRNNDLGFLDLFRLDIYGLHILRYYPLLANIAAFFRIVYKYLFIPV
FT                   YETMVGAYYIKTVKPTLMHDVFLDISYKTFSNPIYYFGQILGNEILIFSLILLVIGFYN
FT                   KKFFKAREVINKLGFFDNIVNEEVRKDLRYALNAQIIFLYMIPYYYLVVGNFLSIYLGK
FT                   TLGGYLIIAGLLTVLLLSLIFAYFPRYSLDRMIQDLIGQDSTIYYHLWCRDKEPEFVSF
FT                   TYYFLYIIS"
FT   gene            complement(443495..444391)
FT                   /locus_tag="Shell_0489"
FT   CDS_pept        complement(443495..444391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0489"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cjd:JJD26997_1143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31620"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBS3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31620.1"
FT                   /translation="MGNGCRGDLANKITKLEDEGLCLIYNLEHFVTPKDLIREANKILN
FT                   EVREVKDSIKKYCKEGSPASTNIEEMIDKLDFLRNILEEYKDYLYKCLISSKHDKLSDL
FT                   ETAPPSLISYDENSSQTPDISLMNYVIRRASILDKIEERYKAEEIGKLIKLYEVINVCF
FT                   RPMLYQSSYDISGMDRKASTKMIKELHSVLSDKYDKLSKEFNEIKDRIPGFSLLKTFFR
FT                   FKLCILKCITELCSKIASNELEIKRYRDLLGGVIFSIIKNEFEPCLIFNEHLGPLSKFS
FT                   TDTLKHVLNKSIESLIH"
FT   gene            444571..446463
FT                   /locus_tag="Shell_0490"
FT   CDS_pept        444571..446463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to CG18255-PA"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31621"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBS4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31621.1"
FT                   /translation="METGIDVWKLLKEEVLRPVDKVLSYDLEALRRTSEDKRERLWGEV
FT                   VDAHEKFEEFMSELPGAVRREVLGEIELAKLLLATAAKVNGENNPIIDLFSSEELKLVE
FT                   RFERYSVFDILTIDEIVERVARRDEIYDLIMEYYKNEYSDLDKILEDPRIRRSLRYAFK
FT                   KRYKKRLDKVKEGVKAYVEKYGPIIMVRQIEEKIWRKIKESEEERKMIMERLRRRMEEL
FT                   SLKLRPLEDVERKSSVFMDRLHDIESSVFFGEKTGYDEHEKDELLRRYLDFEKLLAEQV
FT                   EAIEKEKRELENRRKELEKAEQEYRRKAEEEAQRIIESELRKIEDLGKELAKKKEELEE
FT                   EVKNVRMKRLEIEETLKQVREAEKGEYRLVTSEDARLAELNFIARFDEKMHAFPLRIHS
FT                   PIEGREYVVKSWREGERLKMSESVAEGIPSNLRLRYVITEKKHKFFGERVRKVVIEAIS
FT                   FNHLREFKEFGFDARKANLAEFLKLVEGAIDKAEIGKYFHVMGIASPTGWDDRVVREIS
FT                   SSEFARNYVSRYISVCLIDSITGDIYYNPADERITKFIEFFKPQFKRERVESVKKTILN
FT                   KLSTKGYVVLDDVVNETREERRIVLKAFYDLEKEGKGKVKNVKDIGTVFDAESM"
FT   gene            446475..449312
FT                   /locus_tag="Shell_0491"
FT   CDS_pept        446475..449312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0491"
FT                   /product="serine/threonine protein kinase with WD40
FT                   repeats"
FT                   /note="KEGG: mxa:MXAN_5045 serine/threonine kinase family
FT                   protein; PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; Pyrrolo-quinoline quinone; WD40
FT                   repeat, subgroup; SMART: serine/threonine protein kinase;
FT                   tyrosine protein kinase; Pyrrolo-quinoline quinone
FT                   beta-propeller repeat; WD-40 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31622"
FT                   /db_xref="GOA:D7DBS5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBS5"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADI31622.1"
FT                   /translation="MVFGWFKKKGSEELKKKAKILKRKINKFTTLLWIYKTGGYVDAVS
FT                   VSADGSYIIAGSDDGRVYFFNRDGELLWSYETDDKVYSVSVSADASYIVAGSGDGGVYF
FT                   FNRDGLLWIYKTGDLVHSVSISSNASYIIAGSGDHNVYFFNREGKLLWSYETGNDVRSV
FT                   SISSDGSYIVAESGWVVYLFNMEGKLLWSHKIGSDVYDVSVSADGYVVAGSKDYNVYFF
FT                   SRSGELLWSYKTGGPVYSVSVSADGSYIIAGSDDGRVYFFNRDGELLWSYETDDKVYSV
FT                   SVSADASYIVAGSGDGGVYFFGFDSEKYLARLYGSTIEKWREEGYDVSELEAEISYSKI
FT                   KDYEARIQRLKQLESELSSLNIKGMNKIKAKLKDPRRVEELEEEVSLLKQALKAINAAR
FT                   TALIETGKLCDVSEAEEILRRAESKFGTGDYAGAVSDANECGRVLEKIKERSKPEIEVE
FT                   LPIKSLKPNYWKASSLILKNKGNMHAEDVRIEFSKEVEVRGLKELSIKAGEEKKITISL
FT                   KPKEVGEVPVEVRVSYKDGVGREYFSERTFIILVSEEVPKTPPPVVAETLPPESVSKHV
FT                   TPGISPAEFTPSPTTPRTFPPELASRYTGVEYVGRGGFARVFKAKRKDGKVVAVKIPAV
FT                   LDEATGKSFLREIENWTKLKHENIVRVYDYNILPIPYFEMELCDKSLAELDKPMDVREA
FT                   AWIVFRIAEGLKYAHARGIIHRDLKPQNIMLKDGIPKISDWGLSKVITESSSSLASFTP
FT                   LYAAPEQITGGVKDQRTDIWQLGVIFYELVTGELPFKGDNPVEVGMAIATREPIKPSRL
FT                   NPEAKDVEPIIMKCLEKNKEKRYQSMEELQRDLAEYLKVEYKRSLSESRAKKDIARSKL
FT                   FCGDLVLLSAMLRDYHEVLKHLSVLKDYAGEEGRKEIDMLIKELELRIKRKIEFDDELV
FT                   ERIKVLVYKVKMSRK"
FT   gene            complement(449813..449986)
FT                   /locus_tag="Shell_0492"
FT   CDS_pept        complement(449813..449986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31623"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBS6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31623.1"
FT                   /translation="MGHLWSYNMEDHVDNVSASLDGIYVVAGSRDKKVYFFNLINSVSL
FT                   LACGPCMTTGSE"
FT   gene            450145..452262
FT                   /locus_tag="Shell_0493"
FT   CDS_pept        450145..452262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31624"
FT                   /db_xref="GOA:D7DBS7"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBS7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31624.1"
FT                   /translation="MDDLSRSQNLSSQNCNLFMDTAVISDNKPVSEKSEIACVISKAFN
FT                   IAAKDHIKLELTSIIVGIILLVFSIFLLILGGVGVIDLAAGLIGIVVLACIGAFIILYG
FT                   LFIHKPDEISMLSKVYVVSHLIPYKPGSALLFDGTGIIPEQVMEYKDIPLAKIKELSSK
FT                   LPSSPISYKNETALVDILDQIKQLTGKIKKYQFKAPVVPNSNLYVNAVLDSLPYCVKGA
FT                   PLRNPLGTKISIQDAVQYRQEIERLEEGKEAIDTMNEVKNTITHKSKPFIDNLIKCLND
FT                   IDSYISNIAELLRERFINGFNIHADPKADAEYGYEYVNSKYHIKVGSSENKNISNPINT
FT                   FQRVIDYFDESIRREIGRIRKDGERRIKERKERAESEERLIRQNYDLQIESKKSEKSTY
FT                   EKQAENAYREYRSSYNQYKSYLEEARRARSGEYPDYEKAQHYEEMAQYYKMQADEYYSQ
FT                   YEDAESRAEALENIINKLESRKKREIKQIRDKASRDIASIKEEIKNEILDLRKFINEII
FT                   EKRNTQIEMFEKIYNTLLSSEKELQSAPFNNRKNTIMELQSSIFSVLDDRIKERSKVLQ
FT                   QIGSFKINIDMQKPTSIYIPFWIIIVKRKKGPETIIFPPLKIIHPSETSKSRWKFVEFT
FT                   APLSNALEKFTDYLKTDWIINEAKTASILGKIDHQVASEIDRLVSRGFFGQGYADRIKK
FT                   YYGLIPVGGEK"
FT   gene            452262..452993
FT                   /locus_tag="Shell_0494"
FT   CDS_pept        452262..452993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0494"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpn:lpg2944 UDP-3-O-[3-hydroxymyristoyl]
FT                   glucosamine N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31625"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBS8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31625.1"
FT                   /translation="MVKKPVLSREAVYDTEDRFEMEAGYYPGDILPRTERAINRPIIIK
FT                   DGCVIHGVIFGGRVQLGNNVRALGIYGDQEVVIGESCEIVGYIQSSGKIRVGSNTKVLC
FT                   DIIGKEIDIWDKVRIYGNVIADGNINVGNDVEIGGYVVSLNGSIGIGDNSKVFDIIAYG
FT                   NIELGHGVVIADPVIWSQKGKITLYSKIKVGKNYEVVHDRDRNIVESNKINLHYILSRT
FT                   FTKSLYNDLIKSLGGVKTRSK"
FT   gene            453013..453495
FT                   /locus_tag="Shell_0495"
FT   CDS_pept        453013..453495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31626"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBS9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31626.1"
FT                   /translation="MPRCPKCGKIYVGDTCPYCDKPKEIKDDRPSLDELGWNDLDEIYF
FT                   DPEKIEKPKIEVHGAYVQGNIYGTYIQGDVKITHGDKTQRDLCYESVLLSAKHKDYSEV
FT                   LKNLSALRDYAGEDERKEIDSLIGEINFRMKREIEFDDELVERIKVLVYKVKMSGK"
FT   gene            complement(453793..454224)
FT                   /locus_tag="Shell_0496"
FT   CDS_pept        complement(453793..454224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31627"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBT0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31627.1"
FT                   /translation="MLAFFILLLTPIAQGQEYELVWSHEICHDWTCYDVYDVSVSADAS
FT                   YIVAGSYNKVHFFGNIRLLAQSAIQEAKSVISQEKSKGYDTGKAKSLLVSAIRTIMKYL
FT                   GYHTEDAESLLSQAQAAFNSRDYSKARILAEGEISCYRH"
FT   gene            complement(454246..456078)
FT                   /locus_tag="Shell_0497"
FT   CDS_pept        complement(454246..456078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0497"
FT                   /product="serine/threonine protein kinase"
FT                   /note="KEGG: dol:Dole_1367 serine/threonine protein kinase
FT                   with CHASE2 sensor; PFAM: Serine/threonine protein
FT                   kinase-related; tyrosine protein kinase; SMART:
FT                   serine/threonine protein kinase; tyrosine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31628"
FT                   /db_xref="GOA:D7DBT1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBT1"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADI31628.1"
FT                   /translation="MERLRSTINGIKEDIEKAEKAKANREMIALVDEANRIVRDAKKLF
FT                   NSEKFDDAMNKFKHAKELYLKAVSIAKSFNFREDWEKILGAIKEMDRSIEACMLEKAGK
FT                   MIEAASKERGKAKEKRFSQTLEYLNSISFKISFGKKQYNELKKKAMIGIVRARIEIGED
FT                   MMRNGEEFFNKREYYNAKEAYRRARDYFEKLSDYIAENKISELKDEVDAHIYICVENIR
FT                   RCTDVMIGRKSVREVKLMGVGEIERGVEVKREDIILTFPKDLLKYYTEPKYIGEGGYYW
FT                   VYKARRREDGRLVAVKIPKYWDEKMGKNFVDEVSIWKTMDHPNIARIYDYNVVPRGYIE
FT                   MELADYSLDRIEKPIPPMKAARLIFEIAKGLRYAHSKNVCHLDLKPGNILIKDDKPKIT
FT                   DWGMAKVLRRSRLTSGKAKGYTPLYAAPEQIKDEPVDEKTDIFQLGQIFYELVTGKPPF
FT                   EAKSEEAVKHKILNEDPIPPSKLNPDAKFLEPIIMKCLEKNKENRYQSIRELLMDLAEV
FT                   LGMEIKVTRDRVLRINSHSMIIEIYLETEDLEKCITQLKHMRDDVSSDVKAEIDEVIRM
FT                   YDAYRSTKSIEIDSLKREIKEKLKEIINMARIKV"
FT   gene            complement(456054..456428)
FT                   /locus_tag="Shell_0498"
FT   CDS_pept        complement(456054..456428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31629"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBT2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31629.1"
FT                   /translation="MENYIKVKKEVKKAIEEIRRRNPGANFGEAFQYLLGVREALENDE
FT                   LDRALELARKAQLAAKPTTDYLLSRARKLDNEGGKAFESGRFSDAIEKWRIALEEYESA
FT                   LELAGRRRGRERLWRGLGAQ"
FT   gene            complement(457424..457555)
FT                   /locus_tag="Shell_0499"
FT   CDS_pept        complement(457424..457555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31630"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBT3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31630.1"
FT                   /translation="MGLGAKLPSTPRAPYVERHNLEYLKFSTPSGLAYLTSGAKAWS"
FT   gene            457704..458846
FT                   /locus_tag="Shell_0500"
FT   CDS_pept        457704..458846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31631"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBT4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31631.1"
FT                   /translation="MTVPYWRVNRAIARDLFGVESSDVDRLIAAKVRSVRRRMPGKSSL
FT                   PGEICGSGILAYHLELYYCLEKFKNEVSVLRYVSEDRRRAKVFLLHTILGLLWPRLLAL
FT                   ETTHLPIDKYGKNIVEAVKTEMRGILANFNPIDIPISLHSCLQLKEAFKEILIQLPAML
FT                   NDIYRHPTVRRQLARDVKWRMRYEECMKNLLTSSLEGEKSAGIGNVLPLIFSKQYRVTI
FT                   GKDEIVFQDINNPNRKTVIKGDKCFRILLRSILRGRRMNSKDRFEWLMDRVSRFSATHS
FT                   RLLDLFLLAPFTIKDIYYFLLDTDENDLFSTLFSLGTNVLKSCKDQEDDETLRRKIIDM
FT                   VDSSWRSDLKEYNIPLLEGCAETYADTFIAGYKLVKSITR"
FT   gene            complement(459125..459262)
FT                   /locus_tag="Shell_0501"
FT   CDS_pept        complement(459125..459262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31632"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBT5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31632.1"
FT                   /translation="MFLLDASAIAIWKQSRKIERKRKALESSTKAIDTEECINIQQTQQ
FT                   "
FT   gene            complement(459262..459489)
FT                   /locus_tag="Shell_0502"
FT   CDS_pept        complement(459262..459489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31633"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBT6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31633.1"
FT                   /translation="MTSVTVSARIPRRLKEKLDRYGIKISEVIRRALEEEVKRRELEEA
FT                   RKASRDLGDLFSAISEKEIVEAIREDRLKR"
FT   gene            459737..460672
FT                   /locus_tag="Shell_0503"
FT   CDS_pept        459737..460672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31634"
FT                   /db_xref="InterPro:IPR021246"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBT7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31634.1"
FT                   /translation="MIPRLFYFDTRFYSKEYVRVSGLDLFMGLDRGRELVRYKLVFKGL
FT                   VVQEEGSHTLHLIVPGEKIVFVESYVEYCHWHNGPLNRKDNPLEREYCVREAVSELGYC
FT                   TKHRNSVRAIYSKCFSTSGLESLRNCWILDEKYKDKIKYTVYLLAYNKDKFKVGTTRSW
FT                   RLLDRIAEQPHVAATTLYESNSAVETRNIEIKAGKLEGLTEKPHRKLKETIKTPIPPTL
FT                   LKLEKTLTKTQRILGIKQTKQPTIFRIEPSTEITEYHKAKETNLKQIIGKQLIIQDYYA
FT                   GHLLLEETNTNTKYLLKTNQILHTPSIKTT"
FT   gene            complement(461191..461460)
FT                   /locus_tag="Shell_0504"
FT   CDS_pept        complement(461191..461460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31635"
FT                   /db_xref="GOA:D7DBT8"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBT8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31635.1"
FT                   /translation="MKTIHYVVIALLLTILLPPTLIFLFRDLLIISLRYWYIILPSIYA
FT                   AAYILWRLRRKALSILLVSLATGLILSVIIVLLIIMYAIIMTEY"
FT   gene            complement(461844..464681)
FT                   /locus_tag="Shell_0505"
FT   CDS_pept        complement(461844..464681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0505"
FT                   /product="hydrolase of the HD superfamily (permuted
FT                   catalytic motifs)-like protein"
FT                   /note="KEGG: dol:Dole_0744 CRISPR-associated Csm1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31636"
FT                   /db_xref="GOA:D7DBT9"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR041062"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBT9"
FT                   /inference="protein motif:COG:COG1353"
FT                   /protein_id="ADI31636.1"
FT                   /translation="MYMGGSKRSLGYYELLFAALLHDIGKIPQRAGIGVAENYRTHDDL
FT                   GARLINEYRDLFEYIGLNPETIRLLVRYHHHALRGFKPPETIKDLLYILEKADRSSASE
FT                   RNMGDEIYSKQKSITNYLVSPLWIINYYRHGRSSDHNIEKLPRESTICYKPVSIMSVLR
FT                   GRSSEKDMEDIEKDLENILRAVNCFHEEKKNDHGVREYYAEIYKDLVEILRELGKTAFA
FT                   GVMGVEELLETLVNYIRYSFIFVPNALYGVDIPSTNLSSHSILTMALASSYILSGCYEG
FT                   SECRIRIGLLDLSGIQKFISSYARRKGALRQLRGRSLLLQLVMKASSIKLLKELKLNIS
FT                   HMILERGDSAVFILPETIDEKTFNNAIEKIEEAIYELFHGDIYVTYGLSEPFTPSYQSP
FT                   WSNEFVEKGFSKALLDLGGKVSRSKRQKFKLVDQSILAKNTIIDDNDDREPDECPLCKA
FT                   TLFKDNLVPINKEITQEIGLEEDIERICPSCLLSHIAGYAAENLVYIIEIRSKDITDKL
FT                   FEELRKGNIKSFINKISAINAKYGIVPLKGLDTTYIIISDLSGGETGHWAFLKSFIEVV
FT                   LANLIKKYGGEEKVSIIIYKNNDPGNFIPRGKDLVDLISILEKIKNTHVGFSVIFTNVS
FT                   LRQNELDDLARVDDNYTLLSWLKIDGDHMGYTGLHLIGSLGRYATFNELVSLYTNLIGH
FT                   LILYKRAKLLDNTNPLLRNRIAVIYSGGDDSLVIARFVEGLYYLQYYHDWFMKFFGKIN
FT                   GVDALTISAGMILRESNYPSYLSYKEVVQSLEKAKDEGRNRVFVEPLSINVEGIGSIPW
FT                   SLYNILMNKSLDEEIKQWITNNKQQSYRLLQISRSIVEYYYKYQREKNAEKKNEYYRRI
FT                   IEYLIAYIYIYNRLPKIEKFIKQLTDKGILTISLDPKTIIEKYSTGKINETLVSNFDKL
FT                   SRLLALAMLRLREKL"
FT   gene            complement(464692..465879)
FT                   /locus_tag="Shell_0506"
FT   CDS_pept        complement(464692..465879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0506"
FT                   /product="CRISPR-associated RAMP protein, Csm5 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP protein, Csm5
FT                   family; KEGG: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31637"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR010173"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBU0"
FT                   /inference="protein motif:TFAM:TIGR01899"
FT                   /protein_id="ADI31637.1"
FT                   /translation="MEKNIVEKHRINLEVMTETHVWDGNTLFRNIDILTSIAENRKIAY
FT                   LIDIGKLTRIITGRNGYRDLMNALKQRNISMLIPKYKVNIEDVALTTYQLRTEPKQLGI
FT                   EIKNHLSINNVPSIPGSELKGLLRTAILNYMIMHNLIDPKIIENTLNNLSFSERLKNID
FT                   AAIQNAIKKRINAKSTPLDLLRFIGISDPVKNKVNPVIDKVMALKLTNIEEIASEDIIG
FT                   LSEGSTFEYELSIYKPVLKDHILGNYNVRSYDELYKLYNILIEENGVLKLLEILREFSL
FT                   KLIDFEIGRIRGIKGKIDLSFIDNLYKWRNEVLQNNNIFYFRIGYGTGMYSKTVYLSLS
FT                   PEQQKKLVQIMSSIIAAKTRGRINIWDTLTMKIVGSEYTLNNKLVPVGWVRLEIK"
FT   gene            complement(465881..466939)
FT                   /locus_tag="Shell_0507"
FT   CDS_pept        complement(465881..466939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0507"
FT                   /product="protein of unknown function DUF324"
FT                   /note="PFAM: protein of unknown function DUF324"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31638"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBU1"
FT                   /inference="protein motif:PFAM:PF03787"
FT                   /protein_id="ADI31638.1"
FT                   /translation="MIEWYKIYFETPVHIGERGVGVESVNKLVPSTTIWSALIYSMIQL
FT                   GILDSREDFSNLFRVNTLTPIINSEPMFWINGLNTILYNKIIQLINNTESHNPLKVFND
FT                   TNNILKNTILASTNLLKHDISKCILEARESRDEAGNIELKLQCGTESFYFSRLKELGYA
FT                   LTSNKEEPRNILKIDRRPKNIIDRITSSATPYHLSVVIYNVPLLLGIEILDNNISRKDI
FT                   EASLRLLSDLGIGGERTHGFGKFTYEHADLEILDNNDGSYRIIQGLYFPGTQYLEKILN
FT                   EEAYYNIKIHGYRSGFAGYPRKPVFTLSEGSIIPSEKYVKGLIIVDQRYGDRVVRSFDP
FT                   ITFRIKLSCTGD"
FT   gene            complement(466967..467920)
FT                   /locus_tag="Shell_0508"
FT   CDS_pept        complement(466967..467920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0508"
FT                   /product="CRISPR-associated RAMP protein, Csm3 family"
FT                   /note="KEGG: msu:MS1649 hypothetical protein; TIGRFAM:
FT                   CRISPR-associated RAMP protein, Csm3 family; PFAM: protein
FT                   of unknown function DUF324"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31639"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013412"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBU2"
FT                   /inference="protein motif:TFAM:TIGR02582"
FT                   /protein_id="ADI31639.1"
FT                   /translation="MMSQEQYIRRKLIGVVEIRFKLINKTGLLIQSPLAKTTIGGHDIQ
FT                   PMFIVKNYGNITKDNQVYEVGEIEVPYIPGSSLKGRIRSLLEIYEGAPLYSSDNKIYIH
FT                   VRDIAKNWCTDLEHALDNLFGSPSVDLSKIAKKNRDLYNEILEKYAPTRLIVEDIYPST
FT                   EYISKLLDKGALSKEAFIEEKTENSIDRITSAANPRTILRIKPDVEFKGAFRILLYDVD
FT                   CSNDKIREYIKLLFTGMKLLEDTYLGGFGTRGYGKVEFKVISIKLKKPEYYETGNKQHM
FT                   VDLLERIKLGKTDVETLLSKTNEIAGEIFKEIKCSQ"
FT   gene            complement(467939..468361)
FT                   /locus_tag="Shell_0509"
FT   CDS_pept        complement(467939..468361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31640"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBU3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31640.1"
FT                   /translation="MSYRYQKDILVNTYLDIVKNKNYDLVLQNIAKYGRNYIKYTSKTA
FT                   YRKIHSILTSILDKLLSNPEDRDKYIADLVESAILIRYQAERKQLNRDLSNSLVGILET
FT                   FLKQIRNLDDESLRVHVRTIKMIIDSMLAFYYNKFE"
FT   gene            468592..469239
FT                   /locus_tag="Shell_0510"
FT   CDS_pept        468592..469239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31641"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBU4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31641.1"
FT                   /translation="MVNLYLVIVRSDQKVNTSVINSILDLVNELFISWFNGSYHNGLFF
FT                   GVISDFYGLKDVALAFYSLIASFIKNIRIYVFDYNDLLLYIFNGVKGRSVSFSTILSKS
FT                   AYVGYIIACNKGFPRASKIRLNEQIMDNVCRSYGIKEYVSTSSIREKCIMDKLSGSIKY
FT                   GKYVVNILFKCDSVNDLLQLLRQIILMGIFSDKLFIQECVIKPLWRIHENKQ"
FT   gene            469504..470046
FT                   /locus_tag="Shell_0511"
FT   CDS_pept        469504..470046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31642"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBU5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31642.1"
FT                   /translation="MSTDDELLRILEKIASRIVEKEKKKEEYRSRVEFSVLSTDSPHGI
FT                   YVYDKEKDKWVLVKKENGPFKPDKDGFHIVYFDNVKCPACKIYDLSWYPYVRLVGSTLE
FT                   NTYFYIVYCDWFAQECDSEAARNSFKHYDIRASPTTLLLYVENGEVKDQKKVEGAKTLD
FT                   KLASIIDEFIRRNKKKQ"
FT   gene            complement(470050..470535)
FT                   /locus_tag="Shell_0512"
FT   CDS_pept        complement(470050..470535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0512"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="KEGG: mxa:MXAN_2759 molybdenum cofactor biosynthesis
FT                   protein B; TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31643"
FT                   /db_xref="GOA:D7DBU6"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBU6"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ADI31643.1"
FT                   /translation="MSISFLVIVVSDNVFQGLKKDVSGEVAVETLKNNGYVVVDKVVVP
FT                   NNPREIVKVIRERRGDVLLFIGGTGPGPRDITVDTVESIAWRKLPGFGELFRRLSFEEI
FT                   GFRGIISRAELFILYDGRIAVALPGSTGAVKLGLKILLEIIPHLYEEIWRFEGPHKT"
FT   gene            complement(470767..471867)
FT                   /locus_tag="Shell_0513"
FT   CDS_pept        complement(470767..471867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0513"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ade:Adeh_4137 ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Transport-associated OB
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31644"
FT                   /db_xref="GOA:D7DBU7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBU7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI31644.1"
FT                   /translation="MVDVHLRSVVKRFGKTIALRGIDLDVNNGEFIVLLGPSGCGKTTT
FT                   LRIIAGLERPNKGRVIFGNKDVTYLPPRERNVSMVFQSYAVWPHMKVFDNIAFPLKIKG
FT                   VPKEEIRKKVRWAAELLRIEELLDRYPHQLSGGQRQRVAVARAIVVEPDVLLMDEPLSN
FT                   LDALLRVKMRSELKKLQRKIKVTTIYVTHDQVEAMTMGDRIAVMNSGMIMQVGTPDEVY
FT                   NKPANKFVAGFIGTPQMNFFDATVMVENNKAVLDAGDFKIEIPGDIAEVLKEYIGKTVI
FT                   VGIRPEHVYPEEFIPSKTRRLAKIQGKIDFIEPLGSDTIIHLNTGSNIIVVKLSGSHKF
FT                   HGETLTAYIDIDKIHIFRKEDEKTII"
FT   gene            complement(471882..472724)
FT                   /locus_tag="Shell_0514"
FT   CDS_pept        complement(471882..472724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0514"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ara:Arad_9760 sugar ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31645"
FT                   /db_xref="GOA:D7DBU8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBU8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADI31645.1"
FT                   /translation="MVEEQVILEKKSVVRYYLFKILFAAAVIIVVSWVVLPFIMTIIYA
FT                   LSDPLQYYNRYIILPTRYTFEHVKSLLDLGAGQAIINSVIVASLTILFSFIIGLPAGYA
FT                   FARYKFRGKDSLKLFLVGLRMFPIIVIAVPLVTLYLQLGLNDTLLGVALAHTAMATPFV
FT                   VLITSSIFAGVPVELEEAGLIFGLSRIQAFLRITMPLALPGLTAAAIFTFIMSWNEVFI
FT                   AAVLTFKNRTLPAFILQSALASTDFIKFSAAFIMVIPAIVFVFVAGKYLIQMWGITLK"
FT   gene            complement(472730..473608)
FT                   /locus_tag="Shell_0515"
FT   CDS_pept        complement(472730..473608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0515"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rlg:Rleg_5386
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31646"
FT                   /db_xref="GOA:D7DBU9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBU9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADI31646.1"
FT                   /translation="MGNEEIPFMVKIEKYIPYLLLMPALLYMVFFIGYPLVQAVGLAFF
FT                   ENGEFTMANVNYLFYSPLSKFWDALKYTLLLAAFIIPIQVGVAFAIALLMNVPFKGHNL
FT                   AVYSIILPLTISDVAAGLIWYVMLSPNGFFNKLLISAGIISEPVRFFGAANRNMEFLAI
FT                   VITEVWRATAIVFVILFAGLQMISREYYEAADVFGATPWQRFRYIVFPMLLPSLQAALI
FT                   IRTLFAFQIFGVVWTLAGRDIPVLAGEAYYEQTELHHSGVASLYALIIALISVVIGYIY
FT                   TKLFKARYLEA"
FT   gene            complement(473748..475079)
FT                   /locus_tag="Shell_0516"
FT   CDS_pept        complement(473748..475079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0516"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ara:Arad_9763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31647"
FT                   /db_xref="GOA:D7DBV0"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBV0"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADI31647.1"
FT                   /translation="MGYEAISKTLAIIISIIVIAAIIGGAYWWYVSTQQQQQVTVTWAS
FT                   TQLVPPEEQAFVKGELLPPFTNETGISVEFVGLSYDELNTRLQSEEQSGKVTIDLIGEL
FT                   HGGIDYFASQGWLEDLSKFPALSGRTFPDVLEQYSHIHGIKAYIPWMTATYVMVVNKKA
FT                   WDYLPSGLTKDDVMTGTEKWTYDALLEWAKNLYEKTGGPKLGFPAGPNGLFVRFLHGYL
FT                   YPSFTGAQVKNFNSDDAVAMWQYLKELWKYVVPESTTYDAMADPLLKEDVWIAWDHTAR
FT                   IKDAIEQKPDQFDVVPVPRGPKGRGFILVVAGLAIPKGAPHEDEAWKLIDYLTRPETQV
FT                   KVLEEVGFFPTVKEASEQVPAGPLQVLAKGVMAQQSTSDALVALIPSLGAKGGDFKQIY
FT                   LTAFEKIVLNNEDIKSTLDNLYPQLIDLFQSQGLPLPPPDQPVG"
FT   gene            complement(475268..476413)
FT                   /locus_tag="Shell_0517"
FT   CDS_pept        complement(475268..476413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0517"
FT                   /product="Myo-inositol-1-phosphate synthase"
FT                   /note="PFAM: Myo-inositol-1-phosphate synthase;
FT                   Myo-inositol-1-phosphate synthase GAPDH domain protein;
FT                   KEGG: pay:PAU_02396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31648"
FT                   /db_xref="GOA:D7DBV1"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBV1"
FT                   /inference="protein motif:PFAM:PF07994"
FT                   /protein_id="ADI31648.1"
FT                   /translation="MIRVVIIGQGLVGTHFAVGIEKLKQNLIPDYGVPLGRKIPIPYKD
FT                   IEIVGSYDVDNEKVGKTIYDIALNIFPKQEVPETLKNIVVKRGIHLDSLKGLPFKAEGL
FT                   EKGRSLREAIDDLVNEWRILDADVFINVITTEPVEAIGSDEEIEKNIDEGKISASQAYA
FT                   YAVAEYSRRVKPAVFINAIPSPIANDPGFIELFRRSNAVVFGDDGATGATPLTADLLEH
FT                   LRERNRRVLDIAQFNIGGNTDFLALDQPDRNNMKKKTKSSIVEDILGYNVPNYIRPTGY
FT                   LEPLGDRKFVAMIIEYLSFNNFKDELYVVARINDSPALAGLLVDLVRLGKIAVERKAYG
FT                   TIYEINAFYMKNPGPSKAKSIAKTKAHDQLLSWLRRNNSQL"
FT   gene            complement(476437..476838)
FT                   /locus_tag="Shell_0518"
FT   CDS_pept        complement(476437..476838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0518"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31649"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBV2"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADI31649.1"
FT                   /translation="MTIKAVKRLKRKITVENLWIYILKIIMDHGEIRGYDARKYLREEY
FT                   GIKVPAITTYTVIYRMEREGLIKKIGNGDKYYKITEKGYEAFKQGINIIKESLSKLDPS
FT                   HSIREKTSSPDQSMDETNHSPSTPLNNTS"
FT   gene            complement(476909..478240)
FT                   /locus_tag="Shell_0519"
FT   CDS_pept        complement(476909..478240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0519"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="KEGG: DPS1; Cytoplasmic aspartyl-tRNA synthetase,
FT                   homodimeric enzyme that catalyzes the specific
FT                   aspartylation of tRNA(Asp); class II aminoacyl tRNA
FT                   synthetase; binding to its own mRNA may confer
FT                   autoregulation; K018-TRUNCATED-; TIGRFAM: aspartyl-tRNA
FT                   synthetase; PFAM: tRNA synthetase class II (D K and N);
FT                   nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31650"
FT                   /db_xref="GOA:D7DBV3"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004523"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBV3"
FT                   /inference="protein motif:TFAM:TIGR00458"
FT                   /protein_id="ADI31650.1"
FT                   /translation="MVVDNVLLLKYSFNYVEPIMDGDIGLRICGWIIRLKIVGKVVIIE
FT                   VSGNTSVKPYVLVLKKNREPELFEKAKKLSIGTALCFEGEKSPVQKSKRGVEYIVRKLE
FT                   IYSEPLEPLPVDTVGKVPALLDTRIKYRYLLVRNPVEKAVFRIRAGIIEAARQYFNNNG
FT                   FIEIHTPKIVAAGAEGGATLFPIQYFDNKAYLSQSPQLYKQMLIAGFPRVFEITPYFRA
FT                   EKFNTTRHLNESWGIDAEQGFINGVEDVLNTLEDLIVYINDYIRKNYVEEQEILGTEIE
FT                   KLEKPFKRLRFEEAIDLLRSEGLEVSEGEDLSDAAEKKLGEIMEEKGYKIYFIIGFPWQ
FT                   STGFYYMREEDGYHTRKFDLDYKGLEIASGGQREHRYDKLVSALKDKGLNPEDFAFYLE
FT                   AFKYGMPPHGGFGLGIERLMMKMLGLENIREAILFVRDRTRLIP"
FT   gene            478668..478940
FT                   /locus_tag="Shell_0520"
FT   CDS_pept        478668..478940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0520"
FT                   /product="Ribosomal protein L35AE/L33A-like protein"
FT                   /note="KEGG: hypothetical protein; K02917 large subunit
FT                   ribosomal protein L35Ae"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31651"
FT                   /db_xref="GOA:D7DBV4"
FT                   /db_xref="InterPro:IPR001780"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR038661"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBV4"
FT                   /inference="protein motif:COG:COG2451"
FT                   /protein_id="ADI31651.1"
FT                   /translation="MIRVPGLIMSFRRGPRHQYNRQVLIKILDENIPRKSLVGAKVEYV
FT                   DKYGNKYTGRITRGHGKGWNNVYRAIFYHGLPGQAINSRAFVIKK"
FT   gene            479045..479872
FT                   /locus_tag="Shell_0521"
FT   CDS_pept        479045..479872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0521"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31652"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBV5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31652.1"
FT                   /translation="MPRKKKTRHGKHKTLLDYFSKFEEPNKQVANGIGSNPTGSNNKSA
FT                   GKNMGESLEKRVSEKTLGVEPGGSSPEQIDQSTKNQQVEKNNKNELLELLSILETGKKK
FT                   TNKQVENMEDFKPSSVSFLDKNINIAFEGSIIDVDLGQLRLPTGKILEEIFEKGLGKDD
FT                   VTCYNNGKCSDGVSIGETYTDKYGFLRQRGYINTTRLPVYMDWIVEEGIVKPILERAYG
FT                   LKTNRGAVALIPEDYLCELQLRYGIKLLNFDKCKGHKSIVEWGIKTTRRKRRK"
FT   gene            complement(479937..480293)
FT                   /locus_tag="Shell_0522"
FT   CDS_pept        complement(479937..480293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31653"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBV6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31653.1"
FT                   /translation="MPRIKKIVYEDQEVIVALAPRDEELPEMVLETIKEKGRPMFFDEL
FT                   IKEFSGIAGEDRLRKAVNHLLALGAIIEFPDGSLGTPDMKWIPRKTRRRRRRRTPRLMS
FT                   DMAMPKTYYKPPEQ"
FT   gene            480510..482432
FT                   /locus_tag="Shell_0523"
FT   CDS_pept        480510..482432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0523"
FT                   /product="indolepyruvate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /note="KEGG: dol:Dole_0440 thiamine pyrophosphate binding
FT                   domain-containing protein; TIGRFAM: indolepyruvate
FT                   ferredoxin oxidoreductase, alpha subunit; PFAM: thiamine
FT                   pyrophosphate protein domain protein TPP-binding; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31654"
FT                   /db_xref="GOA:D7DBV7"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBV7"
FT                   /inference="protein motif:TFAM:TIGR03336"
FT                   /protein_id="ADI31654.1"
FT                   /translation="MPKTDLLARKGSKILLMGNEAIARGALEAGICFASAYPGTPSTEI
FT                   VESLASVAKKAGIYVEWSTNEKVAFEAAYAAAISHVRSLVAMKHVGVNVAADILMSSGY
FT                   AGTNAGFVVVSADDPGQHSSQNEQDNRWYGMISHIPVVEPSSPREAYKLVKEAYRLSEK
FT                   YKHPVIFRSTTRISHTRQPVLLEEDIPAEKKCRGKFERTIERWVLVPAHGRKQKRRMMS
FT                   VWKQVREEEGHPPFITVFNPGRRKVVVADGIAYTHVAEALELMGKTDEYTVVKVNLPVP
FT                   LPYKPLVEALQDAKQVLIVEELDPVVEMQVKQIMYENGLAVDLHGKDFVPENGELDLDT
FT                   VYRSIAMFEGREPAAPWEPMKPLDLTPKIPPRPPVMCPGCPHRNTFYIVKVAANKARLK
FT                   NPIFTGDIGCYTLGYQKPFYTQMTSFEMGGSIGVAHGLSKVVDEPVVAVIGDSTFYHAG
FT                   IPGSINIAYNKGKAVVLVLDNYYTAMTGHQPHPGTGKTAMGEETYRVPIEKILETIGFE
FT                   TYVINPMNVKESINKVAEAFEKYKEGKPVAIVSKMKCALQAIRDARHKGIKLPVYTILQ
FT                   DKCTGCMVCVNLLGCPAIVVPKGSKKPVILPELCAGCGLCAQVCPFNAIVLKEKGSPNW
FT                   LEAWF"
FT   gene            482450..483052
FT                   /locus_tag="Shell_0524"
FT   CDS_pept        482450..483052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0524"
FT                   /product="Indolepyruvate ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.8"
FT                   /note="KEGG: gur:Gura_2134 indolepyruvate oxidoreductase
FT                   subunit beta; PFAM: Pyruvate/ketoisovalerate
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31655"
FT                   /db_xref="GOA:D7DBV8"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBV8"
FT                   /inference="protein motif:PRIAM:1.2.7.8"
FT                   /protein_id="ADI31655.1"
FT                   /translation="MPRRYNIVVAGVGGQGLLTLGRVLGNAAIEAGIDLSIAETHGLSQ
FT                   RGGSLIVQIRLGEGESPMIPRGAADLLIGLEALETARQIIYANKETRIVMNKFIWPPPL
FT                   EIYPDIDQIIEKIKERNLRLYIIDANRISEEIAGSIISANMAILGYSYAVDPGLQERLE
FT                   YKHLVKGLERVFRGKVLELNKKVLETAYDLGRKQVEK"
FT   gene            483147..484106
FT                   /locus_tag="Shell_0525"
FT   CDS_pept        483147..484106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0525"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; polysaccharide biosynthesis protein CapD;
FT                   short-chain dehydrogenase/reductase SDR;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: rlt:Rleg2_5599
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31656"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBV9"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADI31656.1"
FT                   /translation="MSSRILVTGGAGFIGSHLVDELLRRGYYVRVLDNLSSGSLKNIQH
FT                   HIGEKNFDFLRGDLKNMDIINNSLKDIDTVFHLAANPEVRLSTTDPEIHFRENIVATFN
FT                   LLEAIRRSGGVEVLVFASSSTVYGDPQIIPTPETHEIRPISVYGASKAACESLICSYAH
FT                   LYGFKALSLRYANIVGPRLNHGVIYDFILKLKKNPEILEVLGDGTQKKSYLYVKDAVDA
FT                   TLHVYDRISKTYDVYNIGNEDWITVREIAEIVAEAMGVSPRIIYSGGTPDGRGWPGDVK
FT                   YMLLSIDKLKKLGWKPKYSSREAVKLTAEALVREIIGK"
FT   gene            complement(484205..484588)
FT                   /locus_tag="Shell_0526"
FT   CDS_pept        complement(484205..484588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31657"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBW0"
FT                   /inference="similar to AA sequence:KEGG:BRAFLDRAFT_104070"
FT                   /protein_id="ADI31657.1"
FT                   /translation="MSYWWYRIMKRYRPPPPPPWYAPPYPYQYPYQQQTQPQQQTQQVQ
FT                   QPTQQQWRPPQPPQPVYQPVPPYFPPPPLPMSPEEELAMLEDYKKALEEDLKELQEELR
FT                   SVEERIKELRETLKKQGGEATYR"
FT   gene            complement(484604..484858)
FT                   /locus_tag="Shell_0527"
FT   CDS_pept        complement(484604..484858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31658"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBW1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31658.1"
FT                   /translation="MSWYPPPPKWYYAYPPAPIPPYGCYPFYDPEYLTAVMTQYMIYPY
FT                   YYMLTIEIYRTMLDTWRKTMETFIKSLEQYKTYTKTSES"
FT   gene            complement(484863..485147)
FT                   /locus_tag="Shell_0528"
FT   CDS_pept        complement(484863..485147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_2108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31659"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBW2"
FT                   /inference="similar to AA sequence:KEGG:Gura_2108"
FT                   /protein_id="ADI31659.1"
FT                   /translation="MAWFPWFGGWGWGKGKGGWRGPWPGKGPFSYLPPWQRPGWILGRG
FT                   AYRWFYPWLGYYWYPWYYYPYYTTPYITPYTPTYYPAPYYYFRPWWGWW"
FT   gene            complement(485226..485708)
FT                   /locus_tag="Shell_0529"
FT   CDS_pept        complement(485226..485708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0529"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: dat:HRM2_15510 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31660"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBW3"
FT                   /inference="protein motif:PFAM:PF02579"
FT                   /protein_id="ADI31660.1"
FT                   /translation="MAWQGYGWGKGRGKGWGRGRGGPRWTGGGPGGFQPYQPIQPQLPP
FT                   PPPNGVRAAVCVDDNNGLESHVSPVFARAPIILFIDIVNGNIANIYPVQNPYAMGGGGA
FT                   GFAFAQFVAGAGARIVIASTIGPNAQAMLQQQGISVYSVPPGSRVVDALRGAGLIR"
FT   gene            485865..486455
FT                   /locus_tag="Shell_0530"
FT   CDS_pept        485865..486455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0530"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: sat:SYN_01458 MarC family integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31661"
FT                   /db_xref="GOA:D7DBW4"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBW4"
FT                   /inference="protein motif:PFAM:PF01914"
FT                   /protein_id="ADI31661.1"
FT                   /translation="MDIDIYQLTSAILMLFVVLDAPGNAPLFYFFTKDMEPWRRIYTIR
FT                   KSIIIATFILLLFGLFGDYILLYFDITVNDFRIAGGIILFIYAVLGILGHTTAEEVSGE
FT                   EIAVVPLATPLLAGPGSITVVIYLKYSMGLVISLLSIAINMIIAWIMLENGGKLLQLLG
FT                   KQGSTVLSKILAILLAAYSVAMIREGIISIINV"
FT   gene            486598..486969
FT                   /locus_tag="Shell_0531"
FT   CDS_pept        486598..486969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31662"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBW5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31662.1"
FT                   /translation="MAEELPDYLKMKLMKKIMSKAMKSSEEKKKAGKEKTDPEKIVWEK
FT                   LRDERARELMYKAKTLYPDRYPLVIQVLHTLIHQGKIKELDGYTTLLLLHRLGVPVKPD
FT                   LKIRFVKHGKEVDMKEYLE"
FT   gene            486973..487280
FT                   /pseudo
FT                   /locus_tag="Shell_0532"
FT   gene            complement(487881..488600)
FT                   /locus_tag="Shell_0533"
FT   CDS_pept        complement(487881..488600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0533"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: smd:Smed_3588 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31663"
FT                   /db_xref="GOA:D7DBW6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBW6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI31663.1"
FT                   /translation="MIEIRDLYVEIGSFKLSIPYLSINDNEYLIVMGPSGVGKTVFLHT
FT                   LAGFHKPLHGEILVNNKNIAELPPEKRGFVLIPQDYGLFPHMTVKENIGFGLMIRGIDK
FT                   DVIEKRIYEISKILGIQHLLERKPDTLSGGEKQRVALARALIVEPKIILLDEPLANIDP
FT                   ENKVKIRSFIKELRKKIKFTAIHVTHDIIEAIDLGDHIAYINKGKLIGKYTIKEFLNTE
FT                   YAKPYIEEIKPIINHLY"
FT   gene            complement(488597..489397)
FT                   /locus_tag="Shell_0534"
FT   CDS_pept        complement(488597..489397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0534"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: nam:NAMH_1313
FT                   sulfate/molybdate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31664"
FT                   /db_xref="GOA:D7DBW7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBW7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADI31664.1"
FT                   /translation="MLVQGLRRIEGFLLVFIAVSSLGILLILSPIIALFISVDPETFSQ
FT                   VWLQDNVFSRQAYPALLLTIQASITSTLILLVIGIPTGYLLARYSFRGKQLVEGLIDVP
FT                   LMIPHTIVGIMILLAYGHNGLFDDLPRVLGFSVENSFWGIVAAMLFVSFPIMIDTLKLG
FT                   YEKISVSLELVARSLGANRWVTFAKITLPLLLPNIIVGFLLSWARALSEVGSILIVAYY
FT                   PKTINVLIYEWFNTYGLKYTTALSSIVVLLSLLAFIGIRVLFRK"
FT   gene            complement(489378..490418)
FT                   /locus_tag="Shell_0535"
FT   CDS_pept        complement(489378..490418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0535"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: sat:SYN_00077 molybdate ABC transporter periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31665"
FT                   /db_xref="GOA:D7DBW8"
FT                   /db_xref="InterPro:IPR022498"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBW8"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADI31665.1"
FT                   /translation="MDKLKTSIIIIVLIIASLTGYYYYAHTANTSKIIIFTAGSLKIPL
FT                   DETASKYREKYGVNIYIEASGSVEAIRKVTDLGREADIIAVADYRLIPKFLVPNHTSWY
FT                   IGFATNQVVLIYTDKSKYHEILENNPSEWYRILMRNNVKWGFSDPNKDPCGYRSVGIIG
FT                   LASIYYNDTSILENLLLNKTNIEVERVNDTLDLIVPADLRVRENSNLIIRSKSVDLISL
FT                   VEAGTIDYAFEYLSVAVQHHLKYIRLPDQINLGNPEYGDFYGKVIVKILVGTDKEKSLA
FT                   MSPIIYGVTVLDNAPNRSEALKFLEFLLGYTGREIFEENGQPYLEKFIVYGEVPEELGS
FT                   IVGSGS"
FT   gene            complement(490492..491532)
FT                   /locus_tag="Shell_0536"
FT   CDS_pept        complement(490492..491532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0536"
FT                   /product="transcriptional regulator of molybdate
FT                   metabolism, LysR family"
FT                   /note="PFAM: regulatory protein LysR; KEGG: ppd:Ppro_1453
FT                   molybdenum cofactor synthesis domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31666"
FT                   /db_xref="GOA:D7DBW9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBW9"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ADI31666.1"
FT                   /translation="MELKLVLDGYVVLDELSAKLLYLINRLGSILSASRVLGLSYSSAW
FT                   DMLTRIENILGRRVVEKHRGARGGATLTSVGLDLLERYISAYKKYFHREFHVEIPRKPG
FT                   ALQKIYVYAGSHDILINYLTGLLRDKGYVVEVHWIGSLKGLSSIILGEADFSGTHLLDP
FT                   DTGEYNVSFIEKYGGSTSLALIRGWLRSIGFITRSKTTYEEIIEKLVNGTYRLINRNEG
FT                   SGSRQLLEYILKREAEKRNTKIDIIRSRIKGYKNIAYTHLEVAEQVSTGKADIGIGIEW
FT                   AAKAYNLYFKHIKWENFDIVIRRDKIENKFYKDLTETIKSKEFIEKIKSMPGYKVPENI
FT                   GEVLFF"
FT   gene            complement(491766..492821)
FT                   /locus_tag="Shell_0537"
FT   CDS_pept        complement(491766..492821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0537"
FT                   /product="Ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="KEGG: scl:sce0074 N-acetylornithine
FT                   carbamoyltransferase; PFAM: aspartate/ornithine
FT                   carbamoyltransferase carbamoyl-P binding domain;
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31667"
FT                   /db_xref="GOA:D7DBX0"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBX0"
FT                   /inference="protein motif:PRIAM:2.1.3.3"
FT                   /protein_id="ADI31667.1"
FT                   /translation="MRHLVRDLSGKDLISTLDWSNEELEIALKLAEELKWTAHYYGVEA
FT                   IPKILERKVFFMLFFAPSTRTRAAFEAAMHYLGGHAAYIEAKTTRMAWGKEEKVGEAVK
FT                   DVAVMYERYGHGIGVRILDKAIDYIYGRGNSYIREIAKAANAPVINMADDLFHPTQGLA
FT                   DLYTFKERFGKVEGKKYVIMWAYSPEIRGWCSVQEDMILFPRFGVDVVVARPPGFDLDP
FT                   KLVEKAKQLAKENGGSLEFTDNYKEALEGAHAVFPRNWASPKLVQLGYSRFKDEELRIY
FT                   EKYKDWKVTRELFDKMDKHGVLMHVLPIMRNYEADDDVIDDPKRSIIYKQAENGLWTKA
FT                   AVLALTMYGLK"
FT   gene            complement(492934..493287)
FT                   /locus_tag="Shell_0538"
FT   CDS_pept        complement(492934..493287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31668"
FT                   /db_xref="GOA:D7DBX1"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBX1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31668.1"
FT                   /translation="MAGSELSNILKTLLCVAVAGSLFITAVFYDIKWLFILAAFFDWLP
FT                   LATKWMKISGTTNSRAREAGIMHGVVTVVAYIIGIAWLFIDHIGMIDLGYLFILLWFQA
FT                   VILGSYTTAVKLA"
FT   gene            493418..494644
FT                   /locus_tag="Shell_0539"
FT   CDS_pept        493418..494644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0539"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II;
FT                   DegT/DnrJ/EryC1/StrS aminotransferase; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; aminotransferase
FT                   class V; KEGG: mes:Meso_2719 aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31669"
FT                   /db_xref="GOA:D7DBX2"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBX2"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADI31669.1"
FT                   /translation="MTSPTLKFRSIIPYMRGEGGFAFIARGRELASKGHHVVNLSIGQP
FT                   DVPTPDNVIESAVHWLRDKKYTAYTETPGIPELRQAVADYLNERYGSDVDWREVVVTPG
FT                   TKGAIFLSLATYLDPGDEIIVPEPSYPAYPEGAKILNAKARFVPLRFEGSDKGFKLDME
FT                   AIEEAITPKTKMIVVNNPHNPSGAVFTPREIDELVDIAREHKIMILADEIYDNYVYDGS
FT                   FKSLISYPDWREFLVYTNGFSKTFSMTGWRLGYIVVRREVAEILSKLAVNIWGCPTSFA
FT                   QKAAVTALKDPDTWKWVEKISKRYAEMRTLLYNELQGIEGVEAWKSRGAFYLFPRISSL
FT                   LNKVNMNVDEFVNYIIDNYYLIILPGTAFPDTAGKDYVRFSFATSREAILEGAKRFREA
FT                   VEDLLSKQS"
FT   gene            complement(494722..495609)
FT                   /locus_tag="Shell_0540"
FT   CDS_pept        complement(494722..495609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0540"
FT                   /product="protein of unknown function DUF89"
FT                   /note="PFAM: protein of unknown function DUF89; KEGG:
FT                   tdn:Suden_1861 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31670"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="InterPro:IPR014444"
FT                   /db_xref="InterPro:IPR036075"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBX3"
FT                   /inference="protein motif:PFAM:PF01937"
FT                   /protein_id="ADI31670.1"
FT                   /translation="MKPHAPCVQCIVSVRLREIMNSIRDHERTIKLQIQLLKVAYEEFT
FT                   RNNELTIIATNIFNKLISLAPEIVDYYKDLKKKAISRAWENIGEYKSFLEKLEGYEKFR
FT                   FATKISIAGNALDTGVAGYEPPDKISVDRILSTPLIIDHTREIYDYIRAGGKKILWLFD
FT                   NAGESVLDTLLVEILQNYGNKVIGVAKEDPGFQNDLTMSDAYYAGLDKVFDEIISTGYN
FT                   GSSIHLNKVSEQFKKYLKEADLIIAKGMAHYEYISGIELEKPIAHLLIPKCEPVAKTIG
FT                   GIKEYYVAYFHNYR"
FT   gene            495789..495941
FT                   /locus_tag="Shell_0541"
FT   CDS_pept        495789..495941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eca:ECA1942 putative periplasmic
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31671"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBX4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31671.1"
FT                   /translation="MSPLYYDPGKTSLQPHLLSLRRQNKSHTVWVFHLRRDAKFHDGTH
FT                   VTAKL"
FT   gene            496128..496799
FT                   /locus_tag="Shell_0542"
FT   CDS_pept        496128..496799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31672"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBX5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31672.1"
FT                   /translation="MVKITGFWFIDRFFDGIPWNSVYEFYSSDNRLLELLFHYVISISS
FT                   VYGRVYVVLVREFGGLDPYFLLRLTRMHRGDPDNVFVSRCFRVGDVETVLEDLLENNFS
FT                   KKSSVLIYTPYSFVRNGLAGYHDMGRITGLIHRLKNLGYRIILFNEVSRDGYYRPMGGS
FT                   FHHHTADIILRLDVKDGKWGYLIVVKHPRLSEGLRISIPINKIRGGNIWVEQRSLIEWL
FT                   S"
FT   gene            496787..496984
FT                   /locus_tag="Shell_0543"
FT   CDS_pept        496787..496984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31673"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBX6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31673.1"
FT                   /translation="MALLRELERFRRIIARLPRDEKARWEEILEGIEDTMSIYSDVPIT
FT                   DPLEIIYFHILRRLLRDDVS"
FT   gene            496981..498927
FT                   /locus_tag="Shell_0544"
FT   CDS_pept        496981..498927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0544"
FT                   /product="DNA polymerase B region"
FT                   /note="KEGG: hypothetical protein; K02320 DNA polymerase
FT                   alpha subunit A; PFAM: DNA polymerase B region; SMART:
FT                   DNA-directed DNA polymerase B"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31674"
FT                   /db_xref="GOA:D7DBX7"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBX7"
FT                   /inference="protein motif:PFAM:PF00136"
FT                   /protein_id="ADI31674.1"
FT                   /translation="MNNNILYLFDAVPSGKYTLFKLLDRDGRVYVVPISLLYRGYLMPR
FT                   IDPDVLLENVELINGVEKVWVENWYKPPYFSSETEVVVYETRDPRIISTVNNWAIRKAI
FT                   GVPVNTFPEPLIEALWRNKIPVLTPLKKYGDRIVALENPFDPEYSEPPIKYLILRLFRG
FT                   GYRLYSEAIDPEKVVVEDNEGIVYEGGLDGAVETIREHKPLILYTSIVEKIYVEQRYSW
FT                   IKKYYDVWIDDAETLVDHTGIVYWSRLSYTPPRMLNYATIGRILTTIEALEARKHKYLI
FT                   INGFGRRESWRSLRSLLETDRGGLVYSPKPGLYWDICQIDYNSLYPSIIAKYNISGETI
FT                   DNPYCRNKYVVKNSPHIICMDRRGLVSIVLDKLVRLREKTKMLRAQTNNEVYSLRSKAL
FT                   KWMLVSGFGYLGFKNSLFGSIMAHETVTWYARRILREAQWLLEKRGYKVVHVIIDSLFV
FT                   QGGDCEKALRIVEETGMPAKIEAEYTWLYIPETKNTGLGAANKYYGRLASGEMKIKGVM
FT                   CVRKNTPIFIRETQLEAINKLGEAGKPEELKEKLREAHTVFQLAEQKLINREVESWKLG
FT                   IIVNARKKPKHKTPWLKASSMIRKYTGPIVYIISPSGEPEPLIDTDQKYSAEYYVKLLH
FT                   SAWEEIPSIDIIQ"
FT   gene            498979..499160
FT                   /pseudo
FT                   /locus_tag="Shell_0545"
FT   gene            499627..500205
FT                   /locus_tag="Shell_0546"
FT   CDS_pept        499627..500205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31675"
FT                   /db_xref="GOA:D7DBX8"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBX8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31675.1"
FT                   /translation="MERPIKLVSISLSLLIIIILLIIIILSISLTPASASTNIEPNRWL
FT                   EPELLSEDHRSHGYVGASTTLNFSISYGGATFRVAVFVSGADAYDVGILALGGHYDVLR
FT                   GYYVDFGVKVATYPKDWTGPGWFESYHFDAIKATHSPLYFYMSLPYAKVWVEGDIRFKV
FT                   THTTWWGASSNIYWDNWTNLYAEAIVRVE"
FT   gene            500279..501163
FT                   /locus_tag="Shell_0547"
FT   CDS_pept        500279..501163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31676"
FT                   /db_xref="GOA:D7DBX9"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBX9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31676.1"
FT                   /translation="MVGSLKHLLFTLAWIGIIMAVLLSIVAVGSATPQPPSVLTYHGDG
FT                   FEFAFRRGDVFVGNDTYLSEDVTITISFEPINSTASWIYVDIRAPAVYYWPHRNFVFRG
FT                   IWDVECNESADWRSVRTIMHNYHLRLKYLVNTTNNYAWLNGEFIGFFPFYIFPTLGYDN
FT                   VTKYTYVYMGKELHVAMLEGKPGPSRLHVKGASGREYEIVALTLYNKYINIGFVYHWPI
FT                   SVTGFIPIGNNTYLHIDSATIDEDWIPYLKAIDDYPEWVTTIDWSRLILFIAIIGSIIA
FT                   LVIMFIRRRRRHK"
FT   gene            501164..501931
FT                   /locus_tag="Shell_0548"
FT   CDS_pept        501164..501931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31677"
FT                   /db_xref="GOA:D7DBY0"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBY0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31677.1"
FT                   /translation="MLKLPLRESFSITTIVIAAILASSPLLIALTGFIPYNYSVYGEII
FT                   KSPNATVSGMSFYRGLCRAAGSVHVNRTMLLLTYLSFFDLVSATYFLLSGVIAAYLIAR
FT                   PLEYKYFFIEATYSGGRLPIFLLRLGSAYMLGVFSSILGAMNLAGVVYVLKLYSGISEA
FT                   LLSSIELLLLETLIAVSVSSLISLFTRSFPTSTLGVLGILVLILLLGMKYSFLNSIVLV
FT                   DRILVGDGSIEAYLAALLVSIVGSVWRADMIEY"
FT   gene            501921..502304
FT                   /locus_tag="Shell_0549"
FT   CDS_pept        501921..502304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31678"
FT                   /db_xref="GOA:D7DBY1"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBY1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31678.1"
FT                   /translation="MSIRARIIIAVSILVIIVFAEFLVFMQGFLPQSQVYIELKAPLYP
FT                   GRAVYSTSINVFLGRGVYEVVINPSTKLSICIVSDNTTRVLNVSKPVKIRIFSETGLSI
FT                   TVLAIIEQYKTNLGTIRVVRRWI"
FT   gene            502295..503095
FT                   /locus_tag="Shell_0550"
FT   CDS_pept        502295..503095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0550"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: cff:CFF8240_0360 molybdenum transport
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31679"
FT                   /db_xref="GOA:D7DBY2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBY2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI31679.1"
FT                   /translation="MDIDRIVLKNVVKKYKRFTLKIKHAEFRKGLNLVVGSNGSGKTTM
FT                   LKMIAGFTWPSNGNIEIIAEGKKYSPRQAMKLVGYVAEDVIFPNLKVRELIESFSSGST
FT                   CEELISNLDLRDHLDKKYLELSAGLRKRVQIAIALLKKPKIILLDEPFSNLDIFIIPRI
FT                   KDILEKLGEKTIIIVTSHIGIEADVETITILDQGRLLYHGDPSVIKQRIVFEADVEGKT
FT                   VSMDLDALNKIIHPIKIRSVKINSQTDAIVDFIKSIKNNKIIHS"
FT   gene            503207..504781
FT                   /locus_tag="Shell_0551"
FT   CDS_pept        503207..504781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0551"
FT                   /product="glycerol kinase"
FT                   /note="KEGG: tau:Tola_0068 glycerol kinase; TIGRFAM:
FT                   glycerol kinase; PFAM: Carbohydrate kinase, FGGY-like"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31680"
FT                   /db_xref="GOA:D7DBY3"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBY3"
FT                   /inference="protein motif:TFAM:TIGR01311"
FT                   /protein_id="ADI31680.1"
FT                   /translation="MPHYILVVDQGTTGTRAVLYDDRGGVINYSYLEHCQIYPRPGWVE
FT                   HDPLEIWRNTVYVLRDAVKHSGIDPSDIVGVGVTNQRETTIVWDKATGKPIYNAIVWQD
FT                   TRTTNYCKDLIEKGLYKLVHEKTGLTISTYFSATKIKWILDNLPGARERAERGELLFGT
FT                   IDTWIIWNMTRGTRDHLTPDRGGAHVIDYSNASRTMLFDIVNHRWSSELLEEMRIPYGI
FT                   LPVVVPSSSRKPYGYMNKDILGEEIPIHGDLGDQQAALVGQTCFRRGELKSTYGTGTFM
FT                   LLNTGDKPVYSSRGLLTTIGYVFEGYDPVYALEGSVAISGAAIQWLRDNLRIIRDPSET
FT                   EKLAMKTGKIGSGGVYFVPAFSGLYAPYWDMTARGLIIGLTRYTRIEHIVHAVLEATAY
FT                   QVRDVYEAMINDTGIVIDKLKVDGGATKNNYLMQLQANILGIPVLRPKNIETTSLGAAF
FT                   AAGLGAGLWRNIEELRQLWVLDKEFKPIWNKEKREKLYSGWRSAVKRAMKWLDEVGELP
FT                   GSSAYKE"
FT   gene            complement(504812..506098)
FT                   /locus_tag="Shell_0552"
FT   CDS_pept        complement(504812..506098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0552"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31681"
FT                   /db_xref="GOA:D7DBY4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBY4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADI31681.1"
FT                   /translation="MSETKNIHLKTILLTLALLVLSYFAGDYMLAAVIDPMYREGIIPG
FT                   TAATWRTYAGLLKTIPGFVGLALTIVWGVLADKIGRPRLLFILGITMGVSLALVGFAMN
FT                   YIYLLLVLTIFGIAKIGIGPVIYAFIPDIMPPEKRGLGYAAYYAPSVLGFVVGMIIGGI
FT                   LFYWRTAYLLVGLMILVFAVPLYLLSRGIRIGFAEKKTIEKKYRFMDALRATMNKTITL
FT                   MMIQIIPWSIPWGFVTLFAVDYIMKRWGLSKPVASGILAIAALSIATGHVLGGKLADNL
FT                   VRKGDINGRVKISVVGIAIGYLAMLGMFIYPYPYGSTAIADLLPPVILALAGLMFTTFA
FT                   YPNISSVISDCTYPEYRGTVFSLYNILNTSGWAIGPVIYGLITGYYISTGLAEKTALMY
FT                   SAVLIEALWLISLIIWIIIGKTYPRDRIQ"
FT   gene            complement(506095..507009)
FT                   /locus_tag="Shell_0553"
FT   CDS_pept        complement(506095..507009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0553"
FT                   /product="peptidase S15"
FT                   /note="PFAM: peptidase S15; KEGG: ade:Adeh_3502
FT                   esterase/lipase/thioesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31682"
FT                   /db_xref="GOA:D7DBY5"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBY5"
FT                   /inference="protein motif:PFAM:PF02129"
FT                   /protein_id="ADI31682.1"
FT                   /translation="MIGLIGIILIIIVLLVVLFALLIIGLAFVAANKLVRPPRHKRSWT
FT                   PKDLGYDYEDAVVETSDGLKLKGWFIDRGSNTTILAIHGYTSSKWDETYMKPVINILAK
FT                   NGFNVAAFDFRAHGESGGETTTLGYLEVRDYMKIIDWLKKNKPDKSEKIGVIGYSMGGA
FT                   VTIMLSAMDNHVNAAVADSPYIDIVESGRRWINRMKGLLKHLLILGYPLIVSIASRKMN
FT                   VNIDDLRMYKYADKIKIPILIIAGEKDDLVSLEEIKKFYNELKKHNENAELWITESAHV
FT                   RSIADKPEEYEKKVVGFFKRWLT"
FT   gene            507103..507798
FT                   /locus_tag="Shell_0554"
FT   CDS_pept        507103..507798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0554"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: afw:Anae109_0978 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31683"
FT                   /db_xref="GOA:D7DBY6"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBY6"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ADI31683.1"
FT                   /translation="MIIIGHRGYPMKYPENTIASFLGALLYGADGIELDVWLSADGQVV
FT                   VIHDPDTERVSNVKLVVKESSYSDLAKIDLGMGQHIPLLRDVLKAVPRRYIVAIEIKDI
FT                   DVVEETVKIVNEMNWHDNIVYVSFLDKALEKIRELDPNAKIGYNIGSVEAAMNAFKLHE
FT                   KLKLYSINPPIQGLQLLGFEKFREYLVNVRRVGAKTVLWTVDDPGLLKGLEELVDAVIT
FT                   NNVEALIKK"
FT   gene            complement(507820..508194)
FT                   /locus_tag="Shell_0555"
FT   CDS_pept        complement(507820..508194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0555"
FT                   /product="protein of unknown function DUF1667"
FT                   /note="PFAM: protein of unknown function DUF1667; KEGG:
FT                   sat:SYN_02448 zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31684"
FT                   /db_xref="InterPro:IPR012460"
FT                   /db_xref="InterPro:IPR036593"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBY7"
FT                   /inference="protein motif:PFAM:PF07892"
FT                   /protein_id="ADI31684.1"
FT                   /translation="MGNTRIDEIICTICPRGCRIKVYSVDGKITRVEDYGCPRGKEYAV
FT                   KEVKTPMRTLMTIVKCRGGDLPVVSVKTSKPIPKNKLLEVSKYLANIVVDAPVEIGDII
FT                   VRNVLGLNVDIVATRPCRKI"
FT   gene            complement(508181..509443)
FT                   /locus_tag="Shell_0556"
FT   CDS_pept        complement(508181..509443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0556"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; FAD dependent oxidoreductase; HI0933 family
FT                   protein; KEGG: sat:SYN_02447 pyridine nucleotide-disulphide
FT                   oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31685"
FT                   /db_xref="GOA:D7DBY8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBY8"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ADI31685.1"
FT                   /translation="MRKEYDALIIGGGPAGLAAAIRLAEKGYDPLIIEARDRLGGIPLQ
FT                   CIHPGFGLHYFHEDLTGPEFIYRFINRVEQLGISYITNAYVEKIINESIVSKKVSTISP
FT                   HGNIVFEGKALIYAAGARERHRYEIGIPGPNIAGIYTAGEAQTMMDMYGIMPGKKVLII
FT                   GSGDVGLIMARRLVLEGAEVVGVVEILRYPSGLVRNIVQCLKDFSIPLMLQHMVTDIKA
FT                   KNGRVSGAIISKVDETLKPIPGTEREIECDTIIIAAGLRPKVKLLKEIGVDIDPKTYGP
FT                   VVNDYLETMNVPGIFVAGNALLINDYVDYAVEQGEWAAESTALHIEYKGLPTKQWRRAV
FT                   AGENIRLIVPQYVGGEKNTILYIRVTEPLENVQLMFPEIGKSIPVVHALPSIMLRIRLR
FT                   REEISKTTNKIIVEAKPYGQY"
FT   gene            complement(509450..510931)
FT                   /locus_tag="Shell_0557"
FT   CDS_pept        complement(509450..510931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0557"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; BFD domain
FT                   protein [2Fe-2S]-binding domain protein; KEGG:
FT                   sat:SYN_02446 glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31686"
FT                   /db_xref="GOA:D7DBY9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBY9"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADI31686.1"
FT                   /translation="MVYRVIIIGAGIVGLSIARVLSRFENLEITVIDKNPDVGWGVSKA
FT                   NTSIIHPCHEEDPDKHPLRTKLCLEGHNIWYEWVRELDIPNKWPGEIIVATNEEEYHVL
FT                   KHYLELARRNSVPGVRIVEGEELFKLEPSINKNSVAGLYAPSAGSIDPVQACIALAENS
FT                   VDNGVRFVLGEKVVNIVTRDKQVKEVVTNNNVYEADIVINTAGLFADEIARMVGINDYT
FT                   IHPRRGQYILFDKTAHPKPDKIIHTTPTPKTKGVYILKTIEETLLIGPTAEDLSINEKE
FT                   ANIVTREGISYILENAKKIIEKLPPMNQVIRTFAGIRPEPPNGSYILRFHEEPWGFVEA
FT                   AGIRSPGLTAAPAIANYIKNLISQHIVLKPKKKWIRMRRGIIKIKSLSRIERNNLIKQN
FT                   PRYGKIICQCMGVSEAEILEAINRMKKLGVKEITLDGIKFRTHSMYGRCQGTFCRPLIS
FT                   LIISRETGLEPWKVSFKGGNSTYGIGFVKELFMKR"
FT   gene            511195..512754
FT                   /locus_tag="Shell_0558"
FT   CDS_pept        511195..512754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0558"
FT                   /product="transcriptional regulator, MarR family"
FT                   /EC_number="6.1.1.20"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, alpha
FT                   subunit; KEGG: hypothetical protein; K01889
FT                   phenylalanyl-tRNA synthetase alpha chain; PFAM:
FT                   phenylalanyl-tRNA synthetase class IIc; regulatory protein
FT                   DeoR; regulatory protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31687"
FT                   /db_xref="GOA:D7DBZ0"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBZ0"
FT                   /inference="protein motif:TFAM:TIGR00468"
FT                   /protein_id="ADI31687.1"
FT                   /translation="MSRGNNGKYYLPSRQYRIVEVLLNTGPLSVEELARALNEKPENIM
FT                   RDLAELEAKGLLRVIRRIKQVPVITGEGREVLIKRTPEERVFRVMYRCAGKSVGDFLEC
FT                   VGSEAGIDKQKARIGFQYLVRNKCLSVMNGIVVVDDEYDCHRAIEDASIIRSALEKIMR
FT                   GETIGKDIVNVLKRRRMVRIEKKTIIIVEPSKVLEKLFREGLIARRELLTVVTPKPRSE
FT                   LEKYIIKEFDLTIPPPKPVGGRLNAYIEFLDLVRDILVSMGFEEVKGPHVELEFWNFDA
FT                   LFQAQDHPAREIHDTFFLKTDFKGKVPEELLSRAGKIHEIGWGYKWDPIRSLRPILRSQ
FT                   TTAVSVRAIYERGEGEYRVFSLDRVFRPETLDAKHAMEFYQLDGIIVGKNVTFKHLLAF
FT                   FKEFAAALGIREVWFKPGYFPFTEPSVEGFIKHPSLGWIEVFPGGVFRPEVMEILGAPG
FT                   VRAIAWGIGIDRLAMAVLGLDDIRDLFSKDLDFLQKLPTPILPYFISKTQASDVRVVSA
FT                   PK"
FT   gene            512786..513445
FT                   /locus_tag="Shell_0559"
FT   CDS_pept        512786..513445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0559"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_2556 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31688"
FT                   /db_xref="InterPro:IPR014856"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBZ1"
FT                   /inference="similar to AA sequence:KEGG:Mlg_2556"
FT                   /protein_id="ADI31688.1"
FT                   /translation="MPLIYVLDTSAVTDPRLREVFGVKTLDGVVREYARLLIRSHIVLG
FT                   AEFYTTPSTALELRSFLERNNVSREAIDMLMGAITIRSPDLYTTRIPAIIMSDWIHDML
FT                   IRITKGLRVAENSVRRAARKGYDYGIAKNKKGLEESVAQSIHELREKYREATRKGVIDT
FT                   RVDFDLVVLAHEINGELVTNDTGIMKLCMQIGVKYIEPPRFINKLFLLLRERTGRV"
FT   gene            513448..514695
FT                   /locus_tag="Shell_0560"
FT   CDS_pept        513448..514695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0560"
FT                   /product="Fmu (Sun) domain protein"
FT                   /note="PFAM: Fmu (Sun) domain protein; KEGG: net:Neut_2280
FT                   Fmu (Sun) domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31689"
FT                   /db_xref="GOA:D7DBZ2"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBZ2"
FT                   /inference="protein motif:PFAM:PF01189"
FT                   /protein_id="ADI31689.1"
FT                   /translation="METVLPPNQLEFFLKRLLNYILKAHVSYDKAFRTIIHKYSFPRWA
FT                   LRIFYKVGYYTVTYYYSLRWLSAKNGYGTKPAGIINYFSRIGFSIRRARSLIRDEVKQL
FT                   SRTKRISLLHSYPEFLVKDLLNHMSEKELDKMLKKLNVRKRWLRINTLKTSYESAYKCL
FT                   EETGIIYQRKNFPDYMVYVEHPKWDPIGHNKCVKNGYVVPQDLASAYVVEALELDRDKY
FT                   FLDACSAPGLKYSLAFMLTDNKLYGFAIDLSSKRMRTGQILLKRLGVDSSRTILINADS
FT                   GNIKLSRVFDYALVDAPCSGLGSVYSDPAVKLNTNRRSKLEQYHKKQYRILKNILRYAR
FT                   RVVYATCSIHPLEGEEVIERIVNEGLAETNKINLPGLSTAYKGFNISNSTYRVLPHTMN
FT                   SQGFYIAVLESKVAGK"
FT   gene            514692..515675
FT                   /locus_tag="Shell_0561"
FT   CDS_pept        514692..515675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0561"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   sat:SYN_01173 radical SAM superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31690"
FT                   /db_xref="GOA:D7DBZ3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBZ3"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADI31690.1"
FT                   /translation="MKLKTVYGPHPSRCFDWSLGVDVLLPPKRCPYNCVYCPLGRTSIK
FT                   TMKPAMLIDPGTVKKELEEFIQVNGCIFSNILVWGHGDPLLNYHTPLIVRTIRETINQY
FT                   GCRSSIRIRTTGFALGEKWALPLLDIVDEIIIPFDAAGETRQVINDPMDNAKISLLIET
FT                   LRNIPKTYRRKIAFETNLLKIDGIKNSDLPILDELTSYISSTGIMKIYLKTVNRPSWKQ
FT                   MIKPVKGRLFTRVKDYLVDKGYTVKECTREKHSTIIISSDLEEALINHLLRKPLSTDEI
FT                   RTIYGNRGIVLAEKMVLENLIDKIPWGQKLFFKVKQTIDLYKWIRR"
FT   gene            515682..515807
FT                   /locus_tag="Shell_0562"
FT   CDS_pept        515682..515807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31691"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBZ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31691.1"
FT                   /translation="MEESIESKIRELENRINILEQRIDRIEKIIDEIYVLLRAHL"
FT   gene            complement(515877..517838)
FT                   /locus_tag="Shell_0563"
FT   CDS_pept        complement(515877..517838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31692"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBZ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31692.1"
FT                   /translation="MVKEKIYMMPMIIEDAVIGEELDPAKPRSIYIYKKGEHSPYPGLA
FT                   YSKSFVYVSAGRLYRTYVKNVSGVDHLFFNDRSMCPIYGSLYNVVYNGQYHGLAVQLAD
FT                   GTHSFIVLDGRRTVYQLSNIKTGFFSKKTCTIIHVDVGVVGDRIIALAHTTGPPGTKCK
FT                   DVIVYSKDEEKYTVKEHEKLLLGGWNGLWFSYIETTSKKTNIFFHLWDRSVKKYSIPKT
FT                   LIPKQFLIPNTIAYYDHSRGLIVLNNTSELLAVDLKNKTALWRRGFNGTIYTPYINTGL
FT                   EEILVHDNRNIYLIDPLTGDEISSLEAPSNTSTANLSRKYLLIGSNGILYLYARKGKKF
FT                   DYIGKYSITGSIRGISIQGDEVLVGYRSPGDIPKIIYMSLGETISFKLKEIELPVNSLV
FT                   EIPVGEIVPNIRVLRRGSRQLLITTRENKIIVADRGSKPGEYKATIEISIPGFLPVVDD
FT                   ISIKVQELKSAFKKLSIQSTVIPSQLGPFIPITINSIIPIDELYMVLTTKDNSLFGTTN
FT                   IIRNVRRGETMIPLYIVWAKMGIHNADLKIVGWNRRNRIFEEFKTKIKIEYDIPPFHLR
FT                   VSGGVAYIWSPFSIEAVRITLRSRETEYTIMHDLKAGWNEIEVHSMIPDEVIITLRGGI
FT                   TYVVRRGQSWIQLMKHSY"
FT   gene            517953..519089
FT                   /locus_tag="Shell_0564"
FT   CDS_pept        517953..519089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31693"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31693.1"
FT                   /translation="MPIRHAWSRALPSNCSLDAVRFREEYIELRLYCADSMTLYTVNFI
FT                   SGKVDIRRIGEPELRGAVERKREFRILTCYKGYGNRAWSKIYRGLNTKMICRKDVCVVA
FT                   NLKPNYALDISAVTSNGDVLESVTVGGVYHFEVAGSDNLIVVTTRGIRADSTTTMLIDG
FT                   STGSVIDHVTGFGGSAVSSLDYVFVYGEHEGKIITHGYNNEGEEIIPGGEEGLPILPPF
FT                   NPIPHRVPGSEIFEVKKVVLMEKNFLKLYNPEDYVIEYTLLKPPFTRGVFNINIHNYSA
FT                   TVLAQIMGWPFIINYDFKGRVIWSSHIIRDTIYGIVTGNIVALYVDNGKIRETKLYSVK
FT                   DNTLVLEESFGPNALPLLVRRSNILLTDGRVVASYMME"
FT   gene            519097..520269
FT                   /locus_tag="Shell_0565"
FT   CDS_pept        519097..520269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0565"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: mlo:mlr2268
FT                   Na/H antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31694"
FT                   /db_xref="GOA:D7DBZ7"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBZ7"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ADI31694.1"
FT                   /translation="MDVEYLIFEIVMMLMLAKILEIPFRKHHLHPLAGHVITGIVLGPY
FT                   LLGLVRPSSEMLGIAYFGLLLLMFYTGLTTDYRELKRRGKIVLLMGGMGVLVTFTLIYL
FT                   VMYFLGYAGLPGIFIAASLSNTATETMAAIVAKKGDAISRSLLVGASFVDDVMAVFIIG
FT                   ILAGLAVENSLSMNTLIILAGKALFFLLSVFLISSLLVNKYPKIYKVISQDYFWFATFS
FT                   ILLALSLAVAAKLFGLSELIGAYLAGILISRGREFHDPMLRTRIAISEFISDFTVVLDA
FT                   LFIPLFFAYIGLSYSPGKVSFYLYLVLLSLAILGKFIGTAPISYISLKDKRRSIAVGLA
FT                   MSGRGALETALLKLGLDYKIISPILFNTAITVSITTTVLAPILYSIVYRE"
FT   gene            complement(520341..522017)
FT                   /locus_tag="Shell_0566"
FT   CDS_pept        complement(520341..522017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0566"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit;
FT                   KEGG: similar to Probable phenylalanyl-tRNA synthetase beta
FT                   chain (Phenylalanine--tRNA ligase beta chain) (PheRS);
FT                   K01890 phenylalanyl-tRNA synthetase beta chain; PFAM: tRNA
FT                   synthetase B5; B3/4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31695"
FT                   /db_xref="GOA:D7DBZ8"
FT                   /db_xref="InterPro:IPR004531"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBZ8"
FT                   /inference="protein motif:TFAM:TIGR00471"
FT                   /protein_id="ADI31695.1"
FT                   /translation="MPVIRIAKWDLERLVGRTLSNEEIMDYLPRIKCEVETISEDGEIE
FT                   YEATHDRPDLYSVEGVARSLRYLLGIKSLNYKFIDEGVKAYNMGVPRRPYAAFAIVKDL
FT                   ELDHESVKQIMQLQEKLATTYGRSRRKASIGVYDLDKFKMPIYYELRDPDNTSLVPLNE
FT                   AREMSLREILEETEKGKIYGHILRDWDKYPVIRSSDGKILSLAPIINSEDTRVTTYTKN
FT                   VLIDSTGLDPRTVVDAVTIMATSIAERSTSKKIIFVDTIMPDNTILQAPRDKGPTIELH
FT                   LDDAEKVLGIKIDTKNIVEYLEKMGHETVEISNNNIKIVAPPYRIDIKSWIDIVEDIAM
FT                   AIGYDTIGVKADKLPPATHPGRMHSLEYISRLIRKILVGYGFTEITSYMMSNPQTQLEM
FT                   FGLKDKKIITVLNPKMDKYTGLRRWLTPGLLEVIIENKEKQSSMKIFEIGDVAIPDPNT
FT                   ETGARIERRIGIAITHGKATLTDGLAIVSTLLNRLKLNPTFEKTHIKGMLPERTASIKI
FT                   NGEEIGFVAEIHPDILYRLDYQFPVVVSEIVLNKLLIILRQ"
FT   gene            complement(522102..523736)
FT                   /locus_tag="Shell_0567"
FT   CDS_pept        complement(522102..523736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31696"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:D7DBZ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31696.1"
FT                   /translation="MINDIYNEIIAKSSQSFVRDALSIITRHHRLQGSSGLWKAVNELR
FT                   EILEGIGLPAKIFRIEEGSGKGFIKAPISWDPVEAYIEIKTGDRVLARLDLKDHPTLLA
FT                   AHSPGGEGCAELKICGEKLCDGEAILVTGYLYDIYLNTDAKLILYYMKNRYPEAVPYTG
FT                   LFLEPGDKMKGAVINIPYSLAMKIMSLKIENPRKKITVCWKAKINRHNKGLPILLSCVG
FT                   DDPGVVFISHICHPKPGAHDNASGSAGNLHVAYVLSQTNPGFSYCNIWVPEYTGTVFLE
FT                   DKLPWRPLSVINLDMIGSKQQITGSTLTLINPPRFMNTYTAPAGWISIQKVFDTSKSFN
FT                   NISQPGIRYGISPYTMGSDHDVFIGWGIDSIMYNEWPSKYYHTDKDTPETIDPRSLMNT
FT                   SIASILTAYIVSKSNNSFLEKLGKMYESYLKTWYKSQAIKIGYSINYLSRYLIKKPLAE
FT                   KIEKPLIDSPIFSKTLYRILGREKYLEIRRIPGIYTYLAIYAPLSEKLGLNNHVKHYKA
FT                   ELLIKWSRKQEKQVIDAWETIKSNIKI"
FT   gene            complement(523866..525187)
FT                   /pseudo
FT                   /locus_tag="Shell_0568"
FT   gene            complement(524612..524806)
FT                   /pseudo
FT                   /locus_tag="Shell_0569"
FT   gene            complement(525215..525778)
FT                   /locus_tag="Shell_0570"
FT   CDS_pept        complement(525215..525778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0570"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: sat:SYN_02574
FT                   isochorismatase superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31697"
FT                   /db_xref="GOA:D7DC00"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC00"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADI31697.1"
FT                   /translation="MIKLIDEKDLVLIVIDLQEKLLKIISDKEKLIINNKMLIRFLSGI
FT                   ETPIIATKQVKLGDIIRDIAKELKSAKIIEKETFSCFRNKDFMDTIRMTNRKTLIITGI
FT                   ETHICVLQTAIDALNLGYRVIIPYDAVSSQIKSDHEYALQYLQSKGVEILPAESIIYAI
FT                   MESSKHPLFKEALNLVKERRKLYV"
FT   gene            525914..527437
FT                   /locus_tag="Shell_0571"
FT   CDS_pept        525914..527437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0571"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   mes:Meso_2234 alpha-glucan phosphorylases"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31698"
FT                   /db_xref="GOA:D7DC01"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR023881"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC01"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADI31698.1"
FT                   /translation="MVIVSITPEIGLDELETYAGGLGVLEGDKLYGAGDMGLDFLVLTL
FT                   FYREGYVKYRFNGEEPIPEPEEQPEQAYEVLRPDKQFKIVLRGEEIIVQPWIYRYKTAR
FT                   AVLFEAICPMWARRLTDRVYIEDSLEHQFLRYALLAKASAYYLKNRVGLDNISMIDLEE
FT                   AHTALTLLSLNNYDKFRIIIHTPGPWGHPGFPGDFIAREFGTFMSDYVSLTELALERLK
FT                   EAIVVSKKQEDVIGKVFPRHKDKIKSITNGVCLKRWMHPKLYKAYLENKADPSLLREAR
FT                   RETREKLVKLMRKYKENIIIDNRPIIAWVRRLARYKRPYFIARFIEENPDINAFFLLGG
FT                   KPHPRDNDGLNYARWFRRLHLRLSNVVYIHDYDINTAKTILQGSDLLLFTPFSGWEACG
FT                   TSYMKSLANGIPILSSRDGGVIEIVEDNVNSWLFGEDIRDFINIYNDPRAANIDEKDYA
FT                   EFKEKLLRIINMYNNDPEKYWEIAFNAYKTVPEKVNIINVLKKYYINNE"
FT   gene            527514..527792
FT                   /locus_tag="Shell_0572"
FT   CDS_pept        527514..527792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31699"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC02"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31699.1"
FT                   /translation="MSLTTKKINDELFNTVIDFGDIKLTAHEILEIINEEKEKLYKQYG
FT                   AKNFNELLELIRTNRIGLSSVFNIMRRLEVLNEMERIVYEDILAVKE"
FT   gene            527913..528320
FT                   /locus_tag="Shell_0573"
FT   CDS_pept        527913..528320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0573"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   dat:HRM2_42600 cupin domain family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31700"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC03"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADI31700.1"
FT                   /translation="MAKEETVLGPCGEKIGHYSIVRNEPVSEDMAVKTWIRWLIRKEDG
FT                   APTFAMRLFEVEPGGHIKAHHHPWEHEIFVLEGIGDVRIGSKVYRVTSGFFIYIPPNVE
FT                   HEYWNRGSSSLKFICIIPHKPSTEERSVKKC"
FT   gene            528336..529202
FT                   /locus_tag="Shell_0574"
FT   CDS_pept        528336..529202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0574"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: hpj:jhp0585 putative 3-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31701"
FT                   /db_xref="GOA:D7DC04"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC04"
FT                   /inference="protein motif:PFAM:PF03446"
FT                   /protein_id="ADI31701.1"
FT                   /translation="MKAGIIGTGLMGSALAKCLSSKGIDLLVYNRTRSKAEKLCEDIKC
FT                   KVVDSPKDMSVADYIVIFVFDDEALDNVVFGDNGLAYMDNKEVYILNSSTVSPRISAVI
FT                   NKKLSSLGFKHYYEAPVYGSVDEASSCSLVSMLAGSSKNLDDVVEFAKNYSVETIYVGE
FT                   IPKAMALKLSLNNIGLSLPPIIAESLAILESYNVDLEKFLHISEKLWFGRLVKRYIERI
FT                   RNTGKIRFTVKGAAKDYRLISTTLSINEYPSILSSALKNFYTSAISKYGGVDYPKAANW
FT                   ILKKPLG"
FT   gene            complement(529232..529657)
FT                   /locus_tag="Shell_0575"
FT   CDS_pept        complement(529232..529657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0575"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: rme:Rmet_1334
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31702"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC05"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADI31702.1"
FT                   /translation="MAYKEAPTYEISFMFRRILVPVDGSENSLKALDLAADLAKHYGSH
FT                   VTVVFARPKGYHVDFKPLEKARKRIENKGIEAEFKELEFDPAENSTAGKILEEIISGNY
FT                   DMVVMGARGRTLTSEITIGSKAISIASNSPVTVIIVR"
FT   gene            complement(529709..530755)
FT                   /locus_tag="Shell_0576"
FT   CDS_pept        complement(529709..530755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0576"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type
FT                   II"
FT                   /EC_number="1.2.1.59"
FT                   /note="TIGRFAM: glyceraldehyde-3-phosphate dehydrogenase,
FT                   type II; KEGG: ajs:Ajs_2165 glyceraldehyde-3-phosphate
FT                   dehydrogenase; PFAM: glyceraldehyde 3-phosphate
FT                   dehydrogenase; dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31703"
FT                   /db_xref="GOA:D7DC06"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR006436"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC06"
FT                   /inference="protein motif:TFAM:TIGR01546"
FT                   /protein_id="ADI31703.1"
FT                   /translation="MSKIRVGINGYGTIGKRIADAVARMPDMELVGVVKVTPDYGYLVA
FT                   EQKGISVYTVKDRIDKFRGKGFKVEGTIEDLLEQVDIIVDATPGGYGSYYKEKYYDELI
FT                   IKGKLKAIYQGGEKPDVADISFNSYCNAEEALEANSIRVVSCNTTGLLRAICVLNNAYG
FT                   IEKVRATIIRRAADPKEDKRGPVNSIKLNPPKIPSHHALDVKTVIPNIDIETAAVIVPT
FT                   TLMHVHSVYMVLKTRVDRDEIIDELSSYNRIVVIDAEKTGIDSTAKIVESARDLLRPRY
FT                   DIPELIIWKDSIFTRENELWFLQAVHQESIVVPENIDAIRGLARTDGYPDKSIRLTDSV
FT                   LGMGKFLG"
FT   gene            complement(530828..532063)
FT                   /locus_tag="Shell_0577"
FT   CDS_pept        complement(530828..532063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0577"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="KEGG: dol:Dole_0677 phosphoglycerate kinase; PFAM:
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31704"
FT                   /db_xref="GOA:D7DC07"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC07"
FT                   /inference="protein motif:PRIAM:2.7.2.3"
FT                   /protein_id="ADI31704.1"
FT                   /translation="MTNMRIPRIPTLREINIREKRVFMRIDINVPIDPDKGEILDDRRI
FT                   RVHSQTIKEIVEKYSPALVLGSHQGRPGEPDFITLERHAELLSKYTGYDIKFVNDVIGP
FT                   TAREAIRKLKPGEILLLDNLRLVSEEVIEATPEKQSYTIFVRRLAPLFDAYVNDAFATA
FT                   HRSQPSIVGFPLVLPSAAGPLFEKEIMALKRVVESFESPRIFVLGGTKVRDLLRVIENL
FT                   VRNKMADRILTTGLLAQLFLVAKGIGLGKENMRFLEEKGILPLIPKARYVLLMGAPVET
FT                   PIDFKVLIDGETRNVSIGEINGKIMDIGEQTTRIYSEFIKDAKIVVMRGPAGVIEDERF
FT                   RNGTIKLLDAAYNSKAFVLIGGGHLSSMIDESKLNEHIHVSTGGNALLLFLSGETLPAL
FT                   KALELSAKMFLG"
FT   gene            complement(532200..532532)
FT                   /pseudo
FT                   /locus_tag="Shell_0578"
FT   gene            complement(532918..534138)
FT                   /locus_tag="Shell_0579"
FT   CDS_pept        complement(532918..534138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0579"
FT                   /product="dihydroorotate dehydrogenase family protein"
FT                   /note="KEGG: dihydroorotate dehydrogenase family protein;
FT                   TIGRFAM: dihydroorotate dehydrogenase family protein; PFAM:
FT                   dihydroorotate oxidase; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31705"
FT                   /db_xref="GOA:D7DC08"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC08"
FT                   /inference="protein motif:TFAM:TIGR01037"
FT                   /protein_id="ADI31705.1"
FT                   /translation="MVSLEVEVAGLKMKNPLMNAACPVSRDAEMMKALIDNGVGAVVAK
FT                   TISVRPAIVPRPSMGAVDRGIVRSQILKTLGPGNIRIVNADSGNYRFIYALLNAELWSD
FT                   IPAEHYFEREYPMVKKYAEEKSIPFIISIGYKPEELRLLGPKSQKAGANAIEFSTHYIG
FT                   KDYRPVVEAAKALREVVDIPIFAKLSPFTPNIPELVKELEKVGVDGIVATNTIGPALHI
FT                   DIETGLPIVGGPNGYGWMSGPALKPLALAVVAEAAKNTHLPIIGVGGISKGTDVIEYFM
FT                   AGASAVQICTAALIEGLGVFRRIEKEIESWLKRHGYDSILDVKGKALKYLKPEPRRVWA
FT                   KPPVVDPRKCIGCGFCEQVCDYNAVKVLPSEEGKRIAQVNHDLCYGCGLCTSVCPTRAI
FT                   HFEEELD"
FT   gene            534344..534478
FT                   /locus_tag="Shell_0580"
FT   CDS_pept        534344..534478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31706"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC09"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31706.1"
FT                   /translation="MRVYPALCLVMIKGPAPNMWGKTKPEWARGTEALKMREATRSPR"
FT   gene            complement(534728..534916)
FT                   /locus_tag="Shell_0581"
FT   CDS_pept        complement(534728..534916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31707"
FT                   /db_xref="GOA:D7DC10"
FT                   /db_xref="InterPro:IPR020906"
FT                   /db_xref="InterPro:IPR038647"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC10"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31707.1"
FT                   /translation="MPACTKSVKVRTPSGKEVELVPKKVWQLSPKGRKGVKVGLFQDPE
FT                   TGKYFRAKVPDDYPICG"
FT   gene            complement(535178..536665)
FT                   /locus_tag="Shell_0582"
FT   CDS_pept        complement(535178..536665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0582"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   Amidohydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31708"
FT                   /db_xref="GOA:D7DC11"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC11"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ADI31708.1"
FT                   /translation="MFGSFYSSAKLIYVATIIYYINSRTICGEVFLVKKVSILIRNGLV
FT                   VTMDDKRRIYNPGYVAIDEDKIVGVGRGDGADKYTAEEVIDARGSIVMPGFLCAHTHFY
FT                   GELLRASPWFAKIDPPTDFMQNLQRIWWALDVLLTHEDAYAAALIGSIDFVKSGTTMFF
FT                   DNISAPNAIEGILDHMEKAVNEVGLRGILSFEATQRRSIGEGIRGVRENERFIKKNNND
FT                   PNKLVKGAIYLHASFTVTDELFRMAREIANKYNALLSIHVEEGLVDVYHNLERYGIRPV
FT                   ERMEKLGFLGPDVILVHVVQANDDELAIIKKTGAHVAHNAMSNMLNAVGVPPIPKMMKL
FT                   GINVGIGNDGYIFDVFENMRSTYLIHKVWNLDPRLMTPQEVVEMATINVAKMFGVEKEL
FT                   GSIEKGKKADIIIIKPEYTPTPVNEQTVYGHLINTFNGRDVRTVIVNGKIIMRDRKLLT
FT                   IDEAKAVEYVHKTVEKLWDRLLSKGEYQLDVLELPKK"
FT   gene            complement(536771..537742)
FT                   /locus_tag="Shell_0583"
FT   CDS_pept        complement(536771..537742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0583"
FT                   /product="carbamate kinase"
FT                   /note="KEGG: sat:SYN_01213 carbamate kinase; TIGRFAM:
FT                   carbamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31709"
FT                   /db_xref="GOA:D7DC12"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC12"
FT                   /inference="protein motif:TFAM:TIGR00746"
FT                   /protein_id="ADI31709.1"
FT                   /translation="MDRHEKYIVVAFGGNAFQTKGEKGTPENYWKNAYRSAEFLVKIIS
FT                   EGYKVAITHGNGPQVGIIAEWMLAGKKLKGLDVMTLDIAGAMSQGWLGYLIQQSLYNKL
FT                   QEQGLLGKIVKGIVTIVTQTIVDKNDPAFQNPTKYIGPWYNEEEAKQLAKEFDWTVKPD
FT                   PRGGWRRVVPSPDPKGHVEIEAVKKLLNEGFIVIASGGGGIPVYKNDKGLIHGVEAVID
FT                   KDLAGERLATAIGAGTFMILTDVDKVYLNYGKPDQKPVDVLTVSEAKKYYEEGHFKPGS
FT                   MGPKVLAAIRFIENGGKQAIIGHLTQAYEALKGKAGTRIVPD"
FT   gene            complement(537916..538695)
FT                   /locus_tag="Shell_0584"
FT   CDS_pept        complement(537916..538695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0584"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: pmu:PM0625
FT                   molybdenum cofactor biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31710"
FT                   /db_xref="GOA:D7DC13"
FT                   /db_xref="InterPro:IPR005980"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC13"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADI31710.1"
FT                   /translation="MPGFDPFKLSSIVYRGVARIRDGLEERRYYRFRGGRWYGGIATGD
FT                   VVGCNLRCKFCWSWRYSFYTNKGFFQTPQQVYEKLTRIAEKRKYRYIRLSGGEPTITMK
FT                   HLLQLLELLDQTKFVFILETNGLLIGYHREYAEELATYRKIAVRVSFKGTTPEEFEQLT
FT                   GADKKYYEYQFKALENLIDAGLKPGEQVYPAVMLSFSPEENIRKFLDRLREIHSVLAQE
FT                   IDPEYIILYPHVVELLRKNKLKPRIAYKPNGIPEFMI"
FT   gene            complement(538854..539228)
FT                   /locus_tag="Shell_0585"
FT   CDS_pept        complement(538854..539228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0585"
FT                   /product="acetyltransferase-like protein"
FT                   /note="KEGG: bpt:Bpet3331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31711"
FT                   /db_xref="GOA:D7DC14"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC14"
FT                   /inference="protein motif:COG:COG2388"
FT                   /protein_id="ADI31711.1"
FT                   /translation="MVRKMSDILEIKHTSRVIYARLPDNSKAFIRYRVENGVMKLVETY
FT                   TPPQHRGKGVAKKLMQYAIELAKKNNWLVEPICSYSIYYFIKYPEHRELLIPEYRKRSD
FT                   EELKELFRKRLEEERNKDKE"
FT   gene            539360..540310
FT                   /locus_tag="Shell_0586"
FT   CDS_pept        539360..540310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0586"
FT                   /product="hydrolase (metallo-beta-lactamase
FT                   superfamily)-like protein"
FT                   /note="KEGG: dat:HRM2_15520 putative selenocysteine
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31712"
FT                   /db_xref="GOA:D7DC15"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR014426"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC15"
FT                   /inference="protein motif:COG:COG2248"
FT                   /protein_id="ADI31712.1"
FT                   /translation="MPIKVYPLAFDSMGVRSQAVLVVVNGYKILIDPGVALAPKRHGLP
FT                   PTDLELKALDIVRRKIIEVGRKSDIVIVTHYHYDHHPYPNDKEMYEEIFTGKKVFMKAY
FT                   EDEVTGSARSRGKKFHKNIKDIASEIIVADGNKFRIGKNIILEFSPPVWHGPVGSKVGR
FT                   VIMVNIRKGRSSFIHSSDAQNLADPDALKWVLEKKPTFIIIDGYPTILMGWRVSKKDFV
FT                   ESIENVKKAITDTPAKTIILDHHIVRDKNFKEKMKEIYELAEKHGKKVLTAAEYMGLEN
FT                   LQLEALRKDIKKGKVKLNEHDIENYYKKLYSKIKI"
FT   gene            540433..540544
FT                   /pseudo
FT                   /locus_tag="Shell_0587"
FT   gene            complement(540963..541313)
FT                   /locus_tag="Shell_0588"
FT   CDS_pept        complement(540963..541313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0588"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG: rfe:RF_0095
FT                   toxin of toxin-antitoxin system"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31713"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC16"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADI31713.1"
FT                   /translation="MKIYDTSVLIDYLRRGELVEGAISVITLIEVLRGVPQHKRKRVKE
FT                   LLERIYEVIGIDNDVIMKYCELYTSLKHMGQLIPDADLLIASTSISRNYVLVTKDKDFE
FT                   RLRSLGLKLELH"
FT   gene            complement(541310..541453)
FT                   /locus_tag="Shell_0589"
FT   CDS_pept        complement(541310..541453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31714"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC17"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31714.1"
FT                   /translation="MLEREKGERDWSSIREAFEELRRILDDRDYEEIIRSSKSFRDGFR
FT                   LR"
FT   repeat_region   541480..542091
FT                   /rpt_unit_range=541480..541504
FT                   /note="CRISPRS"
FT   gene            542906..543424
FT                   /locus_tag="Shell_0590"
FT   CDS_pept        542906..543424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31715"
FT                   /db_xref="GOA:D7DC18"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC18"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31715.1"
FT                   /translation="MSSYIVEKYVVELADSLSYVRSIDGFLVKLGTIVVSLEDDCRNIS
FT                   NCDPAVLLENILMHEKLSRYLSRFSCYLEDIVDAINSDPRHKVLRKYIGVLRGVLERIK
FT                   CVESPGIQKTTPPALWVKEYREQMRPVKPVHKLSLYFRLKKNTESSLTMILLLSIILYV
FT                   ISLIIYLSK"
FT   gene            complement(543601..544674)
FT                   /locus_tag="Shell_0591"
FT   CDS_pept        complement(543601..544674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0591"
FT                   /product="aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region"
FT                   /note="PFAM: aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region; aspartate/ornithine
FT                   carbamoyltransferase carbamoyl-P binding domain; KEGG:
FT                   scl:sce0074 N-acetylornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31716"
FT                   /db_xref="GOA:D7DC19"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC19"
FT                   /inference="protein motif:PFAM:PF00185"
FT                   /protein_id="ADI31716.1"
FT                   /translation="MSEPWYLGYLEGKHWLTNVDYDIDTIFKVLQAAKELKDMYHKGIR
FT                   KANWLDGKTLYLLFYNKSLRTRNSFQTGIYQLGGQGIYIAADQVYRPTLPEDMVPYQTE
FT                   AIRDVSRVLSRYGSGIAIRIYGDAAKWIIGRGHKIIQEFAKWASIPVLNMEDDIYHPFQ
FT                   ALADAQAALEALGWPKDLRGKKFVVSYAYSGGLKPLAVPQSVALIAAMLGADVYIAHPP
FT                   GFELLDNVLAKVKQYAEHWGSEFKVVHDMDEAFEGATFVYPKAWSPKGFFPPFNNVVDK
FT                   EGAKAYQAKFKDWIVTMERLEKAGKPYYMHCGPADRGQEVTDEVLDSYEKSLYFEEAEN
FT                   RLHAQKAVMAMVMGSKK"
FT   gene            544894..545064
FT                   /locus_tag="Shell_0592"
FT   CDS_pept        544894..545064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31717"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC20"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31717.1"
FT                   /translation="MGAGIRSIRRCGEQSVPPESPSMKPERGRLAVAFVAFVSFATANQ
FT                   NGTDISGHGEK"
FT   gene            545143..546630
FT                   /locus_tag="Shell_0593"
FT   CDS_pept        545143..546630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0593"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: polyamine-modulated factor 1-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31718"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC21"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31718.1"
FT                   /translation="MTYKYPIIPTIIDPGSLTYFDQYREAALIIYLYSVKGKKLSKMIP
FT                   IYYPLLFIEGYNNRTFIIDYLNNNDFKLKYKIPNTDHIKSITLDPLSTNSLISIRKLLK
FT                   EYVRGKYSLEEELVLPKVISSRSIIDELVEIVSRCGYDTLSGYEINNTHASIDIDEYIG
FT                   KVNQFIYRITKTVMDILKMNEDLSYQLFIAINDIKEKYSRIHGRIDRSVNETQELIREK
FT                   INLLSTEMVSELKSTEHRYRRMISSIEIQIRTIDNEIHRLISEQSMFRDKKRHAELIKE
FT                   LEHQQKRLRGKIKELQKSLRKDLESVKNKYTRMIRSEEKRLDLIESEKDRVSRKAVSLI
FT                   NHLTASLSEIESLSHSLIDKLQSYIRRLEEITIITPKMRSGIYFLRTYLVQDTDNNFEI
FT                   ITPLKIAPSYTGRDVLRTKYYVNTRRYILSKKVFRQIIDLAKNNYSELVKHDLLNRISY
FT                   EDVKNTLYILSRNYEKLANINLKHIDRIASNSMNKQR"
FT   gene            546639..547820
FT                   /locus_tag="Shell_0594"
FT   CDS_pept        546639..547820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0594"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   neu:NE2492 general substrate transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31719"
FT                   /db_xref="GOA:D7DC22"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC22"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADI31719.1"
FT                   /translation="MSGEDKQYLKKNILALGTTSLLTDISSESVYAVLPFYIQSLGYGK
FT                   EVVGLVEGAGELVASIFKYLSGFIANKIHKYKLLALIGYSLSNFIKPFFSITKSSLGIL
FT                   LVKIIDRTGKGVRTSPRDTLLAASASSKYRGRAFGLHRALDTVGATLGPLLAIFLLIYF
FT                   GYIGVFLFSIVPGLIAILILLFFVEEVGEKKIASKKSESLQTSMSPYFWLFVATVAASG
FT                   LAGYTQAYLLLRAKEIGWSEGFSILFLVIANIVYASLAYPIGFISDVRGFDKLYPLVFV
FT                   LQFIGSIIIVLFSHSYIAIVFFIIYGIYMAFHDTLTRIITSFYVKKSVRAKAYGYMHGT
FT                   YGLSALIGYYILGRIYDLMGYAYAFTYSAIVAVIGFTLSLILIYKTKNMAGGI"
FT   gene            547822..548766
FT                   /locus_tag="Shell_0595"
FT   CDS_pept        547822..548766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0595"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; KEGG:
FT                   sat:SYN_02156 ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31720"
FT                   /db_xref="GOA:D7DC23"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC23"
FT                   /inference="protein motif:TFAM:TIGR00658"
FT                   /protein_id="ADI31720.1"
FT                   /translation="MVTSLKGRDLLTLADYSREELLFIIETAKQLKQRYLAGERIIPLL
FT                   TGRHLAMIFEKPSTRTRISFETAMRELGGDALYLGWKELQLGRGETIEDTARVISRYVD
FT                   GIMARVYEHEKLEKLARYSRVPVINGLSDLLHPAQALTDIYTIMEKKGSDLRKLKIVFV
FT                   GDGGDNVLHSLMLGIGILGGKIIISSPKGYDPNPRIIKLFEEKAVPNGGEYEIIRDPYE
FT                   AVRDADVVYTDVWVSMGQEAEKEKRIKDLEPYRVTVELMKQAKPDAVFMHCLPAHRGQE
FT                   VVDEVIDGKWSIVWDQAENRKHVQKAILALIIP"
FT   gene            548880..551285
FT                   /locus_tag="Shell_0596"
FT   CDS_pept        548880..551285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0596"
FT                   /product="Oligosaccharyl transferase STT3 subunit"
FT                   /note="PFAM: Oligosaccharyl transferase STT3 subunit; KEGG:
FT                   Oligosaccharyl transferase STT3 subunit family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31721"
FT                   /db_xref="GOA:D7DC24"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC24"
FT                   /inference="protein motif:PFAM:PF02516"
FT                   /protein_id="ADI31721.1"
FT                   /translation="MSRSFYRIVDKIYLWLDKRPGAGKALTYLVLLLIIVFGIYVRGLP
FT                   AINYGLELHANDPWIEYWQANYTVTHGLLSWYSLTRQNPDTHIFWYPWGRDFTRSSYPG
FT                   LPIWTALTYPLVKPFGLTIKDWIVLQPLLFAVIAFITIFLAAKELTRGNIFAGLFAVLM
FT                   YAVVPAASDRNIVGFVEKEGIALGFIFLFIYFYAKLARTINDKGAGGTAKIKYAVLAGL
FT                   SMAVVGWFWGGYSYLLGSFILFLMLYPLFAPKEITLDFIKYNILVVVLSLLFVSVSPSI
FT                   IVHLGLYPFRIRGLATLMLGLLLLPILFYLLHNGYKYLHLKKPLIGVWHYFGILVIVVI
FT                   AGLALISAGVINIGARYAWALGLHFVKAPPLVRSVEEHQPAIQSAGILGVLHSWGTGVY
FT                   WLFFVSPLFLAFFGALYLLYKGGADRIYVAIGFLLAFYAYFNAAYFEALASSYGLLVAG
FT                   IFSGYLWSRVVPTRQEINEWRRGRARIKTDSGFRIIAGVLVVLVFINLGFSGYNIYAQY
FT                   ENTIYSIMSGGAPINARTDAWYQTLDFLRTNTSKDSLVVAWWDYGYWISVGAHRATVAD
FT                   GATLNSTQISLLAKILTAKNSSEAVELLKKLKAPVNKTYILVFDVFQFLPRQGNSYMVY
FT                   PVRAGLIIGLVDIPKSRWMIEIGGRDMSEYFYLYRDPSGGVVLAPRFDEPDTLPLIYKI
FT                   LVDSILYLNIQDKNHTYYFTWYTGTPTTLSYEYLSSLSRYGLNIKYEIDAYQTKTLTLA
FT                   DRPLANDPYIKPYMVIAKPFYGITLRSGGSLVEVISIYQVTMPNTTGS"
FT   gene            551360..551920
FT                   /locus_tag="Shell_0597"
FT   CDS_pept        551360..551920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0597"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Daam1; dishevelled associated activator of
FT                   morphogenesis 1; K04512 dishevelled associated activator of
FT                   morphogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31722"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC25"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31722.1"
FT                   /translation="MIFRRKKINPYKATLYAIYNVKQGMSRIEALMDRIKNRRRRMLEI
FT                   AAQLEMRGETFLAKKYASEIAKLDKIHSRLADLRLVLEKIVLSLEYAMTLHNFKGIAKE
FT                   VLNLTNELKKLPEATIPDIGLLFANLESTLRSLEASSYEIPDISYPSIMEDYGDSEKIL
FT                   MEAREIVKKKLETELAVSNDNNY"
FT   gene            complement(551925..552602)
FT                   /locus_tag="Shell_0598"
FT   CDS_pept        complement(551925..552602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31723"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC26"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31723.1"
FT                   /translation="MANNLGNLSKKPNWMILKEAAEQLVKSGKKRFSRKELTKFAKTLD
FT                   PTRPETSLDFEIDLVTVNSNSKDRYRDPDKLFLFRIARGRYTLYDPEIHGPLEKYLEEY
FT                   RFIPTRKHLLAQIIEELKKIGYEAYENQYHRKPLAPDIIAKENNERIGVWVIDPAIDKP
FT                   TQLKALAYALGSAILNKKFNSHIITMPIDLVSSIPPELKELLEKLKVKIVLLKEEKKYA
FT                   LIL"
FT   gene            complement(552759..553622)
FT                   /locus_tag="Shell_0599"
FT   CDS_pept        complement(552759..553622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0599"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="PFAM: ATPase-like, ParA/MinD; KEGG: sat:SYN_01185
FT                   iron-sulfur cluster assembly/repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31724"
FT                   /db_xref="GOA:D7DC27"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC27"
FT                   /inference="protein motif:PFAM:PF10609"
FT                   /protein_id="ADI31724.1"
FT                   /translation="MSQNTSQAPTQQRTFTSIYKLMNDARERLSKTKHKIMVLSGKGGV
FT                   GKTFVSAMLSLALASEGYRIALLDADIHGSSIPTVLAMHGMRLYASANGIEPTPGPLGI
FT                   KVVATNLMLDSPDTPIIWRGPLKSKAITEFLAKVNWGENDFLIIDLPPGTGDEAITIVQ
FT                   TIKDLDGAIIVTAPSVLSEVIVAKAINFVVNNNVRLLGIVENMSYFKCPKCGSIYYVLG
FT                   KSTGEELAKKFNTELLAKIPLDPYIGEALDKGVPYYIEYPDAEAAKAIKELARKLINTF
FT                   QENASE"
FT   gene            553781..554983
FT                   /locus_tag="Shell_0600"
FT   CDS_pept        553781..554983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0600"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK19023 gene product from transcript
FT                   GK19023-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31725"
FT                   /db_xref="GOA:D7DC28"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC28"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31725.1"
FT                   /translation="MILSSDERYAMVSKKLLKQQFISLTINVLGGFASSIFLGMYRFFI
FT                   RDNPWILAINPPLKDLNGNIYSSLLSRLNSGLYLGSIKPRLRDKVVISNILVVLSTLVI
FT                   TSTIILFTTWILIGGDSLLIFEAALPSMIFVSIIMYPFTSYSSIYLYRHGYEPESLMLP
FT                   VVFLLSDIITTPVLIGYSLLVLSNNMIRHIVFILILLVTVFLAYISYMYRLRGTFRTIG
FT                   ESQLVLIFCLFLDVGAGAFLARNIDLLVSYPFIILTVSVFNGLMGSLTSIYAIRQNVLY
FT                   HIGLTSLKPDKKKLSYLPYMYVLSIYTSFLISIIGYALTYIVTGGSVLSIGIAILISLV
FT                   SSIIITPILWVLIQIFAYLSFKIGFDPDNVMSPILTSMIDIIGTITYIVTANMIISAIL
FT                   A"
FT   gene            555071..556027
FT                   /locus_tag="Shell_0601"
FT   CDS_pept        555071..556027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0601"
FT                   /product="mevalonate kinase"
FT                   /EC_number="2.7.1.36"
FT                   /note="TIGRFAM: mevalonate kinase; KEGG: mevalonate kinase;
FT                   K00869 mevalonate kinase; PFAM: GHMP kinase; GHMP kinase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31726"
FT                   /db_xref="GOA:D7DC29"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022937"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC29"
FT                   /inference="protein motif:TFAM:TIGR00549"
FT                   /protein_id="ADI31726.1"
FT                   /translation="MICSAAPAKVILFGEHFVVKGKPAIVTAVNLYAKTCIMELESGKH
FT                   LLISKQLRQETDLDKEHVPEQLAQFKRIYEIIYEKYGVIRGFKAIIDSDIPVSSGMGSS
FT                   AATAVSFTHSLLRFLGVEFKLEDVNNIAYEAEKLVHGKPSGIDNTVSTFGGIIYYKRGY
FT                   MEKLNVKWPQNLSLVVVDSGIKRNTGKVVMDVLERYERHEEIMKHIYVAAEQLVNKAKN
FT                   LILSSRFYDLGELISINQSLLESIGVSIFETDRIIYAMIESGGLGAKISGAGRGGIVYG
FT                   LFMENSLNNAIHRLKNIGYKPIIVKPVEKGVIEFHSS"
FT   gene            556103..556555
FT                   /locus_tag="Shell_0602"
FT   CDS_pept        556103..556555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31727"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC30"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31727.1"
FT                   /translation="MFNNDKSRVHKRIKYTDNVFNRISLIISDNLRSIYEYNNIVKNYG
FT                   YYLKPIHVVVKKSGSGAVKYYYYGRYWYRLEYTRGNKRKLKWIYIGKEKPDKKLPDPPT
FT                   NPLEGTVIKIRRGTIEISGSKEALSILSRAFRSGPLDYEGKNDNEN"
FT   gene            556603..557898
FT                   /locus_tag="Shell_0603"
FT   CDS_pept        556603..557898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0603"
FT                   /product="S-adenosylhomocysteine deaminase"
FT                   /EC_number="3.5.4.28"
FT                   /note="KEGG: dal:Dalk_5014 amidohydrolase; PFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31728"
FT                   /db_xref="GOA:D7DC31"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC31"
FT                   /inference="protein motif:PRIAM:3.5.4.28"
FT                   /protein_id="ADI31728.1"
FT                   /translation="MEDLFIRNARFILTPNSLDNTIVYENKDIVIENGIITCIGDHCSK
FT                   PRGSLVIDASKHVITPAYINAHTRAGTAFLRGSMPDQEYWDLIRNKKILEEKLVSPELV
FT                   FHSSRLSCAEMLLNGIMGFVDAYYYPEETIEACIDLGLHVSTGPSMPVEKELRSFLSKY
FT                   KNIDKVHPIINIPNMNHSRLEELEQSFSLARKYGLKIHLQVSETRREVFLFKKHIGHWP
FT                   IEYLYKKKLLGEDVYLVNANWVSSTELEYISEEKAALIICPHRSMRLAIGGFAPVYEAM
FT                   RKHILLTVGTDDFTGDRMNVLSEIRELLLLYRHYYKDTRLRLGHTYSYTVVNGYRVMGI
FT                   KGGSIKESYPANLVVYDIDALKNTPLHPQNLLSRLILGNGFTPHYVVVDSHVIYDSSKH
FT                   DELVKKIQESIAFLERISQRINYETGEPVEQA"
FT   gene            558081..558383
FT                   /locus_tag="Shell_0604"
FT   CDS_pept        558081..558383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31729"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC32"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31729.1"
FT                   /translation="MGEKKECSALRESAELVAIINYLNNRRDEYGVAWRLDSLLSKVDL
FT                   LSSIIHNCCGVETYELFMNYMSNPENEDLASEIIRMLHECMIKNECRSNISIEEE"
FT   gene            complement(558430..559251)
FT                   /locus_tag="Shell_0605"
FT   CDS_pept        complement(558430..559251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0605"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: vei:Veis_2839 nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31730"
FT                   /db_xref="GOA:D7DC33"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC33"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ADI31730.1"
FT                   /translation="MSRVFIGILQDKFTVDPMENYRRIKELLEEKHQVADIIVVPEYSM
FT                   INILAGLKPIDVYERAERINDSTYISKISDLAAKLDAYILIHFIEKTDTPPKTMSSSIL
FT                   IHPSGRVDKVYSKMHLFDAYGYRESDYFLPGRTLSRTIVFDHLKFYVAICYDLRFPELF
FT                   RSYARQDAYGVFIHAGWVRGPLKEEILDLLARARSHENTMYIILSDQTGKQYVGRSGVF
FT                   SPYGFREVDMGYRRGYIEWPINLDDVLEARKIVPVIEQSRTRWDIVLKTNK"
FT   gene            complement(559307..559642)
FT                   /locus_tag="Shell_0606"
FT   CDS_pept        complement(559307..559642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31731"
FT                   /db_xref="InterPro:IPR017140"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC34"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31731.1"
FT                   /translation="MPEVRTGPVRVSGYAIKLRRVINAALRDYYKQKVLNAKEINNIIS
FT                   DLNAKIFNVLVERFEIPKDAIVNVILNYEVENNKFVIKDIKVEVYDLNEILTRNATAEI
FT                   KKNIGLQ"
FT   gene            559742..560170
FT                   /locus_tag="Shell_0607"
FT   CDS_pept        559742..560170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31732"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC35"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31732.1"
FT                   /translation="MYRIPRLIDVNAKSRIFRDKKKLLIIGRCVELEHPEILEKFKNDY
FT                   ALLSVCLEAEHVNMVGFKLAGILARGKYEEVSVLTVDGSLHCTQLHWMVEEVFKILGGN
FT                   SIKRRHFVIYHGKLYEVSVKAVKTSRYLYKVHKLVAEG"
FT   gene            560179..560967
FT                   /locus_tag="Shell_0608"
FT   CDS_pept        560179..560967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31733"
FT                   /db_xref="GOA:D7DC36"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC36"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31733.1"
FT                   /translation="MSDLETRISDLMRACDIIAKRLHGFKRMPGLLIYSSSLIVVYALL
FT                   LIISYFTRLNELIYLIELLMGLFGSTIIFILHMVILRKLNNHVEVSKYLHSHIEDMLKI
FT                   INLELSVESYNYLAKFLAVEKAPLEYMPVLLVIPYLSLLTVENPLFSILLIILFLVALP
FT                   SLLFFQMELFNRHVVYENKIIREVFSRIGNNEYDPYEPFIVGLKDVLLSIITLGIYLIA
FT                   LYAKVDAYLDNHIVKHRRNYRLFKINYIKKSKELLGFTQL"
FT   gene            complement(560954..562930)
FT                   /locus_tag="Shell_0609"
FT   CDS_pept        complement(560954..562930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0609"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="KEGG: smd:Smed_5507 molybdenum cofactor synthesis
FT                   domain-containing protein; TIGRFAM: molybdenum cofactor
FT                   synthesis domain protein; PFAM: MoeA domain protein domain
FT                   I and II; MoeA domain protein domain IV; molybdopterin
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31734"
FT                   /db_xref="GOA:D7DC37"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC37"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ADI31734.1"
FT                   /translation="MERKIFHQLTGLNEVVKVVEKYYPLKPLGEEYVDLISSTGRVLAE
FT                   DIYAPIDHPPFDRSEVDGYAVRSIDIRGADDLHPVKLRVIGGIEPGEKPSMEIRKGDAA
FT                   EIATGAMIPRGADTVVMVEYTRGEKNEVEIYRAAAPGENIAFTGSDISMGDLVLLKGTI
FT                   ITPNIIGLLAGLGISKVKVYVKPKVAVFSTGNEVVEPGEKLVPGKVFDVNGYLITSSLN
FT                   EMGVEAKFIGKLPDNEETIYSEIKKALTWADIVITSGGTSAGLGDVIYRVFEKLGEPGV
FT                   IVHGLKTKPGKPTVIAVAGKKLLFGLPGFPLSCYMIFDQVVKPIMYKLLGTKPPRRRKI
FT                   RARLAYRIKKPLGKTWLLPVSLIETRQGYTAYPVSIKSGSISPFIYSDGYVILPENTDL
FT                   LLEDSVVETVLFRDLESLPKLVIIGSNDILLYHILVQYGLADQTRIISTGSMGGWRAIR
FT                   RGEADIAPTHLLDEETLEYNAPFMEKFGLKSKAVLLRGYERRLGILVGKGNPKNITGIK
FT                   DFLRNDIVIVNRTRGSGTRVYLDYILKKLAEKENLSLHDIVEKINGYTYEVKTHTAVAA
FT                   AIAQGRADAGIAVEMAAKMYNLDFIPLTWEKYDFLILRDRMNKKLVREFIDILKSLREK
FT                   KNEVQNKYPGYRIPNNIGEIIAE"
FT   gene            563010..565178
FT                   /locus_tag="Shell_0610"
FT   CDS_pept        563010..565178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0610"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="KEGG: sat:SYN_01854 helicase; PFAM: DEAD/DEAH box
FT                   helicase domain protein; helicase domain protein; type III
FT                   restriction protein res subunit; SMART: DEAD-like helicase;
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31735"
FT                   /db_xref="GOA:D7DC38"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR022965"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC38"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADI31735.1"
FT                   /translation="MDGCGKELDVEKLLEYGLPRTYIELLKNRGITKLNPVQKSAVKKG
FT                   LFNNKNLLVSAPTASGKTLIGEMALVHNTINKDMIGLYLVPLRALASEKYYEFKELEKL
FT                   GLRIGITTGDYESPAEYLGRYNIVVATYERFDSLLRLKPRWLNRIGVIVVDEFHMIGDP
FT                   ERGPILEMIIARMLSSRVQIIGLSATIGNPDVLAEWVNAELVDDPYRPVELVEGVYDKK
FT                   NHVIVFEDGRRKKIIHRIGGAALNISLQSISSGIQVLVFVHNRRKTEEWAFKLSEHMGL
FT                   FKHLIDKNKLSQILEELKESPSRLEREKLEYLISRGVAFHHAGLSSVARRVVEKGFRER
FT                   IIRAVFATPTLAAGVNLPARRVLVSIKRYSPVRRRTVNIAVYEYKQMAGRAGRPTYDPY
FT                   GEAIIYDASSLSEGMRFIRGRLEPITSKLNNERSLRIHVLALIASRHANTLDEIINVFK
FT                   NTLFAAEYRDLAYLKSTLDIVLDDLLDWGMIKSTGNNGFVATRLGSITSITYLDPLSVN
FT                   RYLENVKDNVGDLYYLMLITQTPDYLRSKPYISNKLVELYEEEALELSDEGIIPEPPKT
FT                   FDYYDYYTWLQSFVQAKMLHEWINEVGEDEIVEKYSIGPGDVYSARDTASWIAGALSRV
FT                   EKVLGNTFRANKLEKLSLRLEYGVKEDALELVELQGIGRVRARTLIKNGIKSLKDLVNT
FT                   PPSKIESLPGFGPRLVRSLYEQLRERRD"
FT   gene            complement(565188..566156)
FT                   /locus_tag="Shell_0611"
FT   CDS_pept        complement(565188..566156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0611"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sfu:Sfum_0252 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31736"
FT                   /db_xref="GOA:D7DC39"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC39"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI31736.1"
FT                   /translation="MLGKLLTEWINPGRIEAEGYNVKGLDISVNDLVKIYKIGRGIEVQ
FT                   ALRGVSFNVLAGEAVTIMGPSGSGKTTLLNIIGGVDKPTGGTVFAGKIPVHELDEDMLE
FT                   KYRLGVIGYVFQTFNLIPVLSAIENVELPMIAFRVPRSIRVNRAKWLLEEVGLSGRIHH
FT                   KPTELSGGEQQRVAIAVALANDPPVILADEPTAELDTENALKITKLLVDLSIKHGKTVI
FT                   ISTHDPRIAVRASRIFRLEDGRIIGEYKPSDLGVKHEGRGKEEDLAEIIKNKLASVEKA
FT                   MEELVKKLKDGEISMEEFDRRYNKLRYQMEALKEILRSLGH"
FT   gene            complement(566175..569195)
FT                   /locus_tag="Shell_0612"
FT   CDS_pept        complement(566175..569195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0612"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31737"
FT                   /db_xref="GOA:D7DC40"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC40"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADI31737.1"
FT                   /translation="MNLIQKIFLSNKYFIVLFLIGIAVTSLIISAFNTSYLYVNDMVKE
FT                   LTSGLPCHAIVFYSNNDHPWILEKTVSNKLGRDEVKQYLNIYVESYSLPNGFSINDFKY
FT                   NYSSQLVLMYFPGLNEKYVTTSGVIVGLPSGSYNSRAKIIIDNRSFTDLVFVRSDIVDD
FT                   VLDKAFSHTTNISITPSHQHSPYTDIYKYIYEAQTSFSPLFTLYILVGDKQTFIDLATY
FT                   ADKHFEKYPLRIMSREISFTSNTFSIRSYTENISSGKLLLTILWFHAQKMITGLSVEAS
FT                   ENRIKSVLKDLTSISQCVTGIFKDYLSLRLQEARDVEKFIRIFSALSILPSLTVIYLTT
FT                   TRVPTVLVSTMRKIIALVRIRGISIKKIRNQLLFTMIIWITIGSIIGIFTGSLLSEILY
FT                   IGKFDQTIYFNLLNSAFDPLIIISSFVAVLILITASFYSTFKNISKIQPREFTRPSIFA
FT                   ELPLIKKGLSRGSILLLLLSIYYIIRATEIVSPAKLLAIREPNTTIIIGAILLFILEPI
FT                   MIYFGPVILIYSITKLLASYPDKLSSMISWIAKAVSRKYHILASRLIMLKPARIALLIV
FT                   LGTFSTGIVLGGLVGMDSVNLLYDHISISMSGGVDNVVVKQIDFTNTSNIYKDVEDASE
FT                   YINGSYTYALFLIDIRSIYGSIKPIELSKGAMVLPVWIMFIPGNFSKIVEINSALGYGF
FT                   DFREAIKQVENDPGKAIFIANINAMKEREEEIIAEPISGNAYIKLDNQLLANIDIVGTA
FT                   RNIPAVGYIANPIITHSSYFSSMSIGVVSAQIKLIYPTSTGLIMNIMNLEKFVKNKNLT
FT                   NEFLRGYLFIFVKGSVDKTLTSKGYNVLNFKGMQKNIDKAKQFMVIGFNNYLSTGISLF
FT                   IVALIFISILTYTIIFENLYAYTLMRARGVPSSSVYRLCVSEALSMSIISVLPGIIIGL
FT                   FLGYALFNVSFESYAFYAPIGVENVYGVSYILSISLNSLISILIILLLPIILSYIIVKI
FT                   TYKRVVREAIMLLGSHV"
FT   gene            569364..570749
FT                   /locus_tag="Shell_0613"
FT   CDS_pept        569364..570749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0613"
FT                   /product="Conserved TM helix repeat-containing protein"
FT                   /note="PFAM: Conserved TM helix repeat-containing protein;
FT                   KEGG: abb:ABBFA_002842 conserved TM helix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31738"
FT                   /db_xref="GOA:D7DC41"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC41"
FT                   /inference="protein motif:PFAM:PF05552"
FT                   /protein_id="ADI31738.1"
FT                   /translation="MADVFGNVSSAFNEVIVQIINYLPRIIGAAIIVLIGYVVGVLVKD
FT                   ATKIIIDKLFEKPLEKTRSGKSLKEAGVDLGHLIGILMMALVIIISIVAAIDVLSITGY
FT                   TGELVRAIAIAILNITAGITILAIGIPVSIIFAEYIASFFGGSFRDKHGLAVSLIYDVT
FT                   ALVLSVFVIALAVKVMFQYDLLLNYIVSAAPGFITASIILFVGYVLGDAIGKVVDKIID
FT                   AIVEKPLEATDIGKSIKSVNIDLSGLIGGLTKAFVIVVSIVAAVEIINLGGLTGELVYQ
FT                   IALYLPKLIGGITLLTLGLILSVALARYVGKFLHAMFKEKYAGLASLAENLILLGLITV
FT                   ILTISLNIMLLEGSLIYPLILGIIIIVTGVYVAGTVGSVLAETYPTYKRLAPFIESLII
FT                   LIFVVIGASGIFSQFVGATNVINTIAWGLSIAFALVLVPVTFYYTRLAWREAIKSTEEA
FT                   KEE"
FT   gene            570885..572435
FT                   /locus_tag="Shell_0614"
FT   CDS_pept        570885..572435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0614"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: rfe:RF_1278 tRNA-i(6)A37 thiotransferase
FT                   enzyme MiaB; PFAM: Radical SAM domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31739"
FT                   /db_xref="GOA:D7DC42"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC42"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADI31739.1"
FT                   /translation="MYRRIVIVDGYNDEPAGLGVPPYIDVYPRLVAGAVWLANKDVDII
FT                   YWTIDEVRNNIGLFIDQARKSDLVVFIAGPEVPGKYIGGKPLSYKDAEKLSFLLKDTFK
FT                   ILVGPAARYGFGVGGGSVAVERKILYRIFDELVYGDPEIYFYNLVKYGVEKAEPWKLRE
FT                   DYELANKALIHGAKIIKQHPNHGWNLIVEIETFRGCPRWIVGGCSFCIEPRYGRPLMRK
FT                   PEDIVKEVEQLYRFGARHFRIGRQPDILAYMGKGVGEREYPEPNVEALKKLFHGIRNVA
FT                   SGLRVLHIDNVNPGTIIHNPEKSIKALKTIVKYHTPGDVAALGIESFDEKVVRMNNLKV
FT                   YPDEALVVIRIINEIGKHRGWNGLPHLLPGINLLYGLPGETKNTFRTNYEYLKKIYREG
FT                   LLIRRINIRKVSVLENTPLWMHRKTVEQLLRKHRRLYNIYRVKIMNEIDRGMLQRIAPI
FT                   NSIIRYLYTEKHMGEYTIARQPASYPIIVKIPGKLPLKKIVDIRVRKIAAKSIIATIT"
FT   gene            572477..572734
FT                   /locus_tag="Shell_0615"
FT   CDS_pept        572477..572734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0615"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: Transcription regulator, AsnC-type-like; KEGG:
FT                   pfl:PFL_5669 AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31740"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC43"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADI31740.1"
FT                   /translation="MSGIIFVRIKPGYEKEVMDKILGIENVSRVYRVFGDYDLIVVTQD
FT                   ISLEELKKVMEKIRSITYVLSTSTLVVVSKKIKKQVGSKN"
FT   gene            complement(572731..574500)
FT                   /locus_tag="Shell_0616"
FT   CDS_pept        complement(572731..574500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0616"
FT                   /product="Orn/DAP/Arg decarboxylase 2"
FT                   /note="PFAM: Orn/DAP/Arg decarboxylase 2; KEGG:
FT                   ppd:Ppro_2606 arginine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31741"
FT                   /db_xref="GOA:D7DC44"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC44"
FT                   /inference="protein motif:PFAM:PF00278"
FT                   /protein_id="ADI31741.1"
FT                   /translation="MVWDKELARELYGLTGNIWSKYLDIDERGRLIVKLKGYKIDLAKL
FT                   LSEKKLPGAHIRILPIIRYMMDKVYEAFMEAFRKFGYEGEFKPVYPLKSNSTTIVVDTI
FT                   WQYGVKYNWGFNAGTYPEIKLLSKYTNKKPRLLVVDGIKDNKILDLLVKMNDNWEIIVD
FT                   IESMRDADLLSKYRDLNIGLRIKVVSKSSGLWSHSSGLDSKFGLLINTLDEIIKEHPWI
FT                   PGRTVLLHVHAGSQITDKNKLENIIRETITLYNSLVNTGFKNIRYIDFGGGLAYPYVEA
FT                   SDHMFSSNYSLNEYAEILVKEVVESAENIPGIVFEGGRYIVAPHRITVTKIIDTRPYST
FT                   PEDDETSYPIVEEIKNAENIKELVYVSRRAREIITRLMIKSPINIETRRMLEKLLGSIT
FT                   KAITCKAYEIISKDKDNALKELTRTPNFVFEELVKPSHRFFASFSLFSHLPDTIVADQY
FT                   FKVTPLQRLNEKPEVLGVISDLTCDSMGEYSAFATSLPSNIETGTEDLFTSLDHKLMFI
FT                   PGKTLRLKGIPLHIPRKNENYYIAFLDTGAYQDMLSMNHNLLDGYPEIIIDIVNDDLKI
FT                   QYKNLETTENYPF"
FT   gene            574656..575360
FT                   /locus_tag="Shell_0617"
FT   CDS_pept        574656..575360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0617"
FT                   /product="cytidyltransferase-related domain protein"
FT                   /note="KEGG: hypothetical protein; TIGRFAM:
FT                   cytidyltransferase-related domain protein; PFAM: Protein of
FT                   unknown function DUF357; cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31742"
FT                   /db_xref="GOA:D7DC45"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023140"
FT                   /db_xref="InterPro:IPR036809"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC45"
FT                   /inference="protein motif:TFAM:TIGR00125"
FT                   /protein_id="ADI31742.1"
FT                   /translation="MSIQLRDRVNAYILNVEKALDQIDKSKLGDMEKKLVEIAEAYLSD
FT                   AKYYFDKNDYETSLACIAYAEGLIDSLRYLGKTNISWEPLSKLLNRPKVLVAGGFEIIH
FT                   PGHIYLFKKAWEKGRVYVVVARDKNFKKFKKREAVIPENQRLKVVENVKYVYKAVLGDE
FT                   HDYLKPVENIKPDIILLGPDQWPQEEELKKELEARGLSGVKVERLDKRIDENLYSVSRI
FT                   IRKIIETHKCNQ"
FT   gene            complement(575392..576129)
FT                   /locus_tag="Shell_0618"
FT   CDS_pept        complement(575392..576129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0618"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   ppd:Ppro_0727 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31743"
FT                   /db_xref="GOA:D7DC46"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC46"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ADI31743.1"
FT                   /translation="MSKEEINILIINASPRKYGNSTKLSTIAEKGVLDAGGKPEKIFLY
FT                   DYNIKECMGCVSDDPKICRFPCIIRDDDFNMLGEKILRSDGFIIVSPIYWYNVPGKLKN
FT                   LIDRMTSMENMIIHTGRSLLEGKVAGFIAVGNDSGSILEIAYLMVVMNSMGIHIPPWAL
FT                   AYHHSPKEVLNDEQAVRDSYNVGFIVTIAAKMLKERKQWYKNDVDLEVLRKIASKSVEE
FT                   YIEYKHLRQQYYRQALSKENNEG"
FT   gene            complement(576227..578740)
FT                   /locus_tag="Shell_0619"
FT   CDS_pept        complement(576227..578740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0619"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; transferase hexapeptide repeat containing
FT                   protein; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II; KEGG: gur:Gura_0855 nucleotidyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31744"
FT                   /db_xref="GOA:D7DC47"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC47"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ADI31744.1"
FT                   /translation="MVKAVIMAGGEGTRLRPLTVNRPKPLVPLVNKPIMEHVVHLLKTK
FT                   GFKDIGVTLHYLPNTIMRYFGDGSEFGVKIYYSIEEKPLGTAGGVRFLVDRYGWDETII
FT                   VISGDVFTNIDLEKMLEYHRRKGSIFTMAVRKTDDPTKYGIALLDEEGRVRRFLEKPSW
FT                   SEVFSDLINMGIYIIEPEALEMIPPNEEYDFAKNLIPKLLRSGKPVYGWRADKYYWSDI
FT                   GSINQYKDTHNNILSGKVKIDTSMLGSEVAKGVYVGENTSIDNIDNIIPPVVIGKDTRI
FT                   KKNTVIGPFTVIGSNNIIESGVRIEKSIIWDYSYIGPASTIIDSIICNNVHVRDHVAIM
FT                   EGAVIGDDTRIGRGSIIRPNIKIWPSKIIDPYTIVSINIKWGIRWYKTLIEPWGITGLL
FT                   NIEITPELASRIGSAFGSSLPRNSSVVVARDTYASSRIVKHGIVAGLMSSGINVYDLEV
FT                   SPLPVLTNYIKKKKLKGGIHVSSLVYDPLRIRIKIFDHTGKFITRTMAKKIENIFFKEA
FT                   FRKVLGDQVGDLYPTIDHIDQYISDISTHISFENIREQGRVLIDCNYGSAGSLWPRLVR
FT                   ELGLTVYQVNCNEQSPIMPPREPFIHASVDSAIKIIPLLGLSAGFIYDSDADKLIVITD
FT                   SGKVVSGDHLIALVAKILLETRGRGKIVIPHNSSRVVIDTIREYGGETIFAEQGLMGLS
FT                   EHINENILMAADERGGIIYPWLHYGSDAIFTSLLILEYLGSTGYNLSTLLEQLPKTTVI
FT                   KKTIVVPYAQRGRFMRIIYEELKEKEIDTLDGIKIVEENLGSGYIRPLPNEPLIEIIAE
FT                   SDNQERAEKLAKMLLDLAYKIKSKL"
FT   gene            578897..579487
FT                   /locus_tag="Shell_0620"
FT   CDS_pept        578897..579487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0620"
FT                   /product="PEBP family protein"
FT                   /note="PFAM: PEBP family protein; KEGG: nam:NAMH_0997
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31745"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC48"
FT                   /inference="protein motif:PFAM:PF01161"
FT                   /protein_id="ADI31745.1"
FT                   /translation="MLRVNVKFNKEQIYNCIMIEIGDIMIFLRRKKNPLEIAKNEAEQV
FT                   IEVTSPAFKHGERIPRKYTCEGEDISPPLRFENIPDNTAELALIMYDPDAPIGIFHHWL
FT                   LYDISPDTKELPENIPKEDETEYGVQGRNDFGRIGYGGPCPPRGHGRHRYYFLVLALRE
FT                   ETGLTAGARPSDVLEAVKDKIIGYGVLMGTYSR"
FT   gene            complement(579475..580194)
FT                   /locus_tag="Shell_0621"
FT   CDS_pept        complement(579475..580194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0621"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: abc:ACICU_01259 HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31746"
FT                   /db_xref="GOA:D7DC49"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC49"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ADI31746.1"
FT                   /translation="MFIDPRKTIISFDMACTLFWEPGCKPGYDSRVEIFKEILEITRSR
FT                   GYPVKYRDNPHELYRRLWRETRRKGPRRELWHKYVLAKMLYRLGAEVDHVFLEEIYSYY
FT                   INESAKLFTIFPQHKYLLQYLRGRGYRLILTTATGAHDLALKILEYNNVSHYFSMVFST
FT                   QLIGIPKSDHRFYEEIAGVLGVDPGNIIHVGDSLEHDVYSARKAGLKTIYYGWRTRCRA
FT                   NDPDPCITNLLDLLHLL"
FT   gene            580794..581984
FT                   /locus_tag="Shell_0622"
FT   CDS_pept        580794..581984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31747"
FT                   /db_xref="GOA:D7DC50"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC50"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31747.1"
FT                   /translation="MASNVSQYYWLRPGAYFKYRLTVSPPEKIIIHDKINDVKYVADPS
FT                   SSSIFFYWEIVNVEKNFFIARIGINASNVLNEKTNTFTNYTFTEEFMVKIDTLDTYSIT
FT                   SDGRRGAWVGEWPYLLQPILTSKKGVKLLYFSDGDICLVGVNETDFIRDVKRINETVYR
FT                   ISNGTRTYSPIPSSGVEVERSGSSESSSAFCISNWTAIFAFINPPPASSQYNLSGIVLG
FT                   AERIASSPKIKFISYNGEDVPLFNTLYNNSKRGLIVDSICKYNNVLIDPMGRVYAVMIV
FT                   SVQVMYDSITGVLLKAHSPEEPLFVLPFPCLWEKIQITYKQIVPKPADFTIELIETNIN
FT                   FSRPIIGGTESLPETTAPQRSRGTSSGTIWVIVIGITVIAALTFVFYLKQLRKRHI"
FT   gene            582028..582642
FT                   /locus_tag="Shell_0623"
FT   CDS_pept        582028..582642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31748"
FT                   /db_xref="GOA:D7DC51"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC51"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31748.1"
FT                   /translation="MISGEKMWRAWRIRLPMASLMLLLLLLVLLQIYWVAVLEDGKEFS
FT                   RGTLVLGSGIQHSLYRNYVLHSDTGYALLGRGDRLSIDAIVSGTSSWQYILTVVDLASG
FT                   ETYSYNATYYSSRAPTPLFIAPKSSLYYYNLTIVSLSNVSEWTINIKISGQQVARQDVI
FT                   MRLPIATIIILFFSLIIGFLINSVEFKNNFIDLLSWEFRTL"
FT   gene            582721..583335
FT                   /locus_tag="Shell_0624"
FT   CDS_pept        582721..583335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0624"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31749"
FT                   /db_xref="GOA:D7DC52"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC52"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31749.1"
FT                   /translation="MYVLLSPIAFSRKSDFFIVYLLLAASITTMLYTYQWEIRLDRTMD
FT                   LLPLSRVRRFFIRLLLIFILLYLPIVLATLLVYFIWLPNLIIGNPVLFFNVYSMELLYY
FT                   VCIVLVIISFSLLPAVFVPRTSLALPTAALPGIIIYMEVFQSLLGFDFKRYLTEYDPYT
FT                   HLNDPWLNTVPSPFDLLYIVAIFFIITTLLSLFTYIRRENP"
FT   gene            583342..584205
FT                   /locus_tag="Shell_0625"
FT   CDS_pept        583342..584205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0625"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: aeh:Mlg_1076 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31750"
FT                   /db_xref="GOA:D7DC53"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC53"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI31750.1"
FT                   /translation="MTVLEAVDLWKLFGRTIALRNITLRFGRGLYLLLGPNGSGKTTLL
FT                   KLWAGLLRPTRGKVYVKGLNPWRSRVDIMKFMSVEFEETILPWWRSGREYLRFVAKQKG
FT                   VKWSNVVELAELFNVTDYWDKIIRGYSSGMKKKIIILATLMGEPEILILDEPYTLLDRN
FT                   TVEKLNKLLLKMLNTVKTIVIASHVFTGIEERANGVAILINGNLVFHSTTDKLLAEGEK
FT                   TYICKTTNPITLVEILFSQGVKNIRIEGNTVYFESDKHVKLPENINCSLKIDIRRIYED
FT                   ILVKLK"
FT   gene            584306..585400
FT                   /locus_tag="Shell_0626"
FT   CDS_pept        584306..585400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0626"
FT                   /product="Wyosine base formation domain protein"
FT                   /note="PFAM: Wyosine base formation domain protein; Radical
FT                   SAM domain protein; KEGG: SORBIDRAFT_01g006590;
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31751"
FT                   /db_xref="GOA:D7DC54"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR023993"
FT                   /db_xref="InterPro:IPR034556"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC54"
FT                   /inference="protein motif:PFAM:PF08608"
FT                   /protein_id="ADI31751.1"
FT                   /translation="MQRSIDWGEVRRKREEFWNSSPVYKAIYERMKKQGYHFIGTIGVV
FT                   KRCHWTREALVNRRFCYKCLWYGIESHRCVQMSPVAAWCWLRCLHCWRIQPEDIGMHWD
FT                   ETRIPVVDDPEIIAEESIRVHRQIVAGFKGNPKVDPRMVEEAMNPKHVAISLTGEPTLY
FT                   PRLGELIREYHRRGMTTFLVTHGVRPDILAGLEEEPSQLYLSLEAWNKQKFMEFNRPIV
FT                   PRAWELIMETIDLFPSFKCPTVYRITLVKGFNDSDEALEGFAKLIERGNPTYVEVKAYM
FT                   FIGYSRGRLTSANMPSHEYVREIAKKLADLTGYMVLSESIPSRIVLLSRIKEPIRHGKG
FT                   CPDGVKHPEKYAWVITHEYEEMKS"
FT   gene            585493..586308
FT                   /locus_tag="Shell_0627"
FT   CDS_pept        585493..586308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31752"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC55"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31752.1"
FT                   /translation="MQGEDALPKRLRLSSRRDVERRLREIIWILKDKHKTIHYIGEKTL
FT                   DPTTLYSTQKYLESDKMGLVLREVLFHGYDSPIIVIRGIMSRYYIIDGHHRARVMLWLR
FT                   RKVKSLILNIPDYKPRVSVPIWEIELLNPPEKISSWLNTWRHIANIIRFIEKKHGGIAY
FT                   VWKDKLVIKELISTQKIVPAHPRKIVEEPILVYNYSKDYYVIDGHTRACTKLLRGEETI
FT                   LSVVFTLEKKIGLIDTAIKLGKQRFSEEICSRLSPPCHSVYFCVYLCPQ"
FT   gene            complement(586309..586405)
FT                   /pseudo
FT                   /locus_tag="Shell_0628"
FT   gene            complement(586509..587351)
FT                   /locus_tag="Shell_0629"
FT   CDS_pept        complement(586509..587351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0629"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: structural maintenance of chromosomes protein;
FT                   K06675 structural maintenance of chromosome 4"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31753"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC56"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31753.1"
FT                   /translation="MKKTLTAKVLEIVWQNPGSTIKDVAIMLNISLPTARAILYKLKNN
FT                   GYIEKTGKGYILTSKGEWFINNVLLKEKTGGKESIEQKPEEKPVKTERVIVKNKREAEE
FT                   DKKEIQAVIEQKQLVGLEEKVMAKIKLLESRINELEKTIQRITADLESIKNMLKTGKEH
FT                   AKIMEKTEKPSSKPALALGTKKPARNTENKLPAPIMYVYEAKNTLGPLLDSLIRSGKAE
FT                   IIGSLIVDSEFYKEFKKRFPITISEAERLPPMEKKLLEEMNREAIVIIHAGKYYKLVK"
FT   gene            587551..588378
FT                   /locus_tag="Shell_0630"
FT   CDS_pept        587551..588378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0630"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3874 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31754"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC57"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31754.1"
FT                   /translation="MSANELFDEETKQALKEIFQQFQRKIVDYLVVEEGSESASDPDPD
FT                   PDPIDPPDDPSEDENKQTATPIQPHPHVHHHGCPTCGEAKMLAKALMEVSDGKLEFKII
FT                   DKNSEEAKQLHVRYVPAFIYGSQKKNIRYYGLPSGQEFAPFIYIHSYIANNEVKLPENV
FT                   IEEAKKIDAPLHIKIFVTPECPYCPLTVDGFNQLALINDKLLVETIEAVELPLEADMYN
FT                   VAYVPDVVITDPDKMDEYGVEPIERINGYMPIEETINIVKYAAEKLKETKKQG"
FT   gene            588392..588799
FT                   /locus_tag="Shell_0631"
FT   CDS_pept        588392..588799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0631"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="KEGG: dal:Dalk_2732 iron (metal) dependent
FT                   repressor, DtxR family; PFAM: iron dependent repressor;
FT                   SMART: iron dependent repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31755"
FT                   /db_xref="GOA:D7DC58"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC58"
FT                   /inference="protein motif:PFAM:PF02742"
FT                   /protein_id="ADI31755.1"
FT                   /translation="MILRDKVKPWRAEDYLEAIHAMKQQGLRPRVRELARRLGIKPSSV
FT                   VEYLKKLDELGYIVYKKGGFIKLTDKGKSLAEKVYRRHVLLTEFLVAIGVPRDIAEIDA
FT                   CYMEHGLHDETINKIMEFLKKNLKNKGLSTR"
FT   gene            complement(588785..589597)
FT                   /locus_tag="Shell_0632"
FT   CDS_pept        complement(588785..589597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31756"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC59"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31756.1"
FT                   /translation="MIIGFKDFNIEDIIYLSIGVFIGGCKPSVSSGSEPELVLVKKNNG
FT                   IAIIRESNELSIIYEGINASTGIMLNQKHGEIYMHTLNIGNERVEGYLTRSKIDPRIFA
FT                   GLYACMIGKGSDQRKAFLEVMDILALGEGDPFKYMKIVISEHRVFHRLNNALNRLFKNE
FT                   ELLRKIMNNKLIIGGRSLGDTVYVSAIIKAGHGFVRECVEPVSINTYKEYEWVQPNQFF
FT                   ICGLLDEIVKFCSKYGFEKRVDPYMGNCIIGNDAVRLVILLEKYLSSA"
FT   gene            complement(589598..589885)
FT                   /locus_tag="Shell_0633"
FT   CDS_pept        complement(589598..589885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0633"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ilo:IL0300 lipoate-protein ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31757"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC60"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31757.1"
FT                   /translation="MNNPIKKSITYRVPGGKTLKIDVEIKDNTIIDIIISGDFFAYPEE
FT                   GIELLENDLKGKTINEAIRIIDDYRDKIKLLGISLENIKNILIKIFHGVS"
FT   gene            complement(589890..590648)
FT                   /locus_tag="Shell_0634"
FT   CDS_pept        complement(589890..590648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0634"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /note="PFAM: biotin/lipoate A/B protein ligase; KEGG:
FT                   tgr:Tgr7_2206 biotin/lipoate A/B protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31758"
FT                   /db_xref="GOA:D7DC61"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC61"
FT                   /inference="protein motif:PFAM:PF03099"
FT                   /protein_id="ADI31758.1"
FT                   /translation="MVSSWRLIIDEANVYYNMAMDEALLILREKEIIPNTIRIYVMRPS
FT                   AVTIGYFQKIKDVLNLDYLDKYRIDYTRRITGGGAVYHDQDGEVTYSITTSIDSVSKNI
FT                   LESYKKICYGIIEALKELGVKAEYKPINDIVVMGRKISGNAQTRRRKALMQHGTLMYAT
FT                   NIDILGKVLRPPKEKLSSHKARTLHDRVTTLEKILGYKPRKEDVIDALIKGFEKALNIK
FT                   LVRDNYWGEELELASLLIDKYRSREWIFKR"
FT   gene            590768..591742
FT                   /locus_tag="Shell_0635"
FT   CDS_pept        590768..591742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0635"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: tgr:Tgr7_2204 radical SAM domain protein;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31759"
FT                   /db_xref="GOA:D7DC62"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC62"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADI31759.1"
FT                   /translation="MDDLTIRASLWSLVKLGLIDGPQISYPMNIVYLLQYSDKGCLARC
FT                   KFCAQSIVNSSPKKFLSRITWPTTRLSKIINALKKHRGEVRRICFQTIIKPWFLDEALN
FT                   IIRELNNNVPEIPISLAITPIPRKFLEEFREYGVDYLGVGLDASSPRIFRIVNKPYSWS
FT                   IYMKFIDEAIEIYGYRRVMVHLIVGLGEKPLELYKLMEELIMRGANIALFAYTPIDKGV
FT                   WKPEINILRYREAQIIRYFLLKGYRLNEILDENNRVNNDVLEEIIKHIEKYLGIFITSG
FT                   CPYCNRPYYNESPRGPFYNFYSRNHVMKYLDSIINELEKLRNR"
FT   gene            591751..592614
FT                   /locus_tag="Shell_0636"
FT   CDS_pept        591751..592614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0636"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: afr:AFE_2546 radical SAM domain protein; PFAM:
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31760"
FT                   /db_xref="GOA:D7DC63"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC63"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADI31760.1"
FT                   /translation="MSREILVFIPGKKFPGISITGNKCWLMCSYCMGRFLKGMDHVYTP
FT                   KQLYDLARYYAEKGAYGLLISGGFTREGYLPIQPYLDTIREIKKDFELIINVHPGIINE
FT                   ELAIKLRNAGVDIVDYELVLDNKVIRDIKHLNKTIEDYIRTYEILVREGPPYIAPHIMI
FT                   GAKYGNIDWEYIAIDLLKDYNPYLVVFLLIIPARGTLFENVSIPSIDQVVNVLRYARRK
FT                   LNTEISMGCMRPPQVKNLLDKIIVEHELVDRIVNPHPSLIRKYGFKTIETCCSVPRKIL
FT                   VEKGLL"
FT   gene            complement(592731..593450)
FT                   /locus_tag="Shell_0637"
FT   CDS_pept        complement(592731..593450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31761"
FT                   /db_xref="GOA:D7DC64"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC64"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31761.1"
FT                   /translation="MRIIGILVDLVYKSLFLKGEEGFRATSSLVKILLLALMLTYFIID
FT                   HSLYSSLSIILLILILGITGLSFSWFISSFTLSSIPGLWYAITALLFSYTGLSWPISYM
FT                   DVFIIYLRTTTFSLILLFFGSIISPVRLANILLKLGLRRNSVAPILLWRAMPYGLKSMQ
FT                   ESLAIGELKKENVGKRLGPAMASLLEYSDMVNESNHHRLNTSMKHLLPAENSRKHNLIL
FT                   IIACIIVVILLLKTFTS"
FT   gene            complement(593441..594760)
FT                   /locus_tag="Shell_0638"
FT   CDS_pept        complement(593441..594760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0638"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: dal:Dalk_4065 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31762"
FT                   /db_xref="GOA:D7DC65"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC65"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI31762.1"
FT                   /translation="MAEEKVIEANIIEAGYHKGFSIKNISFKLGRGEILVITGRSGSGK
FT                   TTLLKTLLNILYLSNGYFKGVVLVKNKPITKYSSEELYKLISYIPQDPWYAVIGHVVYV
FT                   EYCHALSAANIKCDPRRLEIYGLGKLEKHITYGLSAGEYQRLLWASSIDKGSEILFLDE
FT                   PLIYIDSTSRLEFIGFVKKFVEANGTAVIVDHMPENWLEFDPKILVLDKGIQKYLGPYR
FT                   EDLIPKPNMNIGKVTNQYKKRQPLLVSKNIWFKYPGENYVLRNISFEAYSGEVTGISGR
FT                   NGAGKTTLLKIFAGILKPNRGDIIRYGSIIYIPENPLLYYSYPTPREELSASTRDPGEF
FT                   ERITKRFGLEELLDRPLSKLSSGERRRVALASAFLAGYDIYLLDEPSGGLDNYNLEELL
FT                   DEIMFLKRNNKAIIIASHDERLYPFFDKTCILREGALTCE"
FT   gene            complement(594738..595493)
FT                   /locus_tag="Shell_0639"
FT   CDS_pept        complement(594738..595493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0639"
FT                   /product="protein of unknown function DUF1393"
FT                   /note="PFAM: protein of unknown function DUF1393"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31763"
FT                   /db_xref="GOA:D7DC66"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC66"
FT                   /inference="protein motif:PFAM:PF07155"
FT                   /protein_id="ADI31763.1"
FT                   /translation="MSYKGRIDIVTIVIYIVAVYVATIAIQIYQPVTGGYFNLGEAVIY
FT                   LAAILHGPIVAALAGGIGASLADLSTGYGIFAPATAVIKFIEGYFAGWLIWKFRDKARN
FT                   IKAAVGALIGALYTLLLIFFAIYYWSGPTYVGPEQFLSLTITSAYLEIPVYVWIIIVLV
FT                   IGASLSYVLVKKLVTAWEPLALIFAGLEMVIGYFLYEYFVSNPLTGRQPVAAIVEIPVN
FT                   IGQAVIGASIAVPLASWLVRAGYGRGKSD"
FT   gene            complement(595617..596924)
FT                   /locus_tag="Shell_0640"
FT   CDS_pept        complement(595617..596924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0640"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: pen:PSEEN3862 threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31764"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC67"
FT                   /inference="protein motif:PFAM:PF00291"
FT                   /protein_id="ADI31764.1"
FT                   /translation="MIKIKCLKCGFENNSYRGYNCPNCGSLLEVIHGFEWIIEWGNNGI
FT                   WIFSKMLPQTNHRISLGEGWTPLIRSDNLFRDENIYFKDESRNPTGSFRDRAAALVVSD
FT                   ALDQGAKRLVVASDGNMGASIAAYSAKAGLPATIYVPVWADPEKILLMKAYGAKVIVSK
FT                   EDLDTLLQYVERRTRKEKLYNASSTYNILAMEGLKTIAYEIYLQYGGIPEAIYVPLGSG
FT                   LTLLSLYHGFSEMLTNNIIDHIPRLIGVETCANPVYSSIHGNPTRCNEEPMPGLYYRKP
FT                   VLKEYVSEIIDKHGETIVVNNKQVYEAAKKLAMKEGLFVEPSSAVALAGALKMGGVENS
FT                   IILLTGHGLKGPSSYTRPSRERYTPFPGSTKSLILKIVSEKPGLTGYEIWKRLGLRISV
FT                   QAVYQHLKELERMGLIHSKFLENRKVYFPSYKKSRS"
FT   gene            complement(596944..597408)
FT                   /locus_tag="Shell_0641"
FT   CDS_pept        complement(596944..597408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0641"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="KEGG: bpt:Bpet0026 AsnC family transcriptional
FT                   regulator; PFAM: Transcription regulator, AsnC-type-like;
FT                   SMART: Transcription regulator, AsnC-type"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31765"
FT                   /db_xref="GOA:D7DC68"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC68"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADI31765.1"
FT                   /translation="MTRNTPLLDDIDLKILDELRKYSRKSFREIASKLNKPVSTIYDRI
FT                   KRLEKHGIIHGYTIDIDYRKLGYQIRALILVNAEGKNLIKVEQDIASNPNIQAVYDITG
FT                   EYDIALIASFKTIEELDAFIKKLLGKPGVKHTLTSIVFRTVKETQHLPLK"
FT   gene            597522..598865
FT                   /locus_tag="Shell_0642"
FT   CDS_pept        597522..598865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0642"
FT                   /product="glutamine synthetase, type I"
FT                   /note="KEGG: reh:H16_B0618 glutamine synthetase; TIGRFAM:
FT                   glutamine synthetase, type I; PFAM: glutamine synthetase
FT                   catalytic region; glutamine synthetase beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31766"
FT                   /db_xref="GOA:D7DC69"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC69"
FT                   /inference="protein motif:TFAM:TIGR00653"
FT                   /protein_id="ADI31766.1"
FT                   /translation="MNRIKFVNLYFTDLIGVFRSTSILLSNDEDPSSVTALFDGSSVYG
FT                   FLDISFSDVVLKPVKETEILLPWDKNVYGYIAQVYLPGWKRLDRDPRYIAERTEDIIRR
FT                   EGYRSVMGVEMEFFLFEKLKYIVEAGRQILEIYSAESPWTDNISIPLKKGYHIVESIDR
FT                   VAHIRRSIILALHEAGLNTVKHHHEVASSGQVEITSNKENTVSLGDFIQYFKMIARKVA
FT                   RMHGFEAVFMPKPIMSDNGNGMHIHVSLWSKNINLFYDQNEKYGLSQLARYFMGGLLDH
FT                   GRSLSAIVSPTTNSYRRLIPGYEAPVYLVWGYANRSAAVRIPLANKDKGLATRIEYRPP
FT                   DPTANPYLAASAILLAGLDGVKKKIDPGDPIEENVYKMSAEKRKSLGIRELPRNLDEAL
FT                   DELESDHEYLKPAFREDVIQTYIELKRSEIRELAGIPSPAEFLYYNLI"
FT   gene            599041..599745
FT                   /locus_tag="Shell_0643"
FT   CDS_pept        599041..599745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0643"
FT                   /product="ERCC4 domain protein"
FT                   /note="PFAM: ERCC4 domain protein; helix-hairpin-helix
FT                   motif; KEGG: sbn:Sbal195_0376 ERCC4 domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31767"
FT                   /db_xref="GOA:D7DC70"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC70"
FT                   /inference="protein motif:PFAM:PF02732"
FT                   /protein_id="ADI31767.1"
FT                   /translation="MSYILLSPVDIIIDSRENSKHPEFRKEFQSHGLKTAVQPLPAGDF
FT                   LLLAVPGKKPVLVERKTVTDLGNSIRDNRIWEQAKLLAEAAEKEGYQPFLVVEGWLGVL
FT                   EKYRGWKIQSVLRVIDALMLDFRIPVLNTPNKQATIAWLIAKAKSLGRTEEKRIYRMRV
FT                   EKKPMSLKDRILYVAESIVGPTLARKLLREFKTLRNIANASVKELMVVEGIGEKRANEI
FT                   YLIFNTEWSDDQ"
FT   gene            599742..600776
FT                   /locus_tag="Shell_0644"
FT   CDS_pept        599742..600776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0644"
FT                   /product="UDP-N-acetylglucosamine--dolichyl-phosphateN-acetylglucosaminephosphotransferase"
FT                   /EC_number="2.7.8.15"
FT                   /note="KEGG: N-acetylglucosamine-1-phosphate transferase;
FT                   K01001 UDP-N-acetylglucosamine--dolichyl-phosphate
FT                   N-acetylglucosaminephosphstransferase; PFAM: Glycosyl
FT                   transferase, family 4, conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31768"
FT                   /db_xref="GOA:D7DC71"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC71"
FT                   /inference="protein motif:PRIAM:2.7.8.15"
FT                   /protein_id="ADI31768.1"
FT                   /translation="MMNTCFSDYTLCYALLSALISFMITYTVLPLWIKRAQEIGFTGKD
FT                   MNKPYMVQVAEAGGVWVSISVAFGILFFIALEIYIGGLHKYIVELMALSLLLFLSSFLG
FT                   FLDDILGWKKGLRVIYRIVLMAPLAIPMMVIKAGHSTMNIPFIGVVDFGLAYPLILVPI
FT                   GVLGAANAFNMIAGYNGLEASMGLQLMLFTSIYTYINNVHPSFEASLIMLAAITAFLIY
FT                   NWYPAKIFPGNSFTYGLGAYYASLVILGNFEKYGLMLFTLYFIELILFIRGLINGVYKE
FT                   NYGKVRNDGTLEPPYDKIYSVTHLAIKIQLFIRGKATEKGVVIVLNIIQFFIGLLSLIL
FT                   INII"
FT   gene            complement(601295..602581)
FT                   /locus_tag="Shell_0645"
FT   CDS_pept        complement(601295..602581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0645"
FT                   /product="hydroxymethylglutaryl-CoA reductase, degradative"
FT                   /EC_number="1.1.1.88"
FT                   /note="KEGG: ppf:Pput_3073 hydroxymethylglutaryl-CoA
FT                   reductase, degradative; TIGRFAM: hydroxymethylglutaryl-CoA
FT                   reductase, degradative"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31769"
FT                   /db_xref="GOA:D7DC72"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004553"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC72"
FT                   /inference="protein motif:TFAM:TIGR00532"
FT                   /protein_id="ADI31769.1"
FT                   /translation="MSHEMRSSRIPGFYKKSLDERLRIVGEWAGLTEEEVNLLRNLGNL
FT                   PEKIADSMIENVIGGMTYPFAVAVNFKINGRDYLVPMVIEETSVVAAASNAAKMLRRGR
FT                   GIIVRAGPQEMIGQIHLVNVEAPYYKAMKILEHKEEIIDHAKQQDSTLIKLGGGPRDLE
FT                   VRVLNTRMGPVIVVHLIVDVLDAMGANAVNTMVESIAPLLEKITGGEARLRIISNYATR
FT                   RIVRALARTDPEDVGGKDVARKIVEASILAEADPYRAVTHNKGIMNGIIAVALATAQDH
FT                   RAIEAGAHAYAARSGVYKPLSTWELDEEGMLVGSLELPLQVGIVGGATKVHPIAKIALK
FT                   ILGVKTAKELAEIMAAVGLAQNLAALRALVHEGIQKGHMRLHARNLAIMAGATGELIDK
FT                   IAERMIGEGKIRYDYAKKLLEEYLKGENK"
FT   gene            602834..603790
FT                   /locus_tag="Shell_0646"
FT   CDS_pept        602834..603790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31770"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC73"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31770.1"
FT                   /translation="MPSTSGKHKILRDIVFRSRLLLEGKLVKSIRSNKQVSINNLLRES
FT                   EENPLYITLVTNVEGTDIRAHIYGYKNEILDCFLDNNPDIETSECLGLVSNLLKDELAE
FT                   KRINIHMFPPDLIKDVIQEDKTGSSTVAKGVEKKVEIEEETIDFPYIEYLLLNELTKIG
FT                   LIVDLVHLTMIGKDIVANIKLSDVSELPSPLDTAYIAGGIICENAPIHGNIVVNIIHRK
FT                   RHNIVLEYNGDRIKCIALGLIPRMLKDYGLILRKINYQDVGRTFILKLNLKQYASELKH
FT                   DPMEVVKRIQSTLSSITGKNVYVAIKYGLFGKEYRTY"
FT   gene            complement(603856..604512)
FT                   /locus_tag="Shell_0647"
FT   CDS_pept        complement(603856..604512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0647"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="KEGG: cti:RALTA_B1432 uracil
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31771"
FT                   /db_xref="GOA:D7DC74"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC74"
FT                   /inference="protein motif:PRIAM:2.4.2.9"
FT                   /protein_id="ADI31771.1"
FT                   /translation="MRGDLVIVDNPLVKYYLTILRDHRTTPKIFRDYIRRLGFILGYEA
FT                   SRYLRWKKVFVETPLAKSEGLEIGKPVLIVGILGASIPMIEGIWDALPWAGLGLVAARR
FT                   HEYPDRVEVDVYYERLPEDLSIYTILLIDPMLATGKTIVKVVKKLRDRKARDIIILTII
FT                   SSKPGIEYIRRELGNIPIITVAIDPLLNDKFFIVPGLGDAGDRGLSHDYVEEKRV"
FT   gene            complement(605058..606086)
FT                   /pseudo
FT                   /locus_tag="Shell_0648"
FT   gene            complement(606116..606730)
FT                   /locus_tag="Shell_0649"
FT   CDS_pept        complement(606116..606730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0649"
FT                   /product="molybdenum hydroxylase accessory protein, YgfJ
FT                   family"
FT                   /note="KEGG: geo:Geob_0102 molybdenum hydroxylase accessory
FT                   protein, YgfJ family"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31772"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC75"
FT                   /inference="similar to AA sequence:KEGG:Geob_0102"
FT                   /protein_id="ADI31772.1"
FT                   /translation="MIVAIVLAAGLSRRFPGNKLLYTWEGKPVIRWTVENILNSKYVDK
FT                   IVVVLGHDRERIHDALKDLGDNVEFTYNTNYFEGMSSSVKTGIRHVYNKYGDKIEAILI
FT                   APGDTAWAPPEVYDLIIDVFREKKPKIVVAAYNGRRGHPILFNADIIHELMSISEETRG
FT                   LKAITKKYNYETIVANTIYPGVILDLDTYNDLNRIKYMLKK"
FT   gene            606917..607696
FT                   /locus_tag="Shell_0650"
FT   CDS_pept        606917..607696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0650"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: smt:Smal_3873 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31773"
FT                   /db_xref="GOA:D7DC76"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC76"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI31773.1"
FT                   /translation="MIVYILKVQAVLPIHSDPLVVVEGLEKIYSGKIHALKGISFKVYP
FT                   GEIFGLIGPNGAGKTTTLRIIATILSPTRGDALVDGFSVSKNPGEVRKRISYLPEEAGA
FT                   YKYLTGYEFLEFIAGFFAENIEDRNNMVREAVKISGLGDKIHDKIKTYSKGMLRRLLIA
FT                   KTLMIKPKLAILDEPTSGLDVINAMRVRKIIKSYSREYNVTVLLSSHNMLEVEFLCDRV
FT                   AIIHEGRIIAEGSPVELKTKYEASNLEEVFMKIVGEE"
FT   gene            607696..608988
FT                   /locus_tag="Shell_0651"
FT   CDS_pept        607696..608988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0651"
FT                   /product="ABC-type Na+ efflux pump permease component-like
FT                   protein"
FT                   /note="KEGG: pat:Patl_2950 ABC-type Na+ efflux pump,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31774"
FT                   /db_xref="GOA:D7DC77"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC77"
FT                   /inference="protein motif:COG:COG1668"
FT                   /protein_id="ADI31774.1"
FT                   /translation="MSGFKLVLIKELKSLIRDPKLLIAMLIVPLIITGAMYFMIVSFTE
FT                   QAVKEAEKPGGLVIIVDEDKGFWAKNFTSFLTQRRYSIVYADSVGDALKLYDNLNPVGV
FT                   VVIPPGFSQNITEGKIGYLGVVLKLRSISLTSISSSNKIFNIIRKYSINISATILAREG
FT                   INPAYALSPITSIANVYIRGRLIQATNINDVMGTLLMINIFIPIIVLFLAGIIAQLSAT
FT                   SIAVEKEEKMLETLLSLPMNRLSFIAAKITASAIAGLLGAFVYGGLMIWYFSSLTSVEG
FT                   GSRGTNQLGYIIDIMSNIYGLENITLLILGLIAIVLFVLGLGVLLALFVEDVRSAQIAS
FT                   SYIILPLFFVMFIGLFLDISGYTQLSRMLLALIPIVNIGLIPSYIYIGDQTSIYIAIIS
FT                   SFIYAFLIMYIDSRLVNTEKIFTIKLFRKRR"
FT   gene            complement(609020..609517)
FT                   /locus_tag="Shell_0652"
FT   CDS_pept        complement(609020..609517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31775"
FT                   /db_xref="GOA:D7DC78"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC78"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31775.1"
FT                   /translation="MVKVISRLWGILTGLIVIGIIIYIGLLWVTAQNISAQIKSIDTLT
FT                   YDLAENKVLVCFRAQVNNTGYIDVSIEKLYYKVYIDKNYLGEGIKENILIKRGINNIDF
FT                   CLQITPSNALRIILMRAITNNEKINVTVQGYIDVPIKSFGYIKLWTLELPYKETFYVKV
FT                   TR"
FT   gene            609709..611208
FT                   /locus_tag="Shell_0653"
FT   CDS_pept        609709..611208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0653"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="KEGG: maq:Maqu_0961 leucyl aminopeptidase; PFAM:
FT                   peptidase M17 leucyl aminopeptidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31776"
FT                   /db_xref="GOA:D7DC79"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC79"
FT                   /inference="protein motif:PRIAM:3.4.11.1"
FT                   /protein_id="ADI31776.1"
FT                   /translation="MAKLKYILSDKSLDKIDVDTLIVPVISENNKPRIPEEIRDAYREL
FT                   IDTIISSGDFKGEEKEVIIGYSRNRIKRLVLAGLGKEPDHETFREAVASAINSIAEKQS
FT                   VHAGLYLRDLKNIFEISDLIDNSVLTIEITLFDPGELFKTENKKLTLKEMVLIVDNISE
FT                   DMENALKRSTIISDAVNYARRIAETPSSTMNPARIEEEAKKLAEQYGLEIKVFQKEDLE
FT                   KMGMNGILAVGSGGGIPPRLIILEYRGRNSNEWDYAFVGKTVTFDAGGLNLKPTGYIDN
FT                   MKYDKCGGAVVLGIMKAVAELKLPVNVVAALPAVENLPGPNAYKPRDVIKMYNGLTVEV
FT                   GNTDAEGRLILADALSYIDKNYTPKQIFDLATLTGAIVIALGNYAAGLFTENDEVAKKL
FT                   YDIGWKIGERVWHMPLWKEYYEQLKSNIADTNNIGGRPAGAITAAAFLSKFVSDKKRWI
FT                   HLDIAGVSFVEKGYPKKAYYKPAATGFGVRLLTYYLLKDLE"
FT   gene            complement(611235..611900)
FT                   /locus_tag="Shell_0654"
FT   CDS_pept        complement(611235..611900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0654"
FT                   /product="Putitive phosphate transport regulator"
FT                   /note="PFAM: Putitive phosphate transport regulator; KEGG:
FT                   pol:Bpro_1686 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31777"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC80"
FT                   /inference="protein motif:PFAM:PF01865"
FT                   /protein_id="ADI31777.1"
FT                   /translation="MTEWSWLGGRKLQNVIMKSLEHIKTVHLTVLKLDEFIDSLINDEI
FT                   DQAAKIYNEIVSEERKADEIKREILNSLKGVFIHPLDREDLLRLILTADDIAAYVKAAG
FT                   RRLMSLYDIGYKIPREILEIMKDISKKTVSASKSLLDSIMVLGTDSSKSIELTHNVEKY
FT                   EEEIDEIRIKALEKIYTQCKKNLTMECILLRDVIEDLEAISDKCEDTSDVVRLIAISS"
FT   gene            612218..612595
FT                   /locus_tag="Shell_0655"
FT   CDS_pept        612218..612595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0655"
FT                   /product="transcriptional regulator TrmB"
FT                   /note="PFAM: transcriptional regulator TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31778"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC81"
FT                   /inference="protein motif:PFAM:PF01978"
FT                   /protein_id="ADI31778.1"
FT                   /translation="MSEEEYCSIYDIRFLMKRGITLSPPLWRTLKAVLELKKATAEDLS
FT                   KKTGRPRTIESRYLAELNRLGIVARKRISRKVYYIEPITAVKEALQEFGPEMPVEQLAH
FT                   QISLPADIARIIIQKIKEGKL"
FT   gene            complement(612679..613008)
FT                   /locus_tag="Shell_0656"
FT   CDS_pept        complement(612679..613008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0656"
FT                   /product="putative transcriptional regulator, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31779"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC82"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31779.1"
FT                   /translation="MERFDFDDRLQQNDKNNYIVLDLKPHSRVVSFKIEENTLSRFDKY
FT                   IRQLGFKNRSFVIKQLIYAFIEAVEKHLNRSRKNSGIDENKDAYLTIEGLVPGIVIKEN
FT                   KNNKE"
FT   gene            complement(613308..613568)
FT                   /locus_tag="Shell_0657"
FT   CDS_pept        complement(613308..613568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0657"
FT                   /product="rpl13; ribosomal protein L13"
FT                   /note="K02873 large subunit ribosomal protein L13e; KEGG:
FT                   rpl13; ribosomal protein L13; K02873 large subunit
FT                   ribosomal protein L13e"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31780"
FT                   /db_xref="GOA:D7DC83"
FT                   /db_xref="InterPro:IPR001380"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC83"
FT                   /inference="similar to AA sequence:KEGG:378961"
FT                   /protein_id="ADI31780.1"
FT                   /translation="MNKEIQPPEPIVRKPMLRKHGGLSPGLRIGRGFSKKELEAVGLDL
FT                   KTAEKLGLRIDKRRRTMHEWNVQALRDYLTKIGYSVKEDNK"
FT   gene            613695..613985
FT                   /locus_tag="Shell_0658"
FT   CDS_pept        613695..613985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0658"
FT                   /product="protein of unknown function DUF211"
FT                   /note="PFAM: protein of unknown function DUF211; KEGG:
FT                   eic:NT01EI_3508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31781"
FT                   /db_xref="InterPro:IPR003831"
FT                   /db_xref="InterPro:IPR023129"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC84"
FT                   /inference="protein motif:PFAM:PF02680"
FT                   /protein_id="ADI31781.1"
FT                   /translation="MIKRLVLDVLIPIKGPSIVDIAENLSRVKGVNAVNITVKEVDVET
FT                   QNIIVVIEGDNIDFGETRVLIEELGGVIHSVDQVVAGKKIVGVPREIYEEL"
FT   gene            614004..614744
FT                   /locus_tag="Shell_0659"
FT   CDS_pept        614004..614744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0659"
FT                   /product="Mn2+dependent serine/threonine protein kinase"
FT                   /note="KEGG: abu:Abu_1820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31782"
FT                   /db_xref="GOA:D7DC85"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC85"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31782.1"
FT                   /translation="MSAKRGFVEVVEEFFKQTKILYIDDCPFVHKQYSKEPGLVKWFFI
FT                   KAANLFVKAYPFVLEPRSRMIRETSFMDDEYKLVKTPHIIVKDWVSTSIIREYINGTHF
FT                   DPYFDEQEYFRLGKELAMIHNSGYVMGDTKYTNFLKIDDKFYVVDAEQAIRSNSHDYMF
FT                   WDIFVFITTIIYKMMVDNPFRTKDLIRGRMNNFLNGYISAIEHDYYSILSNVDKFNYKT
FT                   IMFMLLPYPLYIIFNDMIKQLIRK"
FT   gene            614938..615630
FT                   /locus_tag="Shell_0660"
FT   CDS_pept        614938..615630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31783"
FT                   /db_xref="GOA:D7DC86"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC86"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI31783.1"
FT                   /translation="MIETNEVEEEWYVVKGLKPPIYVGLTRNSRKRIISILYILLALLI
FT                   IFIFIAESSGLFIQGLSMILLFLLILGQGLLSFLPTRGKVLSLSDQKYIRGLLESIKDY
FT                   VSKWSIPSNNIPVVAILSNGIYMYIYYSTGAKLLITFVKPTMYLKIVQGKPTVKTKFIK
FT                   QYNGKTWRNKGLIIGVIDAVFPHPEIRGMNIHIRGNAIKLSTPIEHGQIREIVSNFNKI
FT                   VRGRGDIL"
FT   gene            615627..616208
FT                   /locus_tag="Shell_0661"
FT   CDS_pept        615627..616208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0661"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="KEGG: vacuolar protein sorting-associated protein;
FT                   K07095; TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31784"
FT                   /db_xref="GOA:D7DC87"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC87"
FT                   /inference="protein motif:TFAM:TIGR00040"
FT                   /protein_id="ADI31784.1"
FT                   /translation="MTVILVIGDTHIPDRSDKIPDKLLKIIEAGKPWDIVVFTGDFIGE
FT                   NIYRWFLSLGKKKYSVRGNIDYLPLPKTQVFKINDITIGIHHGDGVYPRGDTRGLTRIA
FT                   NQLRADILFTGHTHSPFIKYGVTKNILLINPGSLTGVWGGGGGSMKPSMMIVELFDDSL
FT                   RIEHYELSTDHTKLSMRQIVVKKKNREWIL"
FT   gene            complement(616222..617556)
FT                   /locus_tag="Shell_0662"
FT   CDS_pept        complement(616222..617556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0662"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   gbm:Gbem_1213 protein of unknown function DUF107"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31785"
FT                   /db_xref="GOA:D7DC88"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC88"
FT                   /inference="protein motif:PFAM:PF01957"
FT                   /protein_id="ADI31785.1"
FT                   /translation="MLNKLFYIFLLLTILTVSFKPVFSQETHYIVTVNINGEINYGTQY
FT                   LLEEALGEAEKLDAPLIMILDTPGGLLDSANNMIKLIRNSNVPIIGYVYPAGAQAWSAG
FT                   TLILLATHVAAMAPGTLIGAAQPVLYDPTTGTYKPINESKIINPIVGIMTTLAEDRGRN
FT                   KTAAELFVRKNLYLTAEKALEYHVIEVIALNIDDLMNKIDGWKVKLDNGREYVLRTKGA
FT                   VLYHYSGSIRVYVVKTLSDPIINSLVATLGVLMLIFGLLSGHYLVVPLAIGLIILSLIG
FT                   TGFSINAVSLALLVIGAIALAIELFTPGFGILGFTGIILIALSIALLPMLNPGWLISPS
FT                   YQASLFWTGISLGIGLGAFTGFILYKVIKAKKQPPKLTTVPKGSVGKAIDDIGPNNPGF
FT                   VIVEGEYWKAISDEEIHKGDKIVVVGKEGPLLKVRKISDHVEKEK"
FT   gene            complement(617558..618394)
FT                   /locus_tag="Shell_0663"
FT   CDS_pept        complement(617558..618394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0663"
FT                   /product="band 7 protein"
FT                   /note="KEGG: gsu:GSU2430 SPFH domain-containing
FT                   protein/band 7 family protein; PFAM: band 7 protein; SMART:
FT                   band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31786"
FT                   /db_xref="GOA:D7DC89"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC89"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ADI31786.1"
FT                   /translation="MLPYPYIGLYFLGIEEMLPGILFLVIILLIFLAMSIKIVREYERA
FT                   VIFRLGRLLGAKGPELFFIIPFVDNFIKVDLRVTTIDVPEQQIITKDNVTVGVDAVIYY
FT                   RVFDPVLAVTRVENYHYAVMMMAQTTLRDIIGQVELDDLLSKREEINKKLQAILDEVTD
FT                   PWGIKVTAVTLKQVRLPESMLRAMARQAEAERWRRARIIEAQGEKQASVILGEAAKVFE
FT                   QHPAALRLRELQTLLEIAKEKNLIVISPSTLGAETSLLGTAVALSRKTSGSGGSEE"
FT   gene            complement(618483..619100)
FT                   /locus_tag="Shell_0664"
FT   CDS_pept        complement(618483..619100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0664"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: HD domain containing protein; K06950; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31787"
FT                   /db_xref="GOA:D7DC90"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC90"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADI31787.1"
FT                   /translation="MSNKYSTILPILQNLSKQVMGDDFSHGYPHILRVKKWAQRIIEEE
FT                   KLRGEIDDFVLETSILLHDIGRVVGEPHAYYSAIFAEGILRWYGVDQLAINKIKNTILY
FT                   HSYSYSRKNNIKPETIEAYILSDADKLDALGIIGFLRVFHYTWQHKRSLKDTLNHFYEK
FT                   ILNLKELMHFKYSRKKAEELTNRILQLLDMLTNELDVDYFLK"
FT   gene            complement(619105..620187)
FT                   /locus_tag="Shell_0665"
FT   CDS_pept        complement(619105..620187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0665"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sfu:Sfum_3496 ABC transporter related; PFAM:
FT                   ABC transporter related; Transport-associated OB domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31788"
FT                   /db_xref="GOA:D7DC91"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC91"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI31788.1"
FT                   /translation="MTRVRLENVTKVYGSVVAVDHISFEVESGELFTLLGPSGCGKTTT
FT                   LRIIAGFEVPEEGKVYFDDEEVTFLKPYLRNTAMVFQNYALWPHMTVYDNVAYGLRIRR
FT                   RKLRLSEEDIRRKVRWALELVKLEGLENRYPLQLSGGQQQRVALARALVVEPRVLLLDE
FT                   PLSNLDAKLRIEMREEIKRLQKKLGITTIYVTHDQIEAMSISDRIAVMNKGKLLQYGAP
FT                   REVYFKPTNLFVADFLGRSNILYGEFLGWENEYALVRIPDLDADILGVSPHKDLPRKVA
FT                   VVMRPEIMKITESRVPTDNYIIGKIDLVMFLGDRVEVRLSTGKTSLIVYLPNTMYPTIG
FT                   QELKLVAPKDNVIVIPAVWE"
FT   gene            complement(620218..622425)
FT                   /locus_tag="Shell_0666"
FT   CDS_pept        complement(620218..622425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0666"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dac:Daci_4800
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31789"
FT                   /db_xref="GOA:D7DC92"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC92"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADI31789.1"
FT                   /translation="MQDYEPRLGLKHMYLAGLVLAIIYILVQPYLTPENEAVLWFFGIF
FT                   YSFILFLRGIDYRRIIFSFSLSFFVIISFIYIFFILVLNITGYPRALAFFLLPLISIAT
FT                   MGYFRDKIASMKQARKQKRIKVSFSTRIRSAVYKIDPIMWVFIIVGFTILIVFLLTPVL
FT                   LMLYHAFEVPPGQSVLYNFIRIFTNRKYVKLEIFPWEHFYKKQIIGGRPVYVVTGINYG
FT                   ILLNSLINAVVVTSTATFLGILVAFVLARYNFPGRNVFRILAMIPLFITPFVNAYVIKI
FT                   LFSDQGPISLLTQALFGWGIRIDKLAGVALAQIMAFYPIVYLNAYSSFINLDPSMEEQA
FT                   ENLGAKGLRLFLSVTLPLALPGIVAGSVLVFIFSLEDLGAPIVFQEDRLMSYQIYSSFT
FT                   SETGIVSPEIAALGFVMLFLAAMGFLAIRSYVGMRSYAMISRGGRWTLRERRLGLKGLL
FT                   FVYLFLLPLILFTAMPQIGVILLAFNIMPPRGFAINLDQATPEYFISLFKNPDVFMYIR
FT                   NTLSYAAAAVALATTIAIMIAYSVSRTKIRVITPTMDTLATIPLAIPGLVIALGYFYFY
FT                   ATFFRGTPLDPTSGPTTFQAWVVLIIAYSIRKLPFVVRSVYAGFQQVHEALEEAALNLG
FT                   ATRSKVIFGVILPFILTYIISGAIIGFIYISTEVSTSITIGGLRPDQAPMTFAMMMAYK
FT                   GTTVYGVQIAASMGVLLILFQLLAVSIVVLVFKQRYAFIGV"
FT   gene            complement(622627..624387)
FT                   /locus_tag="Shell_0667"
FT   CDS_pept        complement(622627..624387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0667"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bpt:Bpet3537 putative regulatory lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31790"
FT                   /db_xref="GOA:D7DC93"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC93"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADI31790.1"
FT                   /translation="MFNVKALLIISLSILLMLGTTATAINIKHTAGAWPWGNQSEPYPW
FT                   LEYLKSLPHPTGVTLTIITRHENTIIMKAKEAFLNSPIAKELGITNIVAVFAGPEQWET
FT                   YIKQALDAGRPIDVAWGGGPTLFNYIDEKGYIEPLDNTTHPEFDAVLYEMQKIPERVAG
FT                   APTYKVGDDGYVHWIGAAISSFGFTVNHDVINNYNVPVPKKWMDLTDPVYAKYLPDTPL
FT                   TGIADPTKSTSNTRMYEIILQAYGWDEGWKVLTLMAANAKIYDSSSGVRDAVIRGDIAA
FT                   GITIDFYGYTAMHQNPACEYIIPEGESIVNADPIAILKDTRYPVQAAAFVAWVLSEYGG
FT                   QQVWLDPDINRLPINPRVFNTDIGQQRQDLKQAFETATTSGVIEFNETLSGLTERAMQF
FT                   YFKATLVNAHDDLQNVWSAIAQAYLNGQITKEQFDYLIDQLTKPFEFTDPLTGEKTTFT
FT                   LDYAIKINDQLLKGSIYQALMSEWEDGARNRYLQTYNLLQQILSGSPIPTTTTTTTTTT
FT                   TTTTATTTATTTTTTATTTTTTTPPAPTTPPTITTTTPSGPGGLSTSLMITIVIIVIAV
FT                   IVAIYYLIRK"
FT   gene            624544..627372
FT                   /locus_tag="Shell_0668"
FT   CDS_pept        624544..627372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0668"
FT                   /product="Protein of unknown function DUF2223"
FT                   /note="PFAM: Protein of unknown function DUF2223; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31791"
FT                   /db_xref="GOA:D7DC94"
FT                   /db_xref="InterPro:IPR019248"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC94"
FT                   /inference="protein motif:PFAM:PF09985"
FT                   /protein_id="ADI31791.1"
FT                   /translation="MNYKYVSLILLAILVLSILTPSVMGIKNATANTQNTMKKLVVAVD
FT                   LAHGESDKYLSYIEGNITWVEWREITEAITPDTLSDVDVLILGQPTSALSPDEMMAIRD
FT                   WLAQGNKVLWVAGDSDYGGGPSTQQACNDLLEFLGAKLRLELAAVYDDIHNAQRYYRVI
FT                   TQVVPDENMVLRTDLISAGISKPVLMHGPDAVIWVDESGNYHDPVNEKFPGLIRIVWSY
FT                   DTAYIGDNNEPTPLLYNPLFYGQGTGNHTFVMVAGEYWNETNNMIIVSGESPYGDYEPM
FT                   YSWEYYNVSLDGPKFIKNMITWFDYLVNILPSIPRITVAVDLAHGESDKYLSYIMGNIT
FT                   FVNWKTIDTTITPDELNGVDVLILGQPTSALSPDEMMAIRDWLATGNKALWVAGDSDYG
FT                   GGPSTQQACNDLLEYLGAKLRLELAAVYDDIHNAQRYYRVITRVMPDNATELKTDIISM
FT                   GISKPVLMHGPDAVIWVDESGNYHDPVNEKFPGLIRIVWSYDTAYIGDNNEPTPLLYNP
FT                   LFYGQGTGNHTFVMVAAEYWNESNDIIVVSGESPYGDYEPMYSWEYYNVSLDGPKYIAN
FT                   MITWFAINLKPAAPQLTLIGELTDPEGDDNGYGNITYPTNEVFQPGVFDMLKFGVYEDS
FT                   DNVYFKVTVKNSGDNPWSGPNGFCLQHIQIYMLTTDDALPKNTSTIGLNVEIWHGWNYV
FT                   LLMVPGWDTAPVPKGQLSALYDATGKLLAVETLNNTIDVYLDPSDNNTIVAKISKSLLA
FT                   DVGNIKDWVFVVALAGYDGYAPYKVRSIVAGNSTEWNFGGGDPEAINAGVQPMIIDLLA
FT                   PTAQDQYNMLSSYDAAANSTAIIGGVKLSTGELMTPPTPTTTTTTTTTPPATTTTTTTT
FT                   TTTTTTTTTVPPTTTTTTTTTTTTTPTTTTTTTTPAAAGGGISATTWGVIITIIIIIII
FT                   AIIAWYYYARKK"
FT   gene            complement(627447..629624)
FT                   /locus_tag="Shell_0669"
FT   CDS_pept        complement(627447..629624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0669"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31792"
FT                   /db_xref="GOA:D7DC95"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC95"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADI31792.1"
FT                   /translation="MRFNAGILFVLIVLSVVSVIAITPTYMSSTTATPTPLPELESLAP
FT                   SKGLPTENIGPGKPAIVFPGDTFTVIFKQDHTPQTITGGYMYMLKLEGPQLVLYNYTVQ
FT                   VSGSGVNYTVQVPGNVAGGLYDLVLYGSKEYFIPRSVWVITNLADVLRVVHISDLHFGT
FT                   GYPDELHGSYKRFTGMLMTQILSPDLIINTGDEADTASYKQYIQSVAYRYAFLYPYPVL
FT                   LNPGNHDWPNDNYIKFYGSTTWYRVIGDKILVAALNTRGDQGYPDWNQLKWLTNILEEY
FT                   ENIPIKIIQLHHPVFFWQGELWMTYNSSIIADPHKYSSSPVSYYWGANLTATRYFLKLC
FT                   EDYNISLVLAGHIHRDQYVVFHSTRTNTTTYFITTTTFAHSTGTYDGLQYFNINLAKFN
FT                   LTFPYAPPWFVGFKNYSRTEVYNSIPNWPPYYQGMFVESSNAYVFEVSNYIPNLNLDGN
FT                   VVFALPWSGDLVGVKTLESENMANVELLDYKIVNGIAYVALHVKLPINSTLGFAIYNYE
FT                   DATPPEITLKLSVPETPTLNAVNTFYFEIKDIGWGVKDVHATLIYNGEEYPQTLEYYSQ
FT                   DTYRLKLKFTGEEPLTITLIINATDYAGNTVEKAFNITFYPRGYTPTTTTTTTTTTTTL
FT                   PTTTTSPTTTTTTTTTTTTTSTTTTTTTPPATPTTTTTTTISPPLTTGSPTTTAPPPTT
FT                   GQAQVNYTGVLVSVIVVIIVIAVAVLLMRRK"
FT   gene            629722..630162
FT                   /locus_tag="Shell_0670"
FT   CDS_pept        629722..630162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0670"
FT                   /product="Resolvase, Holliday junction-type"
FT                   /note="PFAM: Resolvase, Holliday junction-type"
FT                   /db_xref="EnsemblGenomes-Gn:Shell_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADI31793"
FT                   /db_xref="GOA:D7DC96"
FT                   /db_xref="InterPro:IPR002732"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014428"
FT                   /db_xref="UniProtKB/TrEMBL:D7DC96"
FT                   /inference="protein motif:PFAM:PF01870"
FT                   /protein_id="ADI31793.1"
FT                   /translation="MPNLNRRRGFAHERDLLLKLWRRGFAVIRAPASGAKARRFAVPDI
FT                   VAIKNNRVLAFEVKTAEKKKTIYIPKHQVEKLLVFIRRAGGYGFIAVKIVGESGWRFIE
FT                   VDKLEKTASGNYKVSPDMLVKSFKLGDLVSFVQGNKRIDEYI"
FT   gene            complement(630159..630389)
FT                   /locus_tag="Shell_0671"
FT   CDS_pept        complement(630159..630389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shell_0671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn: